3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
2Y4QA 3FS7A 5B8IB 5I2OA 1U5IB 2LP2A 4YRUA 1DJXA 4NDCA 1BJFA 5DKQA 3BXKA 1ZACA 3SG4A 1GGWA 3CZTX 1ALWA 2KFHA 2M0RA 5CPVA 3RM1A 2Y1NA 3SG6A 1IG5A 4GBAA 3VRRA 2NCPA 2KAVA 3DVMA 2F33A 1BOCA 2LC5A 3LK0A 5D69A 1ZMZA 1CM1A 3FWCA 4ORAB 4P5OE 5HKWA 2K2AA 1U5IA 1KSOA 4TNCA 1AJ4A 3CS1A 2TN4A 1R6PA 3TZ1A 1LXFC 1Y1XA 2Q4UA 1EH2A 1ZUZA 2Q91A 2ISDA 3EVUA 2NXQA 1C7WA 3GK1A 3TUYC 1IGVA 1IQ5A 1NPQA 2F8PA 1S3PA 1OE9B 2BL0C 1SL8A 4PDZA 2WCFA 4CFQA 1DT7B 2CCMA 2KHNA 2CXJA 2KBIA 3LK1A 4AOMA 1WDCB 1LVCD 2BKHB 2BBNA 5BPJA 3SG3A 1TNQA 3PLFB 3GK2A 1CFPA 2OPOA 1TNXA 1IH0A 2K8MB 5HYDA 1ALVA 1F8HA 1WRZA 1CFFA 1L2OB 1G4YR 1ODBA 2COLB 2LE9B 5CSFA 2CNPA 4XJKB 1L2OC 1OMVA 2OS8B 3AAKA 1TCOB 2KI6C 1QV1A 5HLOA 1UURA 2JTZA 2I18A 1TTXA 3VGOA 1SL9A 4GPLB 1BMOA 4YBHB 1UUSA 2AUCA 2K7CA 1HT9A 3EKHA 3EVRA 1WDCC 1K96A 4PCWA 4MBEA 1DTLA 1CM4A 1G8IA 1PULA 1DMOA 2CT9A 2KAYA 2L2EA 1NX0A 1BG1A 2M49B 5ER4X 3DVJA 5TNCA 1CFCA 4NDBA 3DD4A 2M97A 1J1EA 1MHOA 1RFJA 2F2OA 4XJKA 1F71A 5ER5A 2ZN9A 1IWQA 4MVFA 1B7TY 5GQQC 1HQVA 1TN4A 4AQIA 4I5NB 1SK6D 2E6WA 1QX5B 1S26D 1K9KA 3CR5X 2L4HA 5D7FA 1YUSA 1DF0B 1WLZA 3BUOB 3O4YA 1K2HA 2F2PA 5G08A 5KU1A 1OZSA 1AUIB 2BE4A 4WQ2A 1LA0A 4E68A 2JC2A 1JUOA 3SG5A 2M1KB 3DF0B 1YTZC 1NX3A 2NLNA 2ZN8A 3JTDC 2JNFA 1B8RA 2KAXA 1EXRA 1CTRA 2SASA 1TIZA 3F45A 1EL4A 1XVJA 2MRDA 4YGDB 4N5XA 2MBXA 4D1EA 1PVAA 1J7QA 1TNWA 1FBVA 2EGDA 1IJ6A 4MSPA 1GJYA 1KSMA 1RJVA 1M46A 2MHHA 2KQ6A 3PM8A 1MF8B 2Y5IA 3ICBA 4NDDA 3DF0A 3OB2B 3OX6A 2I94A 2EHBA 3PN7C 5KSZA 4MRXA 2ZFDA 1UWOA 1FI6A 1F4OA 5CSNA 1X02A 1SY9A 3KPXA 2DOQA 2L5XB 1V1FA 2CBLA 1CDPA 2KSPA 1QX2A 1A29A 4PALA 4OVNF 2WNDA 2LLTA 2NZ0A 2PALA 1J7PA 1DJHA 3CR4X 4GFTA 1FI5A 3AKAA 3OHMB 1SR6B 2A4JA 2JQ6A 1CLLA 2KYFA 1QJTA 4I5KA 4OKHA 1QTXA 2AMIA 2JPTA 1NSHA 5JJGA 1W7IB 1AJ5A 2FOTA 3KEVA 3KHEA 1S6JA 4YGAA 1QLKA 3CWGA 3NSOA 2LMUA 1OSAA 3BUWB 5DKRA 4OV2A 2JNXA 3FIAA 3ZNIA 3SIAA 3BUMB 3SIBA 2GV5A 1KQMC 1KWOB 1PSBA 3AKBA 5KTYA 1UP5A 1XFZO 3NSKA 3IQQA 1QS7A 2BCAA 2AAOA 3DVKA 4M2OA 1KFXS 2D8NA 3HX4A 2LMVA 4HRGA 4YGBB 5J3XA 1M31A 1CLMA 3ZWHA 1YX8A 3EK4A 1B47A 1J7OA 1BT6A 1AVSA 2CTNA 2FCEA 2OTGB 2HQ8A 3A8RA 3SG2A 4OCIA 3SG7A 4A4CA 1QVIY 3WHUB 4PE1A 2LANA 1NYAA 1S6IA 2RGIA 5AFPA 2LVIA 1K90D 1F70A 4U8DA 3TDUA 2LVJA 4MRYA 2BCXA 1DF0A 5IBWA 1K93D 2GGMA 3D0YB 3NSLA 4QJ4B 1SRAA 3QRXA 4ETOA 1KFUL 2L51A 1QLSA 3TS5B 2LM5A 3RLZA 2H61C 1S1EA 4ZCVA 1NCYA 3JTDB 4I5LB 1R2UA 2K7DA 1YX7A 2PRUA 2OS8C 1SCVA 3TUYB 2KFFA 1B8CA 4MLWA 3PSRA 4YI9A 1KK7Y 1M45A 1IRJA 1QV0A 3LLEA 3NXAA 1KQVA 3HCMA 1F4QA 3GOFA 2HF5A 5F6TA 1YURA 2I2RE 4HSZA 4UPGA 1NIWA 2K7BA 1L7ZA 2M3WA 4JQ0D 4WQ3A 1BODA 1S6CA 2M7LA 4DS7A 1B1GA 1FPWA 1DJWA 3CR2A 1YRUB 2JOJA 1XO5A 2KGBC 4FQOA 1H4BA 2WCBA 4DRWA 4GGFA 4PE7A 1MQ1A 2L4IA 3TDZA 1F54A 4HREE 1SW8A 3KO0A 3LCPC 2BKIB 1S5GY 1PSRA 4JPZB 2PSRA 2LNKA 1JC2A 4JWQA 1DGVA 3O78A 1XK4C 1UHJA 3OP0A 4PHJA 2OTGC 5HLVA 3WNXB 2BECA 3BUNB 3LL8B 4MN0A 1FW4A 3BOWB 2GGZA 1MWNA 2H2KA 2KYCA 1Y1UA 1BF5A 1WRKA 5HKYA 1W7JB 3I5IC 1YR5A 1S5GZ 5PALA 1NUBA 4C0JA 2KQYA 1SBJA 2LMTA 3H4SE 2ZNDA 1XK4A 4AQJA 4DIRA 1TOPA 1GGZA 2ZRTA 2MLFC 3PATA 1K9UA 1IQ3A 1A4PA 3OX5A 4MZLA 1JFKA 3VRQA 1CLBA 1EG3A 3I5GB 1MUXA 1SKTA 2JT0A 2SCPA 1RK9A 4ICBA 2LP3A 3I5FB 1SR6C 5AANA 3DVEA 1K95A 1LINA 1KK8B 4FTGA 2H61A 2JT8A 3MSEB 4ORBB 4PHNA 1JWDA 1JSAA 2BBMA 2O5GA 2HQWA 1IJ5A 3VRPA 2NCOA 1KK7Z 1OMDA 3BUXB 2QPTA 1RWYA 4NQGA 2K7OA 2KDHA 1D1OA 2JXCA 4CLNA 4YGCB 1WY9A 1BR1B 1Y6WA 1XA5A 1S36A 3PN7B 1UHIA 1H8BA 2WCEA 3I5HC 1CFDA 1NCZA 1KFUS 4R1EA 1JBAA 1XFUO 1OOJA 1JF0A 3D0YA 5I2QA 2WORA 4XYNA 2M9GA 4PE4A 3OB1B 1Q80A 1PALA 1OQPA 1DJGA 1TNPA 5AERA 3TDIA 3CGAA 1K9PA 1SCMB 2G9BA 1QXPA 1Y0VH 2I7AA 1XFXO 1DJYA 2PMYA 2O60A 3I5FC 1OZOA 4P2YB 1JFJA 2KI4C 2JWWA 3IF7A 4F0ZB 4WRIA 1KCYA 1QVIZ 2LVVA 1YRTB 4GGNA 3JVTC 1BU3A 1UHHA 1WLMA 1YVLA 5HKZA 2F3ZA 1SNLA 1CDNA 3EK7A 1QIVA 2KGRA 4GGFC 1TRFA 4BY4A 2LUCA 2IS9A 3A4UB 4CIDA 1J55A 1YVHA 3TS5C 5CSIA 3VROA 2B1UA 1C7VA 2KOTA 2LV7A 4ZCUA 4DCKA 2LLUA 1E8AA 2M7NA 3E3RA 4IL1A 1A03A 1AK8A 1XFVO 4L9MA 3PALA 1CNPA 4BY5A 1CB1A 3FWBA 5AEQA 1F55A 2ZKMX 3IQOA 1M63B 4N1GA 1LKJA 1N65A 1Y1AA 2BL0B 4PHMA 1CMGA 4OR9B 1XFWO 3BOWA 1QX7A 1PK0D 1V1GA 1SPYA 4MZKA 2EC6B 3I5HB 1TCFA 5I8NA 2BCBA 2L98A 1LA3A 4MEWA 2KFGA 1YUTA 2LUXA 4YGEB 3WHTB 1NX2A 2R2IA 1QIWA 4M2QA 2JTTA 2P6BB 1SL7A 3D10A 2M1UA 2QACA 2KI4B 2Y1MA 2LCPA 1FF1A 3EVVA 2HETA 1CKKA 2KI6D 3CLNA 2ZRSA 3C1VA 1JF2A 1ZOTB 1NX1A 1IKUA 3M0WA 1UHNA 3BYAA 1SMGA 4QJ5B 2FCDA 3O2PA 2MJWB 1MR8A 1NWDA 1DGUA 1RTP1 5JOLA 1J7RA 2PASA 5AXIA 3GK4X 3SJSA 5DKNA 2LHIA 1K8UA 1QASA 2FJUB 4GUKA 3CTNA 2G2BA 2L50A 1YUUA 1N2DA 3WXAA 3JVTB 1B4CA 2JXLA 2LAPA 2F3YA 2L0PA 1PRWA 1B7TZ 2JZIA 4C0LA 5FYXA 2PVBA 2WC8A 4M2PA 1QATA 3AAJA 5K89A 1CDMA 2JU0A 3I5GC 1BR4B 2JRFA 2K2FA 4DUQA 4A4BA 1RROA 2E30A 4PE0A 3PFVA 1DJZA 1B9AA 2JULA 1RECA 4MZJA 2KBMA 1EJ3A 1OMRA 1NP8A 1DJIA 4YI8A 1UHKA 1PVBA 3KF9A 3O6BA 4N1FA 4ORCB 1KQMB 1KWOC 1K94A 1MXLC 4HRHA 2WOSA 1J1DA 1AHRA 1A75B 4GNKB 2MA2A 1B8LA 1WRLA 1ZFSA 4Q04A 1SYMA 2KNEA 2ZNEA 1DVIA 1KFXL 3EK8A 4PHKA 2EC6C 1BLQA 1NCXA 2LLSA 1XFYO 2K61A 2V53A 1SCMC 1KK8C 3NSIA 1AP4A 2BE6A 2MLEC 1GQMA 3K21A 4GAOA 2LHLA 3VRNA 3BQ3A 5CSJA 1CDLA 3I5IB 4USLA 4C0KA 1A75A 1N0YA 2VRGA 3EKJA 2MAZA 2LVKA 2M8UA 4QJ3B 1MXEA 1XYDA 1A2XA 2JT3A 5I2LA 4I5JA 2HPSA 1G33A 2M29A 4CPVA 1M39A 1CMFA 4CFRA 1VRKA 1C07A 1EG4A 2K0JA
