3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
1RFJA 3CR5X 3TS5B 1XA5A 1ZACA 2M49B 5AANA 1N65A 1FF1A 2KI6D 1F71A 1R6PA 1KK7Z 4MN0A 5DKQA 1H4BA 1TNQA 1H8BA 1OMDA 1PALA 1JF0A 1KK7Y 1QATA 1DJWA 3PN7B 1TNPA 4ZCVA 2F33A 4WRIA 2L51A 3TDZA 3WNXB 3M0WA 2M1KB 2WCFA 1M39A 1J55A 2L98A 4GGNA 1JUOA 1UUSA 3TS5C 4P2YB 3SIBA 4ORCB 1SY9A 2M8UA 1QX5B 2LLSA 4YI8A 2A4JA 1CMGA 5HLVA 2LLUA 2CCMA 1IWQA 2F8PA 1QV1A 1NCYA 2MA2A 3OB1B 2BE6A 3PN7C 2ZN8A 1EG4A 1LXFC 4QJ3B 4WQ2A 1OSAA 2K7OA 3EK7A 2JPTA 1CFFA 3LK0A 1B47A 1GQMA 1S6CA 2I94A 4GAOA 4ORAB 2JT3A 4ZCUA 2JT0A 1J7PA 3E3RA 3PSRA 1U5IB 2JTTA 2LHIA 1F55A 2M97A 3VRRA 2KI4B 4OVNF 4AQIA 1WRZA 2BKHB 2K8MB 3SJSA 2HPSA 4A4CA 4C0KA 2JTZA 2L50A 3CTNA 4I5KA 4CLNA 2BE4A 1EJ3A 2LVJA 3EVUA 3BQ3A 5I2LA 2MBXA 5HYDA 5I2OA 2JXLA 2I7AA 2KGBC 1MUXA 3CWGA 1S5GZ 3EVRA 1NX3A 3DVKA 4USLA 2KI4C 1B7TY 1SL8A 1DVIA 2M7LA 1EH2A 4GGFC 1OMVA 1S5GY 1BR4B 1BG1A 3I5IB 3VRNA 2H61A 4OR9B 1QLSA 2LE9B 2WNDA 1TCOB 2K2FA 2FCDA 1RJVA 3BYAA 1MXLC 2KSPA 4QJ5B 1SBJA 5G08A 1BODA 3WHUB 3SG3A 1Y1UA 4M2OA 5AFPA 2BBMA 1F4OA 1A4PA 1XFVO 2L4IA 3BOWA 1V1GA 1YX8A 1KK8B 1DJHA 1DJZA 2LMUA 1G33A 2LHLA 1KSOA 2CTNA 2WORA 2F2PA 3DF0B 3GK4X 3I5IC 3KO0A 1J1DA 1JBAA 1SL7A 5FYXA 4DUQA 1XFZO 2JC2A 4HSZA 1KFXL 2V53A 2VRGA 1IG5A 1OOJA 2JQ6A 3FWCA 1IQ3A 2GV5A 1CDNA 2FCEA 3JVTB 3DD4A 1QASA 4M2QA 1OE9B 2BCXA 4R1EA 4BY4A 1NSHA 2LC5A 4JWQA 1D1OA 1NX1A 1CDLA 2OPOA 3KHEA 1DGUA 1XFXO 4JQ0D 1C07A 5ER5A 2KBMA 3JVTC 2O60A 3OP0A 1A03A 1YUUA 1F4QA 3EK4A 1MXEA 1CNPA 5JJGA 1UHNA 4MZJA 1JF2A 5AERA 2EC6B 1QJTA 2NCOA 1AVSA 2LAPA 1DJYA 2WCEA 1OMRA 3GK1A 1IRJA 4P5OE 1L7ZA 1LINA 5J3XA 2B1UA 3NXAA 1B8LA 1CKKA 4XJKA 1YURA 1IJ6A 1UHIA 4NDCA 1IH0A 1PVAA 1BT6A 2G9BA 1AK8A 1QS7A 1NCXA 5CSFA 1RTP1 3NSLA 3CR2A 3TZ1A 4PE0A 3TDUA 1LKJA 1N0YA 2KFHA 3JTDC 5DKRA 2KDHA 2QPTA 3SG7A 5HKYA 1B8RA 1QV0A 2K61A 3D0YB 1BU3A 4MRYA 3SG2A 1WRKA 1YUTA 1M63B 1SCMB 1SL9A 2AMIA 2Q91A 2BL0B 4MZKA 1XFYO 3BOWB 3LLEA 4PCWA 3O6BA 1J7QA 2E30A 1FBVA 1KSMA 1J7RA 4I5NB 1AJ4A 1UURA 4HRGA 3I5GC 1Y1XA 2WOSA 2AAOA 2WCBA 3O2PA 4PALA 1Y6WA 1QX7A 3PATA 4GNKB 1AHRA 2ZKMX 3OX6A 4HREE 4PE7A 2L0PA 5K89A 1DMOA 1TTXA 1KCYA 2BKIB 1SCMC 1A29A 1X02A 2LUCA 4D1EA 4DRWA 1DJIA 2BL0C 2NZ0A 2MHHA 2L4HA 2Y1MA 5I2QA 1OZOA 1DF0A 1KFXS 3AKBA 3CZTX 2M1UA 3A4UB 4Q04A 2QACA 3BXKA 3DVMA 1CLMA 1ZOTB 2JWWA 1K96A 2M29A 1HQVA 1QIVA 1NP8A 4HRHA 2FJUB 1TIZA 4FQOA 4MZLA 2LNKA 1JC2A 2JNXA 1CM1A 5AEQA 1W7JB 3QRXA 5KSZA 2LP3A 4OCIA 1G4YR 3D10A 3PLFB 2ZRTA 2LV7A 1CLLA 3CLNA 1PULA 1ZMZA 2HQ8A 2M0RA 1F8HA 2L5XB 4GFTA 1C7WA 3BUOB 3OHMB 2F2OA 1NCZA 5JOLA 4YRUA 3EVVA 1CFDA 5TNCA 1B7TZ 3MSEB 5ER4X 1TRFA 1B1GA 1L2OB 1CTRA 2JULA 5F6TA 3NSIA 1SPYA 1S6JA 1K93D 4N5XA 1DGVA 4NDDA 2KI6C 2LCPA 1NX2A 4L9MA 1B9AA 1IJ5A 4UPGA 3AAKA 2EHBA 2M9GA 3K21A 1PVBA 1NPQA 5B8IB 1K9KA 1QTXA 1J7OA 4QJ4B 4OKHA 3EKHA 1JSAA 3IQQA 3VGOA 5CPVA 2AUCA 3VRPA 1L2OC 1WRLA 1A75A 5HKZA 1FPWA 1SKTA 4PHMA 1NUBA 4PE1A 5I8NA 2GGZA 3FS7A 3ZNIA 2DOQA 1XK4C 3BUWB 1AP4A 1TNXA 2KQ6A 3SG5A 1ZUZA 3AKAA 3SIAA 1TOPA 1TNWA 1XYDA 3OB2B 4IL1A 4AQJA 1SK6D 5BPJA 1UHKA 1DF0B 2L2EA 3TUYC 5D7FA 1ZFSA 2CNPA 3EKJA 2ZRSA 2M7NA 1MF8B 4GUKA 1BMOA 1PSBA 2KFFA 2ZNEA 4CFQA 2KYFA 1K95A 1M46A 2P6BB 2Y5IA 4DIRA 1EL4A 2ZN9A 3GK2A 3KPXA 1KWOB 1M45A 3HX4A 1QXPA 3NSOA 2LVKA 1WDCB 2JZIA 1QVIZ 4PDZA 1XFWO 2PMYA 2RGIA 4YGEB 1QVIY 4CPVA 3TDIA 2LANA 3JTDB 5KTYA 1KFUS 1GGZA 1MHOA 1IGVA 2CXJA 2LVIA 1OZSA 1SMGA 1V1FA 4MSPA 1C7VA 1KWOC 1EG3A 1QIWA 2KYCA 1WDCC 2SCPA 2MJWB 3VRQA 2HF5A 3ICBA 2LLTA 3EK8A 4WQ3A 1CLBA 5HKWA 3I5GB 2KAXA 1K94A 3IF7A 4NDBA 1CB1A 3BUXB 1ALWA 3IQOA 1GJYA 1U5IA 5CSJA 1E8AA 1MWNA 5IBWA 4YGCB 2NLNA 4GGFA 1VRKA 2JRFA 1K9UA 2K2AA 5KU1A 1QLKA 1LA3A 2MLFC 1TCFA 4XYNA 2H61C 1S26D 1JFJA 3WHTB 4MEWA 1J1EA 3HCMA 1JWDA 3CR4X 1RECA 3CGAA 1K8UA 3I5HB 2OTGB 3PALA 2BCBA 3I5FC 1NIWA 2CT9A 4CIDA 3C1VA 1DT7B 5HLOA 4DCKA 2LM5A 1CFCA 1UHHA 2KGRA 2EGDA 2MLEC 1SYMA 4PHNA 3OX5A 4PHJA 1BLQA 1CDPA 4ICBA 2K7DA 1HT9A 2NXQA 4C0JA 2SASA 4N1GA 2F3YA 3ZWHA 2PSRA 2TN4A 3I5HC 2OTGC 2OS8B 3KEVA 1SR6B 1S3PA 2K7CA 3PM8A 3NSKA 2COLB 2JNFA 1YRUB 2MAZA 1WY9A 2JU0A 1AUIB 2I2RE 2JXCA 3DF0A 3GOFA 3H4SE 3PFVA 1FI5A 4MRXA 5D69A 2K0JA 1UHJA 1KFUL 1N2DA 1ODBA 5DKNA 1RWYA 1RK9A 2KOTA 1AJ5A 1NWDA 1BF5A 3O78A 1XFUO 2FOTA 2OS8C 4XJKB 3BUMB 3VROA 1SR6C 4AOMA 1UP5A 1K9PA 1MR8A 1KQMB 4YGBB 5AXIA 1PRWA 2PVBA 3BUNB 4MLWA 1K90D 4YBHB 1A2XA 4A4BA 1XO5A 1YVHA 3FIAA 4YGAA 4F0ZB 2PASA 2MRDA 1LA0A 1K2HA 4MVFA 1WLMA 1F70A 1XVJA 4C0LA 2ZFDA 4I5JA 1KQMC 3DVJA 1DTLA 1OQPA 1BR1B 1PK0D 3TUYB 1UWOA 2KAVA 4NQGA 2KHNA 1CFPA 1B8CA 4BY5A 1CM4A 3DVEA 3AAJA 1EXRA 2PRUA 1CMFA 1QX2A 1B4CA 3WXAA 4ETOA 4GPLB 1W7IB 5CSNA 2K7BA 1MQ1A 1TN4A 2LUXA 1JFKA 2R2IA 1SRAA 1IQ5A 2LP2A 1M31A 2KFGA 3D0YA 2NCPA 4JPZB 4CFRA 1NX0A 5CSIA 4PHKA 3SG4A 1NYAA 2IS9A 4OV2A 2F3ZA 2O5GA 2ISDA 1SNLA 3KF9A 2LVVA 2Y4QA 4I5LB 2HQWA 4M2PA 2Y1NA 1Y0VH 1S36A 2LMTA 1IKUA 1YR5A 2E6WA 3A8RA 4YGDB 2KQYA 1R2UA 2H2KA 2M3WA 2WC8A 2KNEA 3LCPC 3O4YA 5GQQC 4YI9A 1GGWA 1KQVA 1YRTB 3RLZA 1KK8C 2KBIA 2LMVA 5PALA 1ALVA 1FI6A 1DJXA 2D8NA 2CBLA 1YUSA 1Q80A 1G8IA 1LVCD 2ZNDA 3FWBA 4DS7A 1S6IA 1FW4A 1YX7A 2Q4UA 1DJGA 1CDMA 2KAYA 3F45A 4E68A 4ORBB 1WLZA 3CS1A 2GGMA 4FTGA 1Y1AA 2BECA 2G2BA 1SW8A 3I5FB 1SCVA 4N1FA 1A75B 4GBAA 1S1EA 2BCAA 1PSRA 4TNCA 3RM1A 2HETA 4MBEA 2JOJA 2PALA 4PE4A 3SG6A 2I18A 3LK1A 1BOCA 4U8DA 2EC6C 2BBNA 1RROA 2JT8A 3LL8B 1F54A 1YVLA 1YTZC 1BJFA 1XK4A
