3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
1QATA 4PHMA 2LP2A 3FIAA 2M49B 4DCKA 1GJYA 1UHNA 3BUMB 5HKYA 1YUSA 2WCBA 2KGRA 3CR2A 1DF0B 4FTGA 1B8CA 3K21A 2Y1MA 3DF0A 4Q04A 3WHTB 2KI4B 1L2OC 2VRGA 5AERA 1KK8C 1EG3A 1K9PA 1U5IA 2FCEA 2E6WA 1BMOA 1YVLA 1M63B 1MXLC 2KBIA 2LLTA 1F70A 3LK0A 1IJ6A 2HPSA 3OB1B 3SG5A 3KEVA 3RM1A 2LLUA 2R2IA 4GAOA 1BF5A 1M46A 1RROA 4ORAB 1CFCA 2KBMA 3SG6A 1CB1A 2I94A 1H4BA 4YGAA 2LAPA 2KNEA 2NZ0A 1LINA 2Q4UA 2KI4C 1KWOC 1RK9A 3BUWB 1IQ5A 1AJ5A 1R2UA 1K90D 3BXKA 1QS7A 2KHNA 5CSFA 1TTXA 5JOLA 2B1UA 1NSHA 1ZACA 1DJGA 3D0YB 3IQOA 4JPZB 1LXFC 2F33A 2H61A 1KFXL 1FF1A 1AHRA 1G33A 2MLEC 4BY5A 4ETOA 2LC5A 4M2QA 3TZ1A 3KPXA 1E8AA 1CDLA 1S6IA 2MJWB 4PCWA 1OQPA 3I5GC 4BY4A 1YRUB 4C0KA 1SR6B 3SG2A 1YR5A 2LVVA 5I2LA 1TRFA 3GK1A 5AANA 2BKIB 5I8NA 1WDCC 2M9GA 2QACA 5CPVA 2LHLA 5I2QA 2ISDA 2CCMA 2FOTA 1U5IB 4WQ2A 1N65A 1XK4C 1Q80A 1MR8A 2BCXA 2L4HA 5J3XA 5HLVA 1DJYA 1PK0D 3O2PA 5DKNA 3D0YA 4DIRA 3H4SE 1W7IB 1YVHA 1W7JB 2KGBC 2SASA 4N1GA 2Y1NA 2M1KB 3DVJA 3PN7C 1ZOTB 4GFTA 1AP4A 1Y1XA 5KU1A 1XFWO 1MWNA 1UHKA 2F8PA 1UUSA 1YUUA 5HKZA 1CNPA 5AEQA 1EG4A 1KQMC 1RWYA 2M7NA 3M0WA 1DJHA 1QIVA 2PALA 1KFUS 2L50A 1PVAA 3D10A 1CFPA 1XFUO 2Y5IA 4MRXA 1KSMA 1UURA 1B9AA 4GPLB 2KAYA 1B7TZ 3GK4X 2WNDA 3NSKA 3OX5A 4JWQA 1NP8A 3BUXB 1J55A 1KK7Z 2LVIA 3TUYB 1G8IA 3CZTX 1DGUA 3OB2B 4MSPA 4FQOA 1JWDA 2I7AA 5ER5A 1JFKA 1DGVA 1EJ3A 2CTNA 2JT0A 3JTDC 1BOCA 4WRIA 2CNPA 4M2OA 1EL4A 2LE9B 1K9KA 3DD4A 3EK4A 1K95A 1KQMB 2H61C 4PE7A 2TN4A 4MZLA 1XA5A 3VROA 1B4CA 1OOJA 2L4IA 2O60A 1V1FA 2K2FA 1PSBA 4R1EA 1TNQA 2KQ6A 3EKHA 1JSAA 1IG5A 1WRLA 2HQWA 3OX6A 1TNPA 1HQVA 1TCOB 2CBLA 1N0YA 1NWDA 1SRAA 2EC6B 2KI6C 1J7OA 2LANA 4N1FA 3GK2A 2RGIA 1A4PA 1KCYA 4DUQA 1B8RA 1K93D 1XO5A 3LL8B 1H8BA 3BOWB 2L0PA 1M45A 1NUBA 2KAVA 3SG4A 1BU3A 1RJVA 1ALWA 3I5FC 1TNXA 3E3RA 1BT6A 2K8MB 2BL0B 3FWCA 1ODBA 2EHBA 1MQ1A 1SK6D 2MA2A 4GBAA 2F2PA 1WDCB 1F8HA 2FCDA 1SL7A 4YGBB 2JTTA 1Y1UA 1QLSA 2K7CA 1AUIB 2I18A 1CM1A 3CTNA 1BG1A 4MZKA 1YURA 5GQQC 1N2DA 3TS5C 4U8DA 2JRFA 1MF8B 4QJ4B 1OMVA 1CFDA 1DJWA 3FWBA 1FW4A 3EVVA 3ICBA 5B8IB 2ZKMX 1SCVA 1UHJA 1WRZA 1FI6A 2EGDA 1VRKA 4I5NB 2M29A 1OZOA 1SW8A 2E30A 2BBNA 1GGWA 2PVBA 3BQ3A 2M8UA 3SIAA 2NLNA 3LK1A 1WLMA 2BKHB 2K2AA 5CSNA 4CIDA 1XYDA 1CLMA 1SNLA 1OE9B 1TIZA 4D1EA 2LLSA 4PALA 1QIWA 4GUKA 2JQ6A 4MRYA 1SY9A 2FJUB 5F6TA 1IJ5A 4ZCUA 1K8UA 1TCFA 3EVUA 4CPVA 2MRDA 5TNCA 4MVFA 4OV2A 3GOFA 1C7VA 2LMUA 1CLBA 1YX8A 3EK7A 4DRWA 2M97A 1BJFA 1NIWA 3WNXB 1LKJA 2BCBA 3OP0A 4XJKA 3O78A 3FS7A 2KSPA 2WC8A 3IF7A 3AKAA 1S26D 2QPTA 1KFUL 2JTZA 5D69A 1NCXA 2K7DA 2L2EA 3BUOB 2OTGC 5HYDA 2AAOA 4P5OE 4C0LA 1LA0A 2JC2A 4YGEB 3VRQA 2PRUA 4NQGA 4GGNA 1KWOB 2MAZA 4TNCA 1IGVA 2K7BA 5K89A 1QTXA 1EXRA 3JVTC 1DVIA 1QASA 4PDZA 1K94A 1TOPA 3QRXA 2LNKA 4M2PA 3HX4A 1C07A 3I5IB 2PASA 4GGFC 1F71A 1QV0A 4MEWA 2OPOA 2KFGA 2KYCA 4CFQA 1R6PA 1HT9A 1L2OB 2BCAA 2K7OA 5KTYA 1RTP1 1CDPA 1XFVO 4JQ0D 2LUXA 1G4YR 4OKHA 1LVCD 1PULA 3VRRA 3IQQA 2HETA 2WCEA 2Q91A 3BYAA 5CSIA 1S6CA 1S6JA 1F4OA 1SMGA 4NDDA 1DJXA 1PALA 1B1GA 4PE4A 4PHKA 1ZMZA 1MUXA 4ORBB 3SJSA 1UWOA 1JBAA 4YRUA 1J7RA 2KOTA 4I5KA 2Y4QA 1CTRA 2JXCA 3SIBA 3CGAA 1SL8A 2AUCA 3A4UB 3CS1A 3KO0A 2A4JA 4PE1A 1UHIA 1IQ3A 1K9UA 1YRTB 1TN4A 3CWGA 2JXLA 1GQMA 2LMTA 4WQ3A 4P2YB 1CLLA 1XFZO 2JT8A 2V53A 3JVTB 2F3YA 4YBHB 1FPWA 1BR4B 3PATA 1PVBA 3WHUB 2BBMA 1K96A 4YI9A 1SYMA 3CLNA 4IL1A 1OMRA 2ZRSA 3DF0B 2LUCA 3I5FB 4MLWA 4ORCB 2MLFC 1AVSA 4AQJA 3CR4X 5AFPA 2WORA 1M31A 1DTLA 1S36A 5I2OA 1F4QA 3BOWA 4I5JA 2P6BB 3JTDB 1XVJA 5D7FA 1DF0A 2ZNEA 1BODA 1S3PA 3ZWHA 2ZRTA 1NX1A 3AAJA 1WRKA 4USLA 2NCPA 4A4BA 2NXQA 1NX2A 3TS5B 2JOJA 2LMVA 5HKWA 1A75A 2ZN8A 3EVRA 5KSZA 1EH2A 2LV7A 1FI5A 1AK8A 1XFXO 1X02A 1SR6C 1F54A 1C7WA 4L9MA 1B47A 1FBVA 2PMYA 1RFJA 3CR5X 4OVNF 1OZSA 5JJGA 2JNFA 2NCOA 2AMIA 1J1EA 3PFVA 4AOMA 1JC2A 2H2KA 2MHHA 2MBXA 1QVIY 5BPJA 4CLNA 1ZUZA 3PN7B 2JWWA 4XYNA 1QLKA 2F3ZA 5FYXA 1NPQA 4YI8A 4E68A 1DJZA 2GGZA 5DKRA 3VGOA 2KAXA 5HLOA 2M1UA 1QVIZ 1KQVA 2BE4A 2M7LA 1S5GY 3A8RA 5G08A 1TNWA 5IBWA 1BLQA 3F45A 2BECA 2G9BA 1WLZA 1A75B 1SPYA 2L51A 2ZFDA 4UPGA 3PALA 4CFRA 3AKBA 2JPTA 1XK4A 1SL9A 1CFFA 3WXAA 2PSRA 1QJTA 2ZNDA 1ZFSA 2OTGB 2JU0A 2KDHA 2LVJA 4I5LB 2KQYA 3TDUA 2CT9A 2HF5A 2L98A 2LHIA 2LVKA 1NX3A 3PSRA 1YTZC 3NSLA 4HSZA 3NSIA 2DOQA 1DJIA 4HREE 1JFJA 1CMGA 2F2OA 3AAKA 4QJ5B 4N5XA 3DVEA 3NXAA 4ZCVA 1CDNA 3PLFB 2JNXA 4XJKB 1GGZA 2OS8B 1IRJA 1NCZA 3HCMA 1B8LA 1KSOA 1SKTA 4GNKB 5ER4X 3O4YA 4ICBA 1K2HA 1J1DA 1AJ4A 1KK8B 1NCYA 3I5HB 2KFHA 1A03A 1D1OA 2EC6C 1NX0A 4YGCB 4C0JA 1BR1B 2BE6A 1QXPA 3KHEA 1J7PA 2KYFA 1QX5B 1L7ZA 2ZN9A 1RECA 1KFXS 2GGMA 1ALVA 4MZJA 1IKUA 3ZNIA 2HQ8A 4MBEA 3TDIA 1UHHA 4OR9B 2LCPA 1S5GZ 1B7TY 3VRNA 2BL0C 4AQIA 3O6BA 4YGDB 1JF0A 1CM4A 1Y1AA 1PRWA 2WCFA 4HRHA 1WY9A 2IS9A 2CXJA 1PSRA 1QX7A 1JUOA 2K61A 2COLB 1XFYO 4MN0A 1QX2A 1QV1A 4PE0A 3SG3A 4A4CA 3EK8A 3DVKA 1Y6WA 2JZIA 1SCMB 1CKKA 2OS8C 4GGFA 1IWQA 2LP3A 4NDBA 1SCMC 3SG7A 3RLZA 1S1EA 3KF9A 4NDCA 2L5XB 3DVMA 1OMDA 1NYAA 1SBJA 2KFFA 5AXIA 3TDZA 4F0ZB 4HRGA 4PHNA 4QJ3B 2O5GA 3PM8A 1F55A 1CDMA 3EKJA 1MXEA 4DS7A 3OHMB 1CMFA 1KK7Y 3LCPC 1V1GA 2JT3A 1DT7B 1YUTA 2K0JA 3C1VA 1UP5A 1M39A 1J7QA 1JF2A 3NSOA 2WOSA 1DMOA 4PHJA 1YX7A 3TUYC 3BUNB 3MSEB 2KI6D 3I5IC 5DKQA 1OSAA 1Y0VH 5PALA 2GV5A 4OCIA 5CSJA 3VRPA 2D8NA 2JULA 1LA3A 1IH0A 1A2XA 2M0RA 2M3WA 3I5HC 3I5GB 3LLEA 1MHOA 2LM5A 2G2BA 2SCPA 1A29A 2I2RE
