2L0PA

Solution structure of human apo-s100a1 protein by nmr spectroscopy
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords S100 calcium binding protein A1
publication title Solution NMR structure and dynamics of human apo-S100A1 protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l0pA00
3JVTC 3TUYB 2JQ6A 2V53A 3NSIA 2H2KA 3PN7B 3EKHA 1MXLC 1TN4A 2Q4UA 2BECA 1BR4B 2Y4QA 2ZRTA 2OS8C 1SBJA 1JFJA 1S26D 1C7WA 1QXPA 2BL0C 3A8RA 2E6WA 1H8BA 3FIAA 1JFKA 1B8RA 1RFJA 3OB2B 1SKTA 3SG7A 3K21A 5ER5A 1WRLA 2KYCA 4MZLA 1FF1A 1YUUA 2WOSA 1AK8A 3KPXA 4USLA 4DRWA 4YI9A 1NX0A 5HKZA 4CFQA 1A75B 2LUCA 3DVJA 1NCYA 2JXLA 1LA3A 1SCMC 1J7RA 2EC6B 2K2AA 2KDHA 2KI4B 1DGUA 1OMRA 4GGFA 4N1FA 2KQYA 4C0KA 3TS5C 1XVJA 1MXEA 1SK6D 3SIAA 2M3WA 3BXKA 1QTXA 2Q91A 1F4QA 3I5FB 3BUXB 4JWQA 1J7PA 4A4BA 1NX1A 1K9KA 4PE7A 1F54A 1OOJA 1C7VA 1XFYO 2K7OA 2JT0A 2LLTA 3VROA 4OV2A 3M0WA 3HX4A 3LK1A 1UHNA 3I5IC 4TNCA 2QPTA 3EVRA 1S6IA 4FTGA 2ZKMX 2H61A 4I5JA 1LXFC 1S3PA 2L51A 3IF7A 1XK4C 1XFZO 3KF9A 1NWDA 3GOFA 3PN7C 1N2DA 1M46A 1WLZA 5J3XA 1DTLA 2WCFA 1X02A 3SJSA 2M1UA 1NIWA 5DKNA 4M2QA 3MSEB 2G9BA 2LLSA 5K89A 1SL9A 2ZFDA 5DKRA 1YURA 2CBLA 3O2PA 1PK0D 5D69A 1LINA 1V1GA 3CZTX 1XO5A 1DJIA 1RROA 2NLNA 3AKBA 4CPVA 2LC5A 1XFXO 2M97A 3ICBA 2P6BB 2WORA 1J1EA 2WC8A 2L50A 4C0LA 1J7QA 3WXAA 1SPYA 2I7AA 5HLOA 2KI4C 3BUNB 4N5XA 2LVVA 1NYAA 2WCEA 1JC2A 2HF5A 3BUMB 3CTNA 4HRGA 1QJTA 1OE9B 1TTXA 1K2HA 1UWOA 2F8PA 1KFXS 4M2OA 4PE0A 1Y1XA 1LKJA 2PSRA 1IJ5A 5KTYA 1GQMA 4ZCVA 1NP8A 5AERA 3GK4X 1DF0B 5AFPA 2LAPA 1CDMA 1UHKA 1S6JA 1GJYA 1KK8C 1M63B 4JPZB 2M7NA 2L2EA 3SIBA 4E68A 2GGMA 1BR1B 1ZFSA 3AAKA 2KNEA 1BODA 4DIRA 4MSPA 1SY9A 1TNXA 2BBMA 1S1EA 3I5HC 3OHMB 3AKAA 2LHIA 2BKHB 3RLZA 2LM5A 5F6TA 2PVBA 4NQGA 2PRUA 1KK7Z 1B7TY 5HYDA 1FPWA 1AJ5A 1FW4A 1K95A 2K8MB 1BLQA 1F55A 1BOCA 1NX2A 5GQQC 2JT3A 1NPQA 3QRXA 3NXAA 1KQVA 1DMOA 1CLMA 2JPTA 1R6PA 2LCPA 4GPLB 4MVFA 1Q80A 2BCAA 2KHNA 1J55A 4YGCB 3JTDC 4ETOA 4YGBB 2CTNA 4MZKA 3D10A 2OPOA 1AVSA 1WRZA 4AQJA 4NDCA 2MHHA 3PALA 4I5KA 2MBXA 4OVNF 1QV0A 1UURA 3FWBA 5FYXA 2JU0A 3LK0A 3GK1A 2AMIA 5IBWA 2LVJA 1HQVA 2K0JA 2D8NA 2KBIA 3EK8A 1XK4A 2L4HA 3TDUA 2IS9A 2A4JA 3WHTB 1SR6C 1YR5A 4I5LB 1LA0A 1YRTB 1S36A 1CDPA 2KAYA 2KI6D 2WNDA 1J1DA 1WDCB 3FWCA 1DGVA 1YX7A 1NCZA 4XYNA 2TN4A 1XFVO 1QLKA 1B9AA 1ALWA 3LCPC 3LL8B 1KFUS 1KK7Y 1QVIZ 2FOTA 2MLFC 2ZNEA 3PLFB 4DUQA 1QASA 2MJWB 4OCIA 1TIZA 1BMOA 1ZMZA 2L4IA 1CDLA 5KSZA 2JNFA 3BUOB 1OZSA 1IRJA 1CFDA 3DD4A 4MBEA 1KWOB 2EHBA 4GFTA 2M29A 2KYFA 1TCOB 2MRDA 4YRUA 1SCVA 3DVMA 1E8AA 1MQ1A 2L0PA 2KBMA 2NCPA 3VGOA 1KQMB 2CXJA 2FCDA 1CFCA 1WDCC 1PALA 1CLBA 5CPVA 2GGZA 1PVAA 3TUYC 4CLNA 1JF2A 1VRKA 1DJHA 3EK4A 5I2LA 1SNLA 5CSNA 2LLUA 1BU3A 2KFGA 3IQQA 1DJXA 1TNQA 5CSJA 1EJ3A 3FS7A 1K9UA 1UP5A 3ZNIA 1SL8A 4MZJA 1XA5A 2JOJA 1OQPA 4PHMA 2I18A 4OKHA 1WRKA 2LVIA 2LMVA 1K9PA 1DJZA 2ZN8A 4AQIA 2LHLA 4A4CA 4YGAA 1IWQA 3OX6A 4FQOA 1A03A 1IGVA 1K93D 4ORAB 4IL1A 4CIDA 4I5NB 1F8HA 1QVIY 4QJ4B 2HQ8A 5JJGA 1B7TZ 3CR2A 4WQ3A 2EC6C 1QX5B 1Y1UA 3BOWA 3CLNA 5AEQA 1W7IB 4GGFC 1CMGA 1QV1A 1TNPA 1D1OA 3GK2A 1M39A 2MA2A 2AUCA 1OMDA 4Q04A 3I5FC 5HKWA 1TOPA 3F45A 1CFPA 1N65A 1B8CA 3O4YA 1S6CA 2LNKA 1B1GA 2ZN9A 1V1FA 5HKYA 2COLB 1KWOC 3VRRA 4HREE 1CLLA 1L2OB 3DF0A 1SRAA 5I2OA 1K94A 2ISDA 1KCYA 1CB1A 2LE9B 1UHIA 1DJGA 2I2RE 5ER4X 3H4SE 1EG4A 2FJUB 4DCKA 2OS8B 4XJKB 1YVLA 2JZIA 2BCBA 1G8IA 3EK7A 1DJYA 1NX3A 1SMGA 2LANA 2WCBA 1FI5A 4PALA 1KFXL 1N0YA 1TRFA 2L98A 1KSOA 1JF0A 3EVVA 1IQ5A 1CNPA 3SG3A 2KGRA 4MRYA 1A29A 3HCMA 3A4UB 1MR8A 3SG4A 5JOLA 1ZACA 1BF5A 1J7OA 2HQWA 1MHOA 1SCMB 2GV5A 2OTGB 3CR4X 1YX8A 2LP3A 1WLMA 4MRXA 5AANA 5HLVA 3I5GB 2K7BA 2SASA 1CKKA 1DJWA 4P5OE 3IQOA 2F2OA 2SCPA 1S5GZ 2LMUA 1U5IA 3D0YA 2Y5IA 1QLSA 4PE1A 2BKIB 4DS7A 4L9MA 2M9GA 4C0JA 1CTRA 4BY4A 2DOQA 1PRWA 1OMVA 1RTP1 3DVEA 1CM4A 1UHHA 2JWWA 2JT8A 3BUWB 1Y1AA 3OB1B 2KFFA 2KGBC 4ZCUA 3SG6A 2BE6A 2KOTA 3EVUA 1RJVA 2PASA 1L2OC 1LVCD 1IKUA 3KHEA 4QJ5B 3CR5X 4MLWA 4WRIA 1RWYA 3EKJA 5KU1A 4GUKA 4PHKA 4R1EA 2R2IA 1WY9A 4WQ2A 1L7ZA 3LLEA 1JSAA 3O78A 2MLEC 1A2XA 1Y6WA 3RM1A 3VRPA 1QIWA 2B1UA 1KSMA 1EL4A 3CS1A 2M8UA 1H4BA 1GGZA 1B8LA 2E30A 1AUIB 1K96A 1XFWO 5I2QA 3DVKA 1ODBA 1MF8B 2FCEA 2O5GA 1A75A 2JC2A 1S5GY 2LMTA 4PDZA 3WNXB 5AXIA 2OTGC 3NSOA 4PCWA 1NUBA 1PSRA 1PVBA 3SG5A 3I5GC 2ZNDA 1A4PA 1EG3A 1K8UA 1KFUL 1QS7A 3PATA 3OX5A 1CDNA 5CSIA 5G08A 2K7CA 2KI6C 2LV7A 2MAZA 1QIVA 2CCMA 4HSZA 1BG1A 1F71A 2M49B 2PALA 1QATA 1CFFA 2LP2A 1G33A 2AAOA 4YGEB 4PHNA 1W7JB 5DKQA 2K2FA 2O60A 1UHJA 2LVKA 2KSPA 1NCXA 5BPJA 1SL7A 2BE4A 1QX2A 1C07A 3TDIA 3O6BA 3CWGA 1KK8B 5I8NA 1EH2A 2LUXA 3KO0A 3TZ1A 2HPSA 3VRNA 1SW8A 2NCOA 1FI6A 3NSKA 2EGDA 2F2PA 4UPGA 1MUXA 4NDDA 2M7LA 3WHUB 4D1EA 4HRHA 1IH0A 2RGIA 1FBVA 2L5XB 3BOWB 4GBAA 4YBHB 1SYMA 3I5HB 3KEVA 1AP4A 1ALVA 1BT6A 1F4OA 1HT9A 1YTZC 2KQ6A 2M1KB 1IQ3A 4AOMA 3AAJA 2CNPA 1Y0VH 2BBNA 2BCXA 3OP0A 2QACA 2CT9A 1EXRA 2JULA 3PM8A 1G4YR 2F3ZA 4GNKB 1DT7B 2JRFA 3NSLA 5D7FA 3JVTB 2KFHA 3DF0B 1F70A 2G2BA 4YGDB 2F3YA 1KQMC 1DVIA 1CMFA 3JTDB 4U8DA 4QJ3B 3BQ3A 1JWDA 2H61C 4F0ZB 1R2UA 1PSBA 4YI8A 1XFUO 2I94A 4BY5A 5B8IB 1CM1A 1NSHA 1XYDA 2BL0B 4PHJA 2JTTA 1JUOA 1AJ4A 3PSRA 1QX7A 3E3RA 3BYAA 3C1VA 1YVHA 3TDZA 2M0RA 2PMYA 1JBAA 2HETA 1ZOTB 4GAOA 1B47A 4M2PA 1DF0A 2JXCA 4CFRA 1RECA 1IG5A 1RK9A 1SR6B 2NXQA 4P2YB 4XJKA 1UUSA 2JTZA 4N1GA 1MWNA 4OR9B 1BJFA 5TNCA 3TS5B 1M45A 1K90D 1ZUZA 2K61A 2ZRSA 3ZWHA 4ICBA 3PFVA 1TCFA 1M31A 4MN0A 3SG2A 4NDBA 1YUSA 2KAVA 2Y1NA 5PALA 1U5IB 2F33A 3VRQA 2K7DA 3D0YB 4ORCB 1TNWA 4ORBB 2KAXA 1OSAA 1YUTA 2VRGA 4GGNA 1GGWA 3CGAA 3I5IB 4MEWA 1OZOA 2NZ0A 1IJ6A 4JQ0D 1AHRA 4PE4A 1B4CA 5CSFA 1PULA 2Y1MA 2JNXA 1YRUB
