2Y4QA

Solution structure of the ef-hand domain of human polycystin 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords POLYCYSTIN-2
publication title A High-Resolution Structure of the EF-Hand Domain of Human Polycystin-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2y4qA00
2KFGA 3SJSA 2RGIA 3MSEB 1L7ZA 2M97A 1UHJA 3IF7A 1KCYA 3LL8B 1NCXA 3EVRA 1QASA 1TCFA 2K7OA 2IS9A 3SG6A 4XJKA 2M3WA 5JOLA 1YX8A 3VROA 2LVKA 1Q80A 4JWQA 3SG5A 5IBWA 1YRUB 4ORBB 1YRTB 4L9MA 3EKHA 1YVHA 1BOCA 2LVVA 1CKKA 2KYCA 4DCKA 4C0LA 2K7CA 1VRKA 1F70A 1M46A 2K8MB 3A4UB 1K94A 1DJZA 1NX2A 2H2KA 1WRLA 1Y1UA 3IQQA 4PE0A 1KK7Z 1ALWA 1CMGA 2BKHB 2CXJA 4FTGA 2O60A 2LE9B 4GAOA 2CT9A 2KSPA 5AERA 2QACA 4JQ0D 5HKWA 5AFPA 4OVNF 3OB1B 5AEQA 4WQ2A 1S6CA 1QJTA 2EC6B 2H61A 2JT0A 1J1DA 2P6BB 3PM8A 2KNEA 1GGWA 2K2FA 4MZLA 4M2PA 3BUMB 1CLLA 1PK0D 2BE4A 1N0YA 3EK4A 1YURA 3EVVA 1AP4A 1CFPA 1TNPA 4YGAA 1OZOA 2WORA 3RLZA 4YGDB 1S1EA 3PSRA 1LINA 3LCPC 1OZSA 1GJYA 4HREE 1YUSA 1RK9A 4N1FA 2KI4B 5ER5A 4GUKA 5KTYA 1S5GZ 2AAOA 2SASA 1XFWO 1F54A 3TDIA 3SG3A 1Y1XA 2JPTA 2LCPA 1KQMB 1WY9A 4BY4A 3M0WA 3LLEA 4Q04A 1TRFA 5I2LA 1V1GA 1ZACA 4CFQA 3I5GB 5ER4X 3CGAA 4MN0A 1AUIB 1NYAA 1RWYA 2K2AA 1FW4A 4GFTA 1KK8C 2LVJA 4IL1A 3HCMA 4JPZB 1GQMA 1QV1A 2OTGC 2Y5IA 3CLNA 3CR2A 1SR6C 2BKIB 2EHBA 2M0RA 1KK7Y 2COLB 2LMVA 1JFJA 2KFFA 1QV0A 3CTNA 2JTTA 3I5HB 1DMOA 1K9PA 1SL7A 1WLZA 3PLFB 1TN4A 4YGBB 4AQIA 1M31A 1MUXA 1SNLA 2ZNEA 3RM1A 4OR9B 4GGFA 1B7TZ 5HLOA 2I94A 5PALA 3DF0B 2ISDA 4I5NB 2M8UA 4PE4A 1K93D 1KWOC 3PATA 1NSHA 1UHKA 3ICBA 1SCVA 1DF0B 1PSBA 1SL8A 2KDHA 1SCMC 2M7NA 5DKQA 3DF0A 1IGVA 2Y1MA 1J55A 1OMDA 1Y0VH 3H4SE 4GGNA 2A4JA 4AOMA 3PN7C 1J7OA 1XK4C 3JVTB 1DF0A 2WCEA 1DJHA 2NXQA 1SL9A 1S5GY 2I7AA 2ZN9A 1ZFSA 2Y1NA 2PRUA 4HSZA 3KPXA 1NCYA 1D1OA 2BL0B 1QX7A 3KHEA 4FQOA 2GV5A 1Y6WA 2JQ6A 2GGMA 2KBIA 1FI5A 4MRXA 4QJ5B 1XO5A 2NCOA 1OE9B 5J3XA 3CZTX 1LA3A 1NUBA 1CFCA 2KBMA 2L4IA 1IKUA 3O78A 4PCWA 2MJWB 5CSFA 1G8IA 2B1UA 2HPSA 4OCIA 1JC2A 1UHNA 4PE1A 1XFXO 1U5IB 5GQQC 2OTGB 4P2YB 1RFJA 4XJKB 2LC5A 1EL4A 1B7TY 2EGDA 1JUOA 1L2OC 4MLWA 5D69A 4I5KA 4CFRA 4NQGA 3VRRA 1U5IA 2LAPA 3NSKA 2KI6D 2HF5A 2JC2A 4M2OA 5I8NA 1S36A 2WNDA 2ZFDA 3F45A 1TTXA 4MSPA 1ALVA 2LM5A 1ZMZA 3EVUA 3ZWHA 3OX5A 3AKBA 2JZIA 1FF1A 1QX5B 2M49B 2BCXA 5D7FA 2L2EA 1JSAA 1G33A 4GBAA 1KWOB 1EH2A 3A8RA 2MLFC 3LK1A 4C0KA 2M1KB 2NLNA 4YI9A 4CPVA 2NZ0A 3D10A 2G2BA 4TNCA 1TNWA 2FOTA 2MA2A 1MR8A 3EKJA 4MVFA 5K89A 3BYAA 2LLTA 4A4BA 5B8IB 3JTDC 1QATA 2LHLA 3CR4X 4XYNA 1OQPA 1TCOB 2FCDA 2PALA 3I5IB 5CSNA 1IH0A 4PHKA 1CDMA 5AANA 2MHHA 2KHNA 1SW8A 1M39A 3EK7A 3BUWB 2KQ6A 3GK4X 1AJ4A 1WDCC 2M9GA 2OS8C 3NSLA 2LP2A 3K21A 2L5XB 1WRKA 1PVAA 1BLQA 4HRHA 3OB2B 3SIBA 1KSOA 4ORCB 1OSAA 4ZCUA 2LV7A 1JBAA 3TS5C 1YUUA 3VRQA 1BR4B 4PHMA 3SIAA 2LVIA 4BY5A 2KAYA 4PDZA 1F55A 2CTNA 3DD4A 2PMYA 2ZN8A 3TDUA 2LMTA 3O6BA 4AQJA 1DJXA 1EG3A 1QLKA 1RTP1 2JTZA 5HKZA 1IQ5A 4MRYA 2BBMA 5I2QA 1MQ1A 4WQ3A 4F0ZB 4YGCB 3LK0A 1LVCD 2KI6C 2F3YA 4PE7A 2F33A 2BCAA 3WXAA 1M63B 1C07A 1PULA 2MBXA 1F71A 1RJVA 1QLSA 2I2RE 1NIWA 2FJUB 1Y1AA 3BOWB 1PALA 1UHHA 1OMRA 1QX2A 2K61A 2L51A 4NDDA 5F6TA 2QPTA 5CSJA 3KF9A 1XVJA 1QS7A 1SY9A 2JXLA 3BOWA 3SG4A 2KQYA 1HT9A 2ZRTA 1DGUA 1NX1A 1YX7A 5DKRA 3ZNIA 1XA5A 4MZJA 1DJYA 1G4YR 1J7RA 1EXRA 1OOJA 2JNXA 1CLBA 1KFXS 4DIRA 4E68A 4WRIA 2L4HA 1CDNA 1F4QA 2LUXA 1TNXA 3PALA 2M29A 5KSZA 2R2IA 1TNQA 3NSOA 4U8DA 1BG1A 2WCFA 1LA0A 3FWCA 3O2PA 1IWQA 1H8BA 4ETOA 1QIVA 2LLUA 2KOTA 2GGZA 2PASA 3TS5B 2LHIA 4A4CA 1WLMA 2VRGA 3CS1A 3BQ3A 2K0JA 1KFXL 2LMUA 1CFDA 1YR5A 2OPOA 1NP8A 4MEWA 5TNCA 1SBJA 1CFFA 1B8RA 1FBVA 2JXCA 1UP5A 1K9KA 2SCPA 1BMOA 1NCZA 5G08A 2H61C 1BU3A 1V1FA 1N2DA 2HETA 4ICBA 2HQWA 1S6IA 1JFKA 3VRNA 1B9AA 1PVBA 1KFUS 1KK8B 3I5FC 5DKNA 1XFYO 2LANA 2EC6C 3VRPA 1SR6B 1ZOTB 1XFZO 2PVBA 1NX0A 1R6PA 5AXIA 3GOFA 4QJ4B 1AK8A 4M2QA 1CM1A 1TOPA 1W7IB 3KEVA 4C0JA 2LNKA 2KAVA 1QVIZ 4GPLB 2E6WA 1E8AA 4MZKA 1CDLA 1MWNA 3AAKA 2KI4C 4OKHA 1SRAA 3NXAA 2BECA 3DVJA 3QRXA 1F8HA 1SCMB 1BR1B 1KQMC 1IQ3A 2Q91A 3AAJA 2BCBA 1X02A 3BXKA 2V53A 3PN7B 1J1EA 2Q4UA 1IJ6A 3KO0A 3I5GC 4DS7A 2MLEC 1K2HA 1UURA 2F3ZA 1JWDA 4GNKB 1XK4A 2CCMA 3HX4A 1LKJA 1DTLA 1AVSA 4DUQA 3AKAA 1K8UA 3CR5X 4GGFC 4YGEB 1A2XA 4D1EA 2DOQA 3NSIA 4MBEA 4PHNA 3I5HC 5HYDA 5HLVA 3TUYC 2M7LA 1EG4A 2TN4A 3OX6A 2AUCA 1HQVA 5CPVA 2JWWA 1A4PA 2KGBC 1NWDA 4P5OE 2ZNDA 4DRWA 2K7BA 1N65A 3I5FB 1NPQA 3O4YA 1WRZA 1B4CA 2JRFA 3WHTB 1BF5A 4QJ3B 2L0PA 4USLA 1F4OA 1RECA 2CBLA 1CM4A 1SMGA 3D0YB 2BE6A 2F8PA 4YI8A 1A29A 2WOSA 1L2OB 1QVIY 1B1GA 1DJGA 2FCEA 2JOJA 2JT3A 3OHMB 2LUCA 4N5XA 2LLSA 3DVKA 1BJFA 3JVTC 4I5JA 1MXLC 3WNXB 2AMIA 1C7VA 1UWOA 1PSRA 1SKTA 3D0YA 1YVLA 2HQ8A 5CSIA 1AHRA 1MF8B 3E3RA 1S26D 1KQVA 2G9BA 1PRWA 2BL0C 5JJGA 1ZUZA 3BUNB 2I18A 1KSMA 2JU0A 1DGVA 3TZ1A 1K96A 2D8NA 1B47A 2KAXA 4YBHB 1XYDA 2E30A 1SPYA 3JTDB 2F2OA 1J7QA 1MHOA 3FS7A 1QXPA 1CLMA 4UPGA 5KU1A 3BUXB 4NDBA 2MRDA 4N1GA 1CMFA 2PSRA 3CWGA 2JNFA 3C1VA 1JF2A 2M1UA 4PALA 4OV2A 4CLNA 1EJ3A 3BUOB 1WDCB 2ZRSA 1QIWA 1A75B 1CDPA 2OS8B 2F2PA 3TUYB 1C7WA 5I2OA 1B8LA 3FWBA 2NCPA 1BODA 3SG2A 1CTRA 5BPJA 4ZCVA 4PHJA 1FPWA 1TIZA 2K7DA 1J7PA 1SYMA 1A75A 1GGZA 3SG7A 2KFHA 1IJ5A 1IRJA 2L98A 4HRGA 2O5GA 3FIAA 1BT6A 1W7JB 2BBNA 1K9UA 5FYXA 2CNPA 3EK8A 3OP0A 2KGRA 1DJIA 2Y4QA 1CB1A 1SK6D 2JT8A 1DJWA 2KYFA 1S3PA 4CIDA 4I5LB 3I5IC 3IQOA 1XFVO 1DVIA 4ORAB 1NX3A 3DVMA 4R1EA 1B8CA 3GK2A 2ZKMX 3TDZA 1YUTA 1YTZC 1FI6A 1UUSA 1IG5A 4NDCA 1M45A 3VGOA 3WHUB 1A03A 1K95A 2L50A 1CNPA 3PFVA 1UHIA 1QTXA 1H4BA 1R2UA 1S6JA 2JULA 1DT7B 2LP3A 3GK1A 1MXEA 4YRUA 5HKYA 2WCBA 2MAZA 1KFUL 3DVEA 1JF0A 1OMVA 2WC8A 1RROA 1K90D 1XFUO 1ODBA 1AJ5A 1LXFC