chains in the Genus database with same CATH superfamily
1QATA 4PHMA 2LP2A 3FIAA 2M49B 4DCKA 1GJYA 1UHNA 3BUMB 5HKYA 1YUSA 4FQTA 2WCBA 2KGRA 3CR2A 3NGVA 1DF0B 4FTGA 3QMEA 4IJ7A 1OOHA 1B8CA 3K21A 2Y1MA 1Z2CB 3DF0A 4Q04A 3WHTB 2KI4B 1LS8A 1L2OC 2VRGA 5AERA 1KK8C 2P70A 1EG3A 1K9PA 1U5IA 1C3YA 2E6WA 2FCEA 1BMOA 1YVLA 1M63B 1MXLC 2KBIA 2LLTA 2QEVA 2L5YA 3LK0A 5D3OA 1IJ6A 2HPSA 3OB1B 1DQEA 3S0GA 3SG5A 3KEVA 3RM1A 2LLUA 2R2IA 4GAOA 1BF5A 1M46A 1RROA 4ORAB 1CFCA 2KBMA 1SSEB 3SG6A 1CB1A 2I94A 1H4BA 4YGAA 3BFBA 2BNXA 2LAPA 3D76A 2KNEA 2NZ0A 1LINA 2Q4UA 2FJYA 2KI4C 1KWOC 1RK9A 3BUWB 1IQ5A 1AJ5A 1R2UA 1K90D 3BXKA 1QS7A 2KHNA 5CSFA 1TTXA 5JOLA 2B1UA 4F7FA 1NSHA 1ZACA 1DJGA 3D0YB 3IQOA 4JPZB 1LXFC 2F33A 2H61A 1KFXL 1FF1A 1AHRA 1G33A 2MLEC 3R1PA 4BY5A 4ETOA 2LC5A 4M2QA 3TZ1A 3KPXA 1E8AA 1DEKA 1CDLA 1S6IA 2MJWB 4PCWA 1OQPA 3I5GC 4BY4A 1YRUB 4C0KA 1SR6B 3SG2A 1YR5A 2LVVA 3O4XA 5I2LA 1TRFA 3GK1A 4PT1A 5AANA 2BKIB 5I8NA 1WDCC 2M9GA 2QACA 5CPVA 2LHLA 5I2QA 2ISDA 2CCMA 2FOTA 1U5IB 4WQ2A 1N65A 2WCKA 1XK4C 1Q80A 3BFHA 1MR8A 2BCXA 2L4HA 5J3XA 5HLVA 1DJYA 1PK0D 3O2PA 5DKNA 3D0YA 4DIRA 3IVTA 3H4SE 1W7IB 1YVHA 1W7JB 2KGBC 2PQLA 2SASA 4N1GA 3CABA 3FE8A 2Y1NA 2M1KB 3DVJA 3PN7C 1ZOTB 3FE6A 4GFTA 1AP4A 1Y1XA 5KU1A 2JPOA 3R72A 1XFWO 1MWNA 1UHKA 2F8PA 1UUSA 1YUUA 5HKZA 1CNPA 5AEQA 1EG4A 1KQMC 1RWYA 2M7NA 3D73A 1DJHA 3M0WA 1QIVA 2PALA 1KFUS 2L50A 1PVAA 3D10A 4OZDA 1XFUO 2Y5IA 4MRXA 1CFPA 1KSMA 1UURA 1B9AA 4GPLB 2KAYA 3Q8IA 1B7TZ 3GK4X 2WNDA 3NSKA 3OX5A 4JWQA 1NP8A 3BUXB 1J55A 1QWVA 5I94A 1KK7Z 2LVIA 3TUYB 1G8IA 2WC5A 1DGUA 3CZTX 3OB2B 4MSPA 4FQOA 1JWDA 2I7AA 5ER5A 1JFKA 1DGVA 1EJ3A 2CTNA 2JT0A 3JTDC 1BOCA 3L47A 4WRIA 2CNPA 4M2OA 1EL4A 2LE9B 3OBVA 1K9KA 3DD4A 3EK4A 1IIOA 1K95A 1KQMB 2H61C 1TWOA 4PE7A 2TN4A 4MZLA 1XA5A 3VROA 1B4CA 1OOJA 2L4IA 2O60A 1V1FA 2K2FA 1PSBA 3S0AA 4R1EA 1TNQA 2KQ6A 2QEHA 3EKHA 1JSAA 1IG5A 5DICA 1WRLA 2HQWA 3OX6A 3S0BA 3SS5A 1TNPA 1HQVA 1TCOB 2CBLA 1N0YA 1NWDA 1SRAA 2EC6B 2KI6C 3OGNA 1J7OA 2LANA 4N1FA 3GK2A 2RGIA 1ORGA 1A4PA 1KCYA 4DUQA 1B8RA 1K93D 1XO5A 3LL8B 1H8BA 3BOWB 2L0PA 3S0DA 1M45A 1NUBA 2KAVA 3SG4A 1BU3A 1RJVA 1ALWA 3I5FC 1TNXA 3B7AA 3E3RA 1BT6A 2K8MB 2BL0B 3FWCA 1ODBA 2EHBA 1MQ1A 1SK6D 2MA2A 4GBAA 2F2PA 1WDCB 1F8HA 2FCDA 1SL7A 4INXA 2JTTA 4YGBB 5FI2A 1Y1UA 1QLSA 2K7CA 1AUIB 2I18A 3R1VA 1CM1A 3CTNA 1BG1A 4MZKA 1YURA 5GQQC 1N2DA 3NHTA 4U8DA 2JRFA 3TS5C 1MF8B 2KLDA 1OMVA 1CFDA 1DJWA 3FWBA 1FW4A 3EVVA 3ICBA 4QJ4B 5B8IB 2ZKMX 1SCVA 3D75A 1UHJA 1WRZA 1FI6A 2EGDA 5EL2A 1VRKA 4I5NB 2M29A 1OZOA 1SW8A 2E30A 3EG5B 2BBNA 3S0FA 1GGWA 1P28A 2WCHA 2PVBA 3BQ3A 2M8UA 3SIAA 2NLNA 2QEBA 3LK1A 2BKHB 1WLMA 2K2AA 5CSNA 4CIDA 1XYDA 1CLMA 1SNLA 1OE9B 1TIZA 4D1EA 2LLSA 4PALA 1QIWA 4GUKA 2JQ6A 4MRYA 1SY9A 2FJUB 5F6TA 1IJ5A 4ZCUA 1K8UA 1TCFA 3EVUA 4CPVA 2MRDA 5TNCA 4MVFA 4OV2A 3GOFA 1C7VA 2LMUA 1CLBA 1YX8A 3EK7A 4DRWA 2M97A 1BJFA 1NIWA 3WNXB 1LKJA 2BCBA 2K60A 2KPHA 3OP0A 4XJKA 3N7HA 3O78A 3FS7A 2KSPA 2WC8A 3IF7A 3AKAA 1S26D 2QPTA 1KFUL 3UO9A 2JTZA 5D69A 5FI6A 1NCXA 2K7DA 2L2EA 3BUOB 1OOFA 2OTGC 5HYDA 2AAOA 4P5OE 3SS3A 4C0LA 1LA0A 2JC2A 3L4AA 4YGEB 3VRQA 2PRUA 3D77A 4NQGA 3D74A 4GGNA 1KWOB 3VB1A 2MAZA 4TNCA 1IGVA 2K7BA 5K89A 1QTXA 1EXRA 3JVTC 2WCJA 1DVIA 1QASA 4PDZA 1K94A 1TOPA 3QRXA 2LNKA 4M2PA 3HX4A 1C07A 3I5IB 2PASA 3FE9A 4GGFC 1QV0A 4MEWA 2OPOA 1F71A 2KFGA 2KYCA 4CFQA 1R6PA 1HT9A 1L2OB 1W9ZA 2BCAA 2K7OA 3CDNA 5KTYA 1RTP1 1CDPA 1XFVO 4JQ0D 2LUXA 1G4YR 4OKHA 3SS4A 1LVCD 3B88A 1PULA 3VRRA 3IQQA 2HETA 2WCEA 3CZ0A 3S0EA 2Q91A 3BYAA 5CSIA 1S6CA 1S6JA 1F4OA 1SMGA 4NDDA 1DJXA 1PALA 1B1GA 4PE4A 4PHKA 1ZMZA 1MUXA 3CZ1A 4ORBB 3SJSA 3CZ2A 1UWOA 1JBAA 4YRUA 1J7RA 2KOTA 4I5KA 2Y4QA 1CTRA 2JXCA 3SIBA 3CGAA 1SL8A 2AUCA 3A4UB 3CS1A 3DZTA 3KO0A 2A4JA 4PE1A 1UHIA 1C3ZA 1IQ3A 1K9UA 1YRTB 1TN4A 3CWGA 1OOGA 1GQMA 2JXLA 2LMTA 4WQ3A 4P2YB 1CLLA 1XFZO 2JT8A 2V53A 3JVTB 2F3YA 4YBHB 1FPWA 1BR4B 3PATA 4KYNA 1PVBA 3WHUB 2BBMA 1K96A 4YI9A 3PM2A 1SYMA 3CLNA 2P71A 4IL1A 1OMRA 2ZRSA 3DF0B 2LUCA 2WCLA 2WCMA 3CYZA 3I5FB 4MLWA 4ORCB 2MLFC 1AVSA 4AQJA 3CR4X 5AFPA 2WORA 1M31A 1DTLA 1S36A 5I2OA 1F4QA 3BOWA 4I5JA 2P6BB 3JTDB 1XVJA 5D7FA 1DF0A 2ZNEA 1BODA 1S3PA 3ZWHA 2ZRTA 1NX1A 3AAJA 1WRKA 4USLA 2NCPA 4A4BA 3NHIA 2NXQA 1NX2A 3TS5B 2QEOA 2JOJA 2LMVA 5HKWA 1A75A 2ZN8A 3EVRA 5KSZA 1EH2A 2LV7A 1FI5A 1AK8A 1XFXO 1X02A 2GTEA 1SR6C 2L2CA 1F54A 1C7WA 4L9MA 1B47A 3BJHA 1FBVA 2PMYA 1RFJA 3CR5X 4OVNF 1OZSA 3V2LA 5JJGA 2JNFA 2NCOA 3DYEA 2AMIA 1J1EA 3PFVA 4AOMA 1JC2A 3BFAA 1XFRA 2H2KA 2MHHA 2MBXA 1GM0A 1QVIY 5BPJA 4CLNA 1ZUZA 3PN7B 2JWWA 2QDIA 4XYNA 1QLKA 2F3ZA 5FYXA 1NPQA 4YI8A 4E68A 1DJZA 2GGZA 5DKRA 3VGOA 2KAXA 3B86A 5HLOA 2M1UA 1QVIZ 3K1EA 1KQVA 2BE4A 2M7LA 1S5GY 3A8RA 5G08A 1TUJA 1TNWA 5IBWA 1BLQA 3F45A 4JKTA 2BECA 2G9BA 1WLZA 2PYQA 1A75B 1SPYA 2L51A 2ZFDA 3D78A 4UPGA 3RZSA 3PALA 4CFRA 3AKBA 2JPTA 1XK4A 1SL9A 1CFFA 3WXAA 2PSRA 1QJTA 2ZNDA 1ZFSA 2OTGB 2JU0A 2KDHA 2LVJA 4I5LB 2KQYA 3TDUA 2CT9A 2HF5A 2L98A 2LHIA 2LVKA 1T14A 1Z4HA 1NX3A 3PSRA 1YTZC 3NSLA 4HSZA 3NSIA 2DOQA 1DJIA 4HREE 1JFJA 1CMGA 2F2OA 3AAKA 3L4LA 4QJ5B 4N5XA 3DVEA 3NXAA 4ZCVA 1CDNA 3PLFB 2JNXA 4XJKB 1GGZA 2OS8B 1IRJA 1NCZA 3HCMA 1B8LA 1KSOA 1SKTA 4GNKB 5ER4X 3O4YA 4ICBA 1K2HA 1J1DA 1AJ4A 1KK8B 1NCYA 3I5HB 2KFHA 4INWA 1A03A 1D1OA 