chains in the Genus database with same CATH superfamily
3JVTC 3TUYB 2JQ6A 2V53A 3NSIA 2H2KA 3S0FA 3PN7B 3EKHA 1MXLC 1TN4A 2Q4UA 2BECA 1BR4B 2Y4QA 2ZRTA 2OS8C 1SBJA 1JFJA 1S26D 1C7WA 1QXPA 2BL0C 3A8RA 1OW4A 2E6WA 1H8BA 5FI7A 3FIAA 1JFKA 1B8RA 1RFJA 3OB2B 1SKTA 3SG7A 2JPOA 3K21A 1WRLA 2KYCA 4MZLA 1Z2CB 5ER5A 2K60A 1YUUA 1FF1A 2WOSA 1AK8A 3BFHA 3KPXA 4USLA 4DRWA 4YI9A 1NX0A 5HKZA 4CFQA 1A75B 2LUCA 3DVJA 1NCYA 2JXLA 1LA3A 1SCMC 1J7RA 2EC6B 2K2AA 2KDHA 2KI4B 1DGUA 1OMRA 4GGFA 4N1FA 2KQYA 3EG5B 4C0KA 3TS5C 1XVJA 1MXEA 1SK6D 3SIAA 2M3WA 3BXKA 1LS8A 1QTXA 2Q91A 1F4QA 3I5FB 3BUXB 4JWQA 1J7PA 4A4BA 1NX1A 1K9KA 4PE7A 2KPHA 1F54A 2QEVA 1OOJA 1C7VA 1XFYO 2K7OA 2JT0A 2LLTA 3VROA 2L5YA 4OV2A 3M0WA 3HX4A 3LK1A 1UHNA 3I5IC 4TNCA 2QPTA 3EVRA 4INXA 1S6IA 4FTGA 2ZKMX 2H61A 4I5JA 3L4AA 1LXFC 1S3PA 2L51A 3IF7A 1XK4C 1XFZO 4PT1A 3KF9A 1NWDA 3D76A 3GOFA 3PN7C 1N2DA 1M46A 1WLZA 3CDNA 5J3XA 1DTLA 2GTEA 2WCFA 1X02A 3SJSA 2M1UA 1NIWA 4FQTA 4M2QA 3MSEB 2G9BA 5DKNA 2LLSA 5K89A 1SL9A 2ZFDA 4KYNA 5DKRA 1YURA 2CBLA 3O2PA 1PK0D 5D69A 1LINA 1V1GA 3CZTX 1XO5A 1DJIA 2L2CA 1RROA 2NLNA 3AKBA 4CPVA 2LC5A 1XFXO 2M97A 3ICBA 2P6BB 2WORA 1J1EA 2WC8A 2L50A 4C0LA 1J7QA 3WXAA 1SPYA 2I7AA 5HLOA 2KI4C 3BUNB 4N5XA 3S0AA 2LVVA 1NYAA 2PQLA 2WCEA 1JC2A 2HF5A 2WCMA 3S0EA 3BUMB 3CTNA 4HRGA 1QJTA 1OE9B 3B88A 1TTXA 1K2HA 1UWOA 2F8PA 3R1VA 3D78A 1KFXS 4M2OA 4PE0A 1Y1XA 1LKJA 2PSRA 1IJ5A 5KTYA 2WC5A 1GQMA 4ZCVA 3S0DA 3SS3A 1NP8A 5AERA 3GK4X 1DF0B 5AFPA 3Q8IA 2LAPA 1CDMA 1UHKA 1S6JA 1GJYA 1KK8C 1M63B 4JPZB 2M7NA 2L2EA 3DY9A 3SIBA 4E68A 2GGMA 1BR1B 3DXLA 1ZFSA 3AAKA 2KNEA 1BODA 5FI6A 3OGNA 4MSPA 1SY9A 3L4LA 4DIRA 1TNXA 2BBMA 1S1EA 3I5HC 3OHMB 3AKAA 2LHIA 2BKHB 3RLZA 2LM5A 5F6TA 2PVBA 4NQGA 2PRUA 1KK7Z 1B7TY 5HYDA 1FPWA 1AJ5A 1FW4A 1K95A 2K8MB 1BLQA 1F55A 3L47A 1BOCA 1NX2A 3R1OA 5GQQC 2JT3A 1NPQA 3QRXA 3NXAA 1KQVA 1DMOA 1CLMA 2JPTA 1R6PA 2LCPA 4GPLB 4MVFA 1Q80A 2BCAA 2KHNA 1TWOA 1DEKA 3RZSA 1J55A 4YGCB 3JTDC 4ETOA 4YGBB 2CTNA 4MZKA 3D10A 2OPOA 1AVSA 1WRZA 4AQJA 4NDCA 2MHHA 3PALA 4I5KA 3FE9A 2MBXA 4OVNF 1QV0A 2WC6A 2KLDA 1UURA 3FWBA 5FYXA 2JU0A 3LK0A 3GK1A 3CABA 2AMIA 5IBWA 1C3YA 2LVJA 1HQVA 2K0JA 2D8NA 2KBIA 3EK8A 1XK4A 2L4HA 3TDUA 2WCJA 2IS9A 2A4JA 3WHTB 1SR6C 1YR5A 4I5LB 1LA0A 1YRTB 4IJ7A 1S36A 1CDPA 2KAYA 2KI6D 2WNDA 1J1DA 1WDCB 3FWCA 1DGVA 1YX7A 1NCZA 4XYNA 5I94A 2QEHA 2TN4A 1XFVO 1QLKA 1B9AA 1ALWA 3LCPC 3LL8B 1KFUS 1KK7Y 1QVIZ 2FOTA 2MLFC 2ZNEA 3PLFB 4DUQA 1QASA 2MJWB 4OCIA 1TIZA 1BMOA 1ZMZA 2L4IA 1CDLA 3S0GA 5KSZA 2JNFA 3BUOB 1OZSA 1IRJA 1CFDA 3DD4A 5HL1A 4MBEA 1KWOB 2EHBA 4GFTA 2M29A 2KYFA 1TCOB 2MRDA 4YRUA 1SCVA 3DVMA 5DICA 1E8AA 1MQ1A 1SSEB 2L0PA 2KBMA 2NCPA 3VGOA 1KQMB 2CXJA 3R72A 2FCDA 1CFCA 1WDCC 1PALA 1CLBA 5CPVA 2GGZA 1PVAA 3TUYC 4CLNA 4OZDA 1JF2A 1VRKA 1DC1A 1DJHA 3EK4A 5I2LA 2P70A 1SNLA 5CSNA 2LLUA 3DZTA 1BU3A 2KFGA 3IQQA 1DJXA 2YGUA 1TNQA 5CSJA 1EJ3A 3FS7A 1K9UA 1UP5A 3ZNIA 1SL8A 2QDIA 4MZJA 1XA5A 2JOJA 1OQPA 4PHMA 2I18A 4OKHA 1WRKA 2LVIA 2LMVA 1K9PA 1DJZA 3B6XA 2ZN8A 4AQIA 2LHLA 3CZ1A 4A4CA 4YGAA 1IWQA 3OX6A 4FQOA 1A03A 1IGVA 1K93D 4ORAB 1C3ZA 4IL1A 4I5NB 4CIDA 1F8HA 1QVIY 4QJ4B 2HQ8A 5JJGA 1B7TZ 3CR2A 3UNWA 2PYQA 4WQ3A 3CYZA 2EC6C 1QX5B 1Y1UA 3BOWA 3CLNA 5AEQA 1W7IB 4GGFC 1CMGA 1QV1A 1TNPA 1D1OA 3GK2A 1M39A 2MA2A 2AUCA 1OMDA 4Q04A 3I5FC 5HKWA 1TOPA 3F45A 3NHIA 1CFPA 1N65A 2KLEA 1B8CA 3O4YA 3FE6A 1S6CA 2LNKA 1B1GA 2ZN9A 1V1FA 5HKYA 2COLB 1KWOC 3VRRA 4HREE 1CLLA 1L2OB 3DF0A 1SRAA 5I2OA 1K94A 2ISDA 1KCYA 1CB1A 2LE9B 3DYEA 1UHIA 1DJGA 2I2RE 5ER4X 3H4SE 1OOHA 1EG4A 2FJUB 4DCKA 1IIOA 2OS8B 4XJKB 1YVLA 2JZIA 2BCBA 1G8IA 3EK7A 1DJYA 1NX3A 1SMGA 2LANA 2WCBA 1FI5A 4PALA 1KFXL 1N0YA 1TRFA 3IVTA 2H8VA 3V2LA 2L98A 1KSOA 1JF0A 3EVVA 1IQ5A 3NHTA 1CNPA 3SG3A 2KGRA 4MRYA 1A29A 3HCMA 3A4UB 1MR8A 3SG4A 5JOLA 1W9ZA 1ZACA 2WCKA 1BF5A 1J7OA 2HQWA 1MHOA 1SCMB 2GV5A 1P28A 2OTGB 1YX8A 2LP3A 3CR4X 1WLMA 4MRXA 5AANA 5HLVA 3I5GB 2K7BA 2SASA 2QEOA 1CKKA 1TUZA 1DJWA 4P5OE 3IQOA 2F2OA 2SCPA 1S5GZ 2LMUA 1U5IA 3D0YA 2Y5IA 2P71A 1QLSA 4PE1A 2BKIB 4DS7A 4L9MA 1TUJA 3PJIA 2M9GA 4C0JA 1CTRA 1OOGA 4BY4A 2DOQA 1PRWA 1OMVA 1RTP1 3DVEA 1XFRA 1CM4A 1UHHA 2JT8A 2JWWA 3BUWB 1Y1AA 3OB1B 2KFFA 2KGBC 4ZCUA 3SG6A 2BE6A 2KOTA 3EVUA 1RJVA 2PASA 1L2OC 1LVCD 1IKUA 3KHEA 4QJ5B 3CR5X 4MLWA 4WRIA 1RWYA 3EKJA 5KU1A 4GUKA 4PHKA 4R1EA 2R2IA 1WY9A 3CZ0A 4WQ2A 1L7ZA 3LLEA 1JSAA 3O78A 2MLEC 4JD9A 1A2XA 1Y6WA 3RM1A 1ORGA 4JKTA 3VRPA 1QIWA 2B1UA 1KSMA 1EL4A 3CS1A 2M8UA 3SS5A 1GGZA 1H4BA 1B8LA 2E30A 1AUIB 1K96A 1XFWO 3D73A 5I2QA 3DVKA 1ODBA 1MF8B 1T14A 2FCEA 2O5GA 1A75A 2JC2A 1S5GY 2LMTA 4PDZA 3WNXB 5AXIA 2OTGC 3NSOA 4PCWA 1NUBA 1PSRA 1PVBA 3SG5A 3I5GC 2ZNDA 1A4PA 1EG3A 1K8UA 1KFUL 1QS7A 3B7AA 3PATA 3OX5A 1CDNA 5CSIA 5G08A 2K7CA 2KI6C 2LV7A 2MAZA 1QIVA 2CCMA 4HSZA 3SS4A 1BG1A 2M49B 2PALA 3CZ2A 1F71A 1QATA 1CFFA 2LP2A 1G33A 2AAOA 4YGEB 4PHNA 1W7JB 1GM0A 5DKQA 2K2FA 2O60A 1UHJA 2LVKA 2KSPA 1NCXA 5BPJA 1SL7A 2BE4A 1QX2A 3BFBA 1C07A 3TDIA 3O6BA 3CWGA 1KK8B 5I8NA 1EH2A 2LUXA 3KO0A 3TZ1A 2HPSA 1OOIX 3VRNA 1SW8A 2NCOA 3D74A 1FI6A 4INWA 3NSKA 2EGDA 