chains in the Genus database with same CATH superfamily
2Y4QA 3FS7A 5B8IB 5I2OA 1U5IB 2LP2A 4YRUA 1DJXA 2GTEA 4NDCA 1BJFA 5DKQA 3BXKA 1ZACA 3SG4A 1GGWA 3CZTX 1ALWA 2KFHA 2M0RA 5CPVA 3RM1A 2Y1NA 3DXLA 3SG6A 1IG5A 4GBAA 3VRRA 2NCPA 2KAVA 3DVMA 3D74A 2JPOA 2F33A 1BOCA 2LC5A 3LK0A 5D69A 1ZMZA 1CM1A 3FWCA 4ORAB 4JD9A 4P5OE 5HKWA 2K2AA 3QMEA 3BFAA 1U5IA 1KSOA 4TNCA 1AJ4A 3CS1A 3K1EA 2TN4A 1R6PA 3TZ1A 1LXFC 1Y1XA 2Q4UA 1EH2A 1ZUZA 2Q91A 2ISDA 3EVUA 2NXQA 1C7WA 3GK1A 3TUYC 1GM0A 1IGVA 1IQ5A 1NPQA 2F8PA 1S3PA 1OE9B 2BL0C 1SL8A 4PDZA 2WCFA 4CFQA 1DT7B 2CCMA 2KHNA 2CXJA 1TWOA 5EL2A 2KBIA 1XFRA 3LK1A 4AOMA 1WDCB 1LVCD 2BKHB 2BBNA 5BPJA 1TUZA 3SG3A 1TNQA 3PLFB 3GK2A 4F7FA 1CFPA 2OPOA 1TNXA 1IH0A 2K8MB 5HYDA 1ALVA 1F8HA 1WRZA 3D78A 3CDNA 1CFFA 1L2OB 1G4YR 3B7AA 1ODBA 2COLB 2LE9B 5CSFA 2CNPA 4XJKB 1L2OC 1OMVA 2OS8B 3AAKA 1TCOB 2KI6C 1QV1A 5HLOA 1UURA 1OOGA 2JTZA 2I18A 1TTXA 3VGOA 1SL9A 4GPLB 1BMOA 4YBHB 3DY9A 1UUSA 2AUCA 2K7CA 1HT9A 3EKHA 3EVRA 1WDCC 1K96A 4PCWA 4MBEA 1DTLA 1CM4A 1G8IA 1PULA 1DMOA 2CT9A 2KAYA 2L2EA 1LS8A 1NX0A 1BG1A 2M49B 5ER4X 3DVJA 5TNCA 1CFCA 4NDBA 3DD4A 2M97A 1J1EA 1MHOA 1RFJA 2F2OA 4XJKA 1F71A 5ER5A 2ZN9A 1IWQA 4MVFA 2YGUA 1B7TY 5GQQC 1HQVA 1TN4A 4AQIA 4I5NB 1SK6D 2E6WA 1QX5B 1OOIX 1S26D 4KYNA 1K9KA 3CR5X 1C3ZA 2L4HA 5D7FA 1YUSA 1DF0B 1WLZA 3BUOB 3O4YA 1K2HA 2BAPA 2F2PA 5G08A 2WCHA 5KU1A 1OZSA 1AUIB 2BE4A 4WQ2A 1LA0A 3BFHA 4E68A 2JC2A 1JUOA 3SG5A 2M1KB 3DF0B 1YTZC 1SSEB 3B88A 1NX3A 2NLNA 2ZN8A 3JTDC 2JNFA 3VB1A 1B8RA 2KAXA 1EXRA 1CTRA 2SASA 2WCMA 1TIZA 3F45A 1EL4A 1XVJA 2MRDA 4YGDB 4N5XA 2MBXA 4D1EA 1PVAA 1J7QA 1TNWA 1FBVA 2EGDA 1IJ6A 2WCLA 3UNWA 4MSPA 1GJYA 1KSMA 1RJVA 1M46A 2MHHA 2KQ6A 3PM8A 1MF8B 2Y5IA 3ICBA 4NDDA 3S0EA 3DF0A 3OB2B 3OX6A 2I94A 2EHBA 2KPHA 3PN7C 5KSZA 1C3YA 4MRXA 2ZFDA 1UWOA 1FI6A 1F4OA 5CSNA 1X02A 1SY9A 3KPXA 5I94A 2DOQA 2L5XB 1V1FA 2CBLA 1CDPA 2KSPA 1QX2A 1A29A 3NHIA 4OVNF 2WNDA 2LLTA 2NZ0A 2PALA 1J7PA 1DJHA 3CR4X 4GFTA 1FI5A 3AKAA 2BNXA 1SR6B 3L47A 3OHMB 2A4JA 2JQ6A 1CLLA 2KYFA 2WCJA 1QJTA 4I5KA 4OKHA 1QTXA 2AMIA 2JPTA 1NSHA 5JJGA 1W7IB 1AJ5A 2FOTA 3B6XA 3KEVA 3KHEA 1S6JA 3D77A 4YGAA 3OGNA 1QLKA 3Q8IA 3SS4A 3CWGA 3NSOA 2LMUA 1OSAA 3BUWB 5DKRA 4OV2A 2JNXA 3FIAA 3ZNIA 3SIAA 1ORGA 3BUMB 3SIBA 2GV5A 1KQMC 1KWOB 1PSBA 3AKBA 5KTYA 3FE6A 1UP5A 1XFZO 3NSKA 4PALA 3IQQA 1QS7A 2BCAA 2AAOA 3DVKA 4M2OA 3R72A 1KFXS 2D8NA 3HX4A 2LMVA 4HRGA 4YGBB 5J3XA 1M31A 2KLDA 1CLMA 3ZWHA 1YX8A 3EK4A 1B47A 1J7OA 1BT6A 1AVSA 2CTNA 2FCEA 2OTGB 2HQ8A 3A8RA 3SG2A 4OCIA 3SG7A 4A4CA 1QVIY 3WHUB 4PE1A 2LANA 1NYAA 1S6IA 2RGIA 5AFPA 2LVIA 1K90D 1F70A 4U8DA 3TDUA 3PM2A 2LVJA 4MRYA 3BFBA 2BCXA 1DF0A 5IBWA 1K93D 2GGMA 3D0YB 3NSLA 4QJ4B 1SRAA 3QRXA 4ETOA 1KFUL 2L51A 3CABA 1QLSA 3TS5B 2LM5A 3RLZA 2H61C 1S1EA 4IJ7A 4ZCVA 1NCYA 3JTDB 4I5LB 1R2UA 2K7DA 1YX7A 2PRUA 2OS8C 1SCVA 3TUYB 2KFFA 1B8CA 4MLWA 3PSRA 4YI9A 1KK7Y 1M45A 1IRJA 1QV0A 3LLEA 3NXAA 3CZ0A 2PQLA 3HCMA 1KQVA 1F4QA 3GOFA 3S0FA 2HF5A 5F6TA 1YURA 2QEBA 2I2RE 1TUJA 4HSZA 4UPGA 1NIWA 2K7BA 1L7ZA 2M3WA 4JQ0D 4WQ3A 1BODA 1S6CA 2M7LA 4DS7A 1B1GA 1FPWA 1DJWA 3CR2A 1YRUB 2JOJA 1XO5A 2KGBC 4FQOA 3S0BA 1H4BA 2WCBA 4DRWA 2FJYA 4GGFA 4PE7A 1MQ1A 2L4IA 3TDZA 1F54A 4HREE 1SW8A 3KO0A 3LCPC 2KLEA 2BKIB 1S5GY 1PSRA 4JPZB 3D76A 2PSRA 2LNKA 1JC2A 4JWQA 1DGVA 3O78A 1XK4C 1UHJA 3OP0A 4PHJA 2OTGC 5HLVA 1DEKA 3WNXB 2BECA 3R1VA 3BUNB 3LL8B 4MN0A 1FW4A 3UO9A 3BOWB 2GGZA 1MWNA 2H2KA 2KYCA 4FQTA 1Y1UA 2P70A 3RZSA 1BF5A 1WRKA 5HKYA 1W7JB 3CZ1A 3I5IC 1YR5A 1S5GZ 5PALA 1NUBA 4C0JA 2KQYA 1SBJA 2LMTA 3H4SE 3S0GA 2ZNDA 1XK4A 2QEHA 4AQJA 1TOPA 1GGZA 2ZRTA 4DIRA 2MLFC 1OOHA 3PATA 1K9UA 2WC5A 1A4PA 3OX5A 1IQ3A 4MZLA 1JFKA 3VRQA 1CLBA 1EG3A 3I5GB 1MUXA 1SKTA 2JT0A 2SCPA 1RK9A 4ICBA 2LP3A 3CZ2A 1SR6C 3I5FB 3DVEA 1K95A 2L2CA 1LINA 2QDIA 1KK8B 2QEVA 2H61A 2JT8A 3MSEB 4FTGA 4ORBB 4PHNA 5D3OA 3N7HA 1JWDA 1JSAA 2BBMA 2O5GA 2HQWA 1IJ5A 3VRPA 2NCOA 3NHTA 1KK7Z 1OMDA 3BUXB 2L5YA 2QPTA 1RWYA 4NQGA 2K7OA 2KDHA 3BJHA 2JXCA 4CLNA 1D1OA 4YGCB 1WY9A 1BR1B 1Y6WA 1XA5A 1S36A 3PN7B 1UHIA 1H8BA 2WCEA 3I5HC 1CFDA 1NCZA 3EG5B 1KFUS 4R1EA 1JBAA 1XFUO 1OOJA 3FE9A 1JF0A 3SS3A 3D0YA 5I2QA 5AANA 2WORA 4XYNA 2M9GA 4PE4A 3OB1B 1Q80A 1PALA 1OQPA 1DJGA 1TNPA 5AERA 3TDIA 3CGAA 1K9PA 3PJIA 1SCMB 2G9BA 1QXPA 1Y0VH 2I7AA 3L4LA 1XFXO 1DJYA 2PMYA 2O60A 3I5FC 1OZOA 4P2YB 1JFJA 2KI4C 2JWWA 3IF7A 4F0ZB 4WRIA 1KCYA 1QVIZ 2LVVA 1YRTB 3S0AA 4GGNA 3JVTC 1BU3A 1OOFA 1UHHA 1WLMA 1YVLA 5HKZA 2F3ZA 1SNLA 1CDNA 3EK7A 1QIVA 2KGRA 4GGFC 1TRFA 4BY4A 2PYQA 2LUCA 2IS9A 3A4UB 4CIDA 1J55A 1YVHA 3TS5C 5CSIA 3VROA 2B1UA 1C7VA 2KOTA 1DELA 1QWVA 2LV7A 4ZCUA 3SS5A 4DCKA 2LLUA 1E8AA 2M7NA 3E3RA 5HL1A 4IL1A 4JKTA 1A03A 1AK8A 1XFVO 4L9MA 2QEOA 3PALA 1CNPA 4BY5A 3OBVA 2WCKA 3FWBA 3R1PA 4OZDA 5AEQA 3D73A 1CB1A 1F55A 2ZKMX 3IQOA 1M63B 4N1GA 1LKJA 1N65A 1Y1AA 2BL0B 4PHMA 1CMGA 4OR9B 1XFWO 3BOWA 1QX7A 1PK0D 1V1GA 1SPYA 4MZKA 2EC6B 3I5HB 1TCFA 5I8NA 2BCBA 2L98A 1LA3A 4MEWA 2KFGA 1YUTA 4INWA 5FI7A 2LUXA 4YGEB 3WHTB 1NX2A 2R2IA 1QIWA 4M2QA 2JTTA 2K60A 2P6BB 1SL7A 3D10A 3CYZA 5FI2A 2M1UA 2QACA 2KI4B 2Y1MA 2LCPA 1FF1A 3EVVA 2HETA 3FE8A 1CKKA 2KI6D 3CLNA 2ZRSA 3C1VA 1JF2A 1ZOTB 1NX1A 1IKUA 3M0WA 1UHNA 3BYAA 1SMGA 4QJ5B 2FCDA 3O2PA 2MJWB 1MR8A 1NWDA 1DGUA 1RTP1 5JOLA 1J7RA 2PASA 