2EC6C 1NX0A 4YGCB 4C0JA 1BR1B 2BE6A 1QXPA 3KHEA 1J7PA 2KYFA 1QX5B 1L7ZA 3DY9A 2ZN9A 1RECA 1KFXS 2GGMA 3B87A 1ALVA 4MZJA 1IKUA 3ZNIA 1DELA 2HQ8A 4MBEA 3TDIA 1UHHA 4OR9B 2LCPA 1S5GZ 1B7TY 3VRNA 2BL0C 4AQIA 3O6BA 2H8VA 4YGDB 1JF0A 1CM4A 1Y1AA 1PRWA 3UNWA 2WCFA 4HRHA 1WY9A 2IS9A 1OW4A 2CXJA 1PSRA 1QX7A 1JUOA 5HL1A 2K61A 2COLB 1XFYO 4MN0A 1QX2A 1QV1A 1OOIX 2BAPA 4PE0A 3SG3A 4A4CA 2ERBA 3DVKA 1Y6WA 3EK8A 2JZIA 1SCMB 1CKKA 2OS8C 4GGFA 1IWQA 2LP3A 4NDBA 1SCMC 3SG7A 3RLZA 1S1EA 3KF9A 4NDCA 2L5XB 3DVMA 1TUZA 1OMDA 1NYAA 1SBJA 2KFFA 5AXIA 3TDZA 4F0ZB 4HRGA 4PHNA 3R1OA 2O5GA 3PM8A 4QJ3B 1F55A 1CDMA 3EKJA 1MXEA 4DS7A 3OHMB 1CMFA 1KK7Y 3LCPC 1V1GA 2JT3A 3DXLA 1DT7B 1YUTA 2K0JA 3C1VA 1UP5A 1M39A 1J7QA 1JF2A 3NSOA 2WOSA 2YGUA 1DMOA 1F70A 4PHJA 1YX7A 3TUYC 4JD9A 3BUNB 3MSEB 2KI6D 3B6XA 3I5IC 5DKQA 1OSAA 1Y0VH 5PALA 2KLEA 5FI7A 2GV5A 4OCIA 1DC1A 5CSJA 3PJIA 3VRPA 2D8NA 2WC6A 2JULA 1LA3A 1IH0A 1A2XA 2M0RA 2M3WA 3I5HC 3I5GB 3LLEA 1MHOA 2LM5A 2G2BA 2SCPA 1A29A 2I2RE
chains in the Genus database with same CATH topology
1QATA 4PHMA 2LP2A 3FIAA 2M49B 4DCKA 1GJYA 1UHNA 3BUMB 5HKYA 1YUSA 2WCBA 2KGRA 3CR2A 1DF0B 4FTGA 1B8CA 3K21A 2Y1MA 3DF0A 4Q04A 3WHTB 2KI4B 1L2OC 2VRGA 5AERA 1KK8C 1EG3A 1K9PA 1U5IA 2FCEA 2E6WA 1BMOA 1YVLA 1M63B 1MXLC 2KBIA 2LLTA 1F70A 3LK0A 1IJ6A 2HPSA 3OB1B 3SG5A 3KEVA 3RM1A 2LLUA 2R2IA 4GAOA 1BF5A 1M46A 1RROA 4ORAB 1CFCA 2KBMA 3SG6A 1CB1A 2I94A 1H4BA 4YGAA 2LAPA 2KNEA 2NZ0A 1LINA 2Q4UA 2KI4C 1KWOC 1RK9A 3BUWB 1IQ5A 1AJ5A 1R2UA 1K90D 3BXKA 1QS7A 2KHNA 5CSFA 1TTXA 5JOLA 2B1UA 1NSHA 1ZACA 1DJGA 3D0YB 3IQOA 4JPZB 1LXFC 2F33A 2H61A 1KFXL 1FF1A 1AHRA 1G33A 2MLEC 4BY5A 4ETOA 2LC5A 4M2QA 3TZ1A 3KPXA 1E8AA 1CDLA 1S6IA 2MJWB 4PCWA 1OQPA 3I5GC 4BY4A 1YRUB 4C0KA 1SR6B 3SG2A 1YR5A 2LVVA 5I2LA 1TRFA 3GK1A 5AANA 2BKIB 5I8NA 1WDCC 2M9GA 2QACA 5CPVA 2LHLA 5I2QA 2ISDA 2CCMA 2FOTA 1U5IB 4WQ2A 1N65A 1XK4C 1Q80A 1MR8A 2BCXA 2L4HA 5J3XA 5HLVA 1DJYA 1PK0D 3O2PA 5DKNA 3D0YA 4DIRA 3H4SE 1W7IB 1YVHA 1W7JB 2KGBC 2SASA 4N1GA 2Y1NA 2M1KB 3DVJA 3PN7C 1ZOTB 4GFTA 1AP4A 1Y1XA 5KU1A 1XFWO 1MWNA 1UHKA 2F8PA 1UUSA 1YUUA 5HKZA 1CNPA 5AEQA 1EG4A 1KQMC 1RWYA 2M7NA 3M0WA 1DJHA 1QIVA 2PALA 1KFUS 2L50A 1PVAA 3D10A 1CFPA 1XFUO 2Y5IA 4MRXA 1KSMA 1UURA 1B9AA 4GPLB 2KAYA 1B7TZ 3GK4X 2WNDA 3NSKA 3OX5A 4JWQA 1NP8A 3BUXB 1J55A 1KK7Z 2LVIA 3TUYB 1G8IA 3CZTX 1DGUA 3OB2B 4MSPA 4FQOA 1JWDA 2I7AA 5ER5A 1JFKA 1DGVA 1EJ3A 2CTNA 2JT0A 3JTDC 1BOCA 4WRIA 2CNPA 4M2OA 1EL4A 2LE9B 1K9KA 3DD4A 3EK4A 1K95A 1KQMB 2H61C 4PE7A 2TN4A 4MZLA 1XA5A 3VROA 1B4CA 1OOJA 2L4IA 2O60A 1V1FA 2K2FA 1PSBA 4R1EA 1TNQA 2KQ6A 3EKHA 1JSAA 1IG5A 1WRLA 2HQWA 3OX6A 1TNPA 1HQVA 1TCOB 2CBLA 1N0YA 1NWDA 1SRAA 2EC6B 2KI6C 1J7OA 2LANA 4N1FA 3GK2A 2RGIA 1A4PA 1KCYA 4DUQA 1B8RA 1K93D 1XO5A 3LL8B 1H8BA 3BOWB 2L0PA 1M45A 1NUBA 2KAVA 3SG4A 1BU3A 1RJVA 1ALWA 3I5FC 1TNXA 3E3RA 1BT6A 2K8MB 2BL0B 3FWCA 1ODBA 2EHBA 1MQ1A 1SK6D 2MA2A 4GBAA 2F2PA 1WDCB 1F8HA 2FCDA 1SL7A 4YGBB 2JTTA 1Y1UA 1QLSA 2K7CA 1AUIB 2I18A 1CM1A 3CTNA 1BG1A 4MZKA 1YURA 5GQQC 1N2DA 3TS5C 4U8DA 2JRFA 1MF8B 4QJ4B 1OMVA 1CFDA 1DJWA 3FWBA 1FW4A 3EVVA 3ICBA 5B8IB 2ZKMX 1SCVA 1UHJA 1WRZA 1FI6A 2EGDA 1VRKA 4I5NB 2M29A 1OZOA 1SW8A 2E30A 2BBNA 1GGWA 2PVBA 3BQ3A 2M8UA 3SIAA 2NLNA 3LK1A 1WLMA 2BKHB 2K2AA 5CSNA 4CIDA 1XYDA 1CLMA 1SNLA 1OE9B 1TIZA 4D1EA 2LLSA 4PALA 1QIWA 4GUKA 2JQ6A 4MRYA 1SY9A 2FJUB 5F6TA 1IJ5A 4ZCUA 1K8UA 1TCFA 3EVUA 4CPVA 2MRDA 5TNCA 4MVFA 4OV2A 3GOFA 1C7VA 2LMUA 1CLBA 1YX8A 3EK7A 4DRWA 2M97A 1BJFA 1NIWA 3WNXB 1LKJA 2BCBA 3OP0A 4XJKA 3O78A 3FS7A 2KSPA 2WC8A 3IF7A 3AKAA 1S26D 2QPTA 1KFUL 2JTZA 5D69A 1NCXA 2K7DA 2L2EA 3BUOB 2OTGC 5HYDA 2AAOA 4P5OE 4C0LA 1LA0A 2JC2A 4YGEB 3VRQA 2PRUA 4NQGA 4GGNA 1KWOB 2MAZA 4TNCA 1IGVA 2K7BA 5K89A 1QTXA 1EXRA 3JVTC 1DVIA 1QASA 4PDZA 1K94A 1TOPA 3QRXA 2LNKA 4M2PA 3HX4A 1C07A 3I5IB 2PASA 4GGFC 1F71A 1QV0A 4MEWA 2OPOA 2KFGA 2KYCA 4CFQA 1R6PA 1HT9A 1L2OB 2BCAA 2K7OA 5KTYA 1RTP1 1CDPA 1XFVO 4JQ0D 2LUXA 1G4YR 4OKHA 1LVCD 1PULA 3VRRA 3IQQA 2HETA 2WCEA 2Q91A 3BYAA 5CSIA 1S6CA 1S6JA 1F4OA 1SMGA 4NDDA 1DJXA 1PALA 1B1GA 4PE4A 4PHKA 1ZMZA 1MUXA 4ORBB 3SJSA 1UWOA 1JBAA 4YRUA 1J7RA 2KOTA 4I5KA 2Y4QA 1CTRA 2JXCA 3SIBA 3CGAA 1SL8A 2AUCA 3A4UB 3CS1A 3KO0A 2A4JA 4PE1A 1UHIA 1IQ3A 1K9UA 1YRTB 1TN4A 3CWGA 2JXLA 1GQMA 2LMTA 4WQ3A 4P2YB 1CLLA 1XFZO 2JT8A 2V53A 3JVTB 2F3YA 4YBHB 1FPWA 1BR4B 3PATA 1PVBA 3WHUB 2BBMA 1K96A 4YI9A 1SYMA 3CLNA 4IL1A 1OMRA 2ZRSA 3DF0B 2LUCA 3I5FB 4MLWA 4ORCB 2MLFC 1AVSA 4AQJA 3CR4X 5AFPA 2WORA 1M31A 1DTLA 1S36A 5I2OA 1F4QA 3BOWA 4I5JA 2P6BB 3JTDB 1XVJA 5D7FA 1DF0A 2ZNEA 1BODA 1S3PA 3ZWHA 2ZRTA 1NX1A 3AAJA 1WRKA 4USLA 2NCPA 4A4BA 2NXQA 1NX2A 3TS5B 2JOJA 2LMVA 5HKWA 1A75A 2ZN8A 3EVRA 5KSZA 1EH2A 2LV7A 1FI5A 1AK8A 1XFXO 1X02A 1SR6C 1F54A 1C7WA 4L9MA 1B47A 1FBVA 2PMYA 1RFJA 3CR5X 4OVNF 1OZSA 5JJGA 2JNFA 2NCOA 2AMIA 1J1EA 3PFVA 4AOMA 1JC2A 2H2KA 2MHHA 2MBXA 1QVIY 5BPJA 4CLNA 1ZUZA 3PN7B 2JWWA 4XYNA 1QLKA 2F3ZA 5FYXA 1NPQA 4YI8A 4E68A 1DJZA 2GGZA 5DKRA 3VGOA 2KAXA 5HLOA 2M1UA 1QVIZ 1KQVA 2BE4A 2M7LA 1S5GY 3A8RA 5G08A 1TNWA 5IBWA 1BLQA 3F45A 2BECA 2G9BA 1WLZA 1A75B 1SPYA 2L51A 2ZFDA 4UPGA 3PALA 4CFRA 3AKBA 2JPTA 1XK4A 1SL9A 1CFFA 3WXAA 2PSRA 1QJTA 2ZNDA 1ZFSA 2OTGB 2JU0A 2KDHA 2LVJA 4I5LB 2KQYA 3TDUA 2CT9A 2HF5A 2L98A 2LHIA 2LVKA 1NX3A 3PSRA 1YTZC 3NSLA 4HSZA 3NSIA 2DOQA 1DJIA 4HREE 