2F2PA 4UPGA 1MUXA 4NDDA 2M7LA 3WHUB 2QEBA 4D1EA 4HRHA 1IH0A 2RGIA 1FBVA 2L5XB 3BOWB 4GBAA 4YBHB 1SYMA 3I5HB 3KEVA 1AP4A 2BAPA 1ALVA 1BT6A 1F4OA 1HT9A 1YTZC 2KQ6A 2M1KB 1IQ3A 4AOMA 3AAJA 1DQEA 2CNPA 1Y0VH 2BBNA 2BCXA 3K1EA 2WCLA 3D75A 3B86A 3OP0A 1Z4HA 2QACA 5EL2A 3VB1A 3FE8A 2CT9A 1EXRA 2JULA 3PM8A 3OBVA 1G4YR 2F3ZA 4GNKB 1DT7B 2JRFA 3NSLA 5D7FA 3JVTB 2KFHA 3DF0B 1F70A 2G2BA 4YGDB 2F3YA 1KQMC 3NGVA 1DVIA 3QMEA 3JTDB 4U8DA 1CMFA 4QJ3B 3BQ3A 1JWDA 2H61C 4F0ZB 1R2UA 1PSBA 4YI8A 1XFUO 2I94A 4BY5A 5B8IB 1CM1A 1QWVA 1NSHA 1XYDA 2BL0B 3BJHA 4PHJA 3PM2A 2JTTA 1JUOA 1AJ4A 1DELA 2ERBA 3BFAA 3PSRA 1QX7A 3E3RA 3BYAA 3C1VA 1YVHA 3TDZA 2M0RA 2PMYA 1JBAA 2HETA 1ZOTB 4GAOA 1B47A 4M2PA 1DF0A 2JXCA 5D3OA 4CFRA 1RECA 1IG5A 1RK9A 3N7HA 1SR6B 1OOFA 2NXQA 4P2YB 4XJKA 1UUSA 2JTZA 4N1GA 1MWNA 4OR9B 1BJFA 3D77A 5FI2A 1M45A 1K90D 1ZUZA 2K61A 5TNCA 2ZRSA 3S0BA 3TS5B 3ZWHA 4ICBA 3UO9A 3PFVA 1TCFA 1M31A 4MN0A 4F7FA 3SG2A 4NDBA 1YUSA 2KAVA 2Y1NA 5PALA 1U5IB 2F33A 3VRQA 2K7DA 3D0YB 3B87A 4ORCB 1TNWA 4ORBB 2KAXA 1OSAA 1YUTA 2VRGA 4GGNA 3O4XA 3CGAA 1GGWA 2WCHA 3I5IB 4MEWA 1OZOA 2BNXA 2FJYA 2NZ0A 1IJ6A 4JQ0D 1AHRA 4PE4A 3R1PA 1B4CA 5CSFA 1PULA 2Y1MA 2JNXA 1YRUB
chains in the Genus database with same CATH topology
3JVTC 3TUYB 2JQ6A 2V53A 3NSIA 2H2KA 3PN7B 3EKHA 1MXLC 1TN4A 2Q4UA 2BECA 1BR4B 2Y4QA 2ZRTA 2OS8C 1SBJA 1JFJA 1S26D 1C7WA 1QXPA 2BL0C 3A8RA 2E6WA 1H8BA 3FIAA 1JFKA 1B8RA 1RFJA 3OB2B 1SKTA 3SG7A 3K21A 5ER5A 1WRLA 2KYCA 4MZLA 1FF1A 1YUUA 2WOSA 1AK8A 3KPXA 4USLA 4DRWA 4YI9A 1NX0A 5HKZA 4CFQA 1A75B 2LUCA 3DVJA 1NCYA 2JXLA 1LA3A 1SCMC 1J7RA 2EC6B 2K2AA 2KDHA 2KI4B 1DGUA 1OMRA 4GGFA 4N1FA 2KQYA 4C0KA 3TS5C 1XVJA 1MXEA 1SK6D 3SIAA 2M3WA 3BXKA 1QTXA 2Q91A 1F4QA 3I5FB 3BUXB 4JWQA 1J7PA 4A4BA 1NX1A 1K9KA 4PE7A 1F54A 1OOJA 1C7VA 1XFYO 2K7OA 2JT0A 2LLTA 3VROA 4OV2A 3M0WA 3HX4A 3LK1A 1UHNA 3I5IC 4TNCA 2QPTA 3EVRA 1S6IA 4FTGA 2ZKMX 2H61A 4I5JA 1LXFC 1S3PA 2L51A 3IF7A 1XK4C 1XFZO 3KF9A 1NWDA 3GOFA 3PN7C 1N2DA 1M46A 1WLZA 5J3XA 1DTLA 2WCFA 1X02A 3SJSA 2M1UA 1NIWA 5DKNA 4M2QA 3MSEB 2G9BA 2LLSA 5K89A 1SL9A 2ZFDA 5DKRA 1YURA 2CBLA 3O2PA 1PK0D 5D69A 1LINA 1V1GA 3CZTX 1XO5A 1DJIA 1RROA 2NLNA 3AKBA 4CPVA 2LC5A 1XFXO 2M97A 3ICBA 2P6BB 2WORA 1J1EA 2WC8A 2L50A 4C0LA 1J7QA 3WXAA 1SPYA 2I7AA 5HLOA 2KI4C 3BUNB 4N5XA 2LVVA 1NYAA 2WCEA 1JC2A 2HF5A 3BUMB 3CTNA 4HRGA 1QJTA 1OE9B 1TTXA 1K2HA 1UWOA 2F8PA 1KFXS 4M2OA 4PE0A 1Y1XA 1LKJA 2PSRA 1IJ5A 5KTYA 1GQMA 4ZCVA 1NP8A 5AERA 3GK4X 1DF0B 5AFPA 2LAPA 1CDMA 1UHKA 1S6JA 1GJYA 1KK8C 1M63B 4JPZB 2M7NA 2L2EA 3SIBA 4E68A 2GGMA 1BR1B 1ZFSA 3AAKA 2KNEA 1BODA 4DIRA 4MSPA 1SY9A 1TNXA 2BBMA 1S1EA 3I5HC 3OHMB 3AKAA 2LHIA 2BKHB 3RLZA 2LM5A 5F6TA 2PVBA 4NQGA 2PRUA 1KK7Z 1B7TY 5HYDA 1FPWA 1AJ5A 1FW4A 1K95A 2K8MB 1BLQA 1F55A 1BOCA 1NX2A 5GQQC 2JT3A 1NPQA 3QRXA 3NXAA 1KQVA 1DMOA 1CLMA 2JPTA 1R6PA 2LCPA 4GPLB 4MVFA 1Q80A 2BCAA 2KHNA 1J55A 4YGCB 3JTDC 4ETOA 4YGBB 2CTNA 4MZKA 3D10A 2OPOA 1AVSA 1WRZA 4AQJA 4NDCA 2MHHA 3PALA 4I5KA 2MBXA 4OVNF 1QV0A 1UURA 3FWBA 5FYXA 2JU0A 3LK0A 3GK1A 2AMIA 5IBWA 2LVJA 1HQVA 2K0JA 2D8NA 2KBIA 3EK8A 1XK4A 2L4HA 3TDUA 2IS9A 2A4JA 3WHTB 1SR6C 1YR5A 4I5LB 1LA0A 1YRTB 1S36A 1CDPA 2KAYA 2KI6D 2WNDA 1J1DA 1WDCB 3FWCA 1DGVA 1YX7A 1NCZA 4XYNA 2TN4A 1XFVO 1QLKA 1B9AA 1ALWA 3LCPC 3LL8B 1KFUS 1KK7Y 1QVIZ 2FOTA 2MLFC 2ZNEA 3PLFB 4DUQA 1QASA 2MJWB 4OCIA 1TIZA 1BMOA 1ZMZA 2L4IA 1CDLA 5KSZA 2JNFA 3BUOB 1OZSA 1IRJA 1CFDA 3DD4A 4MBEA 1KWOB 2EHBA 4GFTA 2M29A 2KYFA 1TCOB 2MRDA 4YRUA 1SCVA 3DVMA 1E8AA 1MQ1A 2L0PA 2KBMA 2NCPA 3VGOA 1KQMB 2CXJA 2FCDA 1CFCA 1WDCC 1PALA 1CLBA 5CPVA 2GGZA 1PVAA 3TUYC 4CLNA 1JF2A 1VRKA 1DJHA 3EK4A 5I2LA 1SNLA 5CSNA 2LLUA 1BU3A 2KFGA 3IQQA 1DJXA 1TNQA 5CSJA 1EJ3A 3FS7A 1K9UA 1UP5A 3ZNIA 1SL8A 4MZJA 1XA5A 2JOJA 1OQPA 4PHMA 2I18A 4OKHA 1WRKA 2LVIA 2LMVA 1K9PA 1DJZA 2ZN8A 4AQIA 2LHLA 4A4CA 4YGAA 1IWQA 3OX6A 4FQOA 1A03A 1IGVA 1K93D 4ORAB 4IL1A 4CIDA 4I5NB 1F8HA 1QVIY 4QJ4B 2HQ8A 5JJGA 1B7TZ 3CR2A 4WQ3A 2EC6C 1QX5B 1Y1UA 3BOWA 3CLNA 5AEQA 1W7IB 4GGFC 1CMGA 1QV1A 1TNPA 1D1OA 3GK2A 1M39A 2MA2A 2AUCA 1OMDA 4Q04A 3I5FC 5HKWA 1TOPA 3F45A 1CFPA 1N65A 1B8CA 3O4YA 1S6CA 2LNKA 1B1GA 2ZN9A 1V1FA 5HKYA 2COLB 1KWOC 3VRRA 4HREE 1CLLA 1L2OB 3DF0A 1SRAA 5I2OA 1K94A 2ISDA 1KCYA 1CB1A 2LE9B 1UHIA 1DJGA 2I2RE 5ER4X 3H4SE 1EG4A 2FJUB 4DCKA 2OS8B 4XJKB 1YVLA 2JZIA 2BCBA 1G8IA 3EK7A 1DJYA 1NX3A 1SMGA 2LANA 2WCBA 1FI5A 4PALA 1KFXL 1N0YA 1TRFA 2L98A 1KSOA 1JF0A 3EVVA 1IQ5A 1CNPA 3SG3A 2KGRA 4MRYA 1A29A 3HCMA 3A4UB 1MR8A 3SG4A 5JOLA 1ZACA 1BF5A 1J7OA 2HQWA 1MHOA 1SCMB 2GV5A 2OTGB 3CR4X 1YX8A 2LP3A 1WLMA 4MRXA 5AANA 5HLVA 3I5GB 2K7BA 2SASA 1CKKA 1DJWA 4P5OE 3IQOA 2F2OA 2SCPA 1S5GZ 2LMUA 1U5IA 3D0YA 2Y5IA 1QLSA 4PE1A 2BKIB 4DS7A 4L9MA 2M9GA 4C0JA 1CTRA 4BY4A 2DOQA 1PRWA 1OMVA 1RTP1 3DVEA 1CM4A 1UHHA 2JWWA 2JT8A 3BUWB 1Y1AA 3OB1B 2KFFA 2KGBC 4ZCUA 3SG6A 2BE6A 2KOTA 3EVUA 1RJVA 2PASA 1L2OC 1LVCD 1IKUA 3KHEA 4QJ5B 3CR5X 4MLWA 4WRIA 1RWYA 3EKJA 5KU1A 4GUKA 4PHKA 4R1EA 2R2IA 1WY9A 4WQ2A 1L7ZA 3LLEA 1JSAA 3O78A 2MLEC 1A2XA 1Y6WA 3RM1A 3VRPA 1QIWA 2B1UA 1KSMA 1EL4A 3CS1A 2M8UA 1H4BA 1GGZA 1B8LA 2E30A 1AUIB 1K96A 1XFWO 5I2QA 3DVKA 1ODBA 1MF8B 2FCEA 2O5GA 1A75A 2JC2A 1S5GY 2LMTA 4PDZA 3WNXB 5AXIA 2OTGC 3NSOA 4PCWA 1NUBA 1PSRA 1PVBA 3SG5A 3I5GC 2ZNDA 1A4PA 1EG3A 1K8UA 1KFUL 1QS7A 3PATA 3OX5A 1CDNA 5CSIA 5G08A 2K7CA 2KI6C 2LV7A 2MAZA 1QIVA 2CCMA 4HSZA 