chains in the Genus database with same CATH superfamily
2KFGA 3SJSA 2RGIA 3MSEB 4OZDA 1L7ZA 1Z4HA 2M97A 1UHJA 3IF7A 1KCYA 3PM2A 3LL8B 4FQTA 1NCXA 3EVRA 1QASA 1TCFA 2K7OA 2IS9A 3SG6A 4XJKA 2M3WA 5JOLA 1YX8A 3VROA 2LVKA 1Q80A 4JWQA 3SG5A 5IBWA 1YRUB 4ORBB 1YRTB 4L9MA 3EKHA 3K1EA 1YVHA 1BOCA 2LVVA 1CKKA 2KYCA 4DCKA 2WC6A 2K7CA 4C0LA 1VRKA 1F70A 2QEHA 1M46A 1TWOA 2K8MB 3A4UB 1K94A 1DJZA 1NX2A 2H2KA 1WRLA 1Y1UA 3IQQA 4PE0A 1KK7Z 1ALWA 1TUZA 2BKHB 1CMGA 2CXJA 4FTGA 2O60A 2LE9B 4GAOA 2CT9A 2KSPA 5AERA 2QACA 1DC1A 4JQ0D 5HKWA 5AFPA 3IVTA 3OB1B 4OVNF 4WQ2A 5AEQA 3D74A 1S6CA 1QJTA 2EC6B 2H61A 2JT0A 1J1DA 2P6BB 3PM8A 2KNEA 3BFBA 1GGWA 2K2FA 1C3ZA 4MZLA 4M2PA 3BUMB 1CLLA 1PK0D 2BE4A 1N0YA 3EK4A 1YURA 3EVVA 1AP4A 1CFPA 1TNPA 4YGAA 3VB1A 3R1OA 1OZOA 2WORA 3RLZA 2P70A 4YGDB 1S1EA 3PSRA 1LINA 3LCPC 4JKTA 1OZSA 1GJYA 4HREE 1YUSA 1RK9A 4N1FA 2KI4B 5ER5A 4GUKA 5KTYA 1S5GZ 2AAOA 2SASA 1XFWO 2K60A 1F54A 3TDIA 5EL2A 1Y1XA 2JPTA 2LCPA 1KQMB 1WY9A 3SG3A 4BY4A 3M0WA 3LLEA 4Q04A 1TRFA 3CYZA 5I2LA 1V1GA 1ZACA 4CFQA 4IJ7A 3I5GB 5ER4X 3CGAA 4MN0A 1AUIB 1NYAA 1RWYA 2K2AA 1DQEA 1FW4A 1KK8C 2LVJA 4GFTA 4IL1A 3HCMA 2KLEA 1GQMA 1QV1A 2OTGC 2Y5IA 3CLNA 4JPZB 3CR2A 1SR6C 2BKIB 2EHBA 2M0RA 1OOFA 1KK7Y 2COLB 2LMVA 1JFJA 2KFFA 1QV0A 3CTNA 2JTTA 3I5HB 1DMOA 1K9PA 1SL7A 1WLZA 3PLFB 1TN4A 4YGBB 4AQIA 1M31A 1MUXA 1SNLA 2ZNEA 3D78A 3RM1A 4OR9B 4GGFA 1B7TZ 5HLOA 2I94A 5PALA 3DF0B 2ISDA 4I5NB 2M8UA 4PE4A 1IIOA 1K93D 1KWOC 3PATA 2GTEA 1NSHA 1UHKA 3ICBA 1SCVA 1DF0B 1PSBA 1SL8A 2KDHA 1SCMC 2M7NA 5DKQA 3DF0A 1IGVA 5FI6A 2Y1MA 1J55A 1OMDA 1Y0VH 3H4SE 4GGNA 2A4JA 3S0GA 4AOMA 3PN7C 1J7OA 1XK4C 3DXLA 3JVTB 1DF0A 2WCEA 3L4LA 1DJHA 2NXQA 1SL9A 1S5GY 2I7AA 2ZN9A 1ZFSA 2Y1NA 2PRUA 4HSZA 3KPXA 1NCYA 3SS5A 1D1OA 2BL0B 1QX7A 3KHEA 4FQOA 2GV5A 1Y6WA 2JQ6A 2GGMA 2KBIA 1FI5A 4MRXA 4QJ5B 1XO5A 2NCOA 1OE9B 5J3XA 3CZTX 1LA3A 1NUBA 1CFCA 3S0DA 2QEOA 2KBMA 2L4IA 3S0FA 1IKUA 3O78A 4PCWA 1OOIX 2MJWB 5CSFA 1DEKA 1G8IA 2B1UA 2HPSA 4OCIA 1JC2A 1UHNA 4PE1A 1XFXO 1U5IB 5GQQC 2OTGB 4P2YB 1RFJA 4XJKB 2LC5A 1EL4A 2P71A 1B7TY 2EGDA 1JUOA 1L2OC 4MLWA 5D69A 4I5KA 4CFRA 4NQGA 3VRRA 1U5IA 2LAPA 3NSKA 2KI6D 2HF5A 2JC2A 4M2OA 5I8NA 3L47A 1S36A 2WNDA 2ZFDA 3F45A 1TTXA 4MSPA 1ALVA 2LM5A 1ZMZA 3EVUA 3L4AA 3OX5A 3AKBA 2JZIA 3ZWHA 1QX5B 2M49B 2BCXA 3DYEA 3R1VA 5D7FA 2L2EA 1JSAA 1G33A 4GBAA 1KWOB 2YGUA 1EH2A 3A8RA 2MLFC 3LK1A 4C0KA 2M1KB 2NLNA 4YI9A 4CPVA 2NZ0A 1SSEB 2G2BA 3D10A 4TNCA 1TNWA 2FOTA 2MA2A 1MR8A 3EKJA 4MVFA 5K89A 3BYAA 2LLTA 4A4BA 5B8IB 3S0EA 3JTDC 1QATA 3S0AA 2LHLA 3CR4X 4XYNA 1OQPA 1TCOB 2FCDA 2PALA 3I5IB 5CSNA 1IH0A 4PHKA 1CDMA 5AANA 2MHHA 2KHNA 1W9ZA 1SW8A 1M39A 2BAPA 2KLDA 3EK7A 3BUWB 2KQ6A 3GK4X 1AJ4A 1WDCC 2QEVA 2M9GA 2OS8C 3NSLA 2LP2A 3K21A 2L5XB 1WRKA 1PVAA 3NGVA 1BLQA 4HRHA 3OB2B 3SIBA 1KSOA 4ORCB 1OSAA 4ZCUA 2LV7A 1JBAA 3TS5C 1YUUA 3VRQA 1BR4B 4PHMA 3SIAA 2LVIA 4BY5A 2FJYA 2KAYA 4PDZA 1F55A 2CTNA 3BFHA 3DD4A 2PMYA 2ZN8A 3TDUA 2LMTA 3O6BA 4AQJA 1DJXA 1EG3A 1QLKA 1RTP1 2JTZA 3NHIA 1IQ5A 4MRYA 2BBMA 5HKZA 5I2QA 3SS4A 1MQ1A 4WQ3A 4F0ZB 4YGCB 3BJHA 3LK0A 1LVCD 2KI6C 2F3YA 4PE7A 4JD9A 2F33A 2BCAA 4KYNA 3WXAA 1M63B 1C07A 1PULA 2MBXA 1F71A 1RJVA 1QLSA 2I2RE 2WCKA 3CZ0A 1NIWA 2FJUB 1Y1AA 3BOWB 1PALA 3QMEA 1UHHA 3CZ1A 1OMRA 1QX2A 2K61A 2L51A 4NDDA 5DICA 5F6TA 2QPTA 3S0BA 4INWA 5CSJA 3KF9A 5D3OA 1XVJA 1QS7A 1SY9A 2JXLA 3BOWA 3SG4A 1XFRA 2KQYA 2WC5A 1HT9A 2ZRTA 1DGUA 3D76A 1NX1A 1YX7A 3V2LA 5DKRA 3ZNIA 4PT1A 1XA5A 4MZJA 1DJYA 1G4YR 1J7RA 1EXRA 1OOJA 2JNXA 3R72A 1CLBA 2PYQA 1KFXS 4DIRA 4E68A 4WRIA 2L4HA 1CDNA 1F4QA 2LUXA 1TNXA 3PALA 2M29A 5KSZA 2WCHA 2R2IA 1TNQA 3NSOA 4U8DA 1BG1A 2WCFA 2WCLA 1LA0A 3FWCA 3O2PA 1IWQA 1H8BA 4ETOA 1QIVA 2LLUA 2KOTA 2GGZA 2PASA 3TS5B 1FF1A 2LHIA 4A4CA 1WLMA 2VRGA 2WCJA 3BQ3A 3CS1A 2K0JA 1KFXL 2LMUA 1CFDA 1YR5A 2OPOA 1NP8A 4MEWA 5TNCA 1SBJA 1CFFA 1B8RA 1FBVA 2JXCA 1UP5A 1K9KA 2ERBA 1BMOA 1NCZA 2SCPA 5G08A 3CZ2A 2H61C 1BU3A 1V1FA 1N2DA 2HETA 4ICBA 2HQWA 1S6IA 1JFKA 3VRNA 1B9AA 1PVBA 1KFUS 1KK8B 3I5FC 5DKNA 1XFYO 2LANA 2EC6C 3VRPA 1SR6B 1ZOTB 1XFZO 3B87A 2PVBA 5HL1A 1NX0A 1R6PA 1GM0A 5AXIA 3GOFA 4QJ4B 3OGNA 1AK8A 4M2QA 1CM1A 1TOPA 1W7IB 2KPHA 3KEVA 3OBVA 2L2CA 3SS3A 2LNKA 4C0JA 3O4XA 2KAVA 1DELA 1QVIZ 2PQLA 4GPLB 2H8VA 2E6WA 1E8AA 4MZKA 1CDLA 1MWNA 3AAKA 2KI4C 4OKHA 1SRAA 3NXAA 2BECA 3DVJA 3QRXA 1F8HA 1SCMB 1BR1B 3CABA 3D75A 4INXA 1KQMC 1IQ3A 2Q91A 3AAJA 2BCBA 1X02A 3BXKA 2V53A 3PN7B 1J1EA 2Q4UA 1IJ6A 3KO0A 3I5GC 4DS7A 2MLEC 1K2HA 1UURA 3FE9A 2F3ZA 1JWDA 4GNKB 1XK4A 2CCMA 3HX4A 1LKJA 1DTLA 1AVSA 3DY9A 3AKAA 4DUQA 1K8UA 5I94A 3CR5X 4GGFC 4YGEB 1A2XA 4D1EA 2DOQA 3NSIA 4MBEA 4PHNA 3I5HC 5HYDA 5HLVA 3TUYC 2M7LA 1EG4A 2TN4A 3OX6A 3B86A 3R1PA 2AUCA 1HQVA 5CPVA 2JWWA 1A4PA 1P28A 2KGBC 3CDNA 4F7FA 1NWDA 4P5OE 2ZNDA 3B7AA 4DRWA 2K7BA 1N65A 3I5FB 1NPQA 3DZTA 3O4YA 1WRZA 1B4CA 2JRFA 3WHTB 1BF5A 4QJ3B 2L0PA 4USLA 1F4OA 1RECA 2CBLA 1CM4A 1SMGA 3D0YB 2BE6A 2F8PA 4YI8A 1C3YA 1A29A 2WOSA 1L2OB 1QVIY 1B1GA 1DJGA 2FCEA 2JOJA 2JT3A 3OHMB 2LUCA 4N5XA 2LLSA 3DVKA 1BJFA 3NHTA 3JVTC 4I5JA 1MXLC 3WNXB 2AMIA 1C7VA 1UWOA 