1JFJA 1CMGA 2F2OA 3AAKA 4QJ5B 4N5XA 3DVEA 3NXAA 4ZCVA 1CDNA 3PLFB 2JNXA 4XJKB 1GGZA 2OS8B 1IRJA 1NCZA 3HCMA 1B8LA 1KSOA 1SKTA 4GNKB 5ER4X 3O4YA 4ICBA 1K2HA 1J1DA 1AJ4A 1KK8B 1NCYA 3I5HB 2KFHA 1A03A 1D1OA 2EC6C 1NX0A 4YGCB 4C0JA 1BR1B 2BE6A 1QXPA 3KHEA 1J7PA 2KYFA 1QX5B 1L7ZA 2ZN9A 1RECA 1KFXS 2GGMA 1ALVA 4MZJA 1IKUA 3ZNIA 2HQ8A 4MBEA 3TDIA 1UHHA 4OR9B 2LCPA 1S5GZ 1B7TY 3VRNA 2BL0C 4AQIA 3O6BA 4YGDB 1JF0A 1CM4A 1Y1AA 1PRWA 2WCFA 4HRHA 1WY9A 2IS9A 2CXJA 1PSRA 1QX7A 1JUOA 2K61A 2COLB 1XFYO 4MN0A 1QX2A 1QV1A 4PE0A 3SG3A 4A4CA 3EK8A 3DVKA 1Y6WA 2JZIA 1SCMB 1CKKA 2OS8C 4GGFA 1IWQA 2LP3A 4NDBA 1SCMC 3SG7A 3RLZA 1S1EA 3KF9A 4NDCA 2L5XB 3DVMA 1OMDA 1NYAA 1SBJA 2KFFA 5AXIA 3TDZA 4F0ZB 4HRGA 4PHNA 4QJ3B 2O5GA 3PM8A 1F55A 1CDMA 3EKJA 1MXEA 4DS7A 3OHMB 1CMFA 1KK7Y 3LCPC 1V1GA 2JT3A 1DT7B 1YUTA 2K0JA 3C1VA 1UP5A 1M39A 1J7QA 1JF2A 3NSOA 2WOSA 1DMOA 4PHJA 1YX7A 3TUYC 3BUNB 3MSEB 2KI6D 3I5IC 5DKQA 1OSAA 1Y0VH 5PALA 2GV5A 4OCIA 5CSJA 3VRPA 2D8NA 2JULA 1LA3A 1IH0A 1A2XA 2M0RA 2M3WA 3I5HC 3I5GB 3LLEA 1MHOA 2LM5A 2G2BA 2SCPA 1A29A 2I2RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAT A;  4PHM A;  2LP2 A;  3FIA A;  2M49 B;  4DCK A;  1GJY A;  1UHN A;  3BUM B;  5HKY A;  1YUS A;  2WCB A;  2KGR A;  3CR2 A;  1DF0 B;  4FTG A;  1B8C A;  3K21 A;  2Y1M A;  3DF0 A;  4Q04 A;  3WHT B;  2KI4 B;  1L2O C;  2VRG A;  5AER A;  1KK8 C;  1EG3 A;  1K9P A;  1U5I A;  2FCE A;  2E6W A;  1BMO A;  1YVL A;  1M63 B;  1MXL C;  2KBI A;  2LLT A;  1F70 A;  3LK0 A;  1IJ6 A;  2HPS A;  3OB1 B;  3SG5 A;  3KEV A;  3RM1 A;  2LLU A;  2R2I A;  4GAO A;  1BF5 A;  1M46 A;  1RRO A;  4ORA B;  1CFC A;  2KBM A;  3SG6 A;  1CB1 A;  2I94 A;  1H4B A;  4YGA A;  2LAP A;  2KNE A;  2NZ0 A;  1LIN A;  2Q4U A;  2KI4 C;  1KWO C;  1RK9 A;  3BUW B;  1IQ5 A;  1AJ5 A;  1R2U A;  1K90 D;  3BXK A;  1QS7 A;  2KHN A;  5CSF A;  1TTX A;  5JOL A;  2B1U A;  1NSH A;  1ZAC A;  1DJG A;  3D0Y B;  3IQO A;  4JPZ B;  1LXF C;  2F33 A;  2H61 A;  1KFX L;  1FF1 A;  1AHR A;  1G33 A;  2MLE C;  4BY5 A;  4ETO A;  2LC5 A;  4M2Q A;  3TZ1 A;  3KPX A;  1E8A A;  1CDL A;  1S6I A;  2MJW B;  4PCW A;  1OQP A;  3I5G C;  4BY4 A;  1YRU B;  4C0K A;  1SR6 B;  3SG2 A;  1YR5 A;  2LVV A;  5I2L A;  1TRF A;  3GK1 A;  5AAN A;  2BKI B;  5I8N A;  1WDC C;  2M9G A;  2QAC A;  5CPV A;  2LHL A;  5I2Q A;  2ISD A;  2CCM A;  2FOT A;  1U5I B;  4WQ2 A;  1N65 A;  1XK4 C;  1Q80 A;  1MR8 A;  2BCX A;  2L4H A;  5J3X A;  5HLV A;  1DJY A;  1PK0 D;  3O2P A;  5DKN A;  3D0Y A;  4DIR A;  3H4S E;  1W7I B;  1YVH A;  1W7J B;  2KGB C;  2SAS A;  4N1G A;  2Y1N A;  2M1K B;  3DVJ A;  3PN7 C;  1ZOT B;  4GFT A;  1AP4 A;  1Y1X A;  5KU1 A;  1XFW O;  1MWN A;  1UHK A;  2F8P A;  1UUS A;  1YUU A;  5HKZ A;  1CNP A;  5AEQ A;  1EG4 A;  1KQM C;  1RWY A;  2M7N A;  3M0W A;  1DJH A;  1QIV A;  2PAL A;  1KFU S;  2L50 A;  1PVA A;  3D10 A;  1CFP A;  1XFU O;  2Y5I A;  4MRX A;  1KSM A;  1UUR A;  1B9A A;  4GPL B;  2KAY A;  1B7T Z;  3GK4 X;  2WND A;  3NSK A;  3OX5 A;  4JWQ A;  1NP8 A;  3BUX B;  1J55 A;  1KK7 Z;  2LVI A;  3TUY B;  1G8I A;  3CZT X;  1DGU A;  3OB2 B;  4MSP A;  4FQO A;  1JWD A;  2I7A A;  5ER5 A;  1JFK A;  1DGV A;  1EJ3 A;  2CTN A;  2JT0 A;  3JTD C;  1BOC A;  4WRI A;  2CNP A;  4M2O A;  1EL4 A;  2LE9 B;  1K9K A;  3DD4 A;  3EK4 A;  1K95 A;  1KQM B;  2H61 C;  4PE7 A;  2TN4 A;  4MZL A;  1XA5 A;  3VRO A;  1B4C A;  1OOJ A;  2L4I A;  2O60 A;  1V1F A;  2K2F A;  1PSB A;  4R1E A;  1TNQ A;  2KQ6 A;  3EKH A;  1JSA A;  1IG5 A;  1WRL A;  2HQW A;  3OX6 A;  1TNP A;  1HQV A;  1TCO B;  2CBL A;  1N0Y A;  1NWD A;  1SRA A;  2EC6 B;  2KI6 C;  1J7O A;  2LAN A;  4N1F A;  3GK2 A;  2RGI A;  1A4P A;  1KCY A;  4DUQ A;  1B8R A;  1K93 D;  1XO5 A;  3LL8 B;  1H8B A;  3BOW B;  2L0P A;  1M45 A;  1NUB A;  2KAV A;  3SG4 A;  1BU3 A;  1RJV A;  1ALW A;  3I5F C;  1TNX A;  3E3R A;  1BT6 A;  2K8M B;  2BL0 B;  3FWC A;  1ODB A;  2EHB A;  1MQ1 A;  1SK6 D;  2MA2 A;  4GBA A;  2F2P A;  1WDC B;  1F8H A;  2FCD A;  1SL7 A;  4YGB B;  2JTT A;  1Y1U A;  1QLS A;  2K7C A;  1AUI B;  2I18 A;  1CM1 A;  3CTN A;  1BG1 A;  4MZK A;  1YUR A;  5GQQ C;  1N2D A;  3TS5 C;  4U8D A;  2JRF A;  1MF8 B;  4QJ4 B;  1OMV A;  1CFD A;  1DJW A;  3FWB A;  1FW4 A;  3EVV A;  3ICB A;  5B8I B;  2ZKM X;  1SCV A;  1UHJ A;  1WRZ A;  1FI6 A;  2EGD A;  1VRK A;  4I5N B;  2M29 A;  1OZO A;  1SW8 A;  2E30 A;  2BBN A;  1GGW A;  2PVB A;  3BQ3 A;  2M8U A;  3SIA A;  2NLN A;  3LK1 A;  1WLM A;  2BKH B;  2K2A A;  5CSN A;  4CID A;  1XYD A;  1CLM A;  1SNL A;  1OE9 B;  1TIZ A;  4D1E A;  2LLS A;  4PAL A;  1QIW A;  4GUK A;  2JQ6 A;  4MRY A;  1SY9 A;  2FJU B;  5F6T A;  1IJ5 A;  4ZCU A;  1K8U A;  1TCF A;  3EVU A;  4CPV A;  2MRD A;  5TNC A;  4MVF A;  4OV2 A;  3GOF A;  1C7V A;  2LMU A;  1CLB A;  1YX8 A;  3EK7 A;  4DRW A;  2M97 A;  1BJF A;  1NIW A;  3WNX B;  1LKJ A;  2BCB A;  3OP0 A;  4XJK A;  3O78 A;  3FS7 A;  2KSP A;  2WC8 A;  3IF7 A;  3AKA A;  1S26 D;  2QPT A;  1KFU L;  2JTZ A;  5D69 A;  1NCX A;  2K7D A;  2L2E A;  3BUO B;  2OTG C;  5HYD A;  2AAO A;  4P5O E;  4C0L A;  1LA0 A;  2JC2 A;  4YGE B;  3VRQ A;  2PRU A;  4NQG A;  4GGN A;  1KWO B;  2MAZ A;  4TNC A;  1IGV A;  2K7B A;  5K89 A;  1QTX A;  1EXR A;  3JVT C;  1DVI A;  1QAS A;  4PDZ A;  1K94 A;  1TOP A;  3QRX A;  2LNK A;  4M2P A;  3HX4 A;  1C07 A;  3I5I B;  2PAS A;  4GGF C;  1F71 A;  1QV0 A;  4MEW A;  2OPO