1BG1A 1F71A 2M49B 2PALA 1QATA 1CFFA 2LP2A 1G33A 2AAOA 4YGEB 4PHNA 1W7JB 5DKQA 2K2FA 2O60A 1UHJA 2LVKA 2KSPA 1NCXA 5BPJA 1SL7A 2BE4A 1QX2A 1C07A 3TDIA 3O6BA 3CWGA 1KK8B 5I8NA 1EH2A 2LUXA 3KO0A 3TZ1A 2HPSA 3VRNA 1SW8A 2NCOA 1FI6A 3NSKA 2EGDA 2F2PA 4UPGA 1MUXA 4NDDA 2M7LA 3WHUB 4D1EA 4HRHA 1IH0A 2RGIA 1FBVA 2L5XB 3BOWB 4GBAA 4YBHB 1SYMA 3I5HB 3KEVA 1AP4A 1ALVA 1BT6A 1F4OA 1HT9A 1YTZC 2KQ6A 2M1KB 1IQ3A 4AOMA 3AAJA 2CNPA 1Y0VH 2BBNA 2BCXA 3OP0A 2QACA 2CT9A 1EXRA 2JULA 3PM8A 1G4YR 2F3ZA 4GNKB 1DT7B 2JRFA 3NSLA 5D7FA 3JVTB 2KFHA 3DF0B 1F70A 2G2BA 4YGDB 2F3YA 1KQMC 1DVIA 1CMFA 3JTDB 4U8DA 4QJ3B 3BQ3A 1JWDA 2H61C 4F0ZB 1R2UA 1PSBA 4YI8A 1XFUO 2I94A 4BY5A 5B8IB 1CM1A 1NSHA 1XYDA 2BL0B 4PHJA 2JTTA 1JUOA 1AJ4A 3PSRA 1QX7A 3E3RA 3BYAA 3C1VA 1YVHA 3TDZA 2M0RA 2PMYA 1JBAA 2HETA 1ZOTB 4GAOA 1B47A 4M2PA 1DF0A 2JXCA 4CFRA 1RECA 1IG5A 1RK9A 1SR6B 2NXQA 4P2YB 4XJKA 1UUSA 2JTZA 4N1GA 1MWNA 4OR9B 1BJFA 5TNCA 3TS5B 1M45A 1K90D 1ZUZA 2K61A 2ZRSA 3ZWHA 4ICBA 3PFVA 1TCFA 1M31A 4MN0A 3SG2A 4NDBA 1YUSA 2KAVA 2Y1NA 5PALA 1U5IB 2F33A 3VRQA 2K7DA 3D0YB 4ORCB 1TNWA 4ORBB 2KAXA 1OSAA 1YUTA 2VRGA 4GGNA 1GGWA 3CGAA 3I5IB 4MEWA 1OZOA 2NZ0A 1IJ6A 4JQ0D 1AHRA 4PE4A 1B4CA 5CSFA 1PULA 2Y1MA 2JNXA 1YRUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVT C;  3TUY B;  2JQ6 A;  2V53 A;  3NSI A;  2H2K A;  3PN7 B;  3EKH A;  1MXL C;  1TN4 A;  2Q4U A;  2BEC A;  1BR4 B;  2Y4Q A;  2ZRT A;  2OS8 C;  1SBJ A;  1JFJ A;  1S26 D;  1C7W A;  1QXP A;  2BL0 C;  3A8R A;  2E6W A;  1H8B A;  3FIA A;  1JFK A;  1B8R A;  1RFJ A;  3OB2 B;  1SKT A;  3SG7 A;  3K21 A;  5ER5 A;  1WRL A;  2KYC A;  4MZL A;  1FF1 A;  1YUU A;  2WOS A;  1AK8 A;  3KPX A;  4USL A;  4DRW A;  4YI9 A;  1NX0 A;  5HKZ A;  4CFQ A;  1A75 B;  2LUC A;  3DVJ A;  1NCY A;  2JXL A;  1LA3 A;  1SCM C;  1J7R A;  2EC6 B;  2K2A A;  2KDH A;  2KI4 B;  1DGU A;  1OMR A;  4GGF A;  4N1F A;  2KQY A;  4C0K A;  3TS5 C;  1XVJ A;  1MXE A;  1SK6 D;  3SIA A;  2M3W A;  3BXK A;  1QTX A;  2Q91 A;  1F4Q A;  3I5F B;  3BUX B;  4JWQ A;  1J7P A;  4A4B A;  1NX1 A;  1K9K A;  4PE7 A;  1F54 A;  1OOJ A;  1C7V A;  1XFY O;  2K7O A;  2JT0 A;  2LLT A;  3VRO A;  4OV2 A;  3M0W A;  3HX4 A;  3LK1 A;  1UHN A;  3I5I C;  4TNC A;  2QPT A;  3EVR A;  1S6I A;  4FTG A;  2ZKM X;  2H61 A;  4I5J A;  1LXF C;  1S3P A;  2L51 A;  3IF7 A;  1XK4 C;  1XFZ O;  3KF9 A;  1NWD A;  3GOF A;  3PN7 C;  1N2D A;  1M46 A;  1WLZ A;  5J3X A;  1DTL A;  2WCF A;  1X02 A;  3SJS A;  2M1U A;  1NIW A;  5DKN A;  4M2Q A;  3MSE B;  2G9B A;  2LLS A;  5K89 A;  1SL9 A;  2ZFD A;  5DKR A;  1YUR A;  2CBL A;  3O2P A;  1PK0 D;  5D69 A;  1LIN A;  1V1G A;  3CZT X;  1XO5 A;  1DJI A;  1RRO A;  2NLN A;  3AKB A;  4CPV A;  2LC5 A;  1XFX O;  2M97 A;  3ICB A;  2P6B B;  2WOR A;  1J1E A;  2WC8 A;  2L50 A;  4C0L A;  1J7Q A;  3WXA A;  1SPY A;  2I7A A;  5HLO A;  2KI4 C;  3BUN B;  4N5X A;  2LVV A;  1NYA A;  2WCE A;  1JC2 A;  2HF5 A;  3BUM B;  3CTN A;  4HRG A;  1QJT A;  1OE9 B;  1TTX A;  1K2H A;  1UWO A;  2F8P A;  1KFX S;  4M2O A;  4PE0 A;  1Y1X A;  1LKJ A;  2PSR A;  1IJ5 A;  5KTY A;  1GQM A;  4ZCV A;  1NP8 A;  5AER A;  3GK4 X;  1DF0 B;  5AFP A;  2LAP A;  1CDM A;  1UHK A;  1S6J A;  1GJY A;  1KK8 C;  1M63 B;  4JPZ B;  2M7N A;  2L2E A;  3SIB A;  4E68 A;  2GGM A;  1BR1 B;  1ZFS A;  3AAK A;  2KNE A;  1BOD A;  4DIR A;  4MSP A;  1SY9 A;  1TNX A;  2BBM A;  1S1E A;  3I5H C;  3OHM B;  3AKA A;  2LHI A;  2BKH B;  3RLZ A;  2LM5 A;  5F6T A;  2PVB A;  4NQG A;  2PRU A;  1KK7 Z;  1B7T Y;  5HYD A;  1FPW A;  1AJ5 A;  1FW4 A;  1K95 A;  2K8M B;  1BLQ A;  1F55 A;  1BOC A;  1NX2 A;  5GQQ C;  2JT3 A;  1NPQ A;  3QRX A;  3NXA A;  1KQV A;  1DMO A;  1CLM A;  2JPT A;  1R6P A;  2LCP A;  4GPL B;  4MVF A;  1Q80 A;  2BCA A;  2KHN A;  1J55 A;  4YGC B;  3JTD C;  4ETO A;  4YGB B;  2CTN A;  4MZK A;  3D10 A;  2OPO A;  1AVS A;  1WRZ A;  4AQJ A;  4NDC A;  2MHH A;  3PAL A;  4I5K A;  2MBX A;  4OVN F;  1QV0 A;  1UUR A;  3FWB A;  5FYX A;  2JU0 A;  3LK0 A;  3GK1 A;  2AMI A;  5IBW A;  2LVJ A;  1HQV A;  2K0J A;  2D8N A;  2KBI A;  3EK8 A;  1XK4 A;  2L4H A;  3TDU A;  2IS9 A;  2A4J A;  3WHT B;  1SR6 C;  1YR5 A;  4I5L B;  1LA0 A;  1YRT B;  1S36 A;  1CDP A;  2KAY A;  2KI6 D;  2WND A;  1J1D A;  1WDC B;  3FWC A;  1DGV A;  1YX7 A;  1NCZ A;  4XYN A;  2TN4 A;  1XFV O;  1QLK A;  1B9A A;  1ALW A;  3LCP C;  3LL8 B;  1KFU S;  1KK7 Y;  1QVI Z;  2FOT A;  2MLF C;  2ZNE A;  3PLF B;  4DUQ A;  1QAS A;  2MJW B;  4OCI A;  1TIZ A;  1BMO A;  1ZMZ A;  2L4I A;  1CDL A;  5KSZ A;  2JNF A;  3BUO B;  1OZS A;  1IRJ A;  1CFD A;  3DD4 A;  4MBE A;  1KWO B;  2EHB A;  4GFT A;  2M29 A;  2KYF A;  1TCO B;  2MRD A;  4YRU A;  1SCV A;  3DVM A;  1E8A A;  1MQ1 A;  2L0P A;  2KBM A;  2NCP A;  3VGO A;  1KQM B;  2CXJ A;  2FCD A;  1CFC A;  1WDC C;  1PAL A;  1CLB A;  5CPV A;  2GGZ A;  1PVA A;  3TUY C;  4CLN A;  1JF2 A;  1VRK A;  1DJH A;  3EK4 A;  5I2L A;  1SNL A;  5CSN A;  2LLU A;  1BU3 A;  2KFG A;  3IQQ A;  1DJX A;  1TNQ A;  5CSJ A;  1EJ3 A;  3FS7 A;  1K9U A;  1UP5 A;  3ZNI A;  1SL8 A;  4MZJ A;  1XA5 A;  2JOJ A;  1OQP A;  4PHM A;  2I18 A;  4OKH A;  1WRK A;  2LVI A;  2LMV A;  1K9P A;  1DJZ A;  2ZN8 A;  4AQI A;  2LHL A;  4A4C A;  4YGA A;  1IWQ A;  3OX6 A;  4FQO A;  1A03 A;  1IGV A;  1K93 D;  4ORA B;  4IL1 A;  4CID A;  4I5N B;  1F8H A;  1QVI Y;  4QJ4 B;  2HQ8 A;  5JJG A;  1B7T Z;  3CR2 A;  4WQ3 A;  2EC6 C;  1QX5 