chains in the Genus database with same CATH superfamily
1RFJA 3CR5X 3TS5B 3PJIA 1XA5A 1ZACA 2M49B 5AANA 1N65A 3L4LA 2KI6D 1FF1A 1F71A 1R6PA 1KK7Z 2L2CA 4MN0A 5DKQA 1H4BA 3EG5B 1TNQA 1H8BA 1OMDA 1PALA 1JF0A 1KK7Y 1QATA 3D75A 1DJWA 3PN7B 1TNPA 3PM2A 2F33A 4WRIA 4ZCVA 2L51A 1DEKA 3TDZA 3M0WA 2M1KB 2WCFA 1M39A 3WNXB 1J55A 2L98A 4GGNA 1JUOA 1UUSA 3TS5C 4P2YB 3SIBA 4ORCB 1SY9A 2M8UA 1QX5B 2LLSA 4YI8A 2A4JA 1CMGA 5HLVA 2LLUA 2CCMA 1IWQA 2F8PA 1QV1A 1NCYA 2MA2A 3OB1B 2BE6A 3PN7C 2ZN8A 1EG4A 1LXFC 4QJ3B 4WQ2A 1OSAA 4PT1A 2K7OA 3EK7A 2BNXA 2JPTA 1CFFA 3LK0A 1B47A 1GQMA 1S6CA 2I94A 4GAOA 4ORAB 2JT3A 4ZCUA 2JT0A 2FJYA 1J7PA 3E3RA 3PSRA 1U5IB 2JTTA 2LHIA 1F55A 2M97A 3VRRA 2ERBA 2KI4B 4OVNF 4AQIA 3CYZA 1WRZA 2BKHB 2K8MB 3SJSA 2HPSA 4A4CA 4C0KA 3UO9A 2JTZA 2L50A 3CTNA 4I5KA 4CLNA 2BE4A 1EJ3A 2LVJA 3EVUA 3BQ3A 5I2LA 2MBXA 5HYDA 5I2OA 2JXLA 2I7AA 2KGBC 2QEVA 1MUXA 3CWGA 1S5GZ 3EVRA 1NX3A 3DVKA 3IVTA 3NHTA 4USLA 2KI4C 1B7TY 1SL8A 1DVIA 2M7LA 1EH2A 4GGFC 1OMVA 1S5GY 1BR4B 1BG1A 3I5IB 3VRNA 2H61A 4OR9B 1QLSA 2LE9B 2WNDA 1TCOB 2K2FA 2FCDA 1RJVA 3BYAA 1MXLC 2KSPA 4QJ5B 1SBJA 5G08A 1BODA 3WHUB 3CABA 1Y1UA 4M2OA 3SG3A 5AFPA 2BBMA 1F4OA 1A4PA 1XFVO 2L4IA 3BOWA 1V1GA 1YX8A 1KK8B 1DJHA 1DJZA 2LMUA 1G33A 2LHLA 1KSOA 2CTNA 2WORA 2F2PA 3DF0B 3GK4X 3I5IC 3KO0A 1J1DA 1JBAA 1SL7A 5FYXA 4DUQA 1XFZO 2JC2A 3CZ2A 1KFXL 4HSZA 2V53A 1P28A 2VRGA 1IG5A 1OOJA 2JQ6A 2WCLA 3FWCA 2GV5A 1IQ3A 1CDNA 2FCEA 3JVTB 3DD4A 1QASA 4M2QA 1OE9B 2BCXA 4R1EA 4BY4A 1NSHA 2LC5A 4JWQA 1Z2CB 1D1OA 1NX1A 1CDLA 2OPOA 1Z4HA 3KHEA 1DGUA 1XFXO 4JQ0D 1C07A 5ER5A 2KBMA 3JVTC 2O60A 3OP0A 1A03A 1YUUA 1F4QA 3EK4A 1MXEA 1CNPA 5JJGA 3N7HA 1UHNA 4KYNA 4MZJA 1JF2A 5AERA 2EC6B 1QJTA 2NCOA 1AVSA 2LAPA 1DJYA 2WCEA 1OMRA 1OOFA 1IRJA 3GK1A 4P5OE 1L7ZA 1LINA 5J3XA 2B1UA 3NXAA 3SS4A 1B8LA 1CKKA 4XJKA 3QMEA 1YURA 1IJ6A 1UHIA 4NDCA 1IH0A 1PVAA 1BT6A 2G9BA 1OOGA 1AK8A 1QS7A 1NCXA 1T14A 5CSFA 1RTP1 3NSLA 3CR2A 3TZ1A 4PE0A 3TDUA 1LKJA 1N0YA 2KFHA 3JTDC 5DKRA 2KDHA 2QPTA 3SG7A 5HKYA 3S0AA 1B8RA 1QV0A 2K61A 3D0YB 1BU3A 4MRYA 3SG2A 1WRKA 1YUTA 1M63B 1SCMB 1SL9A 2AMIA 2Q91A 2BL0B 4MZKA 2QEBA 1XFYO 3BOWB 3LLEA 4PCWA 3O6BA 3FE6A 1J7QA 2E30A 1FBVA 1KSMA 1J7RA 4I5NB 1AJ4A 1UURA 2PQLA 4HRGA 3I5GC 1Y1XA 2WOSA 2AAOA 2WCBA 3O2PA 4PALA 1TWOA 1Y6WA 1QX7A 3PATA 4GNKB 1AHRA 1OOHA 2ZKMX 3OX6A 4HREE 2L0PA 4PE7A 5K89A 1TTXA 1DMOA 1KCYA 4IJ7A 2BKIB 1SCMC 1A29A 1X02A 2LUCA 4D1EA 4DRWA 1DJIA 2BL0C 2NZ0A 2MHHA 2L4HA 2Y1MA 4INWA 5I2QA 1OZOA 1DF0A 3Q8IA 1KFXS 3AKBA 3D77A 1W9ZA 3R1OA 3CZTX 2M1UA 5EL2A 3A4UB 4Q04A 2GTEA 2QACA 3BXKA 3DVMA 1CLMA 1ZOTB 2JWWA 1K96A 2M29A 1HQVA 1QIVA 1NP8A 3B87A 4HRHA 2FJUB 1TIZA 4FQOA 4MZLA 2LNKA 3DYEA 2JNXA 2WC5A 3B7AA 1JC2A 1OW4A 1CM1A 5AEQA 3S0GA 1W7JB 5FI6A 3QRXA 5KSZA 2LP3A 4OCIA 1G4YR 3D10A 3PLFB 2ZRTA 2LV7A 4JD9A 1CLLA 3CLNA 1PULA 1ZMZA 2HQ8A 2M0RA 1QWVA 1F8HA 2L5XB 4GFTA 4INXA 1C7WA 3BUOB 3OHMB 2F2OA 1NCZA 5JOLA 4YRUA 3EVVA 1CFDA 5TNCA 1B7TZ 3MSEB 5ER4X 1TRFA 1B1GA 1L2OB 1CTRA 2JULA 5F6TA 3NSIA 1SPYA 1S6JA 1K93D 4N5XA 1DGVA 4NDDA 2KI6C 3O4XA 5DICA 2LCPA 1NX2A 4L9MA 1B9AA 1IJ5A 3VB1A 3AAKA 2EHBA 2M9GA 3K21A 4UPGA 1PVBA 1NPQA 2WCJA 1K9KA 1QTXA 5B8IB 1J7OA 4QJ4B 4OKHA 3EKHA 3S0BA 1JSAA 2WCKA 3IQQA 2BAPA 3VGOA 5CPVA 2AUCA 2YGUA 1DQEA 1L2OC 3VRPA 1WRLA 1A75A 5HKZA 2L5YA 1FPWA 1SKTA 3DXLA 4PHMA 1NUBA 4PE1A 5I8NA 2GGZA 3FS7A 3ZNIA 2DOQA 1C3ZA 1XK4C 3BUWB 1TNXA 2KQ6A 1AP4A 3SG5A 1ZUZA 3AKAA 3SIAA 1TOPA 1TNWA 1XYDA 3OB2B 4IL1A 4AQJA 1SK6D 5BPJA 1UHKA 1DF0B 2L2EA 3CZ0A 5HL1A 3TUYC 1DELA 5D7FA 1ZFSA 5FI7A 2CNPA 3EKJA 2ZRSA 2M7NA 1MF8B 4GUKA 1BMOA 1PSBA 2KFFA 2ZNEA 4CFQA 2KYFA 1K95A 1M46A 2P6BB 2Y5IA 3S0EA 4DIRA 2KLDA 3FE9A 1EL4A 2ZN9A 3GK2A 3KPXA 1KWOB 1M45A 3HX4A 1QXPA 3NSOA 2LVKA 2WCMA 2PYQA 1WDCB 2JZIA 1QVIZ 3SS5A 4PDZA 1XFWO 2PMYA 2RGIA 4YGEB 1QVIY 4CPVA 3TDIA 2LANA 3JTDB 5KTYA 1KFUS 1GGZA 1MHOA 1IGVA 2CXJA 2LVIA 1OZSA 1SMGA 1V1FA 3BJHA 4MSPA 1C7VA 1KWOC 1EG3A 1QIWA 2KYCA 1WDCC 2SCPA 4F7FA 3L47A 2MJWB 3VRQA 2HF5A 3ICBA 2LLTA 3EK8A 4WQ3A 1CLBA 5HKWA 3I5GB 2KAXA 1K94A 3IF7A 4NDBA 1CB1A 3BUXB 1ALWA 3IQOA 1GJYA 1U5IA 5CSJA 1E8AA 5I94A 1MWNA 5IBWA 4YGCB 3R1VA 2NLNA 4GGFA 1VRKA 2JRFA 1K9UA 2K2AA 5KU1A 1QLKA 1LA3A 2MLFC 1TCFA 4XYNA 2H61C 2H8VA 1S26D 3OGNA 1JFJA 3BFBA 3WHTB 4MEWA 1J1EA 3HCMA 1JWDA 4JKTA 3CR4X 1RECA 3CGAA 1K8UA 3I5HB 1OOIX 2OTGB 3PALA 2BCBA 3I5FC 1NIWA 2CT9A 4CIDA 2QEOA 3C1VA 1DT7B 5HLOA 4DCKA 2LM5A 3L4AA 1CFCA 1UHHA 2KGRA 2EGDA 2MLEC 1GM0A 3RZSA 1SYMA 4PHNA 3OX5A 4PHJA 3UNWA 1BLQA 1ORGA 1CDPA 4ICBA 2K7DA 1HT9A 2NXQA 2QDIA 3V2LA 2SASA 4N1GA 4C0JA 2F3YA 3S0FA 3ZWHA 2PSRA 2TN4A 3I5HC 2OTGC 2OS8B 3KEVA 1SR6B 1S3PA 2K7CA 3PM8A 3NSKA 2COLB 2JNFA 1YRUB 2MAZA 1WY9A 2JU0A 1AUIB 2I2RE 2JXCA 3DF0A 3GOFA 3H4SE 3PFVA 1FI5A 4MRXA 5D69A 2K0JA 1UHJA 1KFUL 2K60A 3NGVA 1N2DA 1ODBA 5DKNA 1RWYA 3CDNA 5FI2A 1RK9A 1SSEB 2KOTA 1AJ5A 1NWDA 2QEHA 1BF5A 3O78A 1XFUO 2FOTA 2OS8C 3K1EA 4XJKB 3BUMB 3VROA 1SR6C 3SS3A 4AOMA 1UP5A 1K9PA 1MR8A 1KQMB 2KPHA 4YGBB 5AXIA 1PRWA 3B88A 1DC1A 3DZTA 2PVBA 3BUNB 4MLWA 1K90D 4YBHB 3D74A 1A2XA 4A4BA 1XO5A 1YVHA 3B6XA 3D78A 3FIAA 2PASA 3BFAA 3R72A 4YGAA 4F0ZB 2MRDA 1LA0A 1K2HA 4MVFA 1WLMA 1F70A 1XVJA 4C0LA 2ZFDA 4I5JA 1KQMC 3DVJA 1DTLA 1OQPA 1BR1B 1PK0D 3TUYB 1UWOA 2KAVA 4NQGA 1LS8A 