A;  2KFG A;  2KYC A;  4CFQ A;  1R6P A;  1HT9 A;  1L2O B;  2BCA A;  2K7O A;  5KTY A;  1RTP 1;  1CDP A;  1XFV O;  4JQ0 D;  2LUX A;  1G4Y R;  4OKH A;  1LVC D;  1PUL A;  3VRR A;  3IQQ A;  2HET A;  2WCE A;  2Q91 A;  3BYA A;  5CSI A;  1S6C A;  1S6J A;  1F4O A;  1SMG A;  4NDD A;  1DJX A;  1PAL A;  1B1G A;  4PE4 A;  4PHK A;  1ZMZ A;  1MUX A;  4ORB B;  3SJS A;  1UWO A;  1JBA A;  4YRU A;  1J7R A;  2KOT A;  4I5K A;  2Y4Q A;  1CTR A;  2JXC A;  3SIB A;  3CGA A;  1SL8 A;  2AUC A;  3A4U B;  3CS1 A;  3KO0 A;  2A4J A;  4PE1 A;  1UHI A;  1IQ3 A;  1K9U A;  1YRT B;  1TN4 A;  3CWG A;  2JXL A;  1GQM A;  2LMT A;  4WQ3 A;  4P2Y B;  1CLL A;  1XFZ O;  2JT8 A;  2V53 A;  3JVT B;  2F3Y A;  4YBH B;  1FPW A;  1BR4 B;  3PAT A;  1PVB A;  3WHU B;  2BBM A;  1K96 A;  4YI9 A;  1SYM A;  3CLN A;  4IL1 A;  1OMR A;  2ZRS A;  3DF0 B;  2LUC A;  3I5F B;  4MLW A;  4ORC B;  2MLF C;  1AVS A;  4AQJ A;  3CR4 X;  5AFP A;  2WOR A;  1M31 A;  1DTL A;  1S36 A;  5I2O A;  1F4Q A;  3BOW A;  4I5J A;  2P6B B;  3JTD B;  1XVJ A;  5D7F A;  1DF0 A;  2ZNE A;  1BOD A;  1S3P A;  3ZWH A;  2ZRT A;  1NX1 A;  3AAJ A;  1WRK A;  4USL A;  2NCP A;  4A4B A;  2NXQ A;  1NX2 A;  3TS5 B;  2JOJ A;  2LMV A;  5HKW A;  1A75 A;  2ZN8 A;  3EVR A;  5KSZ A;  1EH2 A;  2LV7 A;  1FI5 A;  1AK8 A;  1XFX O;  1X02 A;  1SR6 C;  1F54 A;  1C7W A;  4L9M A;  1B47 A;  1FBV A;  2PMY A;  1RFJ A;  3CR5 X;  4OVN F;  1OZS A;  5JJG A;  2JNF A;  2NCO A;  2AMI A;  1J1E A;  3PFV A;  4AOM A;  1JC2 A;  2H2K A;  2MHH A;  2MBX A;  1QVI Y;  5BPJ A;  4CLN A;  1ZUZ A;  3PN7 B;  2JWW A;  4XYN A;  1QLK A;  2F3Z A;  5FYX A;  1NPQ A;  4YI8 A;  4E68 A;  1DJZ A;  2GGZ A;  5DKR A;  3VGO A;  2KAX A;  5HLO A;  2M1U A;  1QVI Z;  1KQV A;  2BE4 A;  2M7L A;  1S5G Y;  3A8R A;  5G08 A;  1TNW A;  5IBW A;  1BLQ A;  3F45 A;  2BEC A;  2G9B A;  1WLZ A;  1A75 B;  1SPY A;  2L51 A;  2ZFD A;  4UPG A;  3PAL A;  4CFR A;  3AKB A;  2JPT A;  1XK4 A;  1SL9 A;  1CFF A;  3WXA A;  2PSR A;  1QJT A;  2ZND A;  1ZFS A;  2OTG B;  2JU0 A;  2KDH A;  2LVJ A;  4I5L B;  2KQY A;  3TDU A;  2CT9 A;  2HF5 A;  2L98 A;  2LHI A;  2LVK A;  1NX3 A;  3PSR A;  1YTZ C;  3NSL A;  4HSZ A;  3NSI A;  2DOQ A;  1DJI A;  4HRE E;  1JFJ A;  1CMG A;  2F2O A;  3AAK A;  4QJ5 B;  4N5X A;  3DVE A;  3NXA A;  4ZCV A;  1CDN A;  3PLF B;  2JNX A;  4XJK B;  1GGZ A;  2OS8 B;  1IRJ A;  1NCZ A;  3HCM A;  1B8L A;  1KSO A;  1SKT A;  4GNK B;  5ER4 X;  3O4Y A;  4ICB A;  1K2H A;  1J1D A;  1AJ4 A;  1KK8 B;  1NCY A;  3I5H B;  2KFH A;  1A03 A;  1D1O A;  2EC6 C;  1NX0 A;  4YGC B;  4C0J A;  1BR1 B;  2BE6 A;  1QXP A;  3KHE A;  1J7P A;  2KYF A;  1QX5 B;  1L7Z A;  2ZN9 A;  1REC A;  1KFX S;  2GGM A;  1ALV A;  4MZJ A;  1IKU A;  3ZNI A;  2HQ8 A;  4MBE A;  3TDI A;  1UHH A;  4OR9 B;  2LCP A;  1S5G Z;  1B7T Y;  3VRN A;  2BL0 C;  4AQI A;  3O6B A;  4YGD B;  1JF0 A;  1CM4 A;  1Y1A A;  1PRW A;  2WCF A;  4HRH A;  1WY9 A;  2IS9 A;  2CXJ A;  1PSR A;  1QX7 A;  1JUO A;  2K61 A;  2COL B;  1XFY O;  4MN0 A;  1QX2 A;  1QV1 A;  4PE0 A;  3SG3 A;  4A4C A;  3EK8 A;  3DVK A;  1Y6W A;  2JZI A;  1SCM B;  1CKK A;  2OS8 C;  4GGF A;  1IWQ A;  2LP3 A;  4NDB A;  1SCM C;  3SG7 A;  3RLZ A;  1S1E A;  3KF9 A;  4NDC A;  2L5X B;  3DVM A;  1OMD A;  1NYA A;  1SBJ A;  2KFF A;  5AXI A;  3TDZ A;  4F0Z B;  4HRG A;  4PHN A;  4QJ3 B;  2O5G A;  3PM8 A;  1F55 A;  1CDM A;  3EKJ A;  1MXE A;  4DS7 A;  3OHM B;  1CMF A;  1KK7 Y;  3LCP C;  1V1G A;  2JT3 A;  1DT7 B;  1YUT A;  2K0J A;  3C1V A;  1UP5 A;  1M39 A;  1J7Q A;  1JF2 A;  3NSO A;  2WOS A;  1DMO A;  4PHJ A;  1YX7 A;  3TUY C;  3BUN B;  3MSE B;  2KI6 D;  3I5I C;  5DKQ A;  1OSA A;  1Y0V H;  5PAL A;  2GV5 A;  4OCI A;  5CSJ A;  3VRP A;  2D8N A;  2JUL A;  1LA3 A;  1IH0 A;  1A2X A;  2M0R A;  2M3W A;  3I5H C;  3I5G B;  3LLE A;  1MHO A;  2LM5 A;  2G2B A;  2SCP A;  1A29 A;  2I2R E; 
#chains in the Genus database with same CATH topology
 1QAT A;  4PHM A;  2LP2 A;  3FIA A;  2M49 B;  4DCK A;  1GJY A;  1UHN A;  3BUM B;  5HKY A;  1YUS A;  4FQT A;  2WCB A;  2KGR A;  3CR2 A;  3NGV A;  1DF0 B;  4FTG A;  3QME A;  4IJ7 A;  1OOH A;  1B8C A;  3K21 A;  2Y1M A;  1Z2C B;  3DF0 A;  4Q04 A;  3WHT B;  2KI4 B;  1LS8 A;  1L2O C;  2VRG A;  5AER A;  1KK8 C;  2P70 A;  1EG3 A;  1K9P A;  1U5I A;  1C3Y A;  2E6W A;  2FCE A;  1BMO A;  1YVL A;  1M63 B;  1MXL C;  2KBI A;  2LLT A;  2QEV A;  2L5Y A;  3LK0 A;  5D3O A;  1IJ6 A;  2HPS A;  3OB1 B;  1DQE A;  3S0G A;  3SG5 A;  3KEV A;  3RM1 A;  2LLU A;  2R2I A;  4GAO A;  1BF5 A;  1M46 A;  1RRO A;  4ORA B;  1CFC A;  2KBM A;  1SSE B;  3SG6 A;  1CB1 A;  2I94 A;  1H4B A;  4YGA A;  3BFB A;  2BNX A;  2LAP A;  3D76 A;  2KNE A;  2NZ0 A;  1LIN A;  2Q4U A;  2FJY A;  2KI4 C;  1KWO C;  1RK9 A;  3BUW B;  1IQ5 A;  1AJ5 A;  1R2U A;  1K90 D;  3BXK A;  1QS7 A;  2KHN A;  5CSF A;  1TTX A;  5JOL A;  2B1U A;  4F7F A;  1NSH A;  1ZAC A;  1DJG A;  3D0Y B;  3IQO A;  4JPZ B;  1LXF C;  2F33 A;  2H61 A;  1KFX L;  1FF1 A;  1AHR A;  1G33 A;  2MLE C;  3R1P A;  4BY5 A;  4ETO A;  2LC5 A;  4M2Q A;  3TZ1 A;  3KPX A;  1E8A A;  1DEK A;  1CDL A;  1S6I A;  2MJW B;  4PCW A;  1OQP A;  3I5G C;  4BY4 A;  1YRU B;  4C0K A;  1SR6 B;  3SG2 A;  1YR5 A;  2LVV A;  3O4X A;  5I2L A;  1TRF A;  3GK1 A;  4PT1 A;  5AAN A;  2BKI B;  5I8N A;  1WDC C;  2M9G A;  2QAC A;  5CPV A;  2LHL A;  5I2Q A;  2ISD A;  2CCM A;  2FOT A;  1U5I B;  4WQ2 