3S0DA 5AXIA 3GK4X 3SJSA 5DKNA 2LHIA 3DZTA 1DC1A 3R1OA 1K8UA 1QASA 2FJUB 4GUKA 3O4XA 3CTNA 2G2BA 2L50A 1YUUA 1N2DA 3WXAA 3JVTB 1B4CA 2JXLA 2LAPA 2F3YA 2L0PA 1PRWA 1B7TZ 2JZIA 4C0LA 5FYXA 2PVBA 2WC8A 4M2PA 1QATA 3AAJA 5K89A 3DYEA 1CDMA 2JU0A 3I5GC 3IVTA 2H8VA 1BR4B 2JRFA 2K2FA 4DUQA 3B86A 4A4BA 1RROA 5DICA 2E30A 1T14A 3B87A 4PE0A 3V2LA 1W9ZA 2WC6A 3PFVA 1DJZA 1B9AA 2JULA 1RECA 4MZJA 2KBMA 1EJ3A 1OMRA 1NP8A 1DJIA 4YI8A 1UHKA 1PVBA 1IIOA 2P71A 3KF9A 3O6BA 4INXA 4N1FA 4ORCB 4PT1A 1KQMB 1KWOC 1K94A 1MXLC 4HRHA 1Z4HA 2WOSA 1J1DA 1AHRA 1A75B 4GNKB 2MA2A 1B8LA 1WRLA 5FI6A 1P28A 1ZFSA 4Q04A 1SYMA 2KNEA 2ERBA 2ZNEA 1DVIA 1KFXL 3EK8A 3NGVA 4PHKA 2EC6C 1BLQA 1NCXA 2LLSA 1XFYO 2K61A 2V53A 1SCMC 1Z2CB 1KK8C 3NSIA 1AP4A 2BE6A 2MLEC 1OW4A 1GQMA 3K21A 4GAOA 2LHLA 3VRNA 3BQ3A 5CSJA 1CDLA 3I5IB 4USLA 4C0KA 1A75A 1N0YA 2VRGA 3EKJA 2MAZA 2LVKA 2M8UA 4QJ3B 1MXEA 1XYDA 1A2XA 2JT3A 3L4AA 4I5JA 5I2LA 2HPSA 1G33A 2M29A 4CPVA 1M39A 3D75A 1CMFA 1DQEA 4CFRA 1VRKA 1C07A 1EG4A 2K0JA
chains in the Genus database with same CATH topology
2Y4QA 3FS7A 5B8IB 5I2OA 1U5IB 2LP2A 4YRUA 1DJXA 4NDCA 1BJFA 5DKQA 3BXKA 1ZACA 3SG4A 1GGWA 3CZTX 1ALWA 2KFHA 2M0RA 5CPVA 3RM1A 2Y1NA 3SG6A 1IG5A 4GBAA 3VRRA 2NCPA 2KAVA 3DVMA 2F33A 1BOCA 2LC5A 3LK0A 5D69A 1ZMZA 1CM1A 3FWCA 4ORAB 4P5OE 5HKWA 2K2AA 1U5IA 1KSOA 4TNCA 1AJ4A 3CS1A 2TN4A 1R6PA 3TZ1A 1LXFC 1Y1XA 2Q4UA 1EH2A 1ZUZA 2Q91A 2ISDA 3EVUA 2NXQA 1C7WA 3GK1A 3TUYC 1IGVA 1IQ5A 1NPQA 2F8PA 1S3PA 1OE9B 2BL0C 1SL8A 4PDZA 2WCFA 4CFQA 1DT7B 2CCMA 2KHNA 2CXJA 2KBIA 3LK1A 4AOMA 1WDCB 1LVCD 2BKHB 2BBNA 5BPJA 3SG3A 1TNQA 3PLFB 3GK2A 1CFPA 2OPOA 1TNXA 1IH0A 2K8MB 5HYDA 1ALVA 1F8HA 1WRZA 1CFFA 1L2OB 1G4YR 1ODBA 2COLB 2LE9B 5CSFA 2CNPA 4XJKB 1L2OC 1OMVA 2OS8B 3AAKA 1TCOB 2KI6C 1QV1A 5HLOA 1UURA 2JTZA 2I18A 1TTXA 3VGOA 1SL9A 4GPLB 1BMOA 4YBHB 1UUSA 2AUCA 2K7CA 1HT9A 3EKHA 3EVRA 1WDCC 1K96A 4PCWA 4MBEA 1DTLA 1CM4A 1G8IA 1PULA 1DMOA 2CT9A 2KAYA 2L2EA 1NX0A 1BG1A 2M49B 5ER4X 3DVJA 5TNCA 1CFCA 4NDBA 3DD4A 2M97A 1J1EA 1MHOA 1RFJA 2F2OA 4XJKA 1F71A 5ER5A 2ZN9A 1IWQA 4MVFA 1B7TY 5GQQC 1HQVA 1TN4A 4AQIA 4I5NB 1SK6D 2E6WA 1QX5B 1S26D 1K9KA 3CR5X 2L4HA 5D7FA 1YUSA 1DF0B 1WLZA 3BUOB 3O4YA 1K2HA 2F2PA 5G08A 5KU1A 1OZSA 1AUIB 2BE4A 4WQ2A 1LA0A 4E68A 2JC2A 1JUOA 3SG5A 2M1KB 3DF0B 1YTZC 1NX3A 2NLNA 2ZN8A 3JTDC 2JNFA 1B8RA 2KAXA 1EXRA 1CTRA 2SASA 1TIZA 3F45A 1EL4A 1XVJA 2MRDA 4YGDB 4N5XA 2MBXA 4D1EA 1PVAA 1J7QA 1TNWA 1FBVA 2EGDA 1IJ6A 4MSPA 1GJYA 1KSMA 1RJVA 1M46A 2MHHA 2KQ6A 3PM8A 1MF8B 2Y5IA 3ICBA 4NDDA 3DF0A 3OB2B 3OX6A 2I94A 2EHBA 3PN7C 5KSZA 4MRXA 2ZFDA 1UWOA 1FI6A 1F4OA 5CSNA 1X02A 1SY9A 3KPXA 2DOQA 2L5XB 1V1FA 2CBLA 1CDPA 2KSPA 1QX2A 1A29A 4PALA 4OVNF 2WNDA 2LLTA 2NZ0A 2PALA 1J7PA 1DJHA 3CR4X 4GFTA 1FI5A 3AKAA 3OHMB 1SR6B 2A4JA 2JQ6A 1CLLA 2KYFA 1QJTA 4I5KA 4OKHA 1QTXA 2AMIA 2JPTA 1NSHA 5JJGA 1W7IB 1AJ5A 2FOTA 3KEVA 3KHEA 1S6JA 4YGAA 1QLKA 3CWGA 3NSOA 2LMUA 1OSAA 3BUWB 5DKRA 4OV2A 2JNXA 3FIAA 3ZNIA 3SIAA 3BUMB 3SIBA 2GV5A 1KQMC 1KWOB 1PSBA 3AKBA 5KTYA 1UP5A 1XFZO 3NSKA 3IQQA 1QS7A 2BCAA 2AAOA 3DVKA 4M2OA 1KFXS 2D8NA 3HX4A 2LMVA 4HRGA 4YGBB 5J3XA 1M31A 1CLMA 3ZWHA 1YX8A 3EK4A 1B47A 1J7OA 1BT6A 1AVSA 2CTNA 2FCEA 2OTGB 2HQ8A 3A8RA 3SG2A 4OCIA 3SG7A 4A4CA 1QVIY 3WHUB 4PE1A 2LANA 1NYAA 1S6IA 2RGIA 5AFPA 2LVIA 1K90D 1F70A 4U8DA 3TDUA 2LVJA 4MRYA 2BCXA 1DF0A 5IBWA 1K93D 2GGMA 3D0YB 3NSLA 4QJ4B 1SRAA 3QRXA 4ETOA 1KFUL 2L51A 1QLSA 3TS5B 2LM5A 3RLZA 2H61C 1S1EA 4ZCVA 1NCYA 3JTDB 4I5LB 1R2UA 2K7DA 1YX7A 2PRUA 2OS8C 1SCVA 3TUYB 2KFFA 1B8CA 4MLWA 3PSRA 4YI9A 1KK7Y 1M45A 1IRJA 1QV0A 3LLEA 3NXAA 1KQVA 3HCMA 1F4QA 3GOFA 2HF5A 5F6TA 1YURA 2I2RE 4HSZA 4UPGA 1NIWA 2K7BA 1L7ZA 2M3WA 4JQ0D 4WQ3A 1BODA 1S6CA 2M7LA 4DS7A 1B1GA 1FPWA 1DJWA 3CR2A 1YRUB 2JOJA 1XO5A 2KGBC 4FQOA 1H4BA 2WCBA 4DRWA 4GGFA 4PE7A 1MQ1A 2L4IA 3TDZA 1F54A 4HREE 1SW8A 3KO0A 3LCPC 2BKIB 1S5GY 1PSRA 4JPZB 2PSRA 2LNKA 1JC2A 4JWQA 1DGVA 3O78A 1XK4C 1UHJA 3OP0A 4PHJA 2OTGC 5HLVA 3WNXB 2BECA 3BUNB 3LL8B 4MN0A 1FW4A 3BOWB 2GGZA 1MWNA 2H2KA 2KYCA 1Y1UA 1BF5A 1WRKA 5HKYA 1W7JB 3I5IC 1YR5A 1S5GZ 5PALA 1NUBA 4C0JA 2KQYA 1SBJA 2LMTA 3H4SE 2ZNDA 1XK4A 4AQJA 4DIRA 1TOPA 1GGZA 2ZRTA 2MLFC 3PATA 1K9UA 1IQ3A 1A4PA 3OX5A 4MZLA 1JFKA 3VRQA 1CLBA 1EG3A 3I5GB 1MUXA 1SKTA 2JT0A 2SCPA 1RK9A 4ICBA 2LP3A 3I5FB 1SR6C 5AANA 3DVEA 1K95A 1LINA 1KK8B 4FTGA 2H61A 2JT8A 3MSEB 4ORBB 4PHNA 1JWDA 1JSAA 2BBMA 2O5GA 2HQWA 1IJ5A 3VRPA 2NCOA 1KK7Z 1OMDA 3BUXB 2QPTA 1RWYA 4NQGA 2K7OA 2KDHA 1D1OA 2JXCA 4CLNA 4YGCB 1WY9A 1BR1B 1Y6WA 1XA5A 1S36A 3PN7B 1UHIA 1H8BA 2WCEA 3I5HC 1CFDA 1NCZA 1KFUS 4R1EA 1JBAA 1XFUO 1OOJA 1JF0A 3D0YA 5I2QA 2WORA 4XYNA 2M9GA 4PE4A 3OB1B 1Q80A 1PALA 1OQPA 1DJGA 1TNPA 5AERA 3TDIA 3CGAA 1K9PA 1SCMB 2G9BA 1QXPA 1Y0VH 2I7AA 1XFXO 1DJYA 2PMYA 2O60A 3I5FC 1OZOA 4P2YB 1JFJA 2KI4C 2JWWA 3IF7A 4F0ZB 4WRIA 1KCYA 1QVIZ 2LVVA 1YRTB 4GGNA 3JVTC 1BU3A 1UHHA 1WLMA 1YVLA 5HKZA 2F3ZA 1SNLA 1CDNA 3EK7A 1QIVA 2KGRA 4GGFC 1TRFA 4BY4A 2LUCA 2IS9A 3A4UB 4CIDA 1J55A 1YVHA 3TS5C 5CSIA 3VROA 2B1UA 1C7VA 2KOTA 2LV7A 4ZCUA 4DCKA 2LLUA 1E8AA 2M7NA 3E3RA 4IL1A 1A03A 1AK8A 1XFVO 4L9MA 3PALA 1CNPA 4BY5A 1CB1A 3FWBA 5AEQA 1F55A 2ZKMX 3IQOA 1M63B 4N1GA 1LKJA 1N65A 1Y1AA 2BL0B 4PHMA 1CMGA 4OR9B 1XFWO 3BOWA 1QX7A 1PK0D 1V1GA 1SPYA 4MZKA 2EC6B 3I5HB 1TCFA 5I8NA 2BCBA 2L98A 1LA3A 4MEWA 2KFGA 1YUTA 2LUXA 4YGEB 3WHTB 