B;  1Y1U A;  3BOW A;  3CLN A;  5AEQ A;  1W7I B;  4GGF C;  1CMG A;  1QV1 A;  1TNP A;  1D1O A;  3GK2 A;  1M39 A;  2MA2 A;  2AUC A;  1OMD A;  4Q04 A;  3I5F C;  5HKW A;  1TOP A;  3F45 A;  1CFP A;  1N65 A;  1B8C A;  3O4Y A;  1S6C A;  2LNK A;  1B1G A;  2ZN9 A;  1V1F A;  5HKY A;  2COL B;  1KWO C;  3VRR A;  4HRE E;  1CLL A;  1L2O B;  3DF0 A;  1SRA A;  5I2O A;  1K94 A;  2ISD A;  1KCY A;  1CB1 A;  2LE9 B;  1UHI A;  1DJG A;  2I2R E;  5ER4 X;  3H4S E;  1EG4 A;  2FJU B;  4DCK A;  2OS8 B;  4XJK B;  1YVL A;  2JZI A;  2BCB A;  1G8I A;  3EK7 A;  1DJY A;  1NX3 A;  1SMG A;  2LAN A;  2WCB A;  1FI5 A;  4PAL A;  1KFX L;  1N0Y A;  1TRF A;  2L98 A;  1KSO A;  1JF0 A;  3EVV A;  1IQ5 A;  1CNP A;  3SG3 A;  2KGR A;  4MRY A;  1A29 A;  3HCM A;  3A4U B;  1MR8 A;  3SG4 A;  5JOL A;  1ZAC A;  1BF5 A;  1J7O A;  2HQW A;  1MHO A;  1SCM B;  2GV5 A;  2OTG B;  3CR4 X;  1YX8 A;  2LP3 A;  1WLM A;  4MRX A;  5AAN A;  5HLV A;  3I5G B;  2K7B A;  2SAS A;  1CKK A;  1DJW A;  4P5O E;  3IQO A;  2F2O A;  2SCP A;  1S5G Z;  2LMU A;  1U5I A;  3D0Y A;  2Y5I A;  1QLS A;  4PE1 A;  2BKI B;  4DS7 A;  4L9M A;  2M9G A;  4C0J A;  1CTR A;  4BY4 A;  2DOQ A;  1PRW A;  1OMV A;  1RTP 1;  3DVE A;  1CM4 A;  1UHH A;  2JWW A;  2JT8 A;  3BUW B;  1Y1A A;  3OB1 B;  2KFF A;  2KGB C;  4ZCU A;  3SG6 A;  2BE6 A;  2KOT A;  3EVU A;  1RJV A;  2PAS A;  1L2O C;  1LVC D;  1IKU A;  3KHE A;  4QJ5 B;  3CR5 X;  4MLW A;  4WRI A;  1RWY A;  3EKJ A;  5KU1 A;  4GUK A;  4PHK A;  4R1E A;  2R2I A;  1WY9 A;  4WQ2 A;  1L7Z A;  3LLE A;  1JSA A;  3O78 A;  2MLE C;  1A2X A;  1Y6W A;  3RM1 A;  3VRP A;  1QIW A;  2B1U A;  1KSM A;  1EL4 A;  3CS1 A;  2M8U A;  1H4B A;  1GGZ A;  1B8L A;  2E30 A;  1AUI B;  1K96 A;  1XFW O;  5I2Q A;  3DVK A;  1ODB A;  1MF8 B;  2FCE A;  2O5G A;  1A75 A;  2JC2 A;  1S5G Y;  2LMT A;  4PDZ A;  3WNX B;  5AXI A;  2OTG C;  3NSO A;  4PCW A;  1NUB A;  1PSR A;  1PVB A;  3SG5 A;  3I5G C;  2ZND A;  1A4P A;  1EG3 A;  1K8U A;  1KFU L;  1QS7 A;  3PAT A;  3OX5 A;  1CDN A;  5CSI A;  5G08 A;  2K7C A;  2KI6 C;  2LV7 A;  2MAZ A;  1QIV A;  2CCM A;  4HSZ A;  1BG1 A;  1F71 A;  2M49 B;  2PAL A;  1QAT A;  1CFF A;  2LP2 A;  1G33 A;  2AAO A;  4YGE B;  4PHN A;  1W7J B;  5DKQ A;  2K2F A;  2O60 A;  1UHJ A;  2LVK A;  2KSP A;  1NCX A;  5BPJ A;  1SL7 A;  2BE4 A;  1QX2 A;  1C07 A;  3TDI A;  3O6B A;  3CWG A;  1KK8 B;  5I8N A;  1EH2 A;  2LUX A;  3KO0 A;  3TZ1 A;  2HPS A;  3VRN A;  1SW8 A;  2NCO A;  1FI6 A;  3NSK A;  2EGD A;  2F2P A;  4UPG A;  1MUX A;  4NDD A;  2M7L A;  3WHU B;  4D1E A;  4HRH A;  1IH0 A;  2RGI A;  1FBV A;  2L5X B;  3BOW B;  4GBA A;  4YBH B;  1SYM A;  3I5H B;  3KEV A;  1AP4 A;  1ALV A;  1BT6 A;  1F4O A;  1HT9 A;  1YTZ C;  2KQ6 A;  2M1K B;  1IQ3 A;  4AOM A;  3AAJ A;  2CNP A;  1Y0V H;  2BBN A;  2BCX A;  3OP0 A;  2QAC A;  2CT9 A;  1EXR A;  2JUL A;  3PM8 A;  1G4Y R;  2F3Z A;  4GNK B;  1DT7 B;  2JRF A;  3NSL A;  5D7F A;  3JVT B;  2KFH A;  3DF0 B;  1F70 A;  2G2B A;  4YGD B;  2F3Y A;  1KQM C;  1DVI A;  1CMF A;  3JTD B;  4U8D A;  4QJ3 B;  3BQ3 A;  1JWD A;  2H61 C;  4F0Z B;  1R2U A;  1PSB A;  4YI8 A;  1XFU O;  2I94 A;  4BY5 A;  5B8I B;  1CM1 A;  1NSH A;  1XYD A;  2BL0 B;  4PHJ A;  2JTT A;  1JUO A;  1AJ4 A;  3PSR A;  1QX7 A;  3E3R A;  3BYA A;  3C1V A;  1YVH A;  3TDZ A;  2M0R A;  2PMY A;  1JBA A;  2HET A;  1ZOT B;  4GAO A;  1B47 A;  4M2P A;  1DF0 A;  2JXC A;  4CFR A;  1REC A;  1IG5 A;  1RK9 A;  1SR6 B;  2NXQ A;  4P2Y B;  4XJK A;  1UUS A;  2JTZ A;  4N1G A;  1MWN A;  4OR9 B;  1BJF A;  5TNC A;  3TS5 B;  1M45 A;  1K90 D;  1ZUZ A;  2K61 A;  2ZRS A;  3ZWH A;  4ICB A;  3PFV A;  1TCF A;  1M31 A;  4MN0 A;  3SG2 A;  4NDB A;  1YUS A;  2KAV A;  2Y1N A;  5PAL A;  1U5I B;  2F33 A;  3VRQ A;  2K7D A;  3D0Y B;  4ORC B;  1TNW A;  4ORB B;  2KAX A;  1OSA A;  1YUT A;  2VRG A;  4GGN A;  1GGW A;  3CGA A;  3I5I B;  4MEW A;  1OZO A;  2NZ0 A;  1IJ6 A;  4JQ0 D;  1AHR A;  4PE4 A;  1B4C A;  5CSF A;  1PUL A;  2Y1M A;  2JNX A;  1YRU B; 
#chains in the Genus database with same CATH topology
 3JVT C;  3TUY B;  2JQ6 A;  2V53 A;  3NSI A;  2H2K A;  3S0F A;  3PN7 B;  3EKH A;  1MXL C;  1TN4 A;  2Q4U A;  2BEC A;  1BR4 B;  2Y4Q A;  2ZRT A;  2OS8 C;  1SBJ A;  1JFJ A;  1S26 D;  1C7W A;  1QXP A;  2BL0 C;  3A8R A;  1OW4 A;  2E6W A;  1H8B A;  5FI7 A;  3FIA A;  1JFK A;  1B8R A;  1RFJ A;  3OB2 B;  1SKT A;  3SG7 A;  2JPO A;  3K21 A;  1WRL A;  2KYC A;  4MZL A;  1Z2C B;  5ER5 A;  2K60 A;  1YUU A;  1FF1 A;  2WOS A;  1AK8 A;  3BFH A;  3KPX A;  4USL A;  4DRW A;  4YI9 A;  1NX0 A;  5HKZ A;  4CFQ A;  1A75 B;  2LUC A;  3DVJ A;  1NCY A;  2JXL A;  1LA3 A;  1SCM C;  1J7R A;  2EC6 B;  2K2A A;  2KDH A;  2KI4 B;  1DGU A;  1OMR A;  4GGF A;  4N1F A;  2KQY A;  3EG5 B;  4C0K A;  3TS5 C;  1XVJ A;  1MXE A;  1SK6 D;  3SIA A;  2M3W A;  3BXK A;  1LS8 A;  1QTX A;  2Q91 A;  1F4Q A;  3I5F B;  3BUX B;  4JWQ A;  1J7P A;  4A4B A;  1NX1 A;  1K9K A;  4PE7 A;  2KPH A;  1F54 A;  2QEV A;  1OOJ A;  1C7V A;  1XFY O;  2K7O A;  2JT0 A;  2LLT A;  3VRO A;  2L5Y A;  4OV2 A;  3M0W A;  3HX4 A;  3LK1 A;  1UHN A;  3I5I C;  4TNC A;  2QPT A;  3EVR A;  4INX A;  1S6I A;  4FTG A;  2ZKM X;  2H61 A;  4I5J A;  3L4A A;  1LXF C;  1S3P A;  2L51 A;  3IF7 A;  1XK4 C;  1XFZ O;  4PT1 A;  3KF9 A;  1NWD A;  3D76 A;  3GOF A;  3PN7 C;  1N2D A;  1M46 A;  1WLZ A;  3CDN A;  5J3X A;  1DTL A;  2GTE A;  2WCF A;  1X02 A;  3SJS A;  2M1U A;  1NIW