1PSRA 1SKTA 3BFAA 3D0YA 3RZSA 1YVLA 2HQ8A 5CSIA 1AHRA 1MF8B 3FE8A 3E3RA 1S26D 1KQVA 2G9BA 1PRWA 2BL0C 5JJGA 1ZUZA 3BUNB 2I18A 3Q8IA 1KSMA 2JU0A 1DGVA 3TZ1A 3PJIA 1K96A 2QDIA 1OOGA 2D8NA 1B47A 2KAXA 1QWVA 4YBHB 1XYDA 2E30A 1SPYA 3JTDB 2F2OA 1J7QA 1MHOA 3FS7A 1QXPA 1CLMA 4UPGA 5KU1A 3BUXB 4NDBA 2MRDA 4N1GA 1CMFA 2PSRA 3CWGA 2JNFA 3C1VA 1ORGA 1JF2A 2M1UA 4PALA 4OV2A 4CLNA 1EJ3A 3BUOB 1WDCB 2ZRSA 3UO9A 1QIWA 1A75B 1CDPA 2OS8B 2F2PA 3TUYB 1C7WA 5I2OA 1B8LA 3FWBA 2NCPA 1BODA 3UNWA 3SG2A 1CTRA 5BPJA 4ZCVA 4PHJA 1FPWA 1TIZA 2K7DA 1J7PA 1SYMA 1OOHA 1A75A 1GGZA 3SG7A 1LS8A 2KFHA 1IJ5A 1IRJA 2L98A 4HRGA 2O5GA 3FIAA 1BT6A 1W7JB 2BBNA 5FI7A 1K9UA 5FYXA 2CNPA 3EK8A 3OP0A 2KGRA 2L5YA 3B88A 1DJIA 2Y4QA 1CB1A 1SK6D 3EG5B 2JT8A 1DJWA 2KYFA 1S3PA 4CIDA 1T14A 2QEBA 4I5LB 3I5IC 3IQOA 2WCMA 1XFVO 1DVIA 4ORAB 1NX3A 1OW4A 3FE6A 3DVMA 4R1EA 1B8CA 1TUJA 2ZKMX 3GK2A 3D77A 3TDZA 1YUTA 1YTZC 1FI6A 1UUSA 1IG5A 4NDCA 1M45A 3VGOA 3WHUB 1A03A 1K95A 2L50A 1CNPA 3PFVA 1Z2CB 1UHIA 1QTXA 1H4BA 1R2UA 1S6JA 2JULA 3B6XA 2LP3A 3GK1A 1MXEA 3D73A 4YRUA 1DT7B 5HKYA 2WCBA 5FI2A 2MAZA 1KFUL 3DVEA 1JF0A 2BNXA 1OMVA 2WC8A 1RROA 1K90D 3N7HA 1XFUO 1ODBA 1AJ5A 1LXFC 2JPOA
chains in the Genus database with same CATH topology
2KFGA 3SJSA 2RGIA 3MSEB 1L7ZA 2M97A 1UHJA 3IF7A 1KCYA 3LL8B 1NCXA 3EVRA 1QASA 1TCFA 2K7OA 2IS9A 3SG6A 4XJKA 2M3WA 5JOLA 1YX8A 3VROA 2LVKA 1Q80A 4JWQA 3SG5A 5IBWA 1YRUB 4ORBB 1YRTB 4L9MA 3EKHA 1YVHA 1BOCA 2LVVA 1CKKA 2KYCA 4DCKA 4C0LA 2K7CA 1VRKA 1F70A 1M46A 2K8MB 3A4UB 1K94A 1DJZA 1NX2A 2H2KA 1WRLA 1Y1UA 3IQQA 4PE0A 1KK7Z 1ALWA 1CMGA 2BKHB 2CXJA 4FTGA 2O60A 2LE9B 4GAOA 2CT9A 2KSPA 5AERA 2QACA 4JQ0D 5HKWA 5AFPA 4OVNF 3OB1B 5AEQA 4WQ2A 1S6CA 1QJTA 2EC6B 2H61A 2JT0A 1J1DA 2P6BB 3PM8A 2KNEA 1GGWA 2K2FA 4MZLA 4M2PA 3BUMB 1CLLA 1PK0D 2BE4A 1N0YA 3EK4A 1YURA 3EVVA 1AP4A 1CFPA 1TNPA 4YGAA 1OZOA 2WORA 3RLZA 4YGDB 1S1EA 3PSRA 1LINA 3LCPC 1OZSA 1GJYA 4HREE 1YUSA 1RK9A 4N1FA 2KI4B 5ER5A 4GUKA 5KTYA 1S5GZ 2AAOA 2SASA 1XFWO 1F54A 3TDIA 3SG3A 1Y1XA 2JPTA 2LCPA 1KQMB 1WY9A 4BY4A 3M0WA 3LLEA 4Q04A 1TRFA 5I2LA 1V1GA 1ZACA 4CFQA 3I5GB 5ER4X 3CGAA 4MN0A 1AUIB 1NYAA 1RWYA 2K2AA 1FW4A 4GFTA 1KK8C 2LVJA 4IL1A 3HCMA 4JPZB 1GQMA 1QV1A 2OTGC 2Y5IA 3CLNA 3CR2A 1SR6C 2BKIB 2EHBA 2M0RA 1KK7Y 2COLB 2LMVA 1JFJA 2KFFA 1QV0A 3CTNA 2JTTA 3I5HB 1DMOA 1K9PA 1SL7A 1WLZA 3PLFB 1TN4A 4YGBB 4AQIA 1M31A 1MUXA 1SNLA 2ZNEA 3RM1A 4OR9B 4GGFA 1B7TZ 5HLOA 2I94A 5PALA 3DF0B 2ISDA 4I5NB 2M8UA 4PE4A 1K93D 1KWOC 3PATA 1NSHA 1UHKA 3ICBA 1SCVA 1DF0B 1PSBA 1SL8A 2KDHA 1SCMC 2M7NA 5DKQA 3DF0A 1IGVA 2Y1MA 1J55A 1OMDA 1Y0VH 3H4SE 4GGNA 2A4JA 4AOMA 3PN7C 1J7OA 1XK4C 3JVTB 1DF0A 2WCEA 1DJHA 2NXQA 1SL9A 1S5GY 2I7AA 2ZN9A 1ZFSA 2Y1NA 2PRUA 4HSZA 3KPXA 1NCYA 1D1OA 2BL0B 1QX7A 3KHEA 4FQOA 2GV5A 1Y6WA 2JQ6A 2GGMA 2KBIA 1FI5A 4MRXA 4QJ5B 1XO5A 2NCOA 1OE9B 5J3XA 3CZTX 1LA3A 1NUBA 1CFCA 2KBMA 2L4IA 1IKUA 3O78A 4PCWA 2MJWB 5CSFA 1G8IA 2B1UA 2HPSA 4OCIA 1JC2A 1UHNA 4PE1A 1XFXO 1U5IB 5GQQC 2OTGB 4P2YB 1RFJA 4XJKB 2LC5A 1EL4A 1B7TY 2EGDA 1JUOA 1L2OC 4MLWA 5D69A 4I5KA 4CFRA 4NQGA 3VRRA 1U5IA 2LAPA 3NSKA 2KI6D 2HF5A 2JC2A 4M2OA 5I8NA 1S36A 2WNDA 2ZFDA 3F45A 1TTXA 4MSPA 1ALVA 2LM5A 1ZMZA 3EVUA 3ZWHA 3OX5A 3AKBA 2JZIA 1FF1A 1QX5B 2M49B 2BCXA 5D7FA 2L2EA 1JSAA 1G33A 4GBAA 1KWOB 1EH2A 3A8RA 2MLFC 3LK1A 4C0KA 2M1KB 2NLNA 4YI9A 4CPVA 2NZ0A 3D10A 2G2BA 4TNCA 1TNWA 2FOTA 2MA2A 1MR8A 3EKJA 4MVFA 5K89A 3BYAA 2LLTA 4A4BA 5B8IB 3JTDC 1QATA 2LHLA 3CR4X 4XYNA 1OQPA 1TCOB 2FCDA 2PALA 3I5IB 5CSNA 1IH0A 4PHKA 1CDMA 5AANA 2MHHA 2KHNA 1SW8A 1M39A 3EK7A 3BUWB 2KQ6A 3GK4X 1AJ4A 1WDCC 2M9GA 2OS8C 3NSLA 2LP2A 3K21A 2L5XB 1WRKA 1PVAA 1BLQA 4HRHA 3OB2B 3SIBA 1KSOA 4ORCB 1OSAA 4ZCUA 2LV7A 1JBAA 3TS5C 1YUUA 3VRQA 1BR4B 4PHMA 3SIAA 2LVIA 4BY5A 2KAYA 4PDZA 1F55A 2CTNA 3DD4A 2PMYA 2ZN8A 3TDUA 2LMTA 3O6BA 4AQJA 1DJXA 1EG3A 1QLKA 1RTP1 2JTZA 5HKZA 1IQ5A 4MRYA 2BBMA 5I2QA 1MQ1A 4WQ3A 4F0ZB 4YGCB 3LK0A 1LVCD 2KI6C 2F3YA 4PE7A 2F33A 2BCAA 3WXAA 1M63B 1C07A 1PULA 2MBXA 1F71A 1RJVA 1QLSA 2I2RE 1NIWA 2FJUB 1Y1AA 3BOWB 1PALA 1UHHA 1OMRA 1QX2A 2K61A 2L51A 4NDDA 5F6TA 2QPTA 5CSJA 3KF9A 1XVJA 1QS7A 1SY9A 2JXLA 3BOWA 3SG4A 2KQYA 1HT9A 2ZRTA 1DGUA 1NX1A 1YX7A 5DKRA 3ZNIA 1XA5A 4MZJA 1DJYA 1G4YR 1J7RA 1EXRA 1OOJA 2JNXA 1CLBA 1KFXS 4DIRA 4E68A 4WRIA 2L4HA 1CDNA 1F4QA 2LUXA 1TNXA 3PALA 2M29A 5KSZA 2R2IA 1TNQA 3NSOA 4U8DA 1BG1A 2WCFA 1LA0A 3FWCA 3O2PA 1IWQA 1H8BA 4ETOA 1QIVA 2LLUA 2KOTA 2GGZA 2PASA 3TS5B 2LHIA 4A4CA 1WLMA 2VRGA 3CS1A 3BQ3A 2K0JA 1KFXL 2LMUA 1CFDA 1YR5A 2OPOA 1NP8A 4MEWA 5TNCA 1SBJA 1CFFA 1B8RA 1FBVA 2JXCA 1UP5A 1K9KA 2SCPA 1BMOA 1NCZA 5G08A 2H61C 1BU3A 1V1FA 1N2DA 2HETA 4ICBA 2HQWA 1S6IA 1JFKA 3VRNA 1B9AA 1PVBA 1KFUS 1KK8B 3I5FC 5DKNA 1XFYO 2LANA 2EC6C 3VRPA 1SR6B 1ZOTB 1XFZO 2PVBA 1NX0A 1R6PA 5AXIA 3GOFA 4QJ4B 1AK8A 4M2QA 1CM1A 1TOPA 1W7IB 3KEVA 4C0JA 2LNKA 2KAVA 1QVIZ 4GPLB 2E6WA 1E8AA 4MZKA 1CDLA 1MWNA 3AAKA 2KI4C 4OKHA 1SRAA 3NXAA 2BECA 3DVJA 3QRXA 1F8HA 1SCMB 1BR1B 1KQMC 1IQ3A 2Q91A 3AAJA 2BCBA 1X02A 3BXKA 2V53A 3PN7B 1J1EA 2Q4UA 1IJ6A 3KO0A 3I5GC 4DS7A 2MLEC 1K2HA 1UURA 2F3ZA 1JWDA 4GNKB 1XK4A 2CCMA 3HX4A 1LKJA 1DTLA 1AVSA 4DUQA 3AKAA 1K8UA 3CR5X 4GGFC 4YGEB 1A2XA 4D1EA 2DOQA 3NSIA 4MBEA 4PHNA 3I5HC 5HYDA 5HLVA 3TUYC 2M7LA 1EG4A 2TN4A 3OX6A 2AUCA 1HQVA 5CPVA 2JWWA 1A4PA 2KGBC 1NWDA 4P5OE 2ZNDA 4DRWA 2K7BA 1N65A 3I5FB 1NPQA 3O4YA 1WRZA 1B4CA 