1NX2A 2R2IA 1QIWA 4M2QA 2JTTA 2P6BB 1SL7A 3D10A 2M1UA 2QACA 2KI4B 2Y1MA 2LCPA 1FF1A 3EVVA 2HETA 1CKKA 2KI6D 3CLNA 2ZRSA 3C1VA 1JF2A 1ZOTB 1NX1A 1IKUA 3M0WA 1UHNA 3BYAA 1SMGA 4QJ5B 2FCDA 3O2PA 2MJWB 1MR8A 1NWDA 1DGUA 1RTP1 5JOLA 1J7RA 2PASA 5AXIA 3GK4X 3SJSA 5DKNA 2LHIA 1K8UA 1QASA 2FJUB 4GUKA 3CTNA 2G2BA 2L50A 1YUUA 1N2DA 3WXAA 3JVTB 1B4CA 2JXLA 2LAPA 2F3YA 2L0PA 1PRWA 1B7TZ 2JZIA 4C0LA 5FYXA 2PVBA 2WC8A 4M2PA 1QATA 3AAJA 5K89A 1CDMA 2JU0A 3I5GC 1BR4B 2JRFA 2K2FA 4DUQA 4A4BA 1RROA 2E30A 4PE0A 3PFVA 1DJZA 1B9AA 2JULA 1RECA 4MZJA 2KBMA 1EJ3A 1OMRA 1NP8A 1DJIA 4YI8A 1UHKA 1PVBA 3KF9A 3O6BA 4N1FA 4ORCB 1KQMB 1KWOC 1K94A 1MXLC 4HRHA 2WOSA 1J1DA 1AHRA 1A75B 4GNKB 2MA2A 1B8LA 1WRLA 1ZFSA 4Q04A 1SYMA 2KNEA 2ZNEA 1DVIA 1KFXL 3EK8A 4PHKA 2EC6C 1BLQA 1NCXA 2LLSA 1XFYO 2K61A 2V53A 1SCMC 1KK8C 3NSIA 1AP4A 2BE6A 2MLEC 1GQMA 3K21A 4GAOA 2LHLA 3VRNA 3BQ3A 5CSJA 1CDLA 3I5IB 4USLA 4C0KA 1A75A 1N0YA 2VRGA 3EKJA 2MAZA 2LVKA 2M8UA 4QJ3B 1MXEA 1XYDA 1A2XA 2JT3A 5I2LA 4I5JA 2HPSA 1G33A 2M29A 4CPVA 1M39A 1CMFA 4CFRA 1VRKA 1C07A 1EG4A 2K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Q A;  3FS7 A;  5B8I B;  5I2O A;  1U5I B;  2LP2 A;  4YRU A;  1DJX A;  4NDC A;  1BJF A;  5DKQ A;  3BXK A;  1ZAC A;  3SG4 A;  1GGW A;  3CZT X;  1ALW A;  2KFH A;  2M0R A;  5CPV A;  3RM1 A;  2Y1N A;  3SG6 A;  1IG5 A;  4GBA A;  3VRR A;  2NCP A;  2KAV A;  3DVM A;  2F33 A;  1BOC A;  2LC5 A;  3LK0 A;  5D69 A;  1ZMZ A;  1CM1 A;  3FWC A;  4ORA B;  4P5O E;  5HKW A;  2K2A A;  1U5I A;  1KSO A;  4TNC A;  1AJ4 A;  3CS1 A;  2TN4 A;  1R6P A;  3TZ1 A;  1LXF C;  1Y1X A;  2Q4U A;  1EH2 A;  1ZUZ A;  2Q91 A;  2ISD A;  3EVU A;  2NXQ A;  1C7W A;  3GK1 A;  3TUY C;  1IGV A;  1IQ5 A;  1NPQ A;  2F8P A;  1S3P A;  1OE9 B;  2BL0 C;  1SL8 A;  4PDZ A;  2WCF A;  4CFQ A;  1DT7 B;  2CCM A;  2KHN A;  2CXJ A;  2KBI A;  3LK1 A;  4AOM A;  1WDC B;  1LVC D;  2BKH B;  2BBN A;  5BPJ A;  3SG3 A;  1TNQ A;  3PLF B;  3GK2 A;  1CFP A;  2OPO A;  1TNX A;  1IH0 A;  2K8M B;  5HYD A;  1ALV A;  1F8H A;  1WRZ A;  1CFF A;  1L2O B;  1G4Y R;  1ODB A;  2COL B;  2LE9 B;  5CSF A;  2CNP A;  4XJK B;  1L2O C;  1OMV A;  2OS8 B;  3AAK A;  1TCO B;  2KI6 C;  1QV1 A;  5HLO A;  1UUR A;  2JTZ A;  2I18 A;  1TTX A;  3VGO A;  1SL9 A;  4GPL B;  1BMO A;  4YBH B;  1UUS A;  2AUC A;  2K7C A;  1HT9 A;  3EKH A;  3EVR A;  1WDC C;  1K96 A;  4PCW A;  4MBE A;  1DTL A;  1CM4 A;  1G8I A;  1PUL A;  1DMO A;  2CT9 A;  2KAY A;  2L2E A;  1NX0 A;  1BG1 A;  2M49 B;  5ER4 X;  3DVJ A;  5TNC A;  1CFC A;  4NDB A;  3DD4 A;  2M97 A;  1J1E A;  1MHO A;  1RFJ A;  2F2O A;  4XJK A;  1F71 A;  5ER5 A;  2ZN9 A;  1IWQ A;  4MVF A;  1B7T Y;  5GQQ C;  1HQV A;  1TN4 A;  4AQI A;  4I5N B;  1SK6 D;  2E6W A;  1QX5 B;  1S26 D;  1K9K A;  3CR5 X;  2L4H A;  5D7F A;  1YUS A;  1DF0 B;  1WLZ A;  3BUO B;  3O4Y A;  1K2H A;  2F2P A;  5G08 A;  5KU1 A;  1OZS A;  1AUI B;  2BE4 A;  4WQ2 A;  1LA0 A;  4E68 A;  2JC2 A;  1JUO A;  3SG5 A;  2M1K B;  3DF0 B;  1YTZ C;  1NX3 A;  2NLN A;  2ZN8 A;  3JTD C;  2JNF A;  1B8R A;  2KAX A;  1EXR A;  1CTR A;  2SAS A;  1TIZ A;  3F45 A;  1EL4 A;  1XVJ A;  2MRD A;  4YGD B;  4N5X A;  2MBX A;  4D1E A;  1PVA A;  1J7Q A;  1TNW A;  1FBV A;  2EGD A;  1IJ6 A;  4MSP A;  1GJY A;  1KSM A;  1RJV A;  1M46 A;  2MHH A;  2KQ6 A;  3PM8 A;  1MF8 B;  2Y5I A;  3ICB A;  4NDD A;  3DF0 A;  3OB2 B;  3OX6 A;  2I94 A;  2EHB A;  3PN7 C;  5KSZ A;  4MRX A;  2ZFD A;  1UWO A;  1FI6 A;  1F4O A;  5CSN A;  1X02 A;  1SY9 A;  3KPX A;  2DOQ A;  2L5X B;  1V1F A;  2CBL A;  1CDP A;  2KSP A;  1QX2 A;  1A29 A;  4PAL A;  4OVN F;  2WND A;  2LLT A;  2NZ0 A;  2PAL A;  1J7P A;  1DJH A;  3CR4 X;  4GFT A;  1FI5 A;  3AKA A;  3OHM B;  1SR6 B;  2A4J A;  2JQ6 A;  1CLL A;  2KYF A;  1QJT A;  4I5K A;  4OKH A;  1QTX A;  2AMI A;  2JPT A;  1NSH A;  5JJG A;  1W7I B;  1AJ5 A;  2FOT A;  3KEV A;  3KHE A;  1S6J A;  4YGA A;  1QLK A;  3CWG A;  3NSO A;  2LMU A;  1OSA A;  3BUW B;  5DKR A;  4OV2 A;  2JNX A;  3FIA A;  3ZNI A;  3SIA A;  3BUM B;  3SIB A;  2GV5 A;  1KQM C;  1KWO B;  1PSB A;  3AKB A;  5KTY A;  1UP5 A;  1XFZ O;  3NSK A;  3IQQ A;  1QS7 A;  2BCA A;  2AAO A;  3DVK A;  4M2O A;  1KFX S;  2D8N A;  3HX4 A;  2LMV A;  4HRG A;  4YGB B;  5J3X A;  1M31 A;  1CLM A;  3ZWH A;  1YX8 A;  3EK4 A;  1B47 A;  1J7O A;  1BT6 A;  1AVS A;  2CTN A;  2FCE A;  2OTG B;  2HQ8 A;  3A8R A;  3SG2 A;  4OCI A;  3SG7 A;  4A4C A;  1QVI Y;  3WHU B;  4PE1 A;  2LAN A;  1NYA A;  1S6I A;  2RGI A;  5AFP A;  2LVI A;  1K90 D;  1F70 A;  4U8D A;  3TDU A;  2LVJ A;  4MRY A;  2BCX A;  1DF0 A;  5IBW A;  1K93 D;  2GGM A;  3D0Y B;  3NSL A;  4QJ4 B;  1SRA A;  3QRX A;  4ETO A;  1KFU L;  2L51 A;  1QLS A;  3TS5 B;  2LM5 A;  3RLZ A;  2H61 C;  1S1E A;  4ZCV A;  1NCY A;  3JTD B;  4I5L B;  1R2U A;  2K7D A;  1YX7 A;  2PRU A;  2OS8 C;  1SCV A;  3TUY B;  2KFF A;  1B8C A;  4MLW A;  3PSR A;  4YI9 A;  1KK7 Y;  1M45 A;  1IRJ A;  1QV0 A;  3LLE A;  3NXA A;  1KQV A;  3HCM A;  1F4Q A;  3GOF A;  2HF5 A;  5F6T A;  1YUR A;  2I2R E;  4HSZ A;  4UPG A;  1NIW A;  2K7B A;  1L7Z A;  2M3W A;  4JQ0 D;  4WQ3 A;  1BOD A;  1S6C A;  2M7L A;  4DS7 A;  1B1G A;  1FPW A;  1DJW A;  3CR2 A;  1YRU B;  2JOJ A;  1XO5 A;  2KGB C;  4FQO A;  1H4B A;  2WCB A;  4DRW A;  4GGF A;  4PE7 A;  1MQ1 A;  2L4I A;  3TDZ A;  1F54 A;  4HRE E;  1SW8 A;  3KO0 A;  3LCP C;  2BKI B;  1S5G Y;  1PSR