A;  4FQT A;  4M2Q A;  3MSE B;  2G9B A;  5DKN A;  2LLS A;  5K89 A;  1SL9 A;  2ZFD A;  4KYN A;  5DKR A;  1YUR A;  2CBL A;  3O2P A;  1PK0 D;  5D69 A;  1LIN A;  1V1G A;  3CZT X;  1XO5 A;  1DJI A;  2L2C A;  1RRO A;  2NLN A;  3AKB A;  4CPV A;  2LC5 A;  1XFX O;  2M97 A;  3ICB A;  2P6B B;  2WOR A;  1J1E A;  2WC8 A;  2L50 A;  4C0L A;  1J7Q A;  3WXA A;  1SPY A;  2I7A A;  5HLO A;  2KI4 C;  3BUN B;  4N5X A;  3S0A A;  2LVV A;  1NYA A;  2PQL A;  2WCE A;  1JC2 A;  2HF5 A;  2WCM A;  3S0E A;  3BUM B;  3CTN A;  4HRG A;  1QJT A;  1OE9 B;  3B88 A;  1TTX A;  1K2H A;  1UWO A;  2F8P A;  3R1V A;  3D78 A;  1KFX S;  4M2O A;  4PE0 A;  1Y1X A;  1LKJ A;  2PSR A;  1IJ5 A;  5KTY A;  2WC5 A;  1GQM A;  4ZCV A;  3S0D A;  3SS3 A;  1NP8 A;  5AER A;  3GK4 X;  1DF0 B;  5AFP A;  3Q8I A;  2LAP A;  1CDM A;  1UHK A;  1S6J A;  1GJY A;  1KK8 C;  1M63 B;  4JPZ B;  2M7N A;  2L2E A;  3DY9 A;  3SIB A;  4E68 A;  2GGM A;  1BR1 B;  3DXL A;  1ZFS A;  3AAK A;  2KNE A;  1BOD A;  5FI6 A;  3OGN A;  4MSP A;  1SY9 A;  3L4L A;  4DIR A;  1TNX A;  2BBM A;  1S1E A;  3I5H C;  3OHM B;  3AKA A;  2LHI A;  2BKH B;  3RLZ A;  2LM5 A;  5F6T A;  2PVB A;  4NQG A;  2PRU A;  1KK7 Z;  1B7T Y;  5HYD A;  1FPW A;  1AJ5 A;  1FW4 A;  1K95 A;  2K8M B;  1BLQ A;  1F55 A;  3L47 A;  1BOC A;  1NX2 A;  3R1O A;  5GQQ C;  2JT3 A;  1NPQ A;  3QRX A;  3NXA A;  1KQV A;  1DMO A;  1CLM A;  2JPT A;  1R6P A;  2LCP A;  4GPL B;  4MVF A;  1Q80 A;  2BCA A;  2KHN A;  1TWO A;  1DEK A;  3RZS A;  1J55 A;  4YGC B;  3JTD C;  4ETO A;  4YGB B;  2CTN A;  4MZK A;  3D10 A;  2OPO A;  1AVS A;  1WRZ A;  4AQJ A;  4NDC A;  2MHH A;  3PAL A;  4I5K A;  3FE9 A;  2MBX A;  4OVN F;  1QV0 A;  2WC6 A;  2KLD A;  1UUR A;  3FWB A;  5FYX A;  2JU0 A;  3LK0 A;  3GK1 A;  3CAB A;  2AMI A;  5IBW A;  1C3Y A;  2LVJ A;  1HQV A;  2K0J A;  2D8N A;  2KBI A;  3EK8 A;  1XK4 A;  2L4H A;  3TDU A;  2WCJ A;  2IS9 A;  2A4J A;  3WHT B;  1SR6 C;  1YR5 A;  4I5L B;  1LA0 A;  1YRT B;  4IJ7 A;  1S36 A;  1CDP A;  2KAY A;  2KI6 D;  2WND A;  1J1D A;  1WDC B;  3FWC A;  1DGV A;  1YX7 A;  1NCZ A;  4XYN A;  5I94 A;  2QEH A;  2TN4 A;  1XFV O;  1QLK A;  1B9A A;  1ALW A;  3LCP C;  3LL8 B;  1KFU S;  1KK7 Y;  1QVI Z;  2FOT A;  2MLF C;  2ZNE A;  3PLF B;  4DUQ A;  1QAS A;  2MJW B;  4OCI A;  1TIZ A;  1BMO A;  1ZMZ A;  2L4I A;  1CDL A;  3S0G A;  5KSZ A;  2JNF A;  3BUO B;  1OZS A;  1IRJ A;  1CFD A;  3DD4 A;  5HL1 A;  4MBE A;  1KWO B;  2EHB A;  4GFT A;  2M29 A;  2KYF A;  1TCO B;  2MRD A;  4YRU A;  1SCV A;  3DVM A;  5DIC A;  1E8A A;  1MQ1 A;  1SSE B;  2L0P A;  2KBM A;  2NCP A;  3VGO A;  1KQM B;  2CXJ A;  3R72 A;  2FCD A;  1CFC A;  1WDC C;  1PAL A;  1CLB A;  5CPV A;  2GGZ A;  1PVA A;  3TUY C;  4CLN A;  4OZD A;  1JF2 A;  1VRK A;  1DC1 A;  1DJH A;  3EK4 A;  5I2L A;  2P70 A;  1SNL A;  5CSN A;  2LLU A;  3DZT A;  1BU3 A;  2KFG A;  3IQQ A;  1DJX A;  2YGU A;  1TNQ A;  5CSJ A;  1EJ3 A;  3FS7 A;  1K9U A;  1UP5 A;  3ZNI A;  1SL8 A;  2QDI A;  4MZJ A;  1XA5 A;  2JOJ A;  1OQP A;  4PHM A;  2I18 A;  4OKH A;  1WRK A;  2LVI A;  2LMV A;  1K9P A;  1DJZ A;  3B6X A;  2ZN8 A;  4AQI A;  2LHL A;  3CZ1 A;  4A4C A;  4YGA A;  1IWQ A;  3OX6 A;  4FQO A;  1A03 A;  1IGV A;  1K93 D;  4ORA B;  1C3Z A;  4IL1 A;  4I5N B;  4CID A;  1F8H A;  1QVI Y;  4QJ4 B;  2HQ8 A;  5JJG A;  1B7T Z;  3CR2 A;  3UNW A;  2PYQ A;  4WQ3 A;  3CYZ A;  2EC6 C;  1QX5 B;  1Y1U A;  3BOW A;  3CLN A;  5AEQ A;  1W7I B;  4GGF C;  1CMG A;  1QV1 A;  1TNP A;  1D1O A;  3GK2 A;  1M39 A;  2MA2 A;  2AUC A;  1OMD A;  4Q04 A;  3I5F C;  5HKW A;  1TOP A;  3F45 A;  3NHI A;  1CFP A;  1N65 A;  2KLE A;  1B8C A;  3O4Y A;  3FE6 A;  1S6C A;  2LNK A;  1B1G A;  2ZN9 A;  1V1F A;  5HKY A;  2COL B;  1KWO C;  3VRR A;  4HRE E;  1CLL A;  1L2O B;  3DF0 A;  1SRA A;  5I2O A;  1K94 A;  2ISD A;  1KCY A;  1CB1 A;  2LE9 B;  3DYE A;  1UHI A;  1DJG A;  2I2R E;  5ER4 X;  3H4S E;  1OOH A;  1EG4 A;  2FJU B;  4DCK A;  1IIO A;  2OS8 B;  4XJK B;  1YVL A;  2JZI A;  2BCB A;  1G8I A;  3EK7 A;  1DJY A;  1NX3 A;  1SMG A;  2LAN A;  2WCB A;  1FI5 A;  4PAL A;  1KFX L;  1N0Y A;  1TRF A;  3IVT A;  2H8V A;  3V2L A;  2L98 A;  1KSO A;  1JF0 A;  3EVV A;  1IQ5 A;  3NHT A;  1CNP A;  3SG3 A;  2KGR A;  4MRY A;  1A29 A;  3HCM A;  3A4U B;  1MR8 A;  3SG4 A;  5JOL A;  1W9Z A;  1ZAC A;  2WCK A;  1BF5 A;  1J7O A;  2HQW A;  1MHO A;  1SCM B;  2GV5 A;  1P28 A;  2OTG B;  1YX8 A;  2LP3 A;  3CR4 X;  1WLM A;  4MRX A;  5AAN A;  5HLV A;  3I5G B;  2K7B A;  2SAS A;  2QEO A;  1CKK A;  1TUZ A;  1DJW A;  4P5O E;  3IQO A;  2F2O A;  2SCP A;  1S5G Z;  2LMU A;  1U5I A;  3D0Y A;  2Y5I A;  2P71 A;  1QLS A;  4PE1 A;  2BKI B;  4DS7 A;  4L9M A;  1TUJ A;  3PJI A;  2M9G A;  4C0J A;  1CTR A;  1OOG A;  4BY4 A;  2DOQ A;  1PRW A;  1OMV A;  1RTP 1;  3DVE A;  1XFR A;  1CM4 A;  1UHH A;  2JT8 A;  2JWW A;  3BUW B;  1Y1A A;  3OB1 B;  2KFF A;  2KGB C;  4ZCU A;  3SG6 A;  2BE6 A;  2KOT A;  3EVU A;  1RJV A;  2PAS A;  1L2O C;  1LVC D;  1IKU A;  3KHE A;  4QJ5 B;  3CR5 X;  4MLW A;  4WRI A;  1RWY A;  3EKJ A;  5KU1 A;  4GUK A;  4PHK A;  4R1E A;  2R2I A;  1WY9 A;  3CZ0 A;  4WQ2 A;  1L7Z A;  3LLE A;  1JSA A;  3O78 A;  2MLE C;  4JD9 A;  1A2X A;  1Y6W A;  3RM1 A;  1ORG A;  4JKT A;  3VRP A;  1QIW A;  2B1U A;  1KSM A;  1EL4 A;  3CS1 A;  2M8U A;  3SS5 A;  1GGZ A;  1H4B A;  1B8L A;  2E30 A;  1AUI B;  1K96 A;  1XFW O;  3D73 A;  5I2Q A;  3DVK A;  1ODB A;  1MF8 B;  