2KHNA 1CFPA 1B8CA 2WCHA 3S0DA 4BY5A 1CM4A 3DVEA 3AAJA 1EXRA 2PRUA 1CMFA 1QX2A 1B4CA 4FQTA 3WXAA 3CZ1A 2WC6A 3B86A 4ETOA 4GPLB 1W7IB 5CSNA 2K7BA 3FE8A 1MQ1A 1TN4A 2LUXA 1JFKA 2R2IA 1SRAA 1IQ5A 2LP2A 1M31A 2KFGA 3D0YA 3D73A 1C3YA 2NCPA 4JPZB 4CFRA 1NX0A 5CSIA 4PHKA 3SG4A 1NYAA 2IS9A 4OV2A 2F3ZA 2O5GA 2ISDA 1SNLA 3KF9A 2LVVA 2Y4QA 4I5LB 4OZDA 2HQWA 4M2PA 2Y1NA 1Y0VH 1S36A 2LMTA 1IKUA 1YR5A 2E6WA 3A8RA 4YGDB 2KQYA 1R2UA 2H2KA 2M3WA 2WC8A 2KNEA 3LCPC 3O4YA 5GQQC 4YI9A 1GGWA 1KQVA 1YRTB 3RLZA 1KK8C 2KBIA 2LMVA 3R1PA 5PALA 1ALVA 1FI6A 1DJXA 2D8NA 2CBLA 5D3OA 1YUSA 1TUJA 1Q80A 1G8IA 1LVCD 2P70A 2ZNDA 3FWBA 3DY9A 4DS7A 1S6IA 1FW4A 1YX7A 1TUZA 2Q4UA 1DJGA 1CDMA 2KAYA 3F45A 4E68A 1IIOA 3NHIA 4ORBB 1WLZA 3OBVA 3CS1A 2GGMA 4FTGA 1Y1AA 2BECA 2G2BA 1SW8A 3I5FB 1SCVA 1XFRA 4N1FA 1A75B 4GBAA 1S1EA 2BCAA 1PSRA 3BFHA 4TNCA 3RM1A 2HETA 4MBEA 2JOJA 2PALA 4PE4A 3D76A 3SG6A 2I18A 2JPOA 2P71A 3LK1A 1BOCA 4U8DA 2EC6C 2BBNA 1RROA 2JT8A 2KLEA 3LL8B 1F54A 1YVLA 1YTZC 1BJFA 1XK4A
chains in the Genus database with same CATH topology
1RFJA 3CR5X 3TS5B 1XA5A 1ZACA 2M49B 5AANA 1N65A 1FF1A 2KI6D 1F71A 1R6PA 1KK7Z 4MN0A 5DKQA 1H4BA 1TNQA 1H8BA 1OMDA 1PALA 1JF0A 1KK7Y 1QATA 1DJWA 3PN7B 1TNPA 4ZCVA 2F33A 4WRIA 2L51A 3TDZA 3WNXB 3M0WA 2M1KB 2WCFA 1M39A 1J55A 2L98A 4GGNA 1JUOA 1UUSA 3TS5C 4P2YB 3SIBA 4ORCB 1SY9A 2M8UA 1QX5B 2LLSA 4YI8A 2A4JA 1CMGA 5HLVA 2LLUA 2CCMA 1IWQA 2F8PA 1QV1A 1NCYA 2MA2A 3OB1B 2BE6A 3PN7C 2ZN8A 1EG4A 1LXFC 4QJ3B 4WQ2A 1OSAA 2K7OA 3EK7A 2JPTA 1CFFA 3LK0A 1B47A 1GQMA 1S6CA 2I94A 4GAOA 4ORAB 2JT3A 4ZCUA 2JT0A 1J7PA 3E3RA 3PSRA 1U5IB 2JTTA 2LHIA 1F55A 2M97A 3VRRA 2KI4B 4OVNF 4AQIA 1WRZA 2BKHB 2K8MB 3SJSA 2HPSA 4A4CA 4C0KA 2JTZA 2L50A 3CTNA 4I5KA 4CLNA 2BE4A 1EJ3A 2LVJA 3EVUA 3BQ3A 5I2LA 2MBXA 5HYDA 5I2OA 2JXLA 2I7AA 2KGBC 1MUXA 3CWGA 1S5GZ 3EVRA 1NX3A 3DVKA 4USLA 2KI4C 1B7TY 1SL8A 1DVIA 2M7LA 1EH2A 4GGFC 1OMVA 1S5GY 1BR4B 1BG1A 3I5IB 3VRNA 2H61A 4OR9B 1QLSA 2LE9B 2WNDA 1TCOB 2K2FA 2FCDA 1RJVA 3BYAA 1MXLC 2KSPA 4QJ5B 1SBJA 5G08A 1BODA 3WHUB 3SG3A 1Y1UA 4M2OA 5AFPA 2BBMA 1F4OA 1A4PA 1XFVO 2L4IA 3BOWA 1V1GA 1YX8A 1KK8B 1DJHA 1DJZA 2LMUA 1G33A 2LHLA 1KSOA 2CTNA 2WORA 2F2PA 3DF0B 3GK4X 3I5IC 3KO0A 1J1DA 1JBAA 1SL7A 5FYXA 4DUQA 1XFZO 2JC2A 4HSZA 1KFXL 2V53A 2VRGA 1IG5A 1OOJA 2JQ6A 3FWCA 1IQ3A 2GV5A 1CDNA 2FCEA 3JVTB 3DD4A 1QASA 4M2QA 1OE9B 2BCXA 4R1EA 4BY4A 1NSHA 2LC5A 4JWQA 1D1OA 1NX1A 1CDLA 2OPOA 3KHEA 1DGUA 1XFXO 4JQ0D 1C07A 5ER5A 2KBMA 3JVTC 2O60A 3OP0A 1A03A 1YUUA 1F4QA 3EK4A 1MXEA 1CNPA 5JJGA 1UHNA 4MZJA 1JF2A 5AERA 2EC6B 1QJTA 2NCOA 1AVSA 2LAPA 1DJYA 2WCEA 1OMRA 3GK1A 1IRJA 4P5OE 1L7ZA 1LINA 5J3XA 2B1UA 3NXAA 1B8LA 1CKKA 4XJKA 1YURA 1IJ6A 1UHIA 4NDCA 1IH0A 1PVAA 1BT6A 2G9BA 1AK8A 1QS7A 1NCXA 5CSFA 1RTP1 3NSLA 3CR2A 3TZ1A 4PE0A 3TDUA 1LKJA 1N0YA 2KFHA 3JTDC 5DKRA 2KDHA 2QPTA 3SG7A 5HKYA 1B8RA 1QV0A 2K61A 3D0YB 1BU3A 4MRYA 3SG2A 1WRKA 1YUTA 1M63B 1SCMB 1SL9A 2AMIA 2Q91A 2BL0B 4MZKA 1XFYO 3BOWB 3LLEA 4PCWA 3O6BA 1J7QA 2E30A 1FBVA 1KSMA 1J7RA 4I5NB 1AJ4A 1UURA 4HRGA 3I5GC 1Y1XA 2WOSA 2AAOA 2WCBA 3O2PA 4PALA 1Y6WA 1QX7A 3PATA 4GNKB 1AHRA 2ZKMX 3OX6A 4HREE 4PE7A 2L0PA 5K89A 1DMOA 1TTXA 1KCYA 2BKIB 1SCMC 1A29A 1X02A 2LUCA 4D1EA 4DRWA 1DJIA 2BL0C 2NZ0A 2MHHA 2L4HA 2Y1MA 5I2QA 1OZOA 1DF0A 1KFXS 3AKBA 3CZTX 2M1UA 3A4UB 4Q04A 2QACA 3BXKA 3DVMA 1CLMA 1ZOTB 2JWWA 1K96A 2M29A 1HQVA 1QIVA 1NP8A 4HRHA 2FJUB 1TIZA 4FQOA 4MZLA 2LNKA 1JC2A 2JNXA 1CM1A 5AEQA 1W7JB 3QRXA 5KSZA 2LP3A 4OCIA 1G4YR 3D10A 3PLFB 2ZRTA 2LV7A 1CLLA 3CLNA 1PULA 1ZMZA 2HQ8A 2M0RA 1F8HA 2L5XB 4GFTA 1C7WA 3BUOB 3OHMB 2F2OA 1NCZA 5JOLA 4YRUA 3EVVA 1CFDA 5TNCA 1B7TZ 3MSEB 5ER4X 1TRFA 1B1GA 1L2OB 1CTRA 2JULA 5F6TA 3NSIA 1SPYA 1S6JA 1K93D 4N5XA 1DGVA 4NDDA 2KI6C 2LCPA 1NX2A 4L9MA 1B9AA 1IJ5A 4UPGA 3AAKA 2EHBA 2M9GA 3K21A 1PVBA 1NPQA 5B8IB 1K9KA 1QTXA 1J7OA 4QJ4B 4OKHA 3EKHA 1JSAA 3IQQA 3VGOA 5CPVA 2AUCA 3VRPA 1L2OC 1WRLA 1A75A 5HKZA 1FPWA 1SKTA 4PHMA 1NUBA 4PE1A 5I8NA 2GGZA 3FS7A 3ZNIA 2DOQA 1XK4C 3BUWB 1AP4A 1TNXA 2KQ6A 3SG5A 1ZUZA 3AKAA 3SIAA 1TOPA 1TNWA 1XYDA 3OB2B 4IL1A 4AQJA 1SK6D 5BPJA 1UHKA 1DF0B 2L2EA 3TUYC 5D7FA 1ZFSA 2CNPA 3EKJA 2ZRSA 2M7NA 1MF8B 4GUKA 1BMOA 1PSBA 2KFFA 2ZNEA 4CFQA 2KYFA 1K95A 1M46A 2P6BB 2Y5IA 4DIRA 1EL4A 2ZN9A 3GK2A 3KPXA 1KWOB 1M45A 3HX4A 1QXPA 3NSOA 2LVKA 1WDCB 2JZIA 1QVIZ 4PDZA 1XFWO 2PMYA 2RGIA 4YGEB 1QVIY 4CPVA 3TDIA 2LANA 3JTDB 5KTYA 1KFUS 1GGZA 1MHOA 1IGVA 2CXJA 2LVIA 1OZSA 1SMGA 1V1FA 4MSPA 1C7VA 1KWOC 1EG3A 1QIWA 2KYCA 1WDCC 2SCPA 2MJWB 3VRQA 2HF5A 3ICBA 2LLTA 3EK8A 4WQ3A 1CLBA 5HKWA 3I5GB 2KAXA 1K94A 3IF7A 4NDBA 1CB1A 3BUXB 1ALWA 3IQOA 1GJYA 1U5IA 5CSJA 1E8AA 1MWNA 5IBWA 4YGCB 2NLNA 4GGFA 1VRKA 2JRFA 1K9UA 2K2AA 5KU1A 1QLKA 1LA3A 2MLFC 1TCFA 4XYNA 2H61C 1S26D 1JFJA 3WHTB 4MEWA 1J1EA 3HCMA 1JWDA 3CR4X 1RECA 3CGAA 1K8UA 3I5HB 2OTGB 3PALA 2BCBA 3I5FC 1NIWA 2CT9A 4CIDA 3C1VA 1DT7B 5HLOA 4DCKA 2LM5A 1CFCA 1UHHA 2KGRA 2EGDA 2MLEC 1SYMA 4PHNA 3OX5A 4PHJA 1BLQA 1CDPA 4ICBA 2K7DA 1HT9A 2NXQA 4C0JA 2SASA 4N1GA 2F3YA 3ZWHA 2PSRA 2TN4A 3I5HC 2OTGC 2OS8B 3KEVA 1SR6B 1S3PA 2K7CA 3PM8A 3NSKA 2COLB 2JNFA 1YRUB 2MAZA 1WY9A 2JU0A 1AUIB 2I2RE 2JXCA 3DF0A 3GOFA 3H4SE 3PFVA 1FI5A 4MRXA 5D69A 2K0JA 1UHJA 1KFUL 1N2DA 1ODBA 5DKNA 1RWYA 1RK9A 2KOTA 1AJ5A 1NWDA 1BF5A 3O78A 1XFUO 2FOTA 2OS8C 4XJKB 3BUMB 3VROA 1SR6C 4AOMA 1UP5A 1K9PA 1MR8A 1KQMB 