A;  1N65 A;  2WCK A;  1XK4 C;  1Q80 A;  3BFH A;  1MR8 A;  2BCX A;  2L4H A;  5J3X A;  5HLV A;  1DJY A;  1PK0 D;  3O2P A;  5DKN A;  3D0Y A;  4DIR A;  3IVT A;  3H4S E;  1W7I B;  1YVH A;  1W7J B;  2KGB C;  2PQL A;  2SAS A;  4N1G A;  3CAB A;  3FE8 A;  2Y1N A;  2M1K B;  3DVJ A;  3PN7 C;  1ZOT B;  3FE6 A;  4GFT A;  1AP4 A;  1Y1X A;  5KU1 A;  2JPO A;  3R72 A;  1XFW O;  1MWN A;  1UHK A;  2F8P A;  1UUS A;  1YUU A;  5HKZ A;  1CNP A;  5AEQ A;  1EG4 A;  1KQM C;  1RWY A;  2M7N A;  3D73 A;  1DJH A;  3M0W A;  1QIV A;  2PAL A;  1KFU S;  2L50 A;  1PVA A;  3D10 A;  4OZD A;  1XFU O;  2Y5I A;  4MRX A;  1CFP A;  1KSM A;  1UUR A;  1B9A A;  4GPL B;  2KAY A;  3Q8I A;  1B7T Z;  3GK4 X;  2WND A;  3NSK A;  3OX5 A;  4JWQ A;  1NP8 A;  3BUX B;  1J55 A;  1QWV A;  5I94 A;  1KK7 Z;  2LVI A;  3TUY B;  1G8I A;  2WC5 A;  1DGU A;  3CZT X;  3OB2 B;  4MSP A;  4FQO A;  1JWD A;  2I7A A;  5ER5 A;  1JFK A;  1DGV A;  1EJ3 A;  2CTN A;  2JT0 A;  3JTD C;  1BOC A;  3L47 A;  4WRI A;  2CNP A;  4M2O A;  1EL4 A;  2LE9 B;  3OBV A;  1K9K A;  3DD4 A;  3EK4 A;  1IIO A;  1K95 A;  1KQM B;  2H61 C;  1TWO A;  4PE7 A;  2TN4 A;  4MZL A;  1XA5 A;  3VRO A;  1B4C A;  1OOJ A;  2L4I A;  2O60 A;  1V1F A;  2K2F A;  1PSB A;  3S0A A;  4R1E A;  1TNQ A;  2KQ6 A;  2QEH A;  3EKH A;  1JSA A;  1IG5 A;  5DIC A;  1WRL A;  2HQW A;  3OX6 A;  3S0B A;  3SS5 A;  1TNP A;  1HQV A;  1TCO B;  2CBL A;  1N0Y A;  1NWD A;  1SRA A;  2EC6 B;  2KI6 C;  3OGN A;  1J7O A;  2LAN A;  4N1F A;  3GK2 A;  2RGI A;  1ORG A;  1A4P A;  1KCY A;  4DUQ A;  1B8R A;  1K93 D;  1XO5 A;  3LL8 B;  1H8B A;  3BOW B;  2L0P A;  3S0D A;  1M45 A;  1NUB A;  2KAV A;  3SG4 A;  1BU3 A;  1RJV A;  1ALW A;  3I5F C;  1TNX A;  3B7A A;  3E3R A;  1BT6 A;  2K8M B;  2BL0 B;  3FWC A;  1ODB A;  2EHB A;  1MQ1 A;  1SK6 D;  2MA2 A;  4GBA A;  2F2P A;  1WDC B;  1F8H A;  2FCD A;  1SL7 A;  4INX A;  2JTT A;  4YGB B;  5FI2 A;  1Y1U A;  1QLS A;  2K7C A;  1AUI B;  2I18 A;  3R1V A;  1CM1 A;  3CTN A;  1BG1 A;  4MZK A;  1YUR A;  5GQQ C;  1N2D A;  3NHT A;  4U8D A;  2JRF A;  3TS5 C;  1MF8 B;  2KLD A;  1OMV A;  1CFD A;  1DJW A;  3FWB A;  1FW4 A;  3EVV A;  3ICB A;  4QJ4 B;  5B8I B;  2ZKM X;  1SCV A;  3D75 A;  1UHJ A;  1WRZ A;  1FI6 A;  2EGD A;  5EL2 A;  1VRK A;  4I5N B;  2M29 A;  1OZO A;  1SW8 A;  2E30 A;  3EG5 B;  2BBN A;  3S0F A;  1GGW A;  1P28 A;  2WCH A;  2PVB A;  3BQ3 A;  2M8U A;  3SIA A;  2NLN A;  2QEB A;  3LK1 A;  2BKH B;  1WLM A;  2K2A A;  5CSN A;  4CID A;  1XYD A;  1CLM A;  1SNL A;  1OE9 B;  1TIZ A;  4D1E A;  2LLS A;  4PAL A;  1QIW A;  4GUK A;  2JQ6 A;  4MRY A;  1SY9 A;  2FJU B;  5F6T A;  1IJ5 A;  4ZCU A;  1K8U A;  1TCF A;  3EVU A;  4CPV A;  2MRD A;  5TNC A;  4MVF A;  4OV2 A;  3GOF A;  1C7V A;  2LMU A;  1CLB A;  1YX8 A;  3EK7 A;  4DRW A;  2M97 A;  1BJF A;  1NIW A;  3WNX B;  1LKJ A;  2BCB A;  2K60 A;  2KPH A;  3OP0 A;  4XJK A;  3N7H A;  3O78 A;  3FS7 A;  2KSP A;  2WC8 A;  3IF7 A;  3AKA A;  1S26 D;  2QPT A;  1KFU L;  3UO9 A;  2JTZ A;  5D69 A;  5FI6 A;  1NCX A;  2K7D A;  2L2E A;  3BUO B;  1OOF A;  2OTG C;  5HYD A;  2AAO A;  4P5O E;  3SS3 A;  4C0L A;  1LA0 A;  2JC2 A;  3L4A A;  4YGE B;  3VRQ A;  2PRU A;  3D77 A;  4NQG A;  3D74 A;  4GGN A;  1KWO B;  3VB1 A;  2MAZ A;  4TNC A;  1IGV A;  2K7B A;  5K89 A;  1QTX A;  1EXR A;  3JVT C;  2WCJ A;  1DVI A;  1QAS A;  4PDZ A;  1K94 A;  1TOP A;  3QRX A;  2LNK A;  4M2P A;  3HX4 A;  1C07 A;  3I5I B;  2PAS A;  3FE9 A;  4GGF C;  1QV0 A;  4MEW A;  2OPO A;  1F71 A;  2KFG A;  2KYC A;  4CFQ A;  1R6P A;  1HT9 A;  1L2O B;  1W9Z A;  2BCA A;  2K7O A;  3CDN A;  5KTY A;  1RTP 1;  1CDP A;  1XFV O;  4JQ0 D;  2LUX A;  1G4Y R;  4OKH A;  3SS4 A;  1LVC D;  3B88 A;  1PUL A;  3VRR A;  3IQQ A;  2HET A;  2WCE A;  3CZ0 A;  3S0E A;  2Q91 A;  3BYA A;  5CSI A;  1S6C A;  1S6J A;  1F4O A;  1SMG A;  4NDD A;  1DJX A;  1PAL A;  1B1G A;  4PE4 A;  4PHK A;  1ZMZ A;  1MUX A;  3CZ1 A;  4ORB B;  3SJS A;  3CZ2 A;  1UWO A;  1JBA A;  4YRU A;  1J7R A;  2KOT A;  4I5K A;  2Y4Q A;  1CTR A;  2JXC A;  3SIB A;  3CGA A;  1SL8 A;  2AUC A;  3A4U B;  3CS1 A;  3DZT A;  3KO0 A;  2A4J A;  4PE1 A;  1UHI A;  1C3Z A;  1IQ3 A;  1K9U A;  1YRT B;  1TN4 A;  3CWG A;  1OOG A;  1GQM A;  2JXL A;  2LMT A;  4WQ3 A;  4P2Y B;  1CLL A;  1XFZ O;  2JT8 A;  2V53 A;  3JVT B;  2F3Y A;  4YBH B;  1FPW A;  1BR4 B;  3PAT A;  4KYN A;  1PVB A;  3WHU B;  2BBM A;  1K96 A;  4YI9 A;  3PM2 A;  1SYM A;  3CLN A;  2P71 A;  4IL1 A;  1OMR A;  2ZRS A;  3DF0 B;  2LUC A;  2WCL A;  2WCM A;  3CYZ A;  3I5F B;  4MLW A;  4ORC B;  2MLF C;  1AVS A;  4AQJ A;  3CR4 X;  5AFP A;  2WOR A;  1M31 A;  1DTL A;  1S36 A;  5I2O A;  1F4Q A;  3BOW A;  4I5J A;  2P6B B;  3JTD B;  1XVJ A;  5D7F A;  1DF0 A;  2ZNE A;  1BOD A;  1S3P A;  3ZWH A;  2ZRT A;  1NX1 A;  3AAJ A;  1WRK A;  4USL A;  2NCP A;  4A4B A;  3NHI A;  2NXQ A;  1NX2 A;  3TS5 B;  2QEO A;  2JOJ A;  2LMV A;  5HKW A;  1A75 A;  2ZN8 A;  3EVR A;  5KSZ A;  1EH2 A;  2LV7 A;  1FI5 A;  1AK8 A;  1XFX O;  1X02 A;  2GTE A;  1SR6 C;  2L2C A;  1F54 A;  1C7W A;  4L9M A;  1B47 A;  3BJH A;  1FBV A;  2PMY A;  1RFJ A;  3CR5 X;  4OVN F;  1OZS A;  3V2L A;  5JJG A;  2JNF A;  2NCO A;  3DYE A;  2AMI A;  1J1E A;  3PFV A;  4AOM A;  1JC2 A;  3BFA A;  1XFR A;  2H2K A;  2MHH A;  2MBX A;  1GM0 A;  1QVI Y;  5BPJ A;  4CLN A;  1ZUZ A;  3PN7 B;  2JWW A;  2QDI A;  4XYN A;  1QLK A;  2F3Z A;  