1T14 A;  2FCE A;  2O5G A;  1A75 A;  2JC2 A;  1S5G Y;  2LMT A;  4PDZ A;  3WNX B;  5AXI A;  2OTG C;  3NSO A;  4PCW A;  1NUB A;  1PSR A;  1PVB A;  3SG5 A;  3I5G C;  2ZND A;  1A4P A;  1EG3 A;  1K8U A;  1KFU L;  1QS7 A;  3B7A A;  3PAT A;  3OX5 A;  1CDN A;  5CSI A;  5G08 A;  2K7C A;  2KI6 C;  2LV7 A;  2MAZ A;  1QIV A;  2CCM A;  4HSZ A;  3SS4 A;  1BG1 A;  2M49 B;  2PAL A;  3CZ2 A;  1F71 A;  1QAT A;  1CFF A;  2LP2 A;  1G33 A;  2AAO A;  4YGE B;  4PHN A;  1W7J B;  1GM0 A;  5DKQ A;  2K2F A;  2O60 A;  1UHJ A;  2LVK A;  2KSP A;  1NCX A;  5BPJ A;  1SL7 A;  2BE4 A;  1QX2 A;  3BFB A;  1C07 A;  3TDI A;  3O6B A;  3CWG A;  1KK8 B;  5I8N A;  1EH2 A;  2LUX A;  3KO0 A;  3TZ1 A;  2HPS A;  1OOI X;  3VRN A;  1SW8 A;  2NCO A;  3D74 A;  1FI6 A;  4INW A;  3NSK A;  2EGD A;  2F2P A;  4UPG A;  1MUX A;  4NDD A;  2M7L A;  3WHU B;  2QEB A;  4D1E A;  4HRH A;  1IH0 A;  2RGI A;  1FBV A;  2L5X B;  3BOW B;  4GBA A;  4YBH B;  1SYM A;  3I5H B;  3KEV A;  1AP4 A;  2BAP A;  1ALV A;  1BT6 A;  1F4O A;  1HT9 A;  1YTZ C;  2KQ6 A;  2M1K B;  1IQ3 A;  4AOM A;  3AAJ A;  1DQE A;  2CNP A;  1Y0V H;  2BBN A;  2BCX A;  3K1E A;  2WCL A;  3D75 A;  3B86 A;  3OP0 A;  1Z4H A;  2QAC A;  5EL2 A;  3VB1 A;  3FE8 A;  2CT9 A;  1EXR A;  2JUL A;  3PM8 A;  3OBV A;  1G4Y R;  2F3Z A;  4GNK B;  1DT7 B;  2JRF A;  3NSL A;  5D7F A;  3JVT B;  2KFH A;  3DF0 B;  1F70 A;  2G2B A;  4YGD B;  2F3Y A;  1KQM C;  3NGV A;  1DVI A;  3QME A;  3JTD B;  4U8D A;  1CMF A;  4QJ3 B;  3BQ3 A;  1JWD A;  2H61 C;  4F0Z B;  1R2U A;  1PSB A;  4YI8 A;  1XFU O;  2I94 A;  4BY5 A;  5B8I B;  1CM1 A;  1QWV A;  1NSH A;  1XYD A;  2BL0 B;  3BJH A;  4PHJ A;  3PM2 A;  2JTT A;  1JUO A;  1AJ4 A;  1DEL A;  2ERB A;  3BFA A;  3PSR A;  1QX7 A;  3E3R A;  3BYA A;  3C1V A;  1YVH A;  3TDZ A;  2M0R A;  2PMY A;  1JBA A;  2HET A;  1ZOT B;  4GAO A;  1B47 A;  4M2P A;  1DF0 A;  2JXC A;  5D3O A;  4CFR A;  1REC A;  1IG5 A;  1RK9 A;  3N7H A;  1SR6 B;  1OOF A;  2NXQ A;  4P2Y B;  4XJK A;  1UUS A;  2JTZ A;  4N1G A;  1MWN A;  4OR9 B;  1BJF A;  3D77 A;  5FI2 A;  1M45 A;  1K90 D;  1ZUZ A;  2K61 A;  5TNC A;  2ZRS A;  3S0B A;  3TS5 B;  3ZWH A;  4ICB A;  3UO9 A;  3PFV A;  1TCF A;  1M31 A;  4MN0 A;  4F7F A;  3SG2 A;  4NDB A;  1YUS A;  2KAV A;  2Y1N A;  5PAL A;  1U5I B;  2F33 A;  3VRQ A;  2K7D A;  3D0Y B;  3B87 A;  4ORC B;  1TNW A;  4ORB B;  2KAX A;  1OSA A;  1YUT A;  2VRG A;  4GGN A;  3O4X A;  3CGA A;  1GGW A;  2WCH A;  3I5I B;  4MEW A;  1OZO A;  2BNX A;  2FJY A;  2NZ0 A;  1IJ6 A;  4JQ0 D;  1AHR A;  4PE4 A;  3R1P A;  1B4C A;  5CSF A;  1PUL A;  2Y1M A;  2JNX A;  1YRU B; 
#chains in the Genus database with same CATH homology
 3JVT C;  3TUY B;  2JQ6 A;  2V53 A;  3NSI A;  2H2K A;  3PN7 B;  3EKH A;  1MXL C;  1TN4 A;  2Q4U A;  2BEC A;  1BR4 B;  2Y4Q A;  2ZRT A;  2OS8 C;  1SBJ A;  1JFJ A;  1S26 D;  1C7W A;  1QXP A;  2BL0 C;  3A8R A;  2E6W A;  1H8B A;  3FIA A;  1JFK A;  1B8R A;  1RFJ A;  3OB2 B;  1SKT A;  3SG7 A;  3K21 A;  5ER5 A;  1WRL A;  2KYC A;  4MZL A;  1FF1 A;  1YUU A;  2WOS A;  1AK8 A;  3KPX A;  4USL A;  4DRW A;  4YI9 A;  1NX0 A;  5HKZ A;  4CFQ A;  1A75 B;  2LUC A;  3DVJ A;  1NCY A;  2JXL A;  1LA3 A;  1SCM C;  1J7R A;  2EC6 B;  2K2A A;  2KDH A;  2KI4 B;  1DGU A;  1OMR A;  4GGF A;  4N1F A;  2KQY A;  4C0K A;  3TS5 C;  1XVJ A;  1MXE A;  1SK6 D;  3SIA A;  2M3W A;  3BXK A;  1QTX A;  2Q91 A;  1F4Q A;  3I5F B;  3BUX B;  4JWQ A;  1J7P A;  4A4B A;  1NX1 A;  1K9K A;  4PE7 A;  1F54 A;  1OOJ A;  1C7V A;  1XFY O;  2K7O A;  2JT0 A;  2LLT A;  3VRO A;  4OV2 A;  3M0W A;  3HX4 A;  3LK1 A;  1UHN A;  3I5I C;  4TNC A;  2QPT A;  3EVR A;  1S6I A;  4FTG A;  2ZKM X;  2H61 A;  4I5J A;  1LXF C;  1S3P A;  2L51 A;  3IF7 A;  1XK4 C;  1XFZ O;  3KF9 A;  1NWD A;  3GOF A;  3PN7 C;  1N2D A;  1M46 A;  1WLZ A;  5J3X A;  1DTL A;  2WCF A;  1X02 A;  3SJS A;  2M1U A;  1NIW A;  5DKN A;  4M2Q A;  3MSE B;  2G9B A;  2LLS A;  5K89 A;  1SL9 A;  2ZFD A;  5DKR A;  1YUR A;  2CBL A;  3O2P A;  1PK0 D;  5D69 A;  1LIN A;  1V1G A;  3CZT X;  1XO5 A;  1DJI A;  1RRO A;  2NLN A;  3AKB A;  4CPV A;  2LC5 A;  1XFX O;  2M97 A;  3ICB A;  2P6B B;  2WOR A;  1J1E A;  2WC8 A;  2L50 A;  4C0L A;  1J7Q A;  3WXA A;  1SPY A;  2I7A A;  5HLO A;  2KI4 C;  3BUN B;  4N5X A;  2LVV A;  1NYA A;  2WCE A;  1JC2 A;  2HF5 A;  3BUM B;  3CTN A;  4HRG A;  1QJT A;  1OE9 B;  1TTX A;  1K2H A;  1UWO A;  2F8P A;  1KFX S;  4M2O A;  4PE0 A;  1Y1X A;  1LKJ A;  2PSR A;  1IJ5 A;  5KTY A;  1GQM A;  4ZCV A;  1NP8 A;  5AER A;  3GK4 X;  1DF0 B;  5AFP A;  2LAP A;  1CDM A;  1UHK A;  1S6J A;  1GJY A;  1KK8 C;  1M63 B;  4JPZ B;  2M7N A;  2L2E A;  3SIB A;  4E68 A;  2GGM A;  1BR1 B;  1ZFS A;  3AAK A;  2KNE A;  1BOD A;  4DIR A;  4MSP A;  1SY9 A;  1TNX A;  2BBM A;  1S1E A;  3I5H C;  3OHM B;  3AKA A;  2LHI A;  2BKH B;  3RLZ A;  2LM5 A;  5F6T A;  2PVB A;  4NQG A;  2PRU A;  1KK7 Z;  1B7T Y;  5HYD A;  1FPW A;  1AJ5 A;  1FW4 A;  1K95 A;  2K8M B;  1BLQ A;  1F55 A;  1BOC A;  1NX2 A;  5GQQ C;  2JT3 A;  1NPQ A;  3QRX A;  3NXA A;  1KQV A;  1DMO A;  1CLM A;  2JPT A;  1R6P A;  2LCP A;  4GPL B;  4MVF A;  1Q80 A;  2BCA A;  2KHN A;  1J55 A;  4YGC B;  3JTD C;  4ETO A;  4YGB B;  2CTN A;  4MZK A;  3D10 A;  2OPO A;  1AVS A;  1WRZ A;  4AQJ A;  4NDC A;  2MHH A;  3PAL A;  4I5K A;  2MBX A;  4OVN F;  1QV0 A;  1UUR A;  3FWB A;  5FYX A;  2JU0 A;  3LK0 A;  3GK1 A;  2AMI A;  5IBW A;  2LVJ A;  