4YGBB 5AXIA 1PRWA 2PVBA 3BUNB 4MLWA 1K90D 4YBHB 1A2XA 4A4BA 1XO5A 1YVHA 3FIAA 4YGAA 4F0ZB 2PASA 2MRDA 1LA0A 1K2HA 4MVFA 1WLMA 1F70A 1XVJA 4C0LA 2ZFDA 4I5JA 1KQMC 3DVJA 1DTLA 1OQPA 1BR1B 1PK0D 3TUYB 1UWOA 2KAVA 4NQGA 2KHNA 1CFPA 1B8CA 4BY5A 1CM4A 3DVEA 3AAJA 1EXRA 2PRUA 1CMFA 1QX2A 1B4CA 3WXAA 4ETOA 4GPLB 1W7IB 5CSNA 2K7BA 1MQ1A 1TN4A 2LUXA 1JFKA 2R2IA 1SRAA 1IQ5A 2LP2A 1M31A 2KFGA 3D0YA 2NCPA 4JPZB 4CFRA 1NX0A 5CSIA 4PHKA 3SG4A 1NYAA 2IS9A 4OV2A 2F3ZA 2O5GA 2ISDA 1SNLA 3KF9A 2LVVA 2Y4QA 4I5LB 2HQWA 4M2PA 2Y1NA 1Y0VH 1S36A 2LMTA 1IKUA 1YR5A 2E6WA 3A8RA 4YGDB 2KQYA 1R2UA 2H2KA 2M3WA 2WC8A 2KNEA 3LCPC 3O4YA 5GQQC 4YI9A 1GGWA 1KQVA 1YRTB 3RLZA 1KK8C 2KBIA 2LMVA 5PALA 1ALVA 1FI6A 1DJXA 2D8NA 2CBLA 1YUSA 1Q80A 1G8IA 1LVCD 2ZNDA 3FWBA 4DS7A 1S6IA 1FW4A 1YX7A 2Q4UA 1DJGA 1CDMA 2KAYA 3F45A 4E68A 4ORBB 1WLZA 3CS1A 2GGMA 4FTGA 1Y1AA 2BECA 2G2BA 1SW8A 3I5FB 1SCVA 4N1FA 1A75B 4GBAA 1S1EA 2BCAA 1PSRA 4TNCA 3RM1A 2HETA 4MBEA 2JOJA 2PALA 4PE4A 3SG6A 2I18A 3LK1A 1BOCA 4U8DA 2EC6C 2BBNA 1RROA 2JT8A 3LL8B 1F54A 1YVLA 1YTZC 1BJFA 1XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFJ A;  3CR5 X;  3TS5 B;  1XA5 A;  1ZAC A;  2M49 B;  5AAN A;  1N65 A;  1FF1 A;  2KI6 D;  1F71 A;  1R6P A;  1KK7 Z;  4MN0 A;  5DKQ A;  1H4B A;  1TNQ A;  1H8B A;  1OMD A;  1PAL A;  1JF0 A;  1KK7 Y;  1QAT A;  1DJW A;  3PN7 B;  1TNP A;  4ZCV A;  2F33 A;  4WRI A;  2L51 A;  3TDZ A;  3WNX B;  3M0W A;  2M1K B;  2WCF A;  1M39 A;  1J55 A;  2L98 A;  4GGN A;  1JUO A;  1UUS A;  3TS5 C;  4P2Y B;  3SIB A;  4ORC B;  1SY9 A;  2M8U A;  1QX5 B;  2LLS A;  4YI8 A;  2A4J A;  1CMG A;  5HLV A;  2LLU A;  2CCM A;  1IWQ A;  2F8P A;  1QV1 A;  1NCY A;  2MA2 A;  3OB1 B;  2BE6 A;  3PN7 C;  2ZN8 A;  1EG4 A;  1LXF C;  4QJ3 B;  4WQ2 A;  1OSA A;  2K7O A;  3EK7 A;  2JPT A;  1CFF A;  3LK0 A;  1B47 A;  1GQM A;  1S6C A;  2I94 A;  4GAO A;  4ORA B;  2JT3 A;  4ZCU A;  2JT0 A;  1J7P A;  3E3R A;  3PSR A;  1U5I B;  2JTT A;  2LHI A;  1F55 A;  2M97 A;  3VRR A;  2KI4 B;  4OVN F;  4AQI A;  1WRZ A;  2BKH B;  2K8M B;  3SJS A;  2HPS A;  4A4C A;  4C0K A;  2JTZ A;  2L50 A;  3CTN A;  4I5K A;  4CLN A;  2BE4 A;  1EJ3 A;  2LVJ A;  3EVU A;  3BQ3 A;  5I2L A;  2MBX A;  5HYD A;  5I2O A;  2JXL A;  2I7A A;  2KGB C;  1MUX A;  3CWG A;  1S5G Z;  3EVR A;  1NX3 A;  3DVK A;  4USL A;  2KI4 C;  1B7T Y;  1SL8 A;  1DVI A;  2M7L A;  1EH2 A;  4GGF C;  1OMV A;  1S5G Y;  1BR4 B;  1BG1 A;  3I5I B;  3VRN A;  2H61 A;  4OR9 B;  1QLS A;  2LE9 B;  2WND A;  1TCO B;  2K2F A;  2FCD A;  1RJV A;  3BYA A;  1MXL C;  2KSP A;  4QJ5 B;  1SBJ A;  5G08 A;  1BOD A;  3WHU B;  3SG3 A;  1Y1U A;  4M2O A;  5AFP A;  2BBM A;  1F4O A;  1A4P A;  1XFV O;  2L4I A;  3BOW A;  1V1G A;  1YX8 A;  1KK8 B;  1DJH A;  1DJZ A;  2LMU A;  1G33 A;  2LHL A;  1KSO A;  2CTN A;  2WOR A;  2F2P A;  3DF0 B;  3GK4 X;  3I5I C;  3KO0 A;  1J1D A;  1JBA A;  1SL7 A;  5FYX A;  4DUQ A;  1XFZ O;  2JC2 A;  4HSZ A;  1KFX L;  2V53 A;  2VRG A;  1IG5 A;  1OOJ A;  2JQ6 A;  3FWC A;  1IQ3 A;  2GV5 A;  1CDN A;  2FCE A;  3JVT B;  3DD4 A;  1QAS A;  4M2Q A;  1OE9 B;  2BCX A;  4R1E A;  4BY4 A;  1NSH A;  2LC5 A;  4JWQ A;  1D1O A;  1NX1 A;  1CDL A;  2OPO A;  3KHE A;  1DGU A;  1XFX O;  4JQ0 D;  1C07 A;  5ER5 A;  2KBM A;  3JVT C;  2O60 A;  3OP0 A;  1A03 A;  1YUU A;  1F4Q A;  3EK4 A;  1MXE A;  1CNP A;  5JJG A;  1UHN A;  4MZJ A;  1JF2 A;  5AER A;  2EC6 B;  1QJT A;  2NCO A;  1AVS A;  2LAP A;  1DJY A;  2WCE A;  1OMR A;  3GK1 A;  1IRJ A;  4P5O E;  1L7Z A;  1LIN A;  5J3X A;  2B1U A;  3NXA A;  1B8L A;  1CKK A;  4XJK A;  1YUR A;  1IJ6 A;  1UHI A;  4NDC A;  1IH0 A;  1PVA A;  1BT6 A;  2G9B A;  1AK8 A;  1QS7 A;  1NCX A;  5CSF A;  1RTP 1;  3NSL A;  3CR2 A;  3TZ1 A;  4PE0 A;  3TDU A;  1LKJ A;  1N0Y A;  2KFH A;  3JTD C;  5DKR A;  2KDH A;  2QPT A;  3SG7 A;  5HKY A;  1B8R A;  1QV0 A;  2K61 A;  3D0Y B;  1BU3 A;  4MRY A;  3SG2 A;  1WRK A;  1YUT A;  1M63 B;  1SCM B;  1SL9 A;  2AMI A;  2Q91 A;  2BL0 B;  4MZK A;  1XFY O;  3BOW B;  3LLE A;  4PCW A;  3O6B A;  1J7Q A;  2E30 A;  1FBV A;  1KSM A;  1J7R A;  4I5N B;  1AJ4 A;  1UUR A;  4HRG A;  3I5G C;  1Y1X A;  2WOS A;  2AAO A;  2WCB A;  3O2P A;  4PAL A;  1Y6W A;  1QX7 A;  3PAT A;  4GNK B;  1AHR A;  2ZKM X;  3OX6 A;  4HRE E;  4PE7 A;  2L0P A;  5K89 A;  1DMO A;  1TTX A;  1KCY A;  2BKI B;  1SCM C;  1A29 A;  1X02 A;  2LUC A;  4D1E A;  4DRW A;  1DJI A;  2BL0 C;  2NZ0 A;  2MHH A;  2L4H A;  2Y1M A;  5I2Q A;  1OZO A;  1DF0 A;  1KFX S;  3AKB A;  3CZT X;  2M1U A;  3A4U B;  4Q04 A;  2QAC A;  3BXK A;  3DVM A;  1CLM A;  1ZOT B;  2JWW A;  1K96 A;  2M29 A;  1HQV A;  1QIV A;  1NP8 A;  4HRH A;  2FJU B;  1TIZ A;  4FQO A;  4MZL A;  2LNK A;  1JC2 A;  2JNX A;  1CM1 A;  5AEQ A;  1W7J B;  3QRX A;  5KSZ A;  2LP3 A;  4OCI A;  1G4Y R;  3D10 A;  3PLF B;  2ZRT A;  2LV7 A;  1CLL A;  3CLN A;  1PUL A;  1ZMZ A;  2HQ8 A;  2M0R A;  1F8H A;  2L5X B;  4GFT A;  1C7W A;  3BUO B;  3OHM B;  2F2O A;  1NCZ A;  5JOL A;  4YRU A;  3EVV A;  1CFD A;  5TNC A;  1B7T Z;  3MSE B;  5ER4 X;  1TRF A;  1B1G A;  1L2O B;  1CTR A;  2JUL A;  5F6T A;  3NSI A;  1SPY A;  1S6J A;  1K93 D;  4N5X A;  1DGV A;  4NDD A;  2KI6 C;  2LCP A;  1NX2 A;  4L9M A;  1B9A A;  1IJ5 A;  4UPG A;  3AAK A;  2EHB A;  2M9G A;  3K21 A;  1PVB A;  1NPQ A;  5B8I B;  1K9K A;  1QTX A;  1J7O A;  4QJ4 B;  4OKH A;  3EKH A;  1JSA A;  3IQQ A;  3VGO