2JRFA 3WHTB 1BF5A 4QJ3B 2L0PA 4USLA 1F4OA 1RECA 2CBLA 1CM4A 1SMGA 3D0YB 2BE6A 2F8PA 4YI8A 1A29A 2WOSA 1L2OB 1QVIY 1B1GA 1DJGA 2FCEA 2JOJA 2JT3A 3OHMB 2LUCA 4N5XA 2LLSA 3DVKA 1BJFA 3JVTC 4I5JA 1MXLC 3WNXB 2AMIA 1C7VA 1UWOA 1PSRA 1SKTA 3D0YA 1YVLA 2HQ8A 5CSIA 1AHRA 1MF8B 3E3RA 1S26D 1KQVA 2G9BA 1PRWA 2BL0C 5JJGA 1ZUZA 3BUNB 2I18A 1KSMA 2JU0A 1DGVA 3TZ1A 1K96A 2D8NA 1B47A 2KAXA 4YBHB 1XYDA 2E30A 1SPYA 3JTDB 2F2OA 1J7QA 1MHOA 3FS7A 1QXPA 1CLMA 4UPGA 5KU1A 3BUXB 4NDBA 2MRDA 4N1GA 1CMFA 2PSRA 3CWGA 2JNFA 3C1VA 1JF2A 2M1UA 4PALA 4OV2A 4CLNA 1EJ3A 3BUOB 1WDCB 2ZRSA 1QIWA 1A75B 1CDPA 2OS8B 2F2PA 3TUYB 1C7WA 5I2OA 1B8LA 3FWBA 2NCPA 1BODA 3SG2A 1CTRA 5BPJA 4ZCVA 4PHJA 1FPWA 1TIZA 2K7DA 1J7PA 1SYMA 1A75A 1GGZA 3SG7A 2KFHA 1IJ5A 1IRJA 2L98A 4HRGA 2O5GA 3FIAA 1BT6A 1W7JB 2BBNA 1K9UA 5FYXA 2CNPA 3EK8A 3OP0A 2KGRA 1DJIA 2Y4QA 1CB1A 1SK6D 2JT8A 1DJWA 2KYFA 1S3PA 4CIDA 4I5LB 3I5IC 3IQOA 1XFVO 1DVIA 4ORAB 1NX3A 3DVMA 4R1EA 1B8CA 3GK2A 2ZKMX 3TDZA 1YUTA 1YTZC 1FI6A 1UUSA 1IG5A 4NDCA 1M45A 3VGOA 3WHUB 1A03A 1K95A 2L50A 1CNPA 3PFVA 1UHIA 1QTXA 1H4BA 1R2UA 1S6JA 2JULA 1DT7B 2LP3A 3GK1A 1MXEA 4YRUA 5HKYA 2WCBA 2MAZA 1KFUL 3DVEA 1JF0A 1OMVA 2WC8A 1RROA 1K90D 1XFUO 1ODBA 1AJ5A 1LXFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFG A;  3SJS A;  2RGI A;  3MSE B;  1L7Z A;  2M97 A;  1UHJ A;  3IF7 A;  1KCY A;  3LL8 B;  1NCX A;  3EVR A;  1QAS A;  1TCF A;  2K7O A;  2IS9 A;  3SG6 A;  4XJK A;  2M3W A;  5JOL A;  1YX8 A;  3VRO A;  2LVK A;  1Q80 A;  4JWQ A;  3SG5 A;  5IBW A;  1YRU B;  4ORB B;  1YRT B;  4L9M A;  3EKH A;  1YVH A;  1BOC A;  2LVV A;  1CKK A;  2KYC A;  4DCK A;  4C0L A;  2K7C A;  1VRK A;  1F70 A;  1M46 A;  2K8M B;  3A4U B;  1K94 A;  1DJZ A;  1NX2 A;  2H2K A;  1WRL A;  1Y1U A;  3IQQ A;  4PE0 A;  1KK7 Z;  1ALW A;  1CMG A;  2BKH B;  2CXJ A;  4FTG A;  2O60 A;  2LE9 B;  4GAO A;  2CT9 A;  2KSP A;  5AER A;  2QAC A;  4JQ0 D;  5HKW A;  5AFP A;  4OVN F;  3OB1 B;  5AEQ A;  4WQ2 A;  1S6C A;  1QJT A;  2EC6 B;  2H61 A;  2JT0 A;  1J1D A;  2P6B B;  3PM8 A;  2KNE A;  1GGW A;  2K2F A;  4MZL A;  4M2P A;  3BUM B;  1CLL A;  1PK0 D;  2BE4 A;  1N0Y A;  3EK4 A;  1YUR A;  3EVV A;  1AP4 A;  1CFP A;  1TNP A;  4YGA A;  1OZO A;  2WOR A;  3RLZ A;  4YGD B;  1S1E A;  3PSR A;  1LIN A;  3LCP C;  1OZS A;  1GJY A;  4HRE E;  1YUS A;  1RK9 A;  4N1F A;  2KI4 B;  5ER5 A;  4GUK A;  5KTY A;  1S5G Z;  2AAO A;  2SAS A;  1XFW O;  1F54 A;  3TDI A;  3SG3 A;  1Y1X A;  2JPT A;  2LCP A;  1KQM B;  1WY9 A;  4BY4 A;  3M0W A;  3LLE A;  4Q04 A;  1TRF A;  5I2L A;  1V1G A;  1ZAC A;  4CFQ A;  3I5G B;  5ER4 X;  3CGA A;  4MN0 A;  1AUI B;  1NYA A;  1RWY A;  2K2A A;  1FW4 A;  4GFT A;  1KK8 C;  2LVJ A;  4IL1 A;  3HCM A;  4JPZ B;  1GQM A;  1QV1 A;  2OTG C;  2Y5I A;  3CLN A;  3CR2 A;  1SR6 C;  2BKI B;  2EHB A;  2M0R A;  1KK7 Y;  2COL B;  2LMV A;  1JFJ A;  2KFF A;  1QV0 A;  3CTN A;  2JTT A;  3I5H B;  1DMO A;  1K9P A;  1SL7 A;  1WLZ A;  3PLF B;  1TN4 A;  4YGB B;  4AQI A;  1M31 A;  1MUX A;  1SNL A;  2ZNE A;  3RM1 A;  4OR9 B;  4GGF A;  1B7T Z;  5HLO A;  2I94 A;  5PAL A;  3DF0 B;  2ISD A;  4I5N B;  2M8U A;  4PE4 A;  1K93 D;  1KWO C;  3PAT A;  1NSH A;  1UHK A;  3ICB A;  1SCV A;  1DF0 B;  1PSB A;  1SL8 A;  2KDH A;  1SCM C;  2M7N A;  5DKQ A;  3DF0 A;  1IGV A;  2Y1M A;  1J55 A;  1OMD A;  1Y0V H;  3H4S E;  4GGN A;  2A4J A;  4AOM A;  3PN7 C;  1J7O A;  1XK4 C;  3JVT B;  1DF0 A;  2WCE A;  1DJH A;  2NXQ A;  1SL9 A;  1S5G Y;  2I7A A;  2ZN9 A;  1ZFS A;  2Y1N A;  2PRU A;  4HSZ A;  3KPX A;  1NCY A;  1D1O A;  2BL0 B;  1QX7 A;  3KHE A;  4FQO A;  2GV5 A;  1Y6W A;  2JQ6 A;  2GGM A;  2KBI A;  1FI5 A;  4MRX A;  4QJ5 B;  1XO5 A;  2NCO A;  1OE9 B;  5J3X A;  3CZT X;  1LA3 A;  1NUB A;  1CFC A;  2KBM A;  2L4I A;  1IKU A;  3O78 A;  4PCW A;  2MJW B;  5CSF A;  1G8I A;  2B1U A;  2HPS A;  4OCI A;  1JC2 A;  1UHN A;  4PE1 A;  1XFX O;  1U5I B;  5GQQ C;  2OTG B;  4P2Y B;  1RFJ A;  4XJK B;  2LC5 A;  1EL4 A;  1B7T Y;  2EGD A;  1JUO A;  1L2O C;  4MLW A;  5D69 A;  4I5K A;  4CFR A;  4NQG A;  3VRR A;  1U5I A;  2LAP A;  3NSK A;  2KI6 D;  2HF5 A;  2JC2 A;  4M2O A;  5I8N A;  1S36 A;  2WND A;  2ZFD A;  3F45 A;  1TTX A;  4MSP A;  1ALV A;  2LM5 A;  1ZMZ A;  3EVU A;  3ZWH A;  3OX5 A;  3AKB A;  2JZI A;  1FF1 A;  1QX5 B;  2M49 B;  2BCX A;  5D7F A;  2L2E A;  1JSA A;  1G33 A;  4GBA A;  1KWO B;  1EH2 A;  3A8R A;  2MLF C;  3LK1 A;  4C0K A;  2M1K B;  2NLN A;  4YI9 A;  4CPV A;  2NZ0 A;  3D10 A;  2G2B A;  4TNC A;  1TNW A;  2FOT A;  2MA2 A;  1MR8 A;  3EKJ A;  4MVF A;  5K89 A;  3BYA A;  2LLT A;  4A4B A;  5B8I B;  3JTD C;  1QAT A;  2LHL A;  3CR4 X;  4XYN A;  1OQP A;  1TCO B;  2FCD A;  2PAL A;  3I5I B;  5CSN A;  1IH0 A;  4PHK A;  1CDM A;  5AAN A;  2MHH A;  2KHN A;  1SW8 A;  1M39 A;  3EK7 A;  3BUW B;  2KQ6 A;  3GK4 X;  1AJ4 A;  1WDC C;  2M9G A;  2OS8 C;  3NSL A;  2LP2 A;  3K21 A;  2L5X B;  1WRK A;  1PVA A;  1BLQ A;  4HRH A;  3OB2 B;  3SIB A;  1KSO A;  4ORC B;  1OSA A;  4ZCU A;  2LV7 A;  1JBA A;  3TS5 C;  1YUU A;  3VRQ A;  1BR4 B;  4PHM A;  3SIA A;  2LVI A;  4BY5 A;  2KAY A;  4PDZ A;  1F55 A;  2CTN A;  3DD4 A;  2PMY A;  2ZN8 A;  3TDU A;  2LMT A;  3O6B A;  4AQJ A;  1DJX A;  1EG3 A;  1QLK A;  1RTP 1;  2JTZ A;  5HKZ A;  1IQ5 A;  4MRY A;  2BBM A;  5I2Q A;  1MQ1 A;  4WQ3 A;  4F0Z B;  4YGC B;  3LK0 A;  1LVC D;  2KI6 C;  2F3Y A;  4PE7 A;  2F33 A;  2BCA A;  3WXA A;  1M63 