5FYX A;  1NPQ A;  4YI8 A;  4E68 A;  1DJZ A;  2GGZ A;  5DKR A;  3VGO A;  2KAX A;  3B86 A;  5HLO A;  2M1U A;  1QVI Z;  3K1E A;  1KQV A;  2BE4 A;  2M7L A;  1S5G Y;  3A8R A;  5G08 A;  1TUJ A;  1TNW A;  5IBW A;  1BLQ A;  3F45 A;  4JKT A;  2BEC A;  2G9B A;  1WLZ A;  2PYQ A;  1A75 B;  1SPY A;  2L51 A;  2ZFD A;  3D78 A;  4UPG A;  3RZS A;  3PAL A;  4CFR A;  3AKB A;  2JPT A;  1XK4 A;  1SL9 A;  1CFF A;  3WXA A;  2PSR A;  1QJT A;  2ZND A;  1ZFS A;  2OTG B;  2JU0 A;  2KDH A;  2LVJ A;  4I5L B;  2KQY A;  3TDU A;  2CT9 A;  2HF5 A;  2L98 A;  2LHI A;  2LVK A;  1T14 A;  1Z4H A;  1NX3 A;  3PSR A;  1YTZ C;  3NSL A;  4HSZ A;  3NSI A;  2DOQ A;  1DJI A;  4HRE E;  1JFJ A;  1CMG A;  2F2O A;  3AAK A;  3L4L A;  4QJ5 B;  4N5X A;  3DVE A;  3NXA A;  4ZCV A;  1CDN A;  3PLF B;  2JNX A;  4XJK B;  1GGZ A;  2OS8 B;  1IRJ A;  1NCZ A;  3HCM A;  1B8L A;  1KSO A;  1SKT A;  4GNK B;  5ER4 X;  3O4Y A;  4ICB A;  1K2H A;  1J1D A;  1AJ4 A;  1KK8 B;  1NCY A;  3I5H B;  2KFH A;  4INW A;  1A03 A;  1D1O A;  2EC6 C;  1NX0 A;  4YGC B;  4C0J A;  1BR1 B;  2BE6 A;  1QXP A;  3KHE A;  1J7P A;  2KYF A;  1QX5 B;  1L7Z A;  3DY9 A;  2ZN9 A;  1REC A;  1KFX S;  2GGM A;  3B87 A;  1ALV A;  4MZJ A;  1IKU A;  3ZNI A;  1DEL A;  2HQ8 A;  4MBE A;  3TDI A;  1UHH A;  4OR9 B;  2LCP A;  1S5G Z;  1B7T Y;  3VRN A;  2BL0 C;  4AQI A;  3O6B A;  2H8V A;  4YGD B;  1JF0 A;  1CM4 A;  1Y1A A;  1PRW A;  3UNW A;  2WCF A;  4HRH A;  1WY9 A;  2IS9 A;  1OW4 A;  2CXJ A;  1PSR A;  1QX7 A;  1JUO A;  5HL1 A;  2K61 A;  2COL B;  1XFY O;  4MN0 A;  1QX2 A;  1QV1 A;  1OOI X;  2BAP A;  4PE0 A;  3SG3 A;  4A4C A;  2ERB A;  3DVK A;  1Y6W A;  3EK8 A;  2JZI A;  1SCM B;  1CKK A;  2OS8 C;  4GGF A;  1IWQ A;  2LP3 A;  4NDB A;  1SCM C;  3SG7 A;  3RLZ A;  1S1E A;  3KF9 A;  4NDC A;  2L5X B;  3DVM A;  1TUZ A;  1OMD A;  1NYA A;  1SBJ A;  2KFF A;  5AXI A;  3TDZ A;  4F0Z B;  4HRG A;  4PHN A;  3R1O A;  2O5G A;  3PM8 A;  4QJ3 B;  1F55 A;  1CDM A;  3EKJ A;  1MXE A;  4DS7 A;  3OHM B;  1CMF A;  1KK7 Y;  3LCP C;  1V1G A;  2JT3 A;  3DXL A;  1DT7 B;  1YUT A;  2K0J A;  3C1V A;  1UP5 A;  1M39 A;  1J7Q A;  1JF2 A;  3NSO A;  2WOS A;  2YGU A;  1DMO A;  1F70 A;  4PHJ A;  1YX7 A;  3TUY C;  4JD9 A;  3BUN B;  3MSE B;  2KI6 D;  3B6X A;  3I5I C;  5DKQ A;  1OSA A;  1Y0V H;  5PAL A;  2KLE A;  5FI7 A;  2GV5 A;  4OCI A;  1DC1 A;  5CSJ A;  3PJI A;  3VRP A;  2D8N A;  2WC6 A;  2JUL A;  1LA3 A;  1IH0 A;  1A2X A;  2M0R A;  2M3W A;  3I5H C;  3I5G B;  3LLE A;  1MHO A;  2LM5 A;  2G2B A;  2SCP A;  1A29 A;  2I2R E; 
#chains in the Genus database with same CATH homology
 1QAT A;  4PHM A;  2LP2 A;  3FIA A;  2M49 B;  4DCK A;  1GJY A;  1UHN A;  3BUM B;  5HKY A;  1YUS A;  2WCB A;  2KGR A;  3CR2 A;  1DF0 B;  4FTG A;  1B8C A;  3K21 A;  2Y1M A;  3DF0 A;  4Q04 A;  3WHT B;  2KI4 B;  1L2O C;  2VRG A;  5AER A;  1KK8 C;  1EG3 A;  1K9P A;  1U5I A;  2FCE A;  2E6W A;  1BMO A;  1YVL A;  1M63 B;  1MXL C;  2KBI A;  2LLT A;  1F70 A;  3LK0 A;  1IJ6 A;  2HPS A;  3OB1 B;  3SG5 A;  3KEV A;  3RM1 A;  2LLU A;  2R2I A;  4GAO A;  1BF5 A;  1M46 A;  1RRO A;  4ORA B;  1CFC A;  2KBM A;  3SG6 A;  1CB1 A;  2I94 A;  1H4B A;  4YGA A;  2LAP A;  2KNE A;  2NZ0 A;  1LIN A;  2Q4U A;  2KI4 C;  1KWO C;  1RK9 A;  3BUW B;  1IQ5 A;  1AJ5 A;  1R2U A;  1K90 D;  3BXK A;  1QS7 A;  2KHN A;  5CSF A;  1TTX A;  5JOL A;  2B1U A;  1NSH A;  1ZAC A;  1DJG A;  3D0Y B;  3IQO A;  4JPZ B;  1LXF C;  2F33 A;  2H61 A;  1KFX L;  1FF1 A;  1AHR A;  1G33 A;  2MLE C;  4BY5 A;  4ETO A;  2LC5 A;  4M2Q A;  3TZ1 A;  3KPX A;  1E8A A;  1CDL A;  1S6I A;  2MJW B;  4PCW A;  1OQP A;  3I5G C;  4BY4 A;  1YRU B;  4C0K A;  1SR6 B;  3SG2 A;  1YR5 A;  2LVV A;  5I2L A;  1TRF A;  3GK1 A;  5AAN A;  2BKI B;  5I8N A;  1WDC C;  2M9G A;  2QAC A;  5CPV A;  2LHL A;  5I2Q A;  2ISD A;  2CCM A;  2FOT A;  1U5I B;  4WQ2 A;  1N65 A;  1XK4 C;  1Q80 A;  1MR8 A;  2BCX A;  2L4H A;  5J3X A;  5HLV A;  1DJY A;  1PK0 D;  3O2P A;  5DKN A;  3D0Y A;  4DIR A;  3H4S E;  1W7I B;  1YVH A;  1W7J B;  2KGB C;  2SAS A;  4N1G A;  2Y1N A;  2M1K B;  3DVJ A;  3PN7 C;  1ZOT B;  4GFT A;  1AP4 A;  1Y1X A;  5KU1 A;  1XFW O;  1MWN A;  1UHK A;  2F8P A;  1UUS A;  1YUU A;  5HKZ A;  1CNP A;  5AEQ A;  1EG4 A;  1KQM C;  1RWY A;  2M7N A;  3M0W A;  1DJH A;  1QIV A;  2PAL A;  1KFU S;  2L50 A;  1PVA A;  3D10 A;  1CFP A;  1XFU O;  2Y5I A;  4MRX A;  1KSM A;  1UUR A;  1B9A A;  4GPL B;  2KAY A;  1B7T Z;  3GK4 X;  2WND A;  3NSK A;  3OX5 A;  4JWQ A;  1NP8 A;  3BUX B;  1J55 A;  1KK7 Z;  2LVI A;  3TUY B;  1G8I A;  3CZT X;  1DGU A;  3OB2 B;  4MSP A;  4FQO A;  1JWD A;  2I7A A;  5ER5 A;  1JFK A;  1DGV A;  1EJ3 A;  2CTN A;  2JT0 A;  3JTD C;  1BOC A;  4WRI A;  2CNP A;  4M2O A;  1EL4 A;  2LE9 B;  1K9K A;  3DD4 A;  3EK4 A;  1K95 A;  1KQM B;  2H61 C;  4PE7 A;  2TN4 A;  4MZL A;  1XA5 A;  3VRO A;  1B4C A;  1OOJ A;  2L4I A;  2O60 A;  1V1F A;  2K2F A;  1PSB A;  4R1E A;  1TNQ A;  2KQ6 A;  3EKH A;  1JSA A;  1IG5 A;  1WRL A;  2HQW A;  3OX6 A;  1TNP A;  1HQV A;  1TCO B;  2CBL A;  1N0Y A;  1NWD A;  1SRA A;  2EC6 B;  2KI6 C;  1J7O A;  2LAN A;  4N1F A;  3GK2 A;  2RGI A;  1A4P A;  1KCY A;  4DUQ A;  1B8R A;  1K93 D;  1XO5 A;  3LL8 B;  1H8B A;  3BOW B;  2L0P A;  1M45 A;  1NUB A;  2KAV A;  3SG4 A;  1BU3 A;  1RJV A;  1ALW A;  3I5F C;  1TNX A;  3E3R A;  1BT6 A;  2K8M B;  2BL0 B;  3FWC A;  1ODB A;  2EHB