A;  5CPV A;  2AUC A;  3VRP A;  1L2O C;  1WRL A;  1A75 A;  5HKZ A;  1FPW A;  1SKT A;  4PHM A;  1NUB A;  4PE1 A;  5I8N A;  2GGZ A;  3FS7 A;  3ZNI A;  2DOQ A;  1XK4 C;  3BUW B;  1AP4 A;  1TNX A;  2KQ6 A;  3SG5 A;  1ZUZ A;  3AKA A;  3SIA A;  1TOP A;  1TNW A;  1XYD A;  3OB2 B;  4IL1 A;  4AQJ A;  1SK6 D;  5BPJ A;  1UHK A;  1DF0 B;  2L2E A;  3TUY C;  5D7F A;  1ZFS A;  2CNP A;  3EKJ A;  2ZRS A;  2M7N A;  1MF8 B;  4GUK A;  1BMO A;  1PSB A;  2KFF A;  2ZNE A;  4CFQ A;  2KYF A;  1K95 A;  1M46 A;  2P6B B;  2Y5I A;  4DIR A;  1EL4 A;  2ZN9 A;  3GK2 A;  3KPX A;  1KWO B;  1M45 A;  3HX4 A;  1QXP A;  3NSO A;  2LVK A;  1WDC B;  2JZI A;  1QVI Z;  4PDZ A;  1XFW O;  2PMY A;  2RGI A;  4YGE B;  1QVI Y;  4CPV A;  3TDI A;  2LAN A;  3JTD B;  5KTY A;  1KFU S;  1GGZ A;  1MHO A;  1IGV A;  2CXJ A;  2LVI A;  1OZS A;  1SMG A;  1V1F A;  4MSP A;  1C7V A;  1KWO C;  1EG3 A;  1QIW A;  2KYC A;  1WDC C;  2SCP A;  2MJW B;  3VRQ A;  2HF5 A;  3ICB A;  2LLT A;  3EK8 A;  4WQ3 A;  1CLB A;  5HKW A;  3I5G B;  2KAX A;  1K94 A;  3IF7 A;  4NDB A;  1CB1 A;  3BUX B;  1ALW A;  3IQO A;  1GJY A;  1U5I A;  5CSJ A;  1E8A A;  1MWN A;  5IBW A;  4YGC B;  2NLN A;  4GGF A;  1VRK A;  2JRF A;  1K9U A;  2K2A A;  5KU1 A;  1QLK A;  1LA3 A;  2MLF C;  1TCF A;  4XYN A;  2H61 C;  1S26 D;  1JFJ A;  3WHT B;  4MEW A;  1J1E A;  3HCM A;  1JWD A;  3CR4 X;  1REC A;  3CGA A;  1K8U A;  3I5H B;  2OTG B;  3PAL A;  2BCB A;  3I5F C;  1NIW A;  2CT9 A;  4CID A;  3C1V A;  1DT7 B;  5HLO A;  4DCK A;  2LM5 A;  1CFC A;  1UHH A;  2KGR A;  2EGD A;  2MLE C;  1SYM A;  4PHN A;  3OX5 A;  4PHJ A;  1BLQ A;  1CDP A;  4ICB A;  2K7D A;  1HT9 A;  2NXQ A;  4C0J A;  2SAS A;  4N1G A;  2F3Y A;  3ZWH A;  2PSR A;  2TN4 A;  3I5H C;  2OTG C;  2OS8 B;  3KEV A;  1SR6 B;  1S3P A;  2K7C A;  3PM8 A;  3NSK A;  2COL B;  2JNF A;  1YRU B;  2MAZ A;  1WY9 A;  2JU0 A;  1AUI B;  2I2R E;  2JXC A;  3DF0 A;  3GOF A;  3H4S E;  3PFV A;  1FI5 A;  4MRX A;  5D69 A;  2K0J A;  1UHJ A;  1KFU L;  1N2D A;  1ODB A;  5DKN A;  1RWY A;  1RK9 A;  2KOT A;  1AJ5 A;  1NWD A;  1BF5 A;  3O78 A;  1XFU O;  2FOT A;  2OS8 C;  4XJK B;  3BUM B;  3VRO A;  1SR6 C;  4AOM A;  1UP5 A;  1K9P A;  1MR8 A;  1KQM B;  4YGB B;  5AXI A;  1PRW A;  2PVB A;  3BUN B;  4MLW A;  1K90 D;  4YBH B;  1A2X A;  4A4B A;  1XO5 A;  1YVH A;  3FIA A;  4YGA A;  4F0Z B;  2PAS A;  2MRD A;  1LA0 A;  1K2H A;  4MVF A;  1WLM A;  1F70 A;  1XVJ A;  4C0L A;  2ZFD A;  4I5J A;  1KQM C;  3DVJ A;  1DTL A;  1OQP A;  1BR1 B;  1PK0 D;  3TUY B;  1UWO A;  2KAV A;  4NQG A;  2KHN A;  1CFP A;  1B8C A;  4BY5 A;  1CM4 A;  3DVE A;  3AAJ A;  1EXR A;  2PRU A;  1CMF A;  1QX2 A;  1B4C A;  3WXA A;  4ETO A;  4GPL B;  1W7I B;  5CSN A;  2K7B A;  1MQ1 A;  1TN4 A;  2LUX A;  1JFK A;  2R2I A;  1SRA A;  1IQ5 A;  2LP2 A;  1M31 A;  2KFG A;  3D0Y A;  2NCP A;  4JPZ B;  4CFR A;  1NX0 A;  5CSI A;  4PHK A;  3SG4 A;  1NYA A;  2IS9 A;  4OV2 A;  2F3Z A;  2O5G A;  2ISD A;  1SNL A;  3KF9 A;  2LVV A;  2Y4Q A;  4I5L B;  2HQW A;  4M2P A;  2Y1N A;  1Y0V H;  1S36 A;  2LMT A;  1IKU A;  1YR5 A;  2E6W A;  3A8R A;  4YGD B;  2KQY A;  1R2U A;  2H2K A;  2M3W A;  2WC8 A;  2KNE A;  3LCP C;  3O4Y A;  5GQQ C;  4YI9 A;  1GGW A;  1KQV A;  1YRT B;  3RLZ A;  1KK8 C;  2KBI A;  2LMV A;  5PAL A;  1ALV A;  1FI6 A;  1DJX A;  2D8N A;  2CBL A;  1YUS A;  1Q80 A;  1G8I A;  1LVC D;  2ZND A;  3FWB A;  4DS7 A;  1S6I A;  1FW4 A;  1YX7 A;  2Q4U A;  1DJG A;  1CDM A;  2KAY A;  3F45 A;  4E68 A;  4ORB B;  1WLZ A;  3CS1 A;  2GGM A;  4FTG A;  1Y1A A;  2BEC A;  2G2B A;  1SW8 A;  3I5F B;  1SCV A;  4N1F A;  1A75 B;  4GBA A;  1S1E A;  2BCA A;  1PSR A;  4TNC A;  3RM1 A;  2HET A;  4MBE A;  2JOJ A;  2PAL A;  4PE4 A;  3SG6 A;  2I18 A;  3LK1 A;  1BOC A;  4U8D A;  2EC6 C;  2BBN A;  1RRO A;  2JT8 A;  3LL8 B;  1F54 A;  1YVL A;  1YTZ C;  1BJF A;  1XK4 A; 
#chains in the Genus database with same CATH topology
 1RFJ A;  3CR5 X;  3TS5 B;  3PJI A;  1XA5 A;  1ZAC A;  2M49 B;  5AAN A;  1N65 A;  3L4L A;  2KI6 D;  1FF1 A;  1F71 A;  1R6P A;  1KK7 Z;  2L2C A;  4MN0 A;  5DKQ A;  1H4B A;  3EG5 B;  1TNQ A;  1H8B A;  1OMD A;  1PAL A;  1JF0 A;  1KK7 Y;  1QAT A;  3D75 A;  1DJW A;  3PN7 B;  1TNP A;  3PM2 A;  2F33 A;  4WRI A;  4ZCV A;  2L51 A;  1DEK A;  3TDZ A;  3M0W A;  2M1K B;  2WCF A;  1M39 A;  3WNX B;  1J55 A;  2L98 A;  4GGN A;  1JUO A;  1UUS A;  3TS5 C;  4P2Y B;  3SIB A;  4ORC B;  1SY9 A;  2M8U A;  1QX5 B;  2LLS A;  4YI8 A;  2A4J A;  1CMG A;  5HLV A;  2LLU A;  2CCM A;  1IWQ A;  2F8P A;  1QV1 A;  1NCY A;  2MA2 A;  3OB1 B;  2BE6 A;  3PN7 C;  2ZN8 A;  1EG4 A;  1LXF C;  4QJ3 B;  4WQ2 A;  1OSA A;  4PT1 A;  2K7O A;  3EK7 A;  2BNX A;  2JPT A;  1CFF A;  3LK0 A;  1B47 A;  1GQM A;  1S6C A;  2I94 A;  4GAO A;  4ORA B;  2JT3 A;  4ZCU A;  2JT0 A;  2FJY A;  1J7P A;  3E3R A;  3PSR A;  1U5I B;  2JTT A;  2LHI A;  1F55 A;  2M97 A;  3VRR A;  2ERB A;  2KI4 B;  4OVN F;  4AQI A;  3CYZ A;  1WRZ A;  2BKH B;  2K8M B;  3SJS A;  2HPS A;  4A4C A;  4C0K A;  3UO9 A;  2JTZ A;  2L50 A;  3CTN A;  4I5K A;  4CLN A;  2BE4 A;  1EJ3 A;  2LVJ A;  3EVU A;  3BQ3 A;  5I2L A;  2MBX A;  5HYD A;  5I2O A;  2JXL A;  2I7A A;  2KGB C;  2QEV A;  1MUX A;  3CWG A;  1S5G Z;  3EVR A;  1NX3 A;  3DVK A;  3IVT A;  3NHT A;  4USL A;  2KI4 C;  1B7T Y;  1SL8 A;  1DVI A;  2M7L A;  1EH2 A;  4GGF C;  1OMV A;  1S5G Y;  1BR4 B;  1BG1 A;  3I5I