B;  1C07 A;  1PUL A;  2MBX A;  1F71 A;  1RJV A;  1QLS A;  2I2R E;  1NIW A;  2FJU B;  1Y1A A;  3BOW B;  1PAL A;  1UHH A;  1OMR A;  1QX2 A;  2K61 A;  2L51 A;  4NDD A;  5F6T A;  2QPT A;  5CSJ A;  3KF9 A;  1XVJ A;  1QS7 A;  1SY9 A;  2JXL A;  3BOW A;  3SG4 A;  2KQY A;  1HT9 A;  2ZRT A;  1DGU A;  1NX1 A;  1YX7 A;  5DKR A;  3ZNI A;  1XA5 A;  4MZJ A;  1DJY A;  1G4Y R;  1J7R A;  1EXR A;  1OOJ A;  2JNX A;  1CLB A;  1KFX S;  4DIR A;  4E68 A;  4WRI A;  2L4H A;  1CDN A;  1F4Q A;  2LUX A;  1TNX A;  3PAL A;  2M29 A;  5KSZ A;  2R2I A;  1TNQ A;  3NSO A;  4U8D A;  1BG1 A;  2WCF A;  1LA0 A;  3FWC A;  3O2P A;  1IWQ A;  1H8B A;  4ETO A;  1QIV A;  2LLU A;  2KOT A;  2GGZ A;  2PAS A;  3TS5 B;  2LHI A;  4A4C A;  1WLM A;  2VRG A;  3CS1 A;  3BQ3 A;  2K0J A;  1KFX L;  2LMU A;  1CFD A;  1YR5 A;  2OPO A;  1NP8 A;  4MEW A;  5TNC A;  1SBJ A;  1CFF A;  1B8R A;  1FBV A;  2JXC A;  1UP5 A;  1K9K A;  2SCP A;  1BMO A;  1NCZ A;  5G08 A;  2H61 C;  1BU3 A;  1V1F A;  1N2D A;  2HET A;  4ICB A;  2HQW A;  1S6I A;  1JFK A;  3VRN A;  1B9A A;  1PVB A;  1KFU S;  1KK8 B;  3I5F C;  5DKN A;  1XFY O;  2LAN A;  2EC6 C;  3VRP A;  1SR6 B;  1ZOT B;  1XFZ O;  2PVB A;  1NX0 A;  1R6P A;  5AXI A;  3GOF A;  4QJ4 B;  1AK8 A;  4M2Q A;  1CM1 A;  1TOP A;  1W7I B;  3KEV A;  4C0J A;  2LNK A;  2KAV A;  1QVI Z;  4GPL B;  2E6W A;  1E8A A;  4MZK A;  1CDL A;  1MWN A;  3AAK A;  2KI4 C;  4OKH A;  1SRA A;  3NXA A;  2BEC A;  3DVJ A;  3QRX A;  1F8H A;  1SCM B;  1BR1 B;  1KQM C;  1IQ3 A;  2Q91 A;  3AAJ A;  2BCB A;  1X02 A;  3BXK A;  2V53 A;  3PN7 B;  1J1E A;  2Q4U A;  1IJ6 A;  3KO0 A;  3I5G C;  4DS7 A;  2MLE C;  1K2H A;  1UUR A;  2F3Z A;  1JWD A;  4GNK B;  1XK4 A;  2CCM A;  3HX4 A;  1LKJ A;  1DTL A;  1AVS A;  4DUQ A;  3AKA A;  1K8U A;  3CR5 X;  4GGF C;  4YGE B;  1A2X A;  4D1E A;  2DOQ A;  3NSI A;  4MBE A;  4PHN A;  3I5H C;  5HYD A;  5HLV A;  3TUY C;  2M7L A;  1EG4 A;  2TN4 A;  3OX6 A;  2AUC A;  1HQV A;  5CPV A;  2JWW A;  1A4P A;  2KGB C;  1NWD A;  4P5O E;  2ZND A;  4DRW A;  2K7B A;  1N65 A;  3I5F B;  1NPQ A;  3O4Y A;  1WRZ A;  1B4C A;  2JRF A;  3WHT B;  1BF5 A;  4QJ3 B;  2L0P A;  4USL A;  1F4O A;  1REC A;  2CBL A;  1CM4 A;  1SMG A;  3D0Y B;  2BE6 A;  2F8P A;  4YI8 A;  1A29 A;  2WOS A;  1L2O B;  1QVI Y;  1B1G A;  1DJG A;  2FCE A;  2JOJ A;  2JT3 A;  3OHM B;  2LUC A;  4N5X A;  2LLS A;  3DVK A;  1BJF A;  3JVT C;  4I5J A;  1MXL C;  3WNX B;  2AMI A;  1C7V A;  1UWO A;  1PSR A;  1SKT A;  3D0Y A;  1YVL A;  2HQ8 A;  5CSI A;  1AHR A;  1MF8 B;  3E3R A;  1S26 D;  1KQV A;  2G9B A;  1PRW A;  2BL0 C;  5JJG A;  1ZUZ A;  3BUN B;  2I18 A;  1KSM A;  2JU0 A;  1DGV A;  3TZ1 A;  1K96 A;  2D8N A;  1B47 A;  2KAX A;  4YBH B;  1XYD A;  2E30 A;  1SPY A;  3JTD B;  2F2O A;  1J7Q A;  1MHO A;  3FS7 A;  1QXP A;  1CLM A;  4UPG A;  5KU1 A;  3BUX B;  4NDB A;  2MRD A;  4N1G A;  1CMF A;  2PSR A;  3CWG A;  2JNF A;  3C1V A;  1JF2 A;  2M1U A;  4PAL A;  4OV2 A;  4CLN A;  1EJ3 A;  3BUO B;  1WDC B;  2ZRS A;  1QIW A;  1A75 B;  1CDP A;  2OS8 B;  2F2P A;  3TUY B;  1C7W A;  5I2O A;  1B8L A;  3FWB A;  2NCP A;  1BOD A;  3SG2 A;  1CTR A;  5BPJ A;  4ZCV A;  4PHJ A;  1FPW A;  1TIZ A;  2K7D A;  1J7P A;  1SYM A;  1A75 A;  1GGZ A;  3SG7 A;  2KFH A;  1IJ5 A;  1IRJ A;  2L98 A;  4HRG A;  2O5G A;  3FIA A;  1BT6 A;  1W7J B;  2BBN A;  1K9U A;  5FYX A;  2CNP A;  3EK8 A;  3OP0 A;  2KGR A;  1DJI A;  2Y4Q A;  1CB1 A;  1SK6 D;  2JT8 A;  1DJW A;  2KYF A;  1S3P A;  4CID A;  4I5L B;  3I5I C;  3IQO A;  1XFV O;  1DVI A;  4ORA B;  1NX3 A;  3DVM A;  4R1E A;  1B8C A;  3GK2 A;  2ZKM X;  3TDZ A;  1YUT A;  1YTZ C;  1FI6 A;  1UUS A;  1IG5 A;  4NDC A;  1M45 A;  3VGO A;  3WHU B;  1A03 A;  1K95 A;  2L50 A;  1CNP A;  3PFV A;  1UHI A;  1QTX A;  1H4B A;  1R2U A;  1S6J A;  2JUL A;  1DT7 B;  2LP3 A;  3GK1 A;  1MXE A;  4YRU A;  5HKY A;  2WCB A;  2MAZ A;  1KFU L;  3DVE A;  1JF0 A;  1OMV A;  2WC8 A;  1RRO A;  1K90 D;  1XFU O;  1ODB A;  1AJ5 A;  1LXF C; 
#chains in the Genus database with same CATH topology
 2KFG A;  3SJS A;  2RGI A;  3MSE B;  4OZD A;  1L7Z A;  1Z4H A;  2M97 A;  1UHJ A;  3IF7 A;  1KCY A;  3PM2 A;  3LL8 B;  4FQT A;  1NCX A;  3EVR A;  1QAS A;  1TCF A;  2K7O A;  2IS9 A;  3SG6 A;  4XJK A;  2M3W A;  5JOL A;  1YX8 A;  3VRO A;  2LVK A;  1Q80 A;  4JWQ A;  3SG5 A;  5IBW A;  1YRU B;  4ORB B;  1YRT B;  4L9M A;  3EKH A;  3K1E A;  1YVH A;  1BOC A;  2LVV A;  1CKK A;  2KYC A;  4DCK A;  2WC6 A;  2K7C A;  4C0L A;  1VRK A;  1F70 A;  2QEH A;  1M46 A;  1TWO A;  2K8M B;  3A4U B;  1K94 A;  1DJZ A;  1NX2 A;  2H2K A;  1WRL A;  1Y1U A;  3IQQ A;  4PE0 A;  1KK7 Z;  1ALW A;  1TUZ A;  2BKH B;  1CMG A;  2CXJ A;  4FTG A;  2O60 A;  2LE9 B;  4GAO A;  2CT9 A;  2KSP A;  5AER A;  2QAC A;  1DC1 A;  4JQ0 D;  5HKW A;  5AFP A;  3IVT A;  3OB1 B;  4OVN F;  4WQ2 A;  5AEQ A;  3D74 A;  1S6C A;  1QJT A;  2EC6 B;  2H61 A;  2JT0 A;  1J1D A;  2P6B B;  3PM8 A;  2KNE A;  3BFB A;  1GGW A;  2K2F A;  1C3Z A;  4MZL A;  4M2P A;  3BUM B;  1CLL A;  1PK0 D;  2BE4 A;  1N0Y A;  3EK4 A;  1YUR A;  3EVV A;  1AP4 A;  1CFP A;  1TNP A;  4YGA A;  3VB1 A;  3R1O A;  1OZO A;  2WOR A;  3RLZ A;  2P70 A;  4YGD B;  1S1E A;  3PSR A;  1LIN A;  3LCP C;  4JKT A;  1OZS A;  1GJY A;  4HRE E;  1YUS A;  1RK9 A;  4N1F A;  2KI4 B;  5ER5 A;  4GUK A;  5KTY A;  1S5G Z;  2AAO A;  2SAS A;  1XFW O;  2K60 A;  1F54 A;  3TDI A;  5EL2 A;  1Y1X A;  2JPT A;  