A;  1MQ1 A;  1SK6 D;  2MA2 A;  4GBA A;  2F2P A;  1WDC B;  1F8H A;  2FCD A;  1SL7 A;  4YGB B;  2JTT A;  1Y1U A;  1QLS A;  2K7C A;  1AUI B;  2I18 A;  1CM1 A;  3CTN A;  1BG1 A;  4MZK A;  1YUR A;  5GQQ C;  1N2D A;  3TS5 C;  4U8D A;  2JRF A;  1MF8 B;  4QJ4 B;  1OMV A;  1CFD A;  1DJW A;  3FWB A;  1FW4 A;  3EVV A;  3ICB A;  5B8I B;  2ZKM X;  1SCV A;  1UHJ A;  1WRZ A;  1FI6 A;  2EGD A;  1VRK A;  4I5N B;  2M29 A;  1OZO A;  1SW8 A;  2E30 A;  2BBN A;  1GGW A;  2PVB A;  3BQ3 A;  2M8U A;  3SIA A;  2NLN A;  3LK1 A;  1WLM A;  2BKH B;  2K2A A;  5CSN A;  4CID A;  1XYD A;  1CLM A;  1SNL A;  1OE9 B;  1TIZ A;  4D1E A;  2LLS A;  4PAL A;  1QIW A;  4GUK A;  2JQ6 A;  4MRY A;  1SY9 A;  2FJU B;  5F6T A;  1IJ5 A;  4ZCU A;  1K8U A;  1TCF A;  3EVU A;  4CPV A;  2MRD A;  5TNC A;  4MVF A;  4OV2 A;  3GOF A;  1C7V A;  2LMU A;  1CLB A;  1YX8 A;  3EK7 A;  4DRW A;  2M97 A;  1BJF A;  1NIW A;  3WNX B;  1LKJ A;  2BCB A;  3OP0 A;  4XJK A;  3O78 A;  3FS7 A;  2KSP A;  2WC8 A;  3IF7 A;  3AKA A;  1S26 D;  2QPT A;  1KFU L;  2JTZ A;  5D69 A;  1NCX A;  2K7D A;  2L2E A;  3BUO B;  2OTG C;  5HYD A;  2AAO A;  4P5O E;  4C0L A;  1LA0 A;  2JC2 A;  4YGE B;  3VRQ A;  2PRU A;  4NQG A;  4GGN A;  1KWO B;  2MAZ A;  4TNC A;  1IGV A;  2K7B A;  5K89 A;  1QTX A;  1EXR A;  3JVT C;  1DVI A;  1QAS A;  4PDZ A;  1K94 A;  1TOP A;  3QRX A;  2LNK A;  4M2P A;  3HX4 A;  1C07 A;  3I5I B;  2PAS A;  4GGF C;  1F71 A;  1QV0 A;  4MEW A;  2OPO A;  2KFG A;  2KYC A;  4CFQ A;  1R6P A;  1HT9 A;  1L2O B;  2BCA A;  2K7O A;  5KTY A;  1RTP 1;  1CDP A;  1XFV O;  4JQ0 D;  2LUX A;  1G4Y R;  4OKH A;  1LVC D;  1PUL A;  3VRR A;  3IQQ A;  2HET A;  2WCE A;  2Q91 A;  3BYA A;  5CSI A;  1S6C A;  1S6J A;  1F4O A;  1SMG A;  4NDD A;  1DJX A;  1PAL A;  1B1G A;  4PE4 A;  4PHK A;  1ZMZ A;  1MUX A;  4ORB B;  3SJS A;  1UWO A;  1JBA A;  4YRU A;  1J7R A;  2KOT A;  4I5K A;  2Y4Q A;  1CTR A;  2JXC A;  3SIB A;  3CGA A;  1SL8 A;  2AUC A;  3A4U B;  3CS1 A;  3KO0 A;  2A4J A;  4PE1 A;  1UHI A;  1IQ3 A;  1K9U A;  1YRT B;  1TN4 A;  3CWG A;  2JXL A;  1GQM A;  2LMT A;  4WQ3 A;  4P2Y B;  1CLL A;  1XFZ O;  2JT8 A;  2V53 A;  3JVT B;  2F3Y A;  4YBH B;  1FPW A;  1BR4 B;  3PAT A;  1PVB A;  3WHU B;  2BBM A;  1K96 A;  4YI9 A;  1SYM A;  3CLN A;  4IL1 A;  1OMR A;  2ZRS A;  3DF0 B;  2LUC A;  3I5F B;  4MLW A;  4ORC B;  2MLF C;  1AVS A;  4AQJ A;  3CR4 X;  5AFP A;  2WOR A;  1M31 A;  1DTL A;  1S36 A;  5I2O A;  1F4Q A;  3BOW A;  4I5J A;  2P6B B;  3JTD B;  1XVJ A;  5D7F A;  1DF0 A;  2ZNE A;  1BOD A;  1S3P A;  3ZWH A;  2ZRT A;  1NX1 A;  3AAJ A;  1WRK A;  4USL A;  2NCP A;  4A4B A;  2NXQ A;  1NX2 A;  3TS5 B;  2JOJ A;  2LMV A;  5HKW A;  1A75 A;  2ZN8 A;  3EVR A;  5KSZ A;  1EH2 A;  2LV7 A;  1FI5 A;  1AK8 A;  1XFX O;  1X02 A;  1SR6 C;  1F54 A;  1C7W A;  4L9M A;  1B47 A;  1FBV A;  2PMY A;  1RFJ A;  3CR5 X;  4OVN F;  1OZS A;  5JJG A;  2JNF A;  2NCO A;  2AMI A;  1J1E A;  3PFV A;  4AOM A;  1JC2 A;  2H2K A;  2MHH A;  2MBX A;  1QVI Y;  5BPJ A;  4CLN A;  1ZUZ A;  3PN7 B;  2JWW A;  4XYN A;  1QLK A;  2F3Z A;  5FYX A;  1NPQ A;  4YI8 A;  4E68 A;  1DJZ A;  2GGZ A;  5DKR A;  3VGO A;  2KAX A;  5HLO A;  2M1U A;  1QVI Z;  1KQV A;  2BE4 A;  2M7L A;  1S5G Y;  3A8R A;  5G08 A;  1TNW A;  5IBW A;  1BLQ A;  3F45 A;  2BEC A;  2G9B A;  1WLZ A;  1A75 B;  1SPY A;  2L51 A;  2ZFD A;  4UPG A;  3PAL A;  4CFR A;  3AKB A;  2JPT A;  1XK4 A;  1SL9 A;  1CFF A;  3WXA A;  2PSR A;  1QJT A;  2ZND A;  1ZFS A;  2OTG B;  2JU0 A;  2KDH A;  2LVJ A;  4I5L B;  2KQY A;  3TDU A;  2CT9 A;  2HF5 A;  2L98 A;  2LHI A;  2LVK A;  1NX3 A;  3PSR A;  1YTZ C;  3NSL A;  4HSZ A;  3NSI A;  2DOQ A;  1DJI A;  4HRE E;  1JFJ A;  1CMG A;  2F2O A;  3AAK A;  4QJ5 B;  4N5X A;  3DVE A;  3NXA A;  4ZCV A;  1CDN A;  3PLF B;  2JNX A;  4XJK B;  1GGZ A;  2OS8 B;  1IRJ A;  1NCZ A;  3HCM A;  1B8L A;  1KSO A;  1SKT A;  4GNK B;  5ER4 X;  3O4Y A;  4ICB A;  1K2H A;  1J1D A;  1AJ4 A;  1KK8 B;  1NCY A;  3I5H B;  2KFH A;  1A03 A;  1D1O A;  2EC6 C;  1NX0 A;  4YGC B;  4C0J A;  1BR1 B;  2BE6 A;  1QXP A;  3KHE A;  1J7P A;  2KYF A;  1QX5 B;  1L7Z A;  2ZN9 A;  1REC A;  1KFX S;  2GGM A;  1ALV A;  4MZJ A;  1IKU A;  3ZNI A;  2HQ8 A;  4MBE A;  3TDI A;  1UHH A;  4OR9 B;  2LCP A;  1S5G Z;  1B7T Y;  3VRN A;  2BL0 C;  4AQI A;  3O6B A;  4YGD B;  1JF0 A;  1CM4 A;  1Y1A A;  1PRW A;  2WCF A;  4HRH A;  1WY9 A;  2IS9 A;  2CXJ A;  1PSR A;  1QX7 A;  1JUO A;  2K61 A;  2COL B;  1XFY O;  4MN0 A;  1QX2 A;  1QV1 A;  4PE0 A;  3SG3 A;  4A4C A;  3EK8 A;  3DVK A;  1Y6W A;  2JZI A;  1SCM B;  1CKK A;  2OS8 C;  4GGF A;  1IWQ A;  2LP3 A;  4NDB A;  1SCM C;  3SG7 A;  3RLZ A;  1S1E A;  3KF9 A;  4NDC A;  2L5X B;  3DVM A;  1OMD A;  1NYA A;  1SBJ A;  2KFF A;  5AXI A;  3TDZ A;  4F0Z B;  4HRG A;  4PHN A;  4QJ3 B;  2O5G A;  3PM8 A;  1F55 A;  1CDM A;  3EKJ A;  1MXE A;  4DS7 A;  3OHM B;  1CMF A;  1KK7 Y;  3LCP C;  1V1G A;  2JT3 A;  1DT7 B;  1YUT A;  2K0J A;  3C1V A;  1UP5 A;  1M39 A;  1J7Q A;  1JF2 A;  3NSO A;  2WOS A;  1DMO A;  4PHJ A;  1YX7 A;  3TUY C;  3BUN B;  3MSE B;  2KI6 D;  3I5I C;  5DKQ A;  1OSA A;  1Y0V H;  5PAL A;  2GV5 A;  4OCI A;  5CSJ A;  3VRP A;  2D8N A;  2JUL A;  1LA3 A;  1IH0 A;  1A2X A;  2M0R A;  2M3W A;  3I5H C;  3I5G B;  3LLE A;  1MHO A;  2LM5 A;  2G2B A;  2SCP A;  1A29 A;  2I2R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...