B;  3VRN A;  2H61 A;  4OR9 B;  1QLS A;  2LE9 B;  2WND A;  1TCO B;  2K2F A;  2FCD A;  1RJV A;  3BYA A;  1MXL C;  2KSP A;  4QJ5 B;  1SBJ A;  5G08 A;  1BOD A;  3WHU B;  3CAB A;  1Y1U A;  4M2O A;  3SG3 A;  5AFP A;  2BBM A;  1F4O A;  1A4P A;  1XFV O;  2L4I A;  3BOW A;  1V1G A;  1YX8 A;  1KK8 B;  1DJH A;  1DJZ A;  2LMU A;  1G33 A;  2LHL A;  1KSO A;  2CTN A;  2WOR A;  2F2P A;  3DF0 B;  3GK4 X;  3I5I C;  3KO0 A;  1J1D A;  1JBA A;  1SL7 A;  5FYX A;  4DUQ A;  1XFZ O;  2JC2 A;  3CZ2 A;  1KFX L;  4HSZ A;  2V53 A;  1P28 A;  2VRG A;  1IG5 A;  1OOJ A;  2JQ6 A;  2WCL A;  3FWC A;  2GV5 A;  1IQ3 A;  1CDN A;  2FCE A;  3JVT B;  3DD4 A;  1QAS A;  4M2Q A;  1OE9 B;  2BCX A;  4R1E A;  4BY4 A;  1NSH A;  2LC5 A;  4JWQ A;  1Z2C B;  1D1O A;  1NX1 A;  1CDL A;  2OPO A;  1Z4H A;  3KHE A;  1DGU A;  1XFX O;  4JQ0 D;  1C07 A;  5ER5 A;  2KBM A;  3JVT C;  2O60 A;  3OP0 A;  1A03 A;  1YUU A;  1F4Q A;  3EK4 A;  1MXE A;  1CNP A;  5JJG A;  3N7H A;  1UHN A;  4KYN A;  4MZJ A;  1JF2 A;  5AER A;  2EC6 B;  1QJT A;  2NCO A;  1AVS A;  2LAP A;  1DJY A;  2WCE A;  1OMR A;  1OOF A;  1IRJ A;  3GK1 A;  4P5O E;  1L7Z A;  1LIN A;  5J3X A;  2B1U A;  3NXA A;  3SS4 A;  1B8L A;  1CKK A;  4XJK A;  3QME A;  1YUR A;  1IJ6 A;  1UHI A;  4NDC A;  1IH0 A;  1PVA A;  1BT6 A;  2G9B A;  1OOG A;  1AK8 A;  1QS7 A;  1NCX A;  1T14 A;  5CSF A;  1RTP 1;  3NSL A;  3CR2 A;  3TZ1 A;  4PE0 A;  3TDU A;  1LKJ A;  1N0Y A;  2KFH A;  3JTD C;  5DKR A;  2KDH A;  2QPT A;  3SG7 A;  5HKY A;  3S0A A;  1B8R A;  1QV0 A;  2K61 A;  3D0Y B;  1BU3 A;  4MRY A;  3SG2 A;  1WRK A;  1YUT A;  1M63 B;  1SCM B;  1SL9 A;  2AMI A;  2Q91 A;  2BL0 B;  4MZK A;  2QEB A;  1XFY O;  3BOW B;  3LLE A;  4PCW A;  3O6B A;  3FE6 A;  1J7Q A;  2E30 A;  1FBV A;  1KSM A;  1J7R A;  4I5N B;  1AJ4 A;  1UUR A;  2PQL A;  4HRG A;  3I5G C;  1Y1X A;  2WOS A;  2AAO A;  2WCB A;  3O2P A;  4PAL A;  1TWO A;  1Y6W A;  1QX7 A;  3PAT A;  4GNK B;  1AHR A;  1OOH A;  2ZKM X;  3OX6 A;  4HRE E;  2L0P A;  4PE7 A;  5K89 A;  1TTX A;  1DMO A;  1KCY A;  4IJ7 A;  2BKI B;  1SCM C;  1A29 A;  1X02 A;  2LUC A;  4D1E A;  4DRW A;  1DJI A;  2BL0 C;  2NZ0 A;  2MHH A;  2L4H A;  2Y1M A;  4INW A;  5I2Q A;  1OZO A;  1DF0 A;  3Q8I A;  1KFX S;  3AKB A;  3D77 A;  1W9Z A;  3R1O A;  3CZT X;  2M1U A;  5EL2 A;  3A4U B;  4Q04 A;  2GTE A;  2QAC A;  3BXK A;  3DVM A;  1CLM A;  1ZOT B;  2JWW A;  1K96 A;  2M29 A;  1HQV A;  1QIV A;  1NP8 A;  3B87 A;  4HRH A;  2FJU B;  1TIZ A;  4FQO A;  4MZL A;  2LNK A;  3DYE A;  2JNX A;  2WC5 A;  3B7A A;  1JC2 A;  1OW4 A;  1CM1 A;  5AEQ A;  3S0G A;  1W7J B;  5FI6 A;  3QRX A;  5KSZ A;  2LP3 A;  4OCI A;  1G4Y R;  3D10 A;  3PLF B;  2ZRT A;  2LV7 A;  4JD9 A;  1CLL A;  3CLN A;  1PUL A;  1ZMZ A;  2HQ8 A;  2M0R A;  1QWV A;  1F8H A;  2L5X B;  4GFT A;  4INX A;  1C7W A;  3BUO B;  3OHM B;  2F2O A;  1NCZ A;  5JOL A;  4YRU A;  3EVV A;  1CFD A;  5TNC A;  1B7T Z;  3MSE B;  5ER4 X;  1TRF A;  1B1G A;  1L2O B;  1CTR A;  2JUL A;  5F6T A;  3NSI A;  1SPY A;  1S6J A;  1K93 D;  4N5X A;  1DGV A;  4NDD A;  2KI6 C;  3O4X A;  5DIC A;  2LCP A;  1NX2 A;  4L9M A;  1B9A A;  1IJ5 A;  3VB1 A;  3AAK A;  2EHB A;  2M9G A;  3K21 A;  4UPG A;  1PVB A;  1NPQ A;  2WCJ A;  1K9K A;  1QTX A;  5B8I B;  1J7O A;  4QJ4 B;  4OKH A;  3EKH A;  3S0B A;  1JSA A;  2WCK A;  3IQQ A;  2BAP A;  3VGO A;  5CPV A;  2AUC A;  2YGU A;  1DQE A;  1L2O C;  3VRP A;  1WRL A;  1A75 A;  5HKZ A;  2L5Y A;  1FPW A;  1SKT A;  3DXL A;  4PHM A;  1NUB A;  4PE1 A;  5I8N A;  2GGZ A;  3FS7 A;  3ZNI A;  2DOQ A;  1C3Z A;  1XK4 C;  3BUW B;  1TNX A;  2KQ6 A;  1AP4 A;  3SG5 A;  1ZUZ A;  3AKA A;  3SIA A;  1TOP A;  1TNW A;  1XYD A;  3OB2 B;  4IL1 A;  4AQJ A;  1SK6 D;  5BPJ A;  1UHK A;  1DF0 B;  2L2E A;  3CZ0 A;  5HL1 A;  3TUY C;  1DEL A;  5D7F A;  1ZFS A;  5FI7 A;  2CNP A;  3EKJ A;  2ZRS A;  2M7N A;  1MF8 B;  4GUK A;  1BMO A;  1PSB A;  2KFF A;  2ZNE A;  4CFQ A;  2KYF A;  1K95 A;  1M46 A;  2P6B B;  2Y5I A;  3S0E A;  4DIR A;  2KLD A;  3FE9 A;  1EL4 A;  2ZN9 A;  3GK2 A;  3KPX A;  1KWO B;  1M45 A;  3HX4 A;  1QXP A;  3NSO A;  2LVK A;  2WCM A;  2PYQ A;  1WDC B;  2JZI A;  1QVI Z;  3SS5 A;  4PDZ A;  1XFW O;  2PMY A;  2RGI A;  4YGE B;  1QVI Y;  4CPV A;  3TDI A;  2LAN A;  3JTD B;  5KTY A;  1KFU S;  1GGZ A;  1MHO A;  1IGV A;  2CXJ A;  2LVI A;  1OZS A;  1SMG A;  1V1F A;  3BJH A;  4MSP A;  1C7V A;  1KWO C;  1EG3 A;  1QIW A;  2KYC A;  1WDC C;  2SCP A;  4F7F A;  3L47 A;  2MJW B;  3VRQ A;  2HF5 A;  3ICB A;  2LLT A;  3EK8 A;  4WQ3 A;  1CLB A;  5HKW A;  3I5G B;  2KAX A;  1K94 A;  3IF7 A;  4NDB A;  1CB1 A;  3BUX B;  1ALW A;  3IQO A;  1GJY A;  1U5I A;  5CSJ A;  1E8A A;  5I94 A;  1MWN A;  5IBW A;  4YGC B;  3R1V A;  2NLN A;  4GGF A;  1VRK A;  2JRF A;  1K9U A;  2K2A A;  5KU1 A;  1QLK A;  1LA3 A;  2MLF C;  1TCF A;  4XYN A;  2H61 C;  2H8V A;  1S26 D;  3OGN A;  1JFJ A;  3BFB A;  3WHT B;  4MEW A;  1J1E A;  3HCM A;  1JWD A;  4JKT A;  3CR4 X;  1REC A;  3CGA A;  1K8U A;  3I5H B;  1OOI X;  2OTG B;  3PAL A;  2BCB A;  3I5F C;  1NIW A;  2CT9 A;  4CID A;  2QEO A;  3C1V A;  1DT7 B;  5HLO A;  4DCK A;  2LM5 A;  3L4A A;  1CFC A;  1UHH A;  2KGR A;  2EGD A;  2MLE C;  1GM0 A;  3RZS A;  1SYM A;  4PHN A;  3OX5 A;  4PHJ A;  3UNW A;  1BLQ A;  1ORG A;  1CDP A;  4ICB A;  2K7D A;  1HT9 A;  2NXQ A;  2QDI A;  3V2L A;  2SAS A;  4N1G A;  4C0J A;  2F3Y A;  3S0F A;  