2LCP A;  1KQM B;  1WY9 A;  3SG3 A;  4BY4 A;  3M0W A;  3LLE A;  4Q04 A;  1TRF A;  3CYZ A;  5I2L A;  1V1G A;  1ZAC A;  4CFQ A;  4IJ7 A;  3I5G B;  5ER4 X;  3CGA A;  4MN0 A;  1AUI B;  1NYA A;  1RWY A;  2K2A A;  1DQE A;  1FW4 A;  1KK8 C;  2LVJ A;  4GFT A;  4IL1 A;  3HCM A;  2KLE A;  1GQM A;  1QV1 A;  2OTG C;  2Y5I A;  3CLN A;  4JPZ B;  3CR2 A;  1SR6 C;  2BKI B;  2EHB A;  2M0R A;  1OOF A;  1KK7 Y;  2COL B;  2LMV A;  1JFJ A;  2KFF A;  1QV0 A;  3CTN A;  2JTT A;  3I5H B;  1DMO A;  1K9P A;  1SL7 A;  1WLZ A;  3PLF B;  1TN4 A;  4YGB B;  4AQI A;  1M31 A;  1MUX A;  1SNL A;  2ZNE A;  3D78 A;  3RM1 A;  4OR9 B;  4GGF A;  1B7T Z;  5HLO A;  2I94 A;  5PAL A;  3DF0 B;  2ISD A;  4I5N B;  2M8U A;  4PE4 A;  1IIO A;  1K93 D;  1KWO C;  3PAT A;  2GTE A;  1NSH A;  1UHK A;  3ICB A;  1SCV A;  1DF0 B;  1PSB A;  1SL8 A;  2KDH A;  1SCM C;  2M7N A;  5DKQ A;  3DF0 A;  1IGV A;  5FI6 A;  2Y1M A;  1J55 A;  1OMD A;  1Y0V H;  3H4S E;  4GGN A;  2A4J A;  3S0G A;  4AOM A;  3PN7 C;  1J7O A;  1XK4 C;  3DXL A;  3JVT B;  1DF0 A;  2WCE A;  3L4L A;  1DJH A;  2NXQ A;  1SL9 A;  1S5G Y;  2I7A A;  2ZN9 A;  1ZFS A;  2Y1N A;  2PRU A;  4HSZ A;  3KPX A;  1NCY A;  3SS5 A;  1D1O A;  2BL0 B;  1QX7 A;  3KHE A;  4FQO A;  2GV5 A;  1Y6W A;  2JQ6 A;  2GGM A;  2KBI A;  1FI5 A;  4MRX A;  4QJ5 B;  1XO5 A;  2NCO A;  1OE9 B;  5J3X A;  3CZT X;  1LA3 A;  1NUB A;  1CFC A;  3S0D A;  2QEO A;  2KBM A;  2L4I A;  3S0F A;  1IKU A;  3O78 A;  4PCW A;  1OOI X;  2MJW B;  5CSF A;  1DEK A;  1G8I A;  2B1U A;  2HPS A;  4OCI A;  1JC2 A;  1UHN A;  4PE1 A;  1XFX O;  1U5I B;  5GQQ C;  2OTG B;  4P2Y B;  1RFJ A;  4XJK B;  2LC5 A;  1EL4 A;  2P71 A;  1B7T Y;  2EGD A;  1JUO A;  1L2O C;  4MLW A;  5D69 A;  4I5K A;  4CFR A;  4NQG A;  3VRR A;  1U5I A;  2LAP A;  3NSK A;  2KI6 D;  2HF5 A;  2JC2 A;  4M2O A;  5I8N A;  3L47 A;  1S36 A;  2WND A;  2ZFD A;  3F45 A;  1TTX A;  4MSP A;  1ALV A;  2LM5 A;  1ZMZ A;  3EVU A;  3L4A A;  3OX5 A;  3AKB A;  2JZI A;  3ZWH A;  1QX5 B;  2M49 B;  2BCX A;  3DYE A;  3R1V A;  5D7F A;  2L2E A;  1JSA A;  1G33 A;  4GBA A;  1KWO B;  2YGU A;  1EH2 A;  3A8R A;  2MLF C;  3LK1 A;  4C0K A;  2M1K B;  2NLN A;  4YI9 A;  4CPV A;  2NZ0 A;  1SSE B;  2G2B A;  3D10 A;  4TNC A;  1TNW A;  2FOT A;  2MA2 A;  1MR8 A;  3EKJ A;  4MVF A;  5K89 A;  3BYA A;  2LLT A;  4A4B A;  5B8I B;  3S0E A;  3JTD C;  1QAT A;  3S0A A;  2LHL A;  3CR4 X;  4XYN A;  1OQP A;  1TCO B;  2FCD A;  2PAL A;  3I5I B;  5CSN A;  1IH0 A;  4PHK A;  1CDM A;  5AAN A;  2MHH A;  2KHN A;  1W9Z A;  1SW8 A;  1M39 A;  2BAP A;  2KLD A;  3EK7 A;  3BUW B;  2KQ6 A;  3GK4 X;  1AJ4 A;  1WDC C;  2QEV A;  2M9G A;  2OS8 C;  3NSL A;  2LP2 A;  3K21 A;  2L5X B;  1WRK A;  1PVA A;  3NGV A;  1BLQ A;  4HRH A;  3OB2 B;  3SIB A;  1KSO A;  4ORC B;  1OSA A;  4ZCU A;  2LV7 A;  1JBA A;  3TS5 C;  1YUU A;  3VRQ A;  1BR4 B;  4PHM A;  3SIA A;  2LVI A;  4BY5 A;  2FJY A;  2KAY A;  4PDZ A;  1F55 A;  2CTN A;  3BFH A;  3DD4 A;  2PMY A;  2ZN8 A;  3TDU A;  2LMT A;  3O6B A;  4AQJ A;  1DJX A;  1EG3 A;  1QLK A;  1RTP 1;  2JTZ A;  3NHI A;  1IQ5 A;  4MRY A;  2BBM A;  5HKZ A;  5I2Q A;  3SS4 A;  1MQ1 A;  4WQ3 A;  4F0Z B;  4YGC B;  3BJH A;  3LK0 A;  1LVC D;  2KI6 C;  2F3Y A;  4PE7 A;  4JD9 A;  2F33 A;  2BCA A;  4KYN A;  3WXA A;  1M63 B;  1C07 A;  1PUL A;  2MBX A;  1F71 A;  1RJV A;  1QLS A;  2I2R E;  2WCK A;  3CZ0 A;  1NIW A;  2FJU B;  1Y1A A;  3BOW B;  1PAL A;  3QME A;  1UHH A;  3CZ1 A;  1OMR A;  1QX2 A;  2K61 A;  2L51 A;  4NDD A;  5DIC A;  5F6T A;  2QPT A;  3S0B A;  4INW A;  5CSJ A;  3KF9 A;  5D3O A;  1XVJ A;  1QS7 A;  1SY9 A;  2JXL A;  3BOW A;  3SG4 A;  1XFR A;  2KQY A;  2WC5 A;  1HT9 A;  2ZRT A;  1DGU A;  3D76 A;  1NX1 A;  1YX7 A;  3V2L A;  5DKR A;  3ZNI A;  4PT1 A;  1XA5 A;  4MZJ A;  1DJY A;  1G4Y R;  1J7R A;  1EXR A;  1OOJ A;  2JNX A;  3R72 A;  1CLB A;  2PYQ A;  1KFX S;  4DIR A;  4E68 A;  4WRI A;  2L4H A;  1CDN A;  1F4Q A;  2LUX A;  1TNX A;  3PAL A;  2M29 A;  5KSZ A;  2WCH A;  2R2I A;  1TNQ A;  3NSO A;  4U8D A;  1BG1 A;  2WCF A;  2WCL A;  1LA0 A;  3FWC A;  3O2P A;  1IWQ A;  1H8B A;  4ETO A;  1QIV A;  2LLU A;  2KOT A;  2GGZ A;  2PAS A;  3TS5 B;  1FF1 A;  2LHI A;  4A4C A;  1WLM A;  2VRG A;  2WCJ A;  3BQ3 A;  3CS1 A;  2K0J A;  1KFX L;  2LMU A;  1CFD A;  1YR5 A;  2OPO A;  1NP8 A;  4MEW A;  5TNC A;  1SBJ A;  1CFF A;  1B8R A;  1FBV A;  2JXC A;  1UP5 A;  1K9K A;  2ERB A;  1BMO A;  1NCZ A;  2SCP A;  5G08 A;  3CZ2 A;  2H61 C;  1BU3 A;  1V1F A;  1N2D A;  2HET A;  4ICB A;  2HQW A;  1S6I A;  1JFK A;  3VRN A;  1B9A A;  1PVB A;  1KFU S;  1KK8 B;  3I5F C;  5DKN A;  1XFY O;  2LAN A;  2EC6 C;  3VRP A;  1SR6 B;  1ZOT B;  1XFZ O;  3B87 A;  2PVB A;  5HL1 A;  1NX0 A;  1R6P A;  1GM0 A;  5AXI A;  3GOF A;  4QJ4 B;  3OGN A;  1AK8 A;  4M2Q A;  1CM1 A;  1TOP A;  1W7I B;  2KPH A;  3KEV A;  3OBV A;  2L2C A;  3SS3 A;  2LNK A;  4C0J A;  3O4X A;  2KAV A;  1DEL A;  1QVI Z;  2PQL A;  4GPL B;  2H8V A;  2E6W A;  1E8A A;  4MZK A;  1CDL A;  1MWN A;  3AAK A;  2KI4 C;  4OKH A;  1SRA A;  3NXA A;  2BEC A;  3DVJ A;  3QRX A;  1F8H A;  1SCM B;  1BR1 B;  3CAB A;  3D75 A;  4INX A;  1KQM C;  1IQ3 A;  2Q91 A;  3AAJ A;  2BCB A;  1X02 A;  3BXK A;  2V53 A;  3PN7 B;  1J1E A;  2Q4U A;  1IJ6 A;  3KO0 A;  3I5G C;  4DS7 A;  2MLE C;  1K2H A;  1UUR A;  3FE9 A;  2F3Z A;  1JWD A;  4GNK B;  1XK4 A;  2CCM A;  3HX4 A;  1LKJ A;  1DTL A;  1AVS A;  3DY9 