A;  4JPZ B;  2PSR A;  2LNK A;  1JC2 A;  4JWQ A;  1DGV A;  3O78 A;  1XK4 C;  1UHJ A;  3OP0 A;  4PHJ A;  2OTG C;  5HLV A;  3WNX B;  2BEC A;  3BUN B;  3LL8 B;  4MN0 A;  1FW4 A;  3BOW B;  2GGZ A;  1MWN A;  2H2K A;  2KYC A;  1Y1U A;  1BF5 A;  1WRK A;  5HKY A;  1W7J B;  3I5I C;  1YR5 A;  1S5G Z;  5PAL A;  1NUB A;  4C0J A;  2KQY A;  1SBJ A;  2LMT A;  3H4S E;  2ZND A;  1XK4 A;  4AQJ A;  4DIR A;  1TOP A;  1GGZ A;  2ZRT A;  2MLF C;  3PAT A;  1K9U A;  1IQ3 A;  1A4P A;  3OX5 A;  4MZL A;  1JFK A;  3VRQ A;  1CLB A;  1EG3 A;  3I5G B;  1MUX A;  1SKT A;  2JT0 A;  2SCP A;  1RK9 A;  4ICB A;  2LP3 A;  3I5F B;  1SR6 C;  5AAN A;  3DVE A;  1K95 A;  1LIN A;  1KK8 B;  4FTG A;  2H61 A;  2JT8 A;  3MSE B;  4ORB B;  4PHN A;  1JWD A;  1JSA A;  2BBM A;  2O5G A;  2HQW A;  1IJ5 A;  3VRP A;  2NCO A;  1KK7 Z;  1OMD A;  3BUX B;  2QPT A;  1RWY A;  4NQG A;  2K7O A;  2KDH A;  1D1O A;  2JXC A;  4CLN A;  4YGC B;  1WY9 A;  1BR1 B;  1Y6W A;  1XA5 A;  1S36 A;  3PN7 B;  1UHI A;  1H8B A;  2WCE A;  3I5H C;  1CFD A;  1NCZ A;  1KFU S;  4R1E A;  1JBA A;  1XFU O;  1OOJ A;  1JF0 A;  3D0Y A;  5I2Q A;  2WOR A;  4XYN A;  2M9G A;  4PE4 A;  3OB1 B;  1Q80 A;  1PAL A;  1OQP A;  1DJG A;  1TNP A;  5AER A;  3TDI A;  3CGA A;  1K9P A;  1SCM B;  2G9B A;  1QXP A;  1Y0V H;  2I7A A;  1XFX O;  1DJY A;  2PMY A;  2O60 A;  3I5F C;  1OZO A;  4P2Y B;  1JFJ A;  2KI4 C;  2JWW A;  3IF7 A;  4F0Z B;  4WRI A;  1KCY A;  1QVI Z;  2LVV A;  1YRT B;  4GGN A;  3JVT C;  1BU3 A;  1UHH A;  1WLM A;  1YVL A;  5HKZ A;  2F3Z A;  1SNL A;  1CDN A;  3EK7 A;  1QIV A;  2KGR A;  4GGF C;  1TRF A;  4BY4 A;  2LUC A;  2IS9 A;  3A4U B;  4CID A;  1J55 A;  1YVH A;  3TS5 C;  5CSI A;  3VRO A;  2B1U A;  1C7V A;  2KOT A;  2LV7 A;  4ZCU A;  4DCK A;  2LLU A;  1E8A A;  2M7N A;  3E3R A;  4IL1 A;  1A03 A;  1AK8 A;  1XFV O;  4L9M A;  3PAL A;  1CNP A;  4BY5 A;  1CB1 A;  3FWB A;  5AEQ A;  1F55 A;  2ZKM X;  3IQO A;  1M63 B;  4N1G A;  1LKJ A;  1N65 A;  1Y1A A;  2BL0 B;  4PHM A;  1CMG A;  4OR9 B;  1XFW O;  3BOW A;  1QX7 A;  1PK0 D;  1V1G A;  1SPY A;  4MZK A;  2EC6 B;  3I5H B;  1TCF A;  5I8N A;  2BCB A;  2L98 A;  1LA3 A;  4MEW A;  2KFG A;  1YUT A;  2LUX A;  4YGE B;  3WHT B;  1NX2 A;  2R2I A;  1QIW A;  4M2Q A;  2JTT A;  2P6B B;  1SL7 A;  3D10 A;  2M1U A;  2QAC A;  2KI4 B;  2Y1M A;  2LCP A;  1FF1 A;  3EVV A;  2HET A;  1CKK A;  2KI6 D;  3CLN A;  2ZRS A;  3C1V A;  1JF2 A;  1ZOT B;  1NX1 A;  1IKU A;  3M0W A;  1UHN A;  3BYA A;  1SMG A;  4QJ5 B;  2FCD A;  3O2P A;  2MJW B;  1MR8 A;  1NWD A;  1DGU A;  1RTP 1;  5JOL A;  1J7R A;  2PAS A;  5AXI A;  3GK4 X;  3SJS A;  5DKN A;  2LHI A;  1K8U A;  1QAS A;  2FJU B;  4GUK A;  3CTN A;  2G2B A;  2L50 A;  1YUU A;  1N2D A;  3WXA A;  3JVT B;  1B4C A;  2JXL A;  2LAP A;  2F3Y A;  2L0P A;  1PRW A;  1B7T Z;  2JZI A;  4C0L A;  5FYX A;  2PVB A;  2WC8 A;  4M2P A;  1QAT A;  3AAJ A;  5K89 A;  1CDM A;  2JU0 A;  3I5G C;  1BR4 B;  2JRF A;  2K2F A;  4DUQ A;  4A4B A;  1RRO A;  2E30 A;  4PE0 A;  3PFV A;  1DJZ A;  1B9A A;  2JUL A;  1REC A;  4MZJ A;  2KBM A;  1EJ3 A;  1OMR A;  1NP8 A;  1DJI A;  4YI8 A;  1UHK A;  1PVB A;  3KF9 A;  3O6B A;  4N1F A;  4ORC B;  1KQM B;  1KWO C;  1K94 A;  1MXL C;  4HRH A;  2WOS A;  1J1D A;  1AHR A;  1A75 B;  4GNK B;  2MA2 A;  1B8L A;  1WRL A;  1ZFS A;  4Q04 A;  1SYM A;  2KNE A;  2ZNE A;  1DVI A;  1KFX L;  3EK8 A;  4PHK A;  2EC6 C;  1BLQ A;  1NCX A;  2LLS A;  1XFY O;  2K61 A;  2V53 A;  1SCM C;  1KK8 C;  3NSI A;  1AP4 A;  2BE6 A;  2MLE C;  1GQM A;  3K21 A;  4GAO A;  2LHL A;  3VRN A;  3BQ3 A;  5CSJ A;  1CDL A;  3I5I B;  4USL A;  4C0K A;  1A75 A;  1N0Y A;  2VRG A;  3EKJ A;  2MAZ A;  2LVK A;  2M8U A;  4QJ3 B;  1MXE A;  1XYD A;  1A2X A;  2JT3 A;  5I2L A;  4I5J A;  2HPS A;  1G33 A;  2M29 A;  4CPV A;  1M39 A;  1CMF A;  4CFR A;  1VRK A;  1C07 A;  1EG4 A;  2K0J A; 
#chains in the Genus database with same CATH topology
 2Y4Q A;  3FS7 A;  5B8I B;  5I2O A;  1U5I B;  2LP2 A;  4YRU A;  1DJX A;  2GTE A;  4NDC A;  1BJF A;  5DKQ A;  3BXK A;  1ZAC A;  3SG4 A;  1GGW A;  3CZT X;  1ALW A;  2KFH A;  2M0R A;  5CPV A;  3RM1 A;  2Y1N A;  3DXL A;  3SG6 A;  1IG5 A;  4GBA A;  3VRR A;  2NCP A;  2KAV A;  3DVM A;  3D74 A;  2JPO A;  2F33 A;  1BOC A;  2LC5 A;  3LK0 A;  5D69 A;  1ZMZ A;  1CM1 A;  3FWC A;  4ORA B;  4JD9 A;  4P5O E;  5HKW A;  2K2A A;  3QME A;  3BFA A;  1U5I A;  1KSO A;  4TNC A;  1AJ4 A;  3CS1 A;  3K1E A;  2TN4 A;  1R6P A;  3TZ1 A;  1LXF C;  1Y1X A;  2Q4U A;  1EH2 A;  1ZUZ A;  2Q91 A;  2ISD A;  3EVU A;  2NXQ A;  1C7W A;  3GK1 A;  3TUY C;  1GM0 A;  1IGV A;  1IQ5 A;  1NPQ A;  2F8P A;  1S3P A;  1OE9 B;  2BL0 C;  1SL8 A;  4PDZ A;  2WCF A;  4CFQ A;  1DT7 B;  2CCM A;  2KHN A;  2CXJ A;  1TWO A;  5EL2 A;  2KBI A;  1XFR A;  3LK1 A;  4AOM A;  1WDC B;  1LVC D;  2BKH B;  2BBN A;  5BPJ A;  1TUZ A;  3SG3 A;  1TNQ A;  3PLF B;  3GK2 A;  4F7F A;  1CFP A;  2OPO A;  1TNX A;  1IH0 A;  2K8M B;  5HYD A;  1ALV A;  1F8H A;  1WRZ A;  3D78 A;  3CDN A;  1CFF A;  1L2O B;  1G4Y R;  3B7A A;  1ODB A;  2COL B;  2LE9 B;  5CSF A;  2CNP A;  4XJK B;  1L2O C;  1OMV A;  2OS8 B;  3AAK A;  1TCO B;  2KI6 C;  1QV1 A;  5HLO A;  1UUR A;  1OOG A;  2JTZ A;  2I18 A;  1TTX A;  3VGO A;  1SL9 A;  4GPL B;  1BMO A;  4YBH B;  3DY9 A;  1UUS A;  2AUC A;  2K7C A;  1HT9 A;  3EKH A;  3EVR A;  1WDC C;  1K96 A;  4PCW A;  4MBE A;  1DTL A;  1CM4 