1HQV A;  2K0J A;  2D8N A;  2KBI A;  3EK8 A;  1XK4 A;  2L4H A;  3TDU A;  2IS9 A;  2A4J A;  3WHT B;  1SR6 C;  1YR5 A;  4I5L B;  1LA0 A;  1YRT B;  1S36 A;  1CDP A;  2KAY A;  2KI6 D;  2WND A;  1J1D A;  1WDC B;  3FWC A;  1DGV A;  1YX7 A;  1NCZ A;  4XYN A;  2TN4 A;  1XFV O;  1QLK A;  1B9A A;  1ALW A;  3LCP C;  3LL8 B;  1KFU S;  1KK7 Y;  1QVI Z;  2FOT A;  2MLF C;  2ZNE A;  3PLF B;  4DUQ A;  1QAS A;  2MJW B;  4OCI A;  1TIZ A;  1BMO A;  1ZMZ A;  2L4I A;  1CDL A;  5KSZ A;  2JNF A;  3BUO B;  1OZS A;  1IRJ A;  1CFD A;  3DD4 A;  4MBE A;  1KWO B;  2EHB A;  4GFT A;  2M29 A;  2KYF A;  1TCO B;  2MRD A;  4YRU A;  1SCV A;  3DVM A;  1E8A A;  1MQ1 A;  2L0P A;  2KBM A;  2NCP A;  3VGO A;  1KQM B;  2CXJ A;  2FCD A;  1CFC A;  1WDC C;  1PAL A;  1CLB A;  5CPV A;  2GGZ A;  1PVA A;  3TUY C;  4CLN A;  1JF2 A;  1VRK A;  1DJH A;  3EK4 A;  5I2L A;  1SNL A;  5CSN A;  2LLU A;  1BU3 A;  2KFG A;  3IQQ A;  1DJX A;  1TNQ A;  5CSJ A;  1EJ3 A;  3FS7 A;  1K9U A;  1UP5 A;  3ZNI A;  1SL8 A;  4MZJ A;  1XA5 A;  2JOJ A;  1OQP A;  4PHM A;  2I18 A;  4OKH A;  1WRK A;  2LVI A;  2LMV A;  1K9P A;  1DJZ A;  2ZN8 A;  4AQI A;  2LHL A;  4A4C A;  4YGA A;  1IWQ A;  3OX6 A;  4FQO A;  1A03 A;  1IGV A;  1K93 D;  4ORA B;  4IL1 A;  4CID A;  4I5N B;  1F8H A;  1QVI Y;  4QJ4 B;  2HQ8 A;  5JJG A;  1B7T Z;  3CR2 A;  4WQ3 A;  2EC6 C;  1QX5 B;  1Y1U A;  3BOW A;  3CLN A;  5AEQ A;  1W7I B;  4GGF C;  1CMG A;  1QV1 A;  1TNP A;  1D1O A;  3GK2 A;  1M39 A;  2MA2 A;  2AUC A;  1OMD A;  4Q04 A;  3I5F C;  5HKW A;  1TOP A;  3F45 A;  1CFP A;  1N65 A;  1B8C A;  3O4Y A;  1S6C A;  2LNK A;  1B1G A;  2ZN9 A;  1V1F A;  5HKY A;  2COL B;  1KWO C;  3VRR A;  4HRE E;  1CLL A;  1L2O B;  3DF0 A;  1SRA A;  5I2O A;  1K94 A;  2ISD A;  1KCY A;  1CB1 A;  2LE9 B;  1UHI A;  1DJG A;  2I2R E;  5ER4 X;  3H4S E;  1EG4 A;  2FJU B;  4DCK A;  2OS8 B;  4XJK B;  1YVL A;  2JZI A;  2BCB A;  1G8I A;  3EK7 A;  1DJY A;  1NX3 A;  1SMG A;  2LAN A;  2WCB A;  1FI5 A;  4PAL A;  1KFX L;  1N0Y A;  1TRF A;  2L98 A;  1KSO A;  1JF0 A;  3EVV A;  1IQ5 A;  1CNP A;  3SG3 A;  2KGR A;  4MRY A;  1A29 A;  3HCM A;  3A4U B;  1MR8 A;  3SG4 A;  5JOL A;  1ZAC A;  1BF5 A;  1J7O A;  2HQW A;  1MHO A;  1SCM B;  2GV5 A;  2OTG B;  3CR4 X;  1YX8 A;  2LP3 A;  1WLM A;  4MRX A;  5AAN A;  5HLV A;  3I5G B;  2K7B A;  2SAS A;  1CKK A;  1DJW A;  4P5O E;  3IQO A;  2F2O A;  2SCP A;  1S5G Z;  2LMU A;  1U5I A;  3D0Y A;  2Y5I A;  1QLS A;  4PE1 A;  2BKI B;  4DS7 A;  4L9M A;  2M9G A;  4C0J A;  1CTR A;  4BY4 A;  2DOQ A;  1PRW A;  1OMV A;  1RTP 1;  3DVE A;  1CM4 A;  1UHH A;  2JWW A;  2JT8 A;  3BUW B;  1Y1A A;  3OB1 B;  2KFF A;  2KGB C;  4ZCU A;  3SG6 A;  2BE6 A;  2KOT A;  3EVU A;  1RJV A;  2PAS A;  1L2O C;  1LVC D;  1IKU A;  3KHE A;  4QJ5 B;  3CR5 X;  4MLW A;  4WRI A;  1RWY A;  3EKJ A;  5KU1 A;  4GUK A;  4PHK A;  4R1E A;  2R2I A;  1WY9 A;  4WQ2 A;  1L7Z A;  3LLE A;  1JSA A;  3O78 A;  2MLE C;  1A2X A;  1Y6W A;  3RM1 A;  3VRP A;  1QIW A;  2B1U A;  1KSM A;  1EL4 A;  3CS1 A;  2M8U A;  1H4B A;  1GGZ A;  1B8L A;  2E30 A;  1AUI B;  1K96 A;  1XFW O;  5I2Q A;  3DVK A;  1ODB A;  1MF8 B;  2FCE A;  2O5G A;  1A75 A;  2JC2 A;  1S5G Y;  2LMT A;  4PDZ A;  3WNX B;  5AXI A;  2OTG C;  3NSO A;  4PCW A;  1NUB A;  1PSR A;  1PVB A;  3SG5 A;  3I5G C;  2ZND A;  1A4P A;  1EG3 A;  1K8U A;  1KFU L;  1QS7 A;  3PAT A;  3OX5 A;  1CDN A;  5CSI A;  5G08 A;  2K7C A;  2KI6 C;  2LV7 A;  2MAZ A;  1QIV A;  2CCM A;  4HSZ A;  1BG1 A;  1F71 A;  2M49 B;  2PAL A;  1QAT A;  1CFF A;  2LP2 A;  1G33 A;  2AAO A;  4YGE B;  4PHN A;  1W7J B;  5DKQ A;  2K2F A;  2O60 A;  1UHJ A;  2LVK A;  2KSP A;  1NCX A;  5BPJ A;  1SL7 A;  2BE4 A;  1QX2 A;  1C07 A;  3TDI A;  3O6B A;  3CWG A;  1KK8 B;  5I8N A;  1EH2 A;  2LUX A;  3KO0 A;  3TZ1 A;  2HPS A;  3VRN A;  1SW8 A;  2NCO A;  1FI6 A;  3NSK A;  2EGD A;  2F2P A;  4UPG A;  1MUX A;  4NDD A;  2M7L A;  3WHU B;  4D1E A;  4HRH A;  1IH0 A;  2RGI A;  1FBV A;  2L5X B;  3BOW B;  4GBA A;  4YBH B;  1SYM A;  3I5H B;  3KEV A;  1AP4 A;  1ALV A;  1BT6 A;  1F4O A;  1HT9 A;  1YTZ C;  2KQ6 A;  2M1K B;  1IQ3 A;  4AOM A;  3AAJ A;  2CNP A;  1Y0V H;  2BBN A;  2BCX A;  3OP0 A;  2QAC A;  2CT9 A;  1EXR A;  2JUL A;  3PM8 A;  1G4Y R;  2F3Z A;  4GNK B;  1DT7 B;  2JRF A;  3NSL A;  5D7F A;  3JVT B;  2KFH A;  3DF0 B;  1F70 A;  2G2B A;  4YGD B;  2F3Y A;  1KQM C;  1DVI A;  1CMF A;  3JTD B;  4U8D A;  4QJ3 B;  3BQ3 A;  1JWD A;  2H61 C;  4F0Z B;  1R2U A;  1PSB A;  4YI8 A;  1XFU O;  2I94 A;  4BY5 A;  5B8I B;  1CM1 A;  1NSH A;  1XYD A;  2BL0 B;  4PHJ A;  2JTT A;  1JUO A;  1AJ4 A;  3PSR A;  1QX7 A;  3E3R A;  3BYA A;  3C1V A;  1YVH A;  3TDZ A;  2M0R A;  2PMY A;  1JBA A;  2HET A;  1ZOT B;  4GAO A;  1B47 A;  4M2P A;  1DF0 A;  2JXC A;  4CFR A;  1REC A;  1IG5 A;  1RK9 A;  1SR6 B;  2NXQ A;  4P2Y B;  4XJK A;  1UUS A;  2JTZ A;  4N1G A;  1MWN A;  4OR9 B;  1BJF A;  5TNC A;  3TS5 B;  1M45 A;  1K90 D;  1ZUZ A;  2K61 A;  2ZRS A;  3ZWH A;  4ICB A;  3PFV A;  1TCF A;  1M31 A;  4MN0 A;  3SG2 A;  4NDB A;  1YUS A;  2KAV A;  2Y1N A;  5PAL A;  1U5I B;  2F33 A;  3VRQ A;  2K7D A;  3D0Y B;  4ORC B;  1TNW A;  4ORB B;  2KAX A;  1OSA A;  1YUT A;  2VRG A;  4GGN A;  1GGW A;  3CGA A;  3I5I B;  4MEW A;  1OZO A;  2NZ0 A;  1IJ6 A;  4JQ0 D;  1AHR A;  4PE4 A;  1B4C A;  5CSF A;  1PUL A;  2Y1M A;  2JNX A;  1YRU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...