A;  3AKA A;  4DUQ A;  1K8U A;  5I94 A;  3CR5 X;  4GGF C;  4YGE B;  1A2X A;  4D1E A;  2DOQ A;  3NSI A;  4MBE A;  4PHN A;  3I5H C;  5HYD A;  5HLV A;  3TUY C;  2M7L A;  1EG4 A;  2TN4 A;  3OX6 A;  3B86 A;  3R1P A;  2AUC A;  1HQV A;  5CPV A;  2JWW A;  1A4P A;  1P28 A;  2KGB C;  3CDN A;  4F7F A;  1NWD A;  4P5O E;  2ZND A;  3B7A A;  4DRW A;  2K7B A;  1N65 A;  3I5F B;  1NPQ A;  3DZT A;  3O4Y A;  1WRZ A;  1B4C A;  2JRF A;  3WHT B;  1BF5 A;  4QJ3 B;  2L0P A;  4USL A;  1F4O A;  1REC A;  2CBL A;  1CM4 A;  1SMG A;  3D0Y B;  2BE6 A;  2F8P A;  4YI8 A;  1C3Y A;  1A29 A;  2WOS A;  1L2O B;  1QVI Y;  1B1G A;  1DJG A;  2FCE A;  2JOJ A;  2JT3 A;  3OHM B;  2LUC A;  4N5X A;  2LLS A;  3DVK A;  1BJF A;  3NHT A;  3JVT C;  4I5J A;  1MXL C;  3WNX B;  2AMI A;  1C7V A;  1UWO A;  1PSR A;  1SKT A;  3BFA A;  3D0Y A;  3RZS A;  1YVL A;  2HQ8 A;  5CSI A;  1AHR A;  1MF8 B;  3FE8 A;  3E3R A;  1S26 D;  1KQV A;  2G9B A;  1PRW A;  2BL0 C;  5JJG A;  1ZUZ A;  3BUN B;  2I18 A;  3Q8I A;  1KSM A;  2JU0 A;  1DGV A;  3TZ1 A;  3PJI A;  1K96 A;  2QDI A;  1OOG A;  2D8N A;  1B47 A;  2KAX A;  1QWV A;  4YBH B;  1XYD A;  2E30 A;  1SPY A;  3JTD B;  2F2O A;  1J7Q A;  1MHO A;  3FS7 A;  1QXP A;  1CLM A;  4UPG A;  5KU1 A;  3BUX B;  4NDB A;  2MRD A;  4N1G A;  1CMF A;  2PSR A;  3CWG A;  2JNF A;  3C1V A;  1ORG A;  1JF2 A;  2M1U A;  4PAL A;  4OV2 A;  4CLN A;  1EJ3 A;  3BUO B;  1WDC B;  2ZRS A;  3UO9 A;  1QIW A;  1A75 B;  1CDP A;  2OS8 B;  2F2P A;  3TUY B;  1C7W A;  5I2O A;  1B8L A;  3FWB A;  2NCP A;  1BOD A;  3UNW A;  3SG2 A;  1CTR A;  5BPJ A;  4ZCV A;  4PHJ A;  1FPW A;  1TIZ A;  2K7D A;  1J7P A;  1SYM A;  1OOH A;  1A75 A;  1GGZ A;  3SG7 A;  1LS8 A;  2KFH A;  1IJ5 A;  1IRJ A;  2L98 A;  4HRG A;  2O5G A;  3FIA A;  1BT6 A;  1W7J B;  2BBN A;  5FI7 A;  1K9U A;  5FYX A;  2CNP A;  3EK8 A;  3OP0 A;  2KGR A;  2L5Y A;  3B88 A;  1DJI A;  2Y4Q A;  1CB1 A;  1SK6 D;  3EG5 B;  2JT8 A;  1DJW A;  2KYF A;  1S3P A;  4CID A;  1T14 A;  2QEB A;  4I5L B;  3I5I C;  3IQO A;  2WCM A;  1XFV O;  1DVI A;  4ORA B;  1NX3 A;  1OW4 A;  3FE6 A;  3DVM A;  4R1E A;  1B8C A;  1TUJ A;  2ZKM X;  3GK2 A;  3D77 A;  3TDZ A;  1YUT A;  1YTZ C;  1FI6 A;  1UUS A;  1IG5 A;  4NDC A;  1M45 A;  3VGO A;  3WHU B;  1A03 A;  1K95 A;  2L50 A;  1CNP A;  3PFV A;  1Z2C B;  1UHI A;  1QTX A;  1H4B A;  1R2U A;  1S6J A;  2JUL A;  3B6X A;  2LP3 A;  3GK1 A;  1MXE A;  3D73 A;  4YRU A;  1DT7 B;  5HKY A;  2WCB A;  5FI2 A;  2MAZ A;  1KFU L;  3DVE A;  1JF0 A;  2BNX A;  1OMV A;  2WC8 A;  1RRO A;  1K90 D;  3N7H A;  1XFU O;  1ODB A;  1AJ5 A;  1LXF C;  2JPO A; 
#chains in the Genus database with same CATH homology
 2KFG A;  3SJS A;  2RGI A;  3MSE B;  1L7Z A;  2M97 A;  1UHJ A;  3IF7 A;  1KCY A;  3LL8 B;  1NCX A;  3EVR A;  1QAS A;  1TCF A;  2K7O A;  2IS9 A;  3SG6 A;  4XJK A;  2M3W A;  5JOL A;  1YX8 A;  3VRO A;  2LVK A;  1Q80 A;  4JWQ A;  3SG5 A;  5IBW A;  1YRU B;  4ORB B;  1YRT B;  4L9M A;  3EKH A;  1YVH A;  1BOC A;  2LVV A;  1CKK A;  2KYC A;  4DCK A;  4C0L A;  2K7C A;  1VRK A;  1F70 A;  1M46 A;  2K8M B;  3A4U B;  1K94 A;  1DJZ A;  1NX2 A;  2H2K A;  1WRL A;  1Y1U A;  3IQQ A;  4PE0 A;  1KK7 Z;  1ALW A;  1CMG A;  2BKH B;  2CXJ A;  4FTG A;  2O60 A;  2LE9 B;  4GAO A;  2CT9 A;  2KSP A;  5AER A;  2QAC A;  4JQ0 D;  5HKW A;  5AFP A;  4OVN F;  3OB1 B;  5AEQ A;  4WQ2 A;  1S6C A;  1QJT A;  2EC6 B;  2H61 A;  2JT0 A;  1J1D A;  2P6B B;  3PM8 A;  2KNE A;  1GGW A;  2K2F A;  4MZL A;  4M2P A;  3BUM B;  1CLL A;  1PK0 D;  2BE4 A;  1N0Y A;  3EK4 A;  1YUR A;  3EVV A;  1AP4 A;  1CFP A;  1TNP A;  4YGA A;  1OZO A;  2WOR A;  3RLZ A;  4YGD B;  1S1E A;  3PSR A;  1LIN A;  3LCP C;  1OZS A;  1GJY A;  4HRE E;  1YUS A;  1RK9 A;  4N1F A;  2KI4 B;  5ER5 A;  4GUK A;  5KTY A;  1S5G Z;  2AAO A;  2SAS A;  1XFW O;  1F54 A;  3TDI A;  3SG3 A;  1Y1X A;  2JPT A;  2LCP A;  1KQM B;  1WY9 A;  4BY4 A;  3M0W A;  3LLE A;  4Q04 A;  1TRF A;  5I2L A;  1V1G A;  1ZAC A;  4CFQ A;  3I5G B;  5ER4 X;  3CGA A;  4MN0 A;  1AUI B;  1NYA A;  1RWY A;  2K2A A;  1FW4 A;  4GFT A;  1KK8 C;  2LVJ A;  4IL1 A;  3HCM A;  4JPZ B;  1GQM A;  1QV1 A;  2OTG C;  2Y5I A;  3CLN A;  3CR2 A;  1SR6 C;  2BKI B;  2EHB A;  2M0R A;  1KK7 Y;  2COL B;  2LMV A;  1JFJ A;  2KFF A;  1QV0 A;  3CTN A;  2JTT A;  3I5H B;  1DMO A;  1K9P A;  1SL7 A;  1WLZ A;  3PLF B;  1TN4 A;  4YGB B;  4AQI A;  1M31 A;  1MUX A;  1SNL A;  2ZNE A;  3RM1 A;  4OR9 B;  4GGF A;  1B7T Z;  5HLO A;  2I94 A;  5PAL A;  3DF0 B;  2ISD A;  4I5N B;  2M8U A;  4PE4 A;  1K93 D;  1KWO C;  3PAT A;  1NSH A;  1UHK A;  3ICB A;  1SCV A;  1DF0 B;  1PSB A;  1SL8 A;  2KDH A;  1SCM C;  2M7N A;  5DKQ A;  3DF0 A;  1IGV A;  2Y1M A;  1J55 A;  1OMD A;  1Y0V H;  3H4S E;  4GGN A;  2A4J A;  4AOM A;  3PN7 C;  1J7O A;  1XK4 C;  3JVT B;  1DF0 A;  2WCE A;  1DJH A;  2NXQ A;  1SL9 A;  1S5G Y;  2I7A A;  2ZN9 A;  1ZFS A;  2Y1N A;  2PRU A;  4HSZ A;  3KPX A;  1NCY A;  1D1O A;  2BL0 B;  1QX7 A;  3KHE A;  4FQO A;  2GV5 A;  1Y6W A;  2JQ6 A;  2GGM A;  2KBI A;  1FI5 A;  4MRX A;  4QJ5 B;  1XO5 A;  2NCO A;  1OE9 B;  5J3X A;  3CZT X;  1LA3 A;  1NUB A;  1CFC A;  2KBM A;  2L4I A;  1IKU A;  3O78 A;  4PCW A;  2MJW B;  5CSF A;  1G8I A;  2B1U A;  2HPS A;  4OCI A;  1JC2 A;  1UHN A;  4PE1 A;  1XFX O;  1U5I B;  5GQQ C;  2OTG B;  4P2Y B;  1RFJ A;  4XJK B;  2LC5 A;  1EL4 A;  1B7T Y;  2EGD A;  1JUO A;  1L2O C;  4MLW A;  5D69 A;  