A;  1G8I A;  1PUL A;  1DMO A;  2CT9 A;  2KAY A;  2L2E A;  1LS8 A;  1NX0 A;  1BG1 A;  2M49 B;  5ER4 X;  3DVJ A;  5TNC A;  1CFC A;  4NDB A;  3DD4 A;  2M97 A;  1J1E A;  1MHO A;  1RFJ A;  2F2O A;  4XJK A;  1F71 A;  5ER5 A;  2ZN9 A;  1IWQ A;  4MVF A;  2YGU A;  1B7T Y;  5GQQ C;  1HQV A;  1TN4 A;  4AQI A;  4I5N B;  1SK6 D;  2E6W A;  1QX5 B;  1OOI X;  1S26 D;  4KYN A;  1K9K A;  3CR5 X;  1C3Z A;  2L4H A;  5D7F A;  1YUS A;  1DF0 B;  1WLZ A;  3BUO B;  3O4Y A;  1K2H A;  2BAP A;  2F2P A;  5G08 A;  2WCH A;  5KU1 A;  1OZS A;  1AUI B;  2BE4 A;  4WQ2 A;  1LA0 A;  3BFH A;  4E68 A;  2JC2 A;  1JUO A;  3SG5 A;  2M1K B;  3DF0 B;  1YTZ C;  1SSE B;  3B88 A;  1NX3 A;  2NLN A;  2ZN8 A;  3JTD C;  2JNF A;  3VB1 A;  1B8R A;  2KAX A;  1EXR A;  1CTR A;  2SAS A;  2WCM A;  1TIZ A;  3F45 A;  1EL4 A;  1XVJ A;  2MRD A;  4YGD B;  4N5X A;  2MBX A;  4D1E A;  1PVA A;  1J7Q A;  1TNW A;  1FBV A;  2EGD A;  1IJ6 A;  2WCL A;  3UNW A;  4MSP A;  1GJY A;  1KSM A;  1RJV A;  1M46 A;  2MHH A;  2KQ6 A;  3PM8 A;  1MF8 B;  2Y5I A;  3ICB A;  4NDD A;  3S0E A;  3DF0 A;  3OB2 B;  3OX6 A;  2I94 A;  2EHB A;  2KPH A;  3PN7 C;  5KSZ A;  1C3Y A;  4MRX A;  2ZFD A;  1UWO A;  1FI6 A;  1F4O A;  5CSN A;  1X02 A;  1SY9 A;  3KPX A;  5I94 A;  2DOQ A;  2L5X B;  1V1F A;  2CBL A;  1CDP A;  2KSP A;  1QX2 A;  1A29 A;  3NHI A;  4OVN F;  2WND A;  2LLT A;  2NZ0 A;  2PAL A;  1J7P A;  1DJH A;  3CR4 X;  4GFT A;  1FI5 A;  3AKA A;  2BNX A;  1SR6 B;  3L47 A;  3OHM B;  2A4J A;  2JQ6 A;  1CLL A;  2KYF A;  2WCJ A;  1QJT A;  4I5K A;  4OKH A;  1QTX A;  2AMI A;  2JPT A;  1NSH A;  5JJG A;  1W7I B;  1AJ5 A;  2FOT A;  3B6X A;  3KEV A;  3KHE A;  1S6J A;  3D77 A;  4YGA A;  3OGN A;  1QLK A;  3Q8I A;  3SS4 A;  3CWG A;  3NSO A;  2LMU A;  1OSA A;  3BUW B;  5DKR A;  4OV2 A;  2JNX A;  3FIA A;  3ZNI A;  3SIA A;  1ORG A;  3BUM B;  3SIB A;  2GV5 A;  1KQM C;  1KWO B;  1PSB A;  3AKB A;  5KTY A;  3FE6 A;  1UP5 A;  1XFZ O;  3NSK A;  4PAL A;  3IQQ A;  1QS7 A;  2BCA A;  2AAO A;  3DVK A;  4M2O A;  3R72 A;  1KFX S;  2D8N A;  3HX4 A;  2LMV A;  4HRG A;  4YGB B;  5J3X A;  1M31 A;  2KLD A;  1CLM A;  3ZWH A;  1YX8 A;  3EK4 A;  1B47 A;  1J7O A;  1BT6 A;  1AVS A;  2CTN A;  2FCE A;  2OTG B;  2HQ8 A;  3A8R A;  3SG2 A;  4OCI A;  3SG7 A;  4A4C A;  1QVI Y;  3WHU B;  4PE1 A;  2LAN A;  1NYA A;  1S6I A;  2RGI A;  5AFP A;  2LVI A;  1K90 D;  1F70 A;  4U8D A;  3TDU A;  3PM2 A;  2LVJ A;  4MRY A;  3BFB A;  2BCX A;  1DF0 A;  5IBW A;  1K93 D;  2GGM A;  3D0Y B;  3NSL A;  4QJ4 B;  1SRA A;  3QRX A;  4ETO A;  1KFU L;  2L51 A;  3CAB A;  1QLS A;  3TS5 B;  2LM5 A;  3RLZ A;  2H61 C;  1S1E A;  4IJ7 A;  4ZCV A;  1NCY A;  3JTD B;  4I5L B;  1R2U A;  2K7D A;  1YX7 A;  2PRU A;  2OS8 C;  1SCV A;  3TUY B;  2KFF A;  1B8C A;  4MLW A;  3PSR A;  4YI9 A;  1KK7 Y;  1M45 A;  1IRJ A;  1QV0 A;  3LLE A;  3NXA A;  3CZ0 A;  2PQL A;  3HCM A;  1KQV A;  1F4Q A;  3GOF A;  3S0F A;  2HF5 A;  5F6T A;  1YUR A;  2QEB A;  2I2R E;  1TUJ A;  4HSZ A;  4UPG A;  1NIW A;  2K7B A;  1L7Z A;  2M3W A;  4JQ0 D;  4WQ3 A;  1BOD A;  1S6C A;  2M7L A;  4DS7 A;  1B1G A;  1FPW A;  1DJW A;  3CR2 A;  1YRU B;  2JOJ A;  1XO5 A;  2KGB C;  4FQO A;  3S0B A;  1H4B A;  2WCB A;  4DRW A;  2FJY A;  4GGF A;  4PE7 A;  1MQ1 A;  2L4I A;  3TDZ A;  1F54 A;  4HRE E;  1SW8 A;  3KO0 A;  3LCP C;  2KLE A;  2BKI B;  1S5G Y;  1PSR A;  4JPZ B;  3D76 A;  2PSR A;  2LNK A;  1JC2 A;  4JWQ A;  1DGV A;  3O78 A;  1XK4 C;  1UHJ A;  3OP0 A;  4PHJ A;  2OTG C;  5HLV A;  1DEK A;  3WNX B;  2BEC A;  3R1V A;  3BUN B;  3LL8 B;  4MN0 A;  1FW4 A;  3UO9 A;  3BOW B;  2GGZ A;  1MWN A;  2H2K A;  2KYC A;  4FQT A;  1Y1U A;  2P70 A;  3RZS A;  1BF5 A;  1WRK A;  5HKY A;  1W7J B;  3CZ1 A;  3I5I C;  1YR5 A;  1S5G Z;  5PAL A;  1NUB A;  4C0J A;  2KQY A;  1SBJ A;  2LMT A;  3H4S E;  3S0G A;  2ZND A;  1XK4 A;  2QEH A;  4AQJ A;  1TOP A;  1GGZ A;  2ZRT A;  4DIR A;  2MLF C;  1OOH A;  3PAT A;  1K9U A;  2WC5 A;  1A4P A;  3OX5 A;  1IQ3 A;  4MZL A;  1JFK A;  3VRQ A;  1CLB A;  1EG3 A;  3I5G B;  1MUX A;  1SKT A;  2JT0 A;  2SCP A;  1RK9 A;  4ICB A;  2LP3 A;  3CZ2 A;  1SR6 C;  3I5F B;  3DVE A;  1K95 A;  2L2C A;  1LIN A;  2QDI A;  1KK8 B;  2QEV A;  2H61 A;  2JT8 A;  3MSE B;  4FTG A;  4ORB B;  4PHN A;  5D3O A;  3N7H A;  1JWD A;  1JSA A;  2BBM A;  2O5G A;  2HQW A;  1IJ5 A;  3VRP A;  2NCO A;  3NHT A;  1KK7 Z;  1OMD A;  3BUX B;  2L5Y A;  2QPT A;  1RWY A;  4NQG A;  2K7O A;  2KDH A;  3BJH A;  2JXC A;  4CLN A;  1D1O A;  4YGC B;  1WY9 A;  1BR1 B;  1Y6W A;  1XA5 A;  1S36 A;  3PN7 B;  1UHI A;  1H8B A;  2WCE A;  3I5H C;  1CFD A;  1NCZ A;  3EG5 B;  1KFU S;  4R1E A;  1JBA A;  1XFU O;  1OOJ A;  3FE9 A;  1JF0 A;  3SS3 A;  3D0Y A;  5I2Q A;  5AAN A;  2WOR A;  4XYN A;  2M9G A;  4PE4 A;  3OB1 B;  1Q80 A;  1PAL A;  1OQP A;  1DJG A;  1TNP A;  5AER A;  3TDI A;  3CGA A;  1K9P A;  3PJI A;  1SCM B;  2G9B A;  1QXP A;  1Y0V H;  2I7A A;  3L4L A;  1XFX O;  1DJY A;  2PMY A;  2O60 A;  3I5F C;  1OZO A;  4P2Y B;  1JFJ A;  2KI4 C;  2JWW A;  3IF7 A;  4F0Z B;  4WRI A;  1KCY A;  1QVI Z;  2LVV A;  1YRT B;  3S0A A;  4GGN A;  3JVT C;  1BU3 A;  1OOF A;  1UHH A;  1WLM A;  1YVL A;  5HKZ A;  2F3Z A;  1SNL A;  1CDN A;  3EK7 A;  1QIV A;  2KGR A;  4GGF C;  1TRF A;  4BY4 A;  2PYQ A;  2LUC A;  2IS9 A;  3A4U B;  4CID A;  1J55 A;  1YVH A;  3TS5 C;  5CSI A;  3VRO A;  2B1U A;  1C7V A;  2KOT A;  