3ZWH A;  2PSR A;  2TN4 A;  3I5H C;  2OTG C;  2OS8 B;  3KEV A;  1SR6 B;  1S3P A;  2K7C A;  3PM8 A;  3NSK A;  2COL B;  2JNF A;  1YRU B;  2MAZ A;  1WY9 A;  2JU0 A;  1AUI B;  2I2R E;  2JXC A;  3DF0 A;  3GOF A;  3H4S E;  3PFV A;  1FI5 A;  4MRX A;  5D69 A;  2K0J A;  1UHJ A;  1KFU L;  2K60 A;  3NGV A;  1N2D A;  1ODB A;  5DKN A;  1RWY A;  3CDN A;  5FI2 A;  1RK9 A;  1SSE B;  2KOT A;  1AJ5 A;  1NWD A;  2QEH A;  1BF5 A;  3O78 A;  1XFU O;  2FOT A;  2OS8 C;  3K1E A;  4XJK B;  3BUM B;  3VRO A;  1SR6 C;  3SS3 A;  4AOM A;  1UP5 A;  1K9P A;  1MR8 A;  1KQM B;  2KPH A;  4YGB B;  5AXI A;  1PRW A;  3B88 A;  1DC1 A;  3DZT A;  2PVB A;  3BUN B;  4MLW A;  1K90 D;  4YBH B;  3D74 A;  1A2X A;  4A4B A;  1XO5 A;  1YVH A;  3B6X A;  3D78 A;  3FIA A;  2PAS A;  3BFA A;  3R72 A;  4YGA A;  4F0Z B;  2MRD A;  1LA0 A;  1K2H A;  4MVF A;  1WLM A;  1F70 A;  1XVJ A;  4C0L A;  2ZFD A;  4I5J A;  1KQM C;  3DVJ A;  1DTL A;  1OQP A;  1BR1 B;  1PK0 D;  3TUY B;  1UWO A;  2KAV A;  4NQG A;  1LS8 A;  2KHN A;  1CFP A;  1B8C A;  2WCH A;  3S0D A;  4BY5 A;  1CM4 A;  3DVE A;  3AAJ A;  1EXR A;  2PRU A;  1CMF A;  1QX2 A;  1B4C A;  4FQT A;  3WXA A;  3CZ1 A;  2WC6 A;  3B86 A;  4ETO A;  4GPL B;  1W7I B;  5CSN A;  2K7B A;  3FE8 A;  1MQ1 A;  1TN4 A;  2LUX A;  1JFK A;  2R2I A;  1SRA A;  1IQ5 A;  2LP2 A;  1M31 A;  2KFG A;  3D0Y A;  3D73 A;  1C3Y A;  2NCP A;  4JPZ B;  4CFR A;  1NX0 A;  5CSI A;  4PHK A;  3SG4 A;  1NYA A;  2IS9 A;  4OV2 A;  2F3Z A;  2O5G A;  2ISD A;  1SNL A;  3KF9 A;  2LVV A;  2Y4Q A;  4I5L B;  4OZD A;  2HQW A;  4M2P A;  2Y1N A;  1Y0V H;  1S36 A;  2LMT A;  1IKU A;  1YR5 A;  2E6W A;  3A8R A;  4YGD B;  2KQY A;  1R2U A;  2H2K A;  2M3W A;  2WC8 A;  2KNE A;  3LCP C;  3O4Y A;  5GQQ C;  4YI9 A;  1GGW A;  1KQV A;  1YRT B;  3RLZ A;  1KK8 C;  2KBI A;  2LMV A;  3R1P A;  5PAL A;  1ALV A;  1FI6 A;  1DJX A;  2D8N A;  2CBL A;  5D3O A;  1YUS A;  1TUJ A;  1Q80 A;  1G8I A;  1LVC D;  2P70 A;  2ZND A;  3FWB A;  3DY9 A;  4DS7 A;  1S6I A;  1FW4 A;  1YX7 A;  1TUZ A;  2Q4U A;  1DJG A;  1CDM A;  2KAY A;  3F45 A;  4E68 A;  1IIO A;  3NHI A;  4ORB B;  1WLZ A;  3OBV A;  3CS1 A;  2GGM A;  4FTG A;  1Y1A A;  2BEC A;  2G2B A;  1SW8 A;  3I5F B;  1SCV A;  1XFR A;  4N1F A;  1A75 B;  4GBA A;  1S1E A;  2BCA A;  1PSR A;  3BFH A;  4TNC A;  3RM1 A;  2HET A;  4MBE A;  2JOJ A;  2PAL A;  4PE4 A;  3D76 A;  3SG6 A;  2I18 A;  2JPO A;  2P71 A;  3LK1 A;  1BOC A;  4U8D A;  2EC6 C;  2BBN A;  1RRO A;  2JT8 A;  2KLE A;  3LL8 B;  1F54 A;  1YVL A;  1YTZ C;  1BJF A;  1XK4 A; 
#chains in the Genus database with same CATH homology
 1RFJ A;  3CR5 X;  3TS5 B;  1XA5 A;  1ZAC A;  2M49 B;  5AAN A;  1N65 A;  1FF1 A;  2KI6 D;  1F71 A;  1R6P A;  1KK7 Z;  4MN0 A;  5DKQ A;  1H4B A;  1TNQ A;  1H8B A;  1OMD A;  1PAL A;  1JF0 A;  1KK7 Y;  1QAT A;  1DJW A;  3PN7 B;  1TNP A;  4ZCV A;  2F33 A;  4WRI A;  2L51 A;  3TDZ A;  3WNX B;  3M0W A;  2M1K B;  2WCF A;  1M39 A;  1J55 A;  2L98 A;  4GGN A;  1JUO A;  1UUS A;  3TS5 C;  4P2Y B;  3SIB A;  4ORC B;  1SY9 A;  2M8U A;  1QX5 B;  2LLS A;  4YI8 A;  2A4J A;  1CMG A;  5HLV A;  2LLU A;  2CCM A;  1IWQ A;  2F8P A;  1QV1 A;  1NCY A;  2MA2 A;  3OB1 B;  2BE6 A;  3PN7 C;  2ZN8 A;  1EG4 A;  1LXF C;  4QJ3 B;  4WQ2 A;  1OSA A;  2K7O A;  3EK7 A;  2JPT A;  1CFF A;  3LK0 A;  1B47 A;  1GQM A;  1S6C A;  2I94 A;  4GAO A;  4ORA B;  2JT3 A;  4ZCU A;  2JT0 A;  1J7P A;  3E3R A;  3PSR A;  1U5I B;  2JTT A;  2LHI A;  1F55 A;  2M97 A;  3VRR A;  2KI4 B;  4OVN F;  4AQI A;  1WRZ A;  2BKH B;  2K8M B;  3SJS A;  2HPS A;  4A4C A;  4C0K A;  2JTZ A;  2L50 A;  3CTN A;  4I5K A;  4CLN A;  2BE4 A;  1EJ3 A;  2LVJ A;  3EVU A;  3BQ3 A;  5I2L A;  2MBX A;  5HYD A;  5I2O A;  2JXL A;  2I7A A;  2KGB C;  1MUX A;  3CWG A;  1S5G Z;  3EVR A;  1NX3 A;  3DVK A;  4USL A;  2KI4 C;  1B7T Y;  1SL8 A;  1DVI A;  2M7L A;  1EH2 A;  4GGF C;  1OMV A;  1S5G Y;  1BR4 B;  1BG1 A;  3I5I B;  3VRN A;  2H61 A;  4OR9 B;  1QLS A;  2LE9 B;  2WND A;  1TCO B;  2K2F A;  2FCD A;  1RJV A;  3BYA A;  1MXL C;  2KSP A;  4QJ5 B;  1SBJ A;  5G08 A;  1BOD A;  3WHU B;  3SG3 A;  1Y1U A;  4M2O A;  5AFP A;  2BBM A;  1F4O A;  1A4P A;  1XFV O;  2L4I A;  3BOW A;  1V1G A;  1YX8 A;  1KK8 B;  1DJH A;  1DJZ A;  2LMU A;  1G33 A;  2LHL A;  1KSO A;  2CTN A;  2WOR A;  2F2P A;  3DF0 B;  3GK4 X;  3I5I C;  3KO0 A;  1J1D A;  1JBA A;  1SL7 A;  5FYX A;  4DUQ A;  1XFZ O;  2JC2 A;  4HSZ A;  1KFX L;  2V53 A;  2VRG A;  1IG5 A;  1OOJ A;  2JQ6 A;  3FWC A;  1IQ3 A;  2GV5 A;  1CDN A;  2FCE A;  3JVT B;  3DD4 A;  1QAS A;  4M2Q A;  1OE9 B;  2BCX A;  4R1E A;  4BY4 A;  1NSH A;  2LC5 A;  4JWQ A;  1D1O A;  1NX1 A;  1CDL A;  2OPO A;  3KHE A;  1DGU A;  1XFX O;  4JQ0 D;  1C07 A;  5ER5 A;  2KBM A;  3JVT C;  2O60 A;  3OP0 A;  1A03 A;  1YUU A;  1F4Q A;  3EK4 A;  1MXE A;  1CNP A;  5JJG A;  1UHN A;  4MZJ A;  1JF2 A;  5AER A;  2EC6 B;  1QJT A;  2NCO A;  1AVS A;  2LAP A;  1DJY A;  2WCE A;  1OMR A;  3GK1 A;  1IRJ A;  4P5O E;  1L7Z A;  1LIN A;  5J3X A;  2B1U A;  3NXA A;  1B8L A;  1CKK A;  4XJK A;  1YUR A;  1IJ6 A;  1UHI A;  4NDC A;  1IH0 A;  1PVA A;  1BT6 A;  2G9B A;  1AK8 A;  1QS7 A;  1NCX A;  5CSF A;  1RTP 1;  3NSL A;  3CR2 A;  3TZ1 A;  4PE0 A;  3TDU A;  1LKJ A;  1N0Y A;  2KFH A;  3JTD C;  5DKR A;  2KDH A;  2QPT A;  3SG7 A;  5HKY A;  1B8R A;  1QV0 A;  2K61 A;  3D0Y B;  1BU3 A;  4MRY A;  3SG2 A;  