4I5K A;  4CFR A;  4NQG A;  3VRR A;  1U5I A;  2LAP A;  3NSK A;  2KI6 D;  2HF5 A;  2JC2 A;  4M2O A;  5I8N A;  1S36 A;  2WND A;  2ZFD A;  3F45 A;  1TTX A;  4MSP A;  1ALV A;  2LM5 A;  1ZMZ A;  3EVU A;  3ZWH A;  3OX5 A;  3AKB A;  2JZI A;  1FF1 A;  1QX5 B;  2M49 B;  2BCX A;  5D7F A;  2L2E A;  1JSA A;  1G33 A;  4GBA A;  1KWO B;  1EH2 A;  3A8R A;  2MLF C;  3LK1 A;  4C0K A;  2M1K B;  2NLN A;  4YI9 A;  4CPV A;  2NZ0 A;  3D10 A;  2G2B A;  4TNC A;  1TNW A;  2FOT A;  2MA2 A;  1MR8 A;  3EKJ A;  4MVF A;  5K89 A;  3BYA A;  2LLT A;  4A4B A;  5B8I B;  3JTD C;  1QAT A;  2LHL A;  3CR4 X;  4XYN A;  1OQP A;  1TCO B;  2FCD A;  2PAL A;  3I5I B;  5CSN A;  1IH0 A;  4PHK A;  1CDM A;  5AAN A;  2MHH A;  2KHN A;  1SW8 A;  1M39 A;  3EK7 A;  3BUW B;  2KQ6 A;  3GK4 X;  1AJ4 A;  1WDC C;  2M9G A;  2OS8 C;  3NSL A;  2LP2 A;  3K21 A;  2L5X B;  1WRK A;  1PVA A;  1BLQ A;  4HRH A;  3OB2 B;  3SIB A;  1KSO A;  4ORC B;  1OSA A;  4ZCU A;  2LV7 A;  1JBA A;  3TS5 C;  1YUU A;  3VRQ A;  1BR4 B;  4PHM A;  3SIA A;  2LVI A;  4BY5 A;  2KAY A;  4PDZ A;  1F55 A;  2CTN A;  3DD4 A;  2PMY A;  2ZN8 A;  3TDU A;  2LMT A;  3O6B A;  4AQJ A;  1DJX A;  1EG3 A;  1QLK A;  1RTP 1;  2JTZ A;  5HKZ A;  1IQ5 A;  4MRY A;  2BBM A;  5I2Q A;  1MQ1 A;  4WQ3 A;  4F0Z B;  4YGC B;  3LK0 A;  1LVC D;  2KI6 C;  2F3Y A;  4PE7 A;  2F33 A;  2BCA A;  3WXA A;  1M63 B;  1C07 A;  1PUL A;  2MBX A;  1F71 A;  1RJV A;  1QLS A;  2I2R E;  1NIW A;  2FJU B;  1Y1A A;  3BOW B;  1PAL A;  1UHH A;  1OMR A;  1QX2 A;  2K61 A;  2L51 A;  4NDD A;  5F6T A;  2QPT A;  5CSJ A;  3KF9 A;  1XVJ A;  1QS7 A;  1SY9 A;  2JXL A;  3BOW A;  3SG4 A;  2KQY A;  1HT9 A;  2ZRT A;  1DGU A;  1NX1 A;  1YX7 A;  5DKR A;  3ZNI A;  1XA5 A;  4MZJ A;  1DJY A;  1G4Y R;  1J7R A;  1EXR A;  1OOJ A;  2JNX A;  1CLB A;  1KFX S;  4DIR A;  4E68 A;  4WRI A;  2L4H A;  1CDN A;  1F4Q A;  2LUX A;  1TNX A;  3PAL A;  2M29 A;  5KSZ A;  2R2I A;  1TNQ A;  3NSO A;  4U8D A;  1BG1 A;  2WCF A;  1LA0 A;  3FWC A;  3O2P A;  1IWQ A;  1H8B A;  4ETO A;  1QIV A;  2LLU A;  2KOT A;  2GGZ A;  2PAS A;  3TS5 B;  2LHI A;  4A4C A;  1WLM A;  2VRG A;  3CS1 A;  3BQ3 A;  2K0J A;  1KFX L;  2LMU A;  1CFD A;  1YR5 A;  2OPO A;  1NP8 A;  4MEW A;  5TNC A;  1SBJ A;  1CFF A;  1B8R A;  1FBV A;  2JXC A;  1UP5 A;  1K9K A;  2SCP A;  1BMO A;  1NCZ A;  5G08 A;  2H61 C;  1BU3 A;  1V1F A;  1N2D A;  2HET A;  4ICB A;  2HQW A;  1S6I A;  1JFK A;  3VRN A;  1B9A A;  1PVB A;  1KFU S;  1KK8 B;  3I5F C;  5DKN A;  1XFY O;  2LAN A;  2EC6 C;  3VRP A;  1SR6 B;  1ZOT B;  1XFZ O;  2PVB A;  1NX0 A;  1R6P A;  5AXI A;  3GOF A;  4QJ4 B;  1AK8 A;  4M2Q A;  1CM1 A;  1TOP A;  1W7I B;  3KEV A;  4C0J A;  2LNK A;  2KAV A;  1QVI Z;  4GPL B;  2E6W A;  1E8A A;  4MZK A;  1CDL A;  1MWN A;  3AAK A;  2KI4 C;  4OKH A;  1SRA A;  3NXA A;  2BEC A;  3DVJ A;  3QRX A;  1F8H A;  1SCM B;  1BR1 B;  1KQM C;  1IQ3 A;  2Q91 A;  3AAJ A;  2BCB A;  1X02 A;  3BXK A;  2V53 A;  3PN7 B;  1J1E A;  2Q4U A;  1IJ6 A;  3KO0 A;  3I5G C;  4DS7 A;  2MLE C;  1K2H A;  1UUR A;  2F3Z A;  1JWD A;  4GNK B;  1XK4 A;  2CCM A;  3HX4 A;  1LKJ A;  1DTL A;  1AVS A;  4DUQ A;  3AKA A;  1K8U A;  3CR5 X;  4GGF C;  4YGE B;  1A2X A;  4D1E A;  2DOQ A;  3NSI A;  4MBE A;  4PHN A;  3I5H C;  5HYD A;  5HLV A;  3TUY C;  2M7L A;  1EG4 A;  2TN4 A;  3OX6 A;  2AUC A;  1HQV A;  5CPV A;  2JWW A;  1A4P A;  2KGB C;  1NWD A;  4P5O E;  2ZND A;  4DRW A;  2K7B A;  1N65 A;  3I5F B;  1NPQ A;  3O4Y A;  1WRZ A;  1B4C A;  2JRF A;  3WHT B;  1BF5 A;  4QJ3 B;  2L0P A;  4USL A;  1F4O A;  1REC A;  2CBL A;  1CM4 A;  1SMG A;  3D0Y B;  2BE6 A;  2F8P A;  4YI8 A;  1A29 A;  2WOS A;  1L2O B;  1QVI Y;  1B1G A;  1DJG A;  2FCE A;  2JOJ A;  2JT3 A;  3OHM B;  2LUC A;  4N5X A;  2LLS A;  3DVK A;  1BJF A;  3JVT C;  4I5J A;  1MXL C;  3WNX B;  2AMI A;  1C7V A;  1UWO A;  1PSR A;  1SKT A;  3D0Y A;  1YVL A;  2HQ8 A;  5CSI A;  1AHR A;  1MF8 B;  3E3R A;  1S26 D;  1KQV A;  2G9B A;  1PRW A;  2BL0 C;  5JJG A;  1ZUZ A;  3BUN B;  2I18 A;  1KSM A;  2JU0 A;  1DGV A;  3TZ1 A;  1K96 A;  2D8N A;  1B47 A;  2KAX A;  4YBH B;  1XYD A;  2E30 A;  1SPY A;  3JTD B;  2F2O A;  1J7Q A;  1MHO A;  3FS7 A;  1QXP A;  1CLM A;  4UPG A;  5KU1 A;  3BUX B;  4NDB A;  2MRD A;  4N1G A;  1CMF A;  2PSR A;  3CWG A;  2JNF A;  3C1V A;  1JF2 A;  2M1U A;  4PAL A;  4OV2 A;  4CLN A;  1EJ3 A;  3BUO B;  1WDC B;  2ZRS A;  1QIW A;  1A75 B;  1CDP A;  2OS8 B;  2F2P A;  3TUY B;  1C7W A;  5I2O A;  1B8L A;  3FWB A;  2NCP A;  1BOD A;  3SG2 A;  1CTR A;  5BPJ A;  4ZCV A;  4PHJ A;  1FPW A;  1TIZ A;  2K7D A;  1J7P A;  1SYM A;  1A75 A;  1GGZ A;  3SG7 A;  2KFH A;  1IJ5 A;  1IRJ A;  2L98 A;  4HRG A;  2O5G A;  3FIA A;  1BT6 A;  1W7J B;  2BBN A;  1K9U A;  5FYX A;  2CNP A;  3EK8 A;  3OP0 A;  2KGR A;  1DJI A;  2Y4Q A;  1CB1 A;  1SK6 D;  2JT8 A;  1DJW A;  2KYF A;  1S3P A;  4CID A;  4I5L B;  3I5I C;  3IQO A;  1XFV O;  1DVI A;  4ORA B;  1NX3 A;  3DVM A;  4R1E A;  1B8C A;  3GK2 A;  2ZKM X;  3TDZ A;  1YUT A;  1YTZ C;  1FI6 A;  1UUS A;  1IG5 A;  4NDC A;  1M45 A;  3VGO A;  3WHU B;  1A03 A;  1K95 A;  2L50 A;  1CNP A;  3PFV A;  1UHI A;  1QTX A;  1H4B A;  1R2U A;  1S6J A;  2JUL A;  1DT7 B;  2LP3 A;  3GK1 A;  1MXE A;  4YRU A;  5HKY A;  2WCB A;  2MAZ A;  1KFU L;  3DVE A;  1JF0 A;  1OMV A;  2WC8 A;  1RRO A;  1K90 D;  1XFU O;  1ODB A;  1AJ5 A;  1LXF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...