1DEL A;  1QWV A;  2LV7 A;  4ZCU A;  3SS5 A;  4DCK A;  2LLU A;  1E8A A;  2M7N A;  3E3R A;  5HL1 A;  4IL1 A;  4JKT A;  1A03 A;  1AK8 A;  1XFV O;  4L9M A;  2QEO A;  3PAL A;  1CNP A;  4BY5 A;  3OBV A;  2WCK A;  3FWB A;  3R1P A;  4OZD A;  5AEQ A;  3D73 A;  1CB1 A;  1F55 A;  2ZKM X;  3IQO A;  1M63 B;  4N1G A;  1LKJ A;  1N65 A;  1Y1A A;  2BL0 B;  4PHM A;  1CMG A;  4OR9 B;  1XFW O;  3BOW A;  1QX7 A;  1PK0 D;  1V1G A;  1SPY A;  4MZK A;  2EC6 B;  3I5H B;  1TCF A;  5I8N A;  2BCB A;  2L98 A;  1LA3 A;  4MEW A;  2KFG A;  1YUT A;  4INW A;  5FI7 A;  2LUX A;  4YGE B;  3WHT B;  1NX2 A;  2R2I A;  1QIW A;  4M2Q A;  2JTT A;  2K60 A;  2P6B B;  1SL7 A;  3D10 A;  3CYZ A;  5FI2 A;  2M1U A;  2QAC A;  2KI4 B;  2Y1M A;  2LCP A;  1FF1 A;  3EVV A;  2HET A;  3FE8 A;  1CKK A;  2KI6 D;  3CLN A;  2ZRS A;  3C1V A;  1JF2 A;  1ZOT B;  1NX1 A;  1IKU A;  3M0W A;  1UHN A;  3BYA A;  1SMG A;  4QJ5 B;  2FCD A;  3O2P A;  2MJW B;  1MR8 A;  1NWD A;  1DGU A;  1RTP 1;  5JOL A;  1J7R A;  2PAS A;  3S0D A;  5AXI A;  3GK4 X;  3SJS A;  5DKN A;  2LHI A;  3DZT A;  1DC1 A;  3R1O A;  1K8U A;  1QAS A;  2FJU B;  4GUK A;  3O4X A;  3CTN A;  2G2B A;  2L50 A;  1YUU A;  1N2D A;  3WXA A;  3JVT B;  1B4C A;  2JXL A;  2LAP A;  2F3Y A;  2L0P A;  1PRW A;  1B7T Z;  2JZI A;  4C0L A;  5FYX A;  2PVB A;  2WC8 A;  4M2P A;  1QAT A;  3AAJ A;  5K89 A;  3DYE A;  1CDM A;  2JU0 A;  3I5G C;  3IVT A;  2H8V A;  1BR4 B;  2JRF A;  2K2F A;  4DUQ A;  3B86 A;  4A4B A;  1RRO A;  5DIC A;  2E30 A;  1T14 A;  3B87 A;  4PE0 A;  3V2L A;  1W9Z A;  2WC6 A;  3PFV A;  1DJZ A;  1B9A A;  2JUL A;  1REC A;  4MZJ A;  2KBM A;  1EJ3 A;  1OMR A;  1NP8 A;  1DJI A;  4YI8 A;  1UHK A;  1PVB A;  1IIO A;  2P71 A;  3KF9 A;  3O6B A;  4INX A;  4N1F A;  4ORC B;  4PT1 A;  1KQM B;  1KWO C;  1K94 A;  1MXL C;  4HRH A;  1Z4H A;  2WOS A;  1J1D A;  1AHR A;  1A75 B;  4GNK B;  2MA2 A;  1B8L A;  1WRL A;  5FI6 A;  1P28 A;  1ZFS A;  4Q04 A;  1SYM A;  2KNE A;  2ERB A;  2ZNE A;  1DVI A;  1KFX L;  3EK8 A;  3NGV A;  4PHK A;  2EC6 C;  1BLQ A;  1NCX A;  2LLS A;  1XFY O;  2K61 A;  2V53 A;  1SCM C;  1Z2C B;  1KK8 C;  3NSI A;  1AP4 A;  2BE6 A;  2MLE C;  1OW4 A;  1GQM A;  3K21 A;  4GAO A;  2LHL A;  3VRN A;  3BQ3 A;  5CSJ A;  1CDL A;  3I5I B;  4USL A;  4C0K A;  1A75 A;  1N0Y A;  2VRG A;  3EKJ A;  2MAZ A;  2LVK A;  2M8U A;  4QJ3 B;  1MXE A;  1XYD A;  1A2X A;  2JT3 A;  3L4A A;  4I5J A;  5I2L A;  2HPS A;  1G33 A;  2M29 A;  4CPV A;  1M39 A;  3D75 A;  1CMF A;  1DQE A;  4CFR A;  1VRK A;  1C07 A;  1EG4 A;  2K0J A; 
#chains in the Genus database with same CATH homology
 2Y4Q A;  3FS7 A;  5B8I B;  5I2O A;  1U5I B;  2LP2 A;  4YRU A;  1DJX A;  4NDC A;  1BJF A;  5DKQ A;  3BXK A;  1ZAC A;  3SG4 A;  1GGW A;  3CZT X;  1ALW A;  2KFH A;  2M0R A;  5CPV A;  3RM1 A;  2Y1N A;  3SG6 A;  1IG5 A;  4GBA A;  3VRR A;  2NCP A;  2KAV A;  3DVM A;  2F33 A;  1BOC A;  2LC5 A;  3LK0 A;  5D69 A;  1ZMZ A;  1CM1 A;  3FWC A;  4ORA B;  4P5O E;  5HKW A;  2K2A A;  1U5I A;  1KSO A;  4TNC A;  1AJ4 A;  3CS1 A;  2TN4 A;  1R6P A;  3TZ1 A;  1LXF C;  1Y1X A;  2Q4U A;  1EH2 A;  1ZUZ A;  2Q91 A;  2ISD A;  3EVU A;  2NXQ A;  1C7W A;  3GK1 A;  3TUY C;  1IGV A;  1IQ5 A;  1NPQ A;  2F8P A;  1S3P A;  1OE9 B;  2BL0 C;  1SL8 A;  4PDZ A;  2WCF A;  4CFQ A;  1DT7 B;  2CCM A;  2KHN A;  2CXJ A;  2KBI A;  3LK1 A;  4AOM A;  1WDC B;  1LVC D;  2BKH B;  2BBN A;  5BPJ A;  3SG3 A;  1TNQ A;  3PLF B;  3GK2 A;  1CFP A;  2OPO A;  1TNX A;  1IH0 A;  2K8M B;  5HYD A;  1ALV A;  1F8H A;  1WRZ A;  1CFF A;  1L2O B;  1G4Y R;  1ODB A;  2COL B;  2LE9 B;  5CSF A;  2CNP A;  4XJK B;  1L2O C;  1OMV A;  2OS8 B;  3AAK A;  1TCO B;  2KI6 C;  1QV1 A;  5HLO A;  1UUR A;  2JTZ A;  2I18 A;  1TTX A;  3VGO A;  1SL9 A;  4GPL B;  1BMO A;  4YBH B;  1UUS A;  2AUC A;  2K7C A;  1HT9 A;  3EKH A;  3EVR A;  1WDC C;  1K96 A;  4PCW A;  4MBE A;  1DTL A;  1CM4 A;  1G8I A;  1PUL A;  1DMO A;  2CT9 A;  2KAY A;  2L2E A;  1NX0 A;  1BG1 A;  2M49 B;  5ER4 X;  3DVJ A;  5TNC A;  1CFC A;  4NDB A;  3DD4 A;  2M97 A;  1J1E A;  1MHO A;  1RFJ A;  2F2O A;  4XJK A;  1F71 A;  5ER5 A;  2ZN9 A;  1IWQ A;  4MVF A;  1B7T Y;  5GQQ C;  1HQV A;  1TN4 A;  4AQI A;  4I5N B;  1SK6 D;  2E6W A;  1QX5 B;  1S26 D;  1K9K A;  3CR5 X;  2L4H A;  5D7F A;  1YUS A;  1DF0 B;  1WLZ A;  3BUO B;  3O4Y A;  1K2H A;  2F2P A;  5G08 A;  5KU1 A;  1OZS A;  1AUI B;  2BE4 A;  4WQ2 A;  1LA0 A;  4E68 A;  2JC2 A;  1JUO A;  3SG5 A;  2M1K B;  3DF0 B;  1YTZ C;  1NX3 A;  2NLN A;  2ZN8 A;  3JTD C;  2JNF A;  1B8R A;  2KAX A;  1EXR A;  1CTR A;  2SAS A;  1TIZ A;  3F45 A;  1EL4 A;  1XVJ A;  2MRD A;  4YGD B;  4N5X A;  2MBX A;  4D1E A;  1PVA A;  1J7Q A;  1TNW A;  1FBV A;  2EGD A;  1IJ6 A;  4MSP A;  1GJY A;  1KSM A;  1RJV A;  1M46 A;  2MHH A;  2KQ6 A;  3PM8 A;  1MF8 B;  2Y5I A;  3ICB A;  4NDD A;  3DF0 A;  3OB2 B;  3OX6 A;  2I94 A;  2EHB A;  3PN7 C;  5KSZ A;  4MRX A;  2ZFD A;  1UWO A;  1FI6 A;  1F4O A;  5CSN A;  1X02 A;  1SY9 A;  3KPX A;  2DOQ A;  2L5X B;  1V1F A;  2CBL A;  1CDP A;  2KSP A;  1QX2 A;  1A29 A;  4PAL A;  4OVN F;  2WND A;  2LLT A;  2NZ0 A;  2PAL A;  1J7P A;  1DJH A;  3CR4 X;  4GFT A;  1FI5 A;  3AKA A;  3OHM B;  1SR6 B;  2A4J A;  2JQ6 A;  1CLL A;  2KYF A;  1QJT A;  4I5K A;  4OKH A;  1QTX A;  2AMI A;  2JPT A;  1NSH A;  5JJG A;  1W7I B;  1AJ5 A;  2FOT A;  3KEV A;  3KHE A;  1S6J A;  4YGA A;  