1WRK A;  1YUT A;  1M63 B;  1SCM B;  1SL9 A;  2AMI A;  2Q91 A;  2BL0 B;  4MZK A;  1XFY O;  3BOW B;  3LLE A;  4PCW A;  3O6B A;  1J7Q A;  2E30 A;  1FBV A;  1KSM A;  1J7R A;  4I5N B;  1AJ4 A;  1UUR A;  4HRG A;  3I5G C;  1Y1X A;  2WOS A;  2AAO A;  2WCB A;  3O2P A;  4PAL A;  1Y6W A;  1QX7 A;  3PAT A;  4GNK B;  1AHR A;  2ZKM X;  3OX6 A;  4HRE E;  4PE7 A;  2L0P A;  5K89 A;  1DMO A;  1TTX A;  1KCY A;  2BKI B;  1SCM C;  1A29 A;  1X02 A;  2LUC A;  4D1E A;  4DRW A;  1DJI A;  2BL0 C;  2NZ0 A;  2MHH A;  2L4H A;  2Y1M A;  5I2Q A;  1OZO A;  1DF0 A;  1KFX S;  3AKB A;  3CZT X;  2M1U A;  3A4U B;  4Q04 A;  2QAC A;  3BXK A;  3DVM A;  1CLM A;  1ZOT B;  2JWW A;  1K96 A;  2M29 A;  1HQV A;  1QIV A;  1NP8 A;  4HRH A;  2FJU B;  1TIZ A;  4FQO A;  4MZL A;  2LNK A;  1JC2 A;  2JNX A;  1CM1 A;  5AEQ A;  1W7J B;  3QRX A;  5KSZ A;  2LP3 A;  4OCI A;  1G4Y R;  3D10 A;  3PLF B;  2ZRT A;  2LV7 A;  1CLL A;  3CLN A;  1PUL A;  1ZMZ A;  2HQ8 A;  2M0R A;  1F8H A;  2L5X B;  4GFT A;  1C7W A;  3BUO B;  3OHM B;  2F2O A;  1NCZ A;  5JOL A;  4YRU A;  3EVV A;  1CFD A;  5TNC A;  1B7T Z;  3MSE B;  5ER4 X;  1TRF A;  1B1G A;  1L2O B;  1CTR A;  2JUL A;  5F6T A;  3NSI A;  1SPY A;  1S6J A;  1K93 D;  4N5X A;  1DGV A;  4NDD A;  2KI6 C;  2LCP A;  1NX2 A;  4L9M A;  1B9A A;  1IJ5 A;  4UPG A;  3AAK A;  2EHB A;  2M9G A;  3K21 A;  1PVB A;  1NPQ A;  5B8I B;  1K9K A;  1QTX A;  1J7O A;  4QJ4 B;  4OKH A;  3EKH A;  1JSA A;  3IQQ A;  3VGO A;  5CPV A;  2AUC A;  3VRP A;  1L2O C;  1WRL A;  1A75 A;  5HKZ A;  1FPW A;  1SKT A;  4PHM A;  1NUB A;  4PE1 A;  5I8N A;  2GGZ A;  3FS7 A;  3ZNI A;  2DOQ A;  1XK4 C;  3BUW B;  1AP4 A;  1TNX A;  2KQ6 A;  3SG5 A;  1ZUZ A;  3AKA A;  3SIA A;  1TOP A;  1TNW A;  1XYD A;  3OB2 B;  4IL1 A;  4AQJ A;  1SK6 D;  5BPJ A;  1UHK A;  1DF0 B;  2L2E A;  3TUY C;  5D7F A;  1ZFS A;  2CNP A;  3EKJ A;  2ZRS A;  2M7N A;  1MF8 B;  4GUK A;  1BMO A;  1PSB A;  2KFF A;  2ZNE A;  4CFQ A;  2KYF A;  1K95 A;  1M46 A;  2P6B B;  2Y5I A;  4DIR A;  1EL4 A;  2ZN9 A;  3GK2 A;  3KPX A;  1KWO B;  1M45 A;  3HX4 A;  1QXP A;  3NSO A;  2LVK A;  1WDC B;  2JZI A;  1QVI Z;  4PDZ A;  1XFW O;  2PMY A;  2RGI A;  4YGE B;  1QVI Y;  4CPV A;  3TDI A;  2LAN A;  3JTD B;  5KTY A;  1KFU S;  1GGZ A;  1MHO A;  1IGV A;  2CXJ A;  2LVI A;  1OZS A;  1SMG A;  1V1F A;  4MSP A;  1C7V A;  1KWO C;  1EG3 A;  1QIW A;  2KYC A;  1WDC C;  2SCP A;  2MJW B;  3VRQ A;  2HF5 A;  3ICB A;  2LLT A;  3EK8 A;  4WQ3 A;  1CLB A;  5HKW A;  3I5G B;  2KAX A;  1K94 A;  3IF7 A;  4NDB A;  1CB1 A;  3BUX B;  1ALW A;  3IQO A;  1GJY A;  1U5I A;  5CSJ A;  1E8A A;  1MWN A;  5IBW A;  4YGC B;  2NLN A;  4GGF A;  1VRK A;  2JRF A;  1K9U A;  2K2A A;  5KU1 A;  1QLK A;  1LA3 A;  2MLF C;  1TCF A;  4XYN A;  2H61 C;  1S26 D;  1JFJ A;  3WHT B;  4MEW A;  1J1E A;  3HCM A;  1JWD A;  3CR4 X;  1REC A;  3CGA A;  1K8U A;  3I5H B;  2OTG B;  3PAL A;  2BCB A;  3I5F C;  1NIW A;  2CT9 A;  4CID A;  3C1V A;  1DT7 B;  5HLO A;  4DCK A;  2LM5 A;  1CFC A;  1UHH A;  2KGR A;  2EGD A;  2MLE C;  1SYM A;  4PHN A;  3OX5 A;  4PHJ A;  1BLQ A;  1CDP A;  4ICB A;  2K7D A;  1HT9 A;  2NXQ A;  4C0J A;  2SAS A;  4N1G A;  2F3Y A;  3ZWH A;  2PSR A;  2TN4 A;  3I5H C;  2OTG C;  2OS8 B;  3KEV A;  1SR6 B;  1S3P A;  2K7C A;  3PM8 A;  3NSK A;  2COL B;  2JNF A;  1YRU B;  2MAZ A;  1WY9 A;  2JU0 A;  1AUI B;  2I2R E;  2JXC A;  3DF0 A;  3GOF A;  3H4S E;  3PFV A;  1FI5 A;  4MRX A;  5D69 A;  2K0J A;  1UHJ A;  1KFU L;  1N2D A;  1ODB A;  5DKN A;  1RWY A;  1RK9 A;  2KOT A;  1AJ5 A;  1NWD A;  1BF5 A;  3O78 A;  1XFU O;  2FOT A;  2OS8 C;  4XJK B;  3BUM B;  3VRO A;  1SR6 C;  4AOM A;  1UP5 A;  1K9P A;  1MR8 A;  1KQM B;  4YGB B;  5AXI A;  1PRW A;  2PVB A;  3BUN B;  4MLW A;  1K90 D;  4YBH B;  1A2X A;  4A4B A;  1XO5 A;  1YVH A;  3FIA A;  4YGA A;  4F0Z B;  2PAS A;  2MRD A;  1LA0 A;  1K2H A;  4MVF A;  1WLM A;  1F70 A;  1XVJ A;  4C0L A;  2ZFD A;  4I5J A;  1KQM C;  3DVJ A;  1DTL A;  1OQP A;  1BR1 B;  1PK0 D;  3TUY B;  1UWO A;  2KAV A;  4NQG A;  2KHN A;  1CFP A;  1B8C A;  4BY5 A;  1CM4 A;  3DVE A;  3AAJ A;  1EXR A;  2PRU A;  1CMF A;  1QX2 A;  1B4C A;  3WXA A;  4ETO A;  4GPL B;  1W7I B;  5CSN A;  2K7B A;  1MQ1 A;  1TN4 A;  2LUX A;  1JFK A;  2R2I A;  1SRA A;  1IQ5 A;  2LP2 A;  1M31 A;  2KFG A;  3D0Y A;  2NCP A;  4JPZ B;  4CFR A;  1NX0 A;  5CSI A;  4PHK A;  3SG4 A;  1NYA A;  2IS9 A;  4OV2 A;  2F3Z A;  2O5G A;  2ISD A;  1SNL A;  3KF9 A;  2LVV A;  2Y4Q A;  4I5L B;  2HQW A;  4M2P A;  2Y1N A;  1Y0V H;  1S36 A;  2LMT A;  1IKU A;  1YR5 A;  2E6W A;  3A8R A;  4YGD B;  2KQY A;  1R2U A;  2H2K A;  2M3W A;  2WC8 A;  2KNE A;  3LCP C;  3O4Y A;  5GQQ C;  4YI9 A;  1GGW A;  1KQV A;  1YRT B;  3RLZ A;  1KK8 C;  2KBI A;  2LMV A;  5PAL A;  1ALV A;  1FI6 A;  1DJX A;  2D8N A;  2CBL A;  1YUS A;  1Q80 A;  1G8I A;  1LVC D;  2ZND A;  3FWB A;  4DS7 A;  1S6I A;  1FW4 A;  1YX7 A;  2Q4U A;  1DJG A;  1CDM A;  2KAY A;  3F45 A;  4E68 A;  4ORB B;  1WLZ A;  3CS1 A;  2GGM A;  4FTG A;  1Y1A A;  2BEC A;  2G2B A;  1SW8 A;  3I5F B;  1SCV A;  4N1F A;  1A75 B;  4GBA A;  1S1E A;  2BCA A;  1PSR A;  4TNC A;  3RM1 A;  2HET A;  4MBE A;  2JOJ A;  2PAL A;  4PE4 A;  3SG6 A;  2I18 A;  3LK1 A;  1BOC A;  4U8D A;  2EC6 C;  2BBN A;  1RRO A;  2JT8 A;  3LL8 B;  1F54 A;  1YVL A;  1YTZ C;  1BJF A;  1XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...