1QLK A;  3CWG A;  3NSO A;  2LMU A;  1OSA A;  3BUW B;  5DKR A;  4OV2 A;  2JNX A;  3FIA A;  3ZNI A;  3SIA A;  3BUM B;  3SIB A;  2GV5 A;  1KQM C;  1KWO B;  1PSB A;  3AKB A;  5KTY A;  1UP5 A;  1XFZ O;  3NSK A;  3IQQ A;  1QS7 A;  2BCA A;  2AAO A;  3DVK A;  4M2O A;  1KFX S;  2D8N A;  3HX4 A;  2LMV A;  4HRG A;  4YGB B;  5J3X A;  1M31 A;  1CLM A;  3ZWH A;  1YX8 A;  3EK4 A;  1B47 A;  1J7O A;  1BT6 A;  1AVS A;  2CTN A;  2FCE A;  2OTG B;  2HQ8 A;  3A8R A;  3SG2 A;  4OCI A;  3SG7 A;  4A4C A;  1QVI Y;  3WHU B;  4PE1 A;  2LAN A;  1NYA A;  1S6I A;  2RGI A;  5AFP A;  2LVI A;  1K90 D;  1F70 A;  4U8D A;  3TDU A;  2LVJ A;  4MRY A;  2BCX A;  1DF0 A;  5IBW A;  1K93 D;  2GGM A;  3D0Y B;  3NSL A;  4QJ4 B;  1SRA A;  3QRX A;  4ETO A;  1KFU L;  2L51 A;  1QLS A;  3TS5 B;  2LM5 A;  3RLZ A;  2H61 C;  1S1E A;  4ZCV A;  1NCY A;  3JTD B;  4I5L B;  1R2U A;  2K7D A;  1YX7 A;  2PRU A;  2OS8 C;  1SCV A;  3TUY B;  2KFF A;  1B8C A;  4MLW A;  3PSR A;  4YI9 A;  1KK7 Y;  1M45 A;  1IRJ A;  1QV0 A;  3LLE A;  3NXA A;  1KQV A;  3HCM A;  1F4Q A;  3GOF A;  2HF5 A;  5F6T A;  1YUR A;  2I2R E;  4HSZ A;  4UPG A;  1NIW A;  2K7B A;  1L7Z A;  2M3W A;  4JQ0 D;  4WQ3 A;  1BOD A;  1S6C A;  2M7L A;  4DS7 A;  1B1G A;  1FPW A;  1DJW A;  3CR2 A;  1YRU B;  2JOJ A;  1XO5 A;  2KGB C;  4FQO A;  1H4B A;  2WCB A;  4DRW A;  4GGF A;  4PE7 A;  1MQ1 A;  2L4I A;  3TDZ A;  1F54 A;  4HRE E;  1SW8 A;  3KO0 A;  3LCP C;  2BKI B;  1S5G Y;  1PSR A;  4JPZ B;  2PSR A;  2LNK A;  1JC2 A;  4JWQ A;  1DGV A;  3O78 A;  1XK4 C;  1UHJ A;  3OP0 A;  4PHJ A;  2OTG C;  5HLV A;  3WNX B;  2BEC A;  3BUN B;  3LL8 B;  4MN0 A;  1FW4 A;  3BOW B;  2GGZ A;  1MWN A;  2H2K A;  2KYC A;  1Y1U A;  1BF5 A;  1WRK A;  5HKY A;  1W7J B;  3I5I C;  1YR5 A;  1S5G Z;  5PAL A;  1NUB A;  4C0J A;  2KQY A;  1SBJ A;  2LMT A;  3H4S E;  2ZND A;  1XK4 A;  4AQJ A;  4DIR A;  1TOP A;  1GGZ A;  2ZRT A;  2MLF C;  3PAT A;  1K9U A;  1IQ3 A;  1A4P A;  3OX5 A;  4MZL A;  1JFK A;  3VRQ A;  1CLB A;  1EG3 A;  3I5G B;  1MUX A;  1SKT A;  2JT0 A;  2SCP A;  1RK9 A;  4ICB A;  2LP3 A;  3I5F B;  1SR6 C;  5AAN A;  3DVE A;  1K95 A;  1LIN A;  1KK8 B;  4FTG A;  2H61 A;  2JT8 A;  3MSE B;  4ORB B;  4PHN A;  1JWD A;  1JSA A;  2BBM A;  2O5G A;  2HQW A;  1IJ5 A;  3VRP A;  2NCO A;  1KK7 Z;  1OMD A;  3BUX B;  2QPT A;  1RWY A;  4NQG A;  2K7O A;  2KDH A;  1D1O A;  2JXC A;  4CLN A;  4YGC B;  1WY9 A;  1BR1 B;  1Y6W A;  1XA5 A;  1S36 A;  3PN7 B;  1UHI A;  1H8B A;  2WCE A;  3I5H C;  1CFD A;  1NCZ A;  1KFU S;  4R1E A;  1JBA A;  1XFU O;  1OOJ A;  1JF0 A;  3D0Y A;  5I2Q A;  2WOR A;  4XYN A;  2M9G A;  4PE4 A;  3OB1 B;  1Q80 A;  1PAL A;  1OQP A;  1DJG A;  1TNP A;  5AER A;  3TDI A;  3CGA A;  1K9P A;  1SCM B;  2G9B A;  1QXP A;  1Y0V H;  2I7A A;  1XFX O;  1DJY A;  2PMY A;  2O60 A;  3I5F C;  1OZO A;  4P2Y B;  1JFJ A;  2KI4 C;  2JWW A;  3IF7 A;  4F0Z B;  4WRI A;  1KCY A;  1QVI Z;  2LVV A;  1YRT B;  4GGN A;  3JVT C;  1BU3 A;  1UHH A;  1WLM A;  1YVL A;  5HKZ A;  2F3Z A;  1SNL A;  1CDN A;  3EK7 A;  1QIV A;  2KGR A;  4GGF C;  1TRF A;  4BY4 A;  2LUC A;  2IS9 A;  3A4U B;  4CID A;  1J55 A;  1YVH A;  3TS5 C;  5CSI A;  3VRO A;  2B1U A;  1C7V A;  2KOT A;  2LV7 A;  4ZCU A;  4DCK A;  2LLU A;  1E8A A;  2M7N A;  3E3R A;  4IL1 A;  1A03 A;  1AK8 A;  1XFV O;  4L9M A;  3PAL A;  1CNP A;  4BY5 A;  1CB1 A;  3FWB A;  5AEQ A;  1F55 A;  2ZKM X;  3IQO A;  1M63 B;  4N1G A;  1LKJ A;  1N65 A;  1Y1A A;  2BL0 B;  4PHM A;  1CMG A;  4OR9 B;  1XFW O;  3BOW A;  1QX7 A;  1PK0 D;  1V1G A;  1SPY A;  4MZK A;  2EC6 B;  3I5H B;  1TCF A;  5I8N A;  2BCB A;  2L98 A;  1LA3 A;  4MEW A;  2KFG A;  1YUT A;  2LUX A;  4YGE B;  3WHT B;  1NX2 A;  2R2I A;  1QIW A;  4M2Q A;  2JTT A;  2P6B B;  1SL7 A;  3D10 A;  2M1U A;  2QAC A;  2KI4 B;  2Y1M A;  2LCP A;  1FF1 A;  3EVV A;  2HET A;  1CKK A;  2KI6 D;  3CLN A;  2ZRS A;  3C1V A;  1JF2 A;  1ZOT B;  1NX1 A;  1IKU A;  3M0W A;  1UHN A;  3BYA A;  1SMG A;  4QJ5 B;  2FCD A;  3O2P A;  2MJW B;  1MR8 A;  1NWD A;  1DGU A;  1RTP 1;  5JOL A;  1J7R A;  2PAS A;  5AXI A;  3GK4 X;  3SJS A;  5DKN A;  2LHI A;  1K8U A;  1QAS A;  2FJU B;  4GUK A;  3CTN A;  2G2B A;  2L50 A;  1YUU A;  1N2D A;  3WXA A;  3JVT B;  1B4C A;  2JXL A;  2LAP A;  2F3Y A;  2L0P A;  1PRW A;  1B7T Z;  2JZI A;  4C0L A;  5FYX A;  2PVB A;  2WC8 A;  4M2P A;  1QAT A;  3AAJ A;  5K89 A;  1CDM A;  2JU0 A;  3I5G C;  1BR4 B;  2JRF A;  2K2F A;  4DUQ A;  4A4B A;  1RRO A;  2E30 A;  4PE0 A;  3PFV A;  1DJZ A;  1B9A A;  2JUL A;  1REC A;  4MZJ A;  2KBM A;  1EJ3 A;  1OMR A;  1NP8 A;  1DJI A;  4YI8 A;  1UHK A;  1PVB A;  3KF9 A;  3O6B A;  4N1F A;  4ORC B;  1KQM B;  1KWO C;  1K94 A;  1MXL C;  4HRH A;  2WOS A;  1J1D A;  1AHR A;  1A75 B;  4GNK B;  2MA2 A;  1B8L A;  1WRL A;  1ZFS A;  4Q04 A;  1SYM A;  2KNE A;  2ZNE A;  1DVI A;  1KFX L;  3EK8 A;  4PHK A;  2EC6 C;  1BLQ A;  1NCX A;  2LLS A;  1XFY O;  2K61 A;  2V53 A;  1SCM C;  1KK8 C;  3NSI A;  1AP4 A;  2BE6 A;  2MLE C;  1GQM A;  3K21 A;  4GAO A;  2LHL A;  3VRN A;  3BQ3 A;  5CSJ A;  1CDL A;  3I5I B;  4USL A;  4C0K A;  1A75 A;  1N0Y A;  2VRG A;  3EKJ A;  2MAZ A;  2LVK A;  2M8U A;  4QJ3 B;  1MXE A;  1XYD A;  1A2X A;  2JT3 A;  5I2L A;  4I5J A;  2HPS A;  1G33 A;  2M29 A;  4CPV A;  1M39 A;  1CMF A;  4CFR A;  1VRK A;  1C07 A;  1EG4 A;  2K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...