3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
1NSHA 1K9UA 2KQYA 2K61A 1LA0A 2GGMA 5DKQA 1GGWA 1EXRA 1QASA 2LMTA 1DGUA 3JTDB 1WY9A 4OVNF 5TNCA 1NIWA 1SR6C 1J55A 1DGVA 5AXIA 3FS7A 1DJYA 4PALA 1QX7A 1CLLA 5CSJA 5DKNA 2Y4QA 3AKBA 2WNDA 4ETOA 4XYNA 3ZNIA 3TS5C 1CFFA 4I5JA 2ZRSA 2K7OA 1L2OB 4AQJA 1OZSA 3MSEB 1ZOTB 1JSAA 2KQ6A 3NSIA 1F71A 1NX2A 2F2PA 3SG2A 4ZCUA 3EKHA 5JOLA 4QJ3B 1SYMA 4MZLA 4MBEA 1XA5A 4R1EA 3SIBA 1RTP1 2F33A 1PVBA 1M46A 1AK8A 4A4CA 4C0KA 1C7WA 3HX4A 1IG5A 1XK4A 1J1EA 5DKRA 4GNKB 1BLQA 4USLA 1EG4A 1KWOB 5D69A 3LK1A 2BE4A 2LV7A 1SY9A 1U5IA 3AAJA 3IF7A 4OR9B 3SG4A 1IWQA 1DJIA 1PSRA 1QVIY 4DRWA 4L9MA 2LVKA 1TCFA 3CS1A 2BCAA 3TDZA 1PVAA 1B7TZ 2K2FA 1Y1UA 3SJSA 4AQIA 1CB1A 1KK7Y 1K96A 4A4BA 4C0LA 2K0JA 1CLBA 3DVEA 2BECA 1DTLA 1QLKA 1U5IB 1OMDA 2OPOA 1DJXA 2LVVA 1XFYO 4M2PA 1KSMA 1S5GY 1B1GA 2LAPA 1WRZA 1HT9A 2OS8C 2LMVA 3A4UB 4PHKA 1SKTA 1AP4A 1SR6B 1NX1A 3NSOA 2L5XB 2NCPA 3A8RA 3TDIA 3LLEA 2M8UA 1UHJA 3DD4A 1DT7B 2JNFA 1SRAA 3SG7A 2L98A 3EVUA 4OKHA 2KHNA 1UURA 1JC2A 3BXKA 4C0JA 1ALVA 2M0RA 3VRQA 4MLWA 2KGRA 1CKKA 1BR1B 2WOSA 1LA3A 1RWYA 2I94A 1BG1A 1CMGA 4GGFC 2NCOA 1XVJA 1K93D 1Y1AA 2JT8A 4E68A 2LHLA 2LLUA 1GQMA 1JF0A 3I5GC 1K94A 3I5FB 5GQQC 3TDUA 1KQVA 2Q4UA 3PM8A 2I2RE 2JRFA 4MSPA 5HLOA 4P2YB 5AANA 1XFZO 2AUCA 3OHMB 1DJHA 2JPTA 1WDCC 3LCPC 1KK8C 1NCYA 1SMGA 1NWDA 3SG3A 4QJ5B 4F0ZB 3DF0A 2RGIA 1TNPA 2LNKA 3E3RA 2JU0A 3DVKA 1QX5B 1LINA 1G4YR 3VRPA 1K9PA 2LVIA 1AVSA 4JPZB 1UWOA 1K90D 5I2QA 3CR2A 1SK6D 1D1OA 1B8LA 2D8NA 2ZKMX 4PE7A 1X02A 1CDMA 1IKUA 3FWCA 1CTRA 4GPLB 1KCYA 3CR5X 2LLTA 1IQ5A 2PSRA 1CNPA 1N2DA 1YURA 4ORAB 1JF2A 1W7JB 2SCPA 2VRGA 3VRRA 1F4OA 2LVJA 1CDNA 1MR8A 1M31A 1C7VA 1YX7A 2NZ0A 2F3YA 1AHRA 4GGFA 3D0YB 4I5LB 1QIVA 1V1GA 1CM1A 3H4SE 4WQ3A 3SG5A 2NXQA 2WORA 4YBHB 2L51A 2Y1MA 4BY5A 1IRJA 1JFKA 4N1GA 2CBLA 2P6BB 1MHOA 4BY4A 3O78A 4ICBA 1XFVO 1IJ6A 3RLZA 3SG6A 1JUOA 1W7IB 4YI8A 5HKYA 2SASA 1MUXA 2BE6A 1NP8A 2K7DA 2JT3A 3I5IC 4CIDA 3EK4A 1SL9A 1NCZA 1RK9A 1ALWA 3OP0A 2E30A 2LUXA 3CWGA 2BCXA 4N5XA 1QTXA 2Q91A 4GFTA 5HLVA 3F45A 2ZN8A 4M2OA 4DIRA 1Y0VH 1OMRA 2KBIA 1QVIZ 2PVBA 4YRUA 3CZTX 1C07A 1QX2A 1TN4A 2GV5A 3DVMA 1DF0A 4JQ0D 5G08A 2WCFA 4QJ4B 1EG3A 5IBWA 1LXFC 2JNXA 3AAKA 1F4QA 5AFPA 4XJKA 4CLNA 1ZACA 4HRGA 3C1VA 2KI4B 2M29A 3PN7C 1S3PA 4MZKA 1MXEA 2OTGC 1YVHA 4IL1A 1DF0B 1LKJA 4GGNA 5KSZA 2QACA 2MHHA 1RECA 4ORBB 4XJKB 4MEWA 3TUYC 1JWDA 1OZOA 1TNWA 2E6WA 1SCVA 3VGOA 4NQGA 1M45A 5CSNA 1IH0A 1SL7A 4D1EA 1BOCA 2BBMA 1LVCD 2ZFDA 1R6PA 1K2HA 3I5HC 2FCDA 3RM1A 3QRXA 2K7BA 4I5KA 1A75A 3CLNA 3BUMB 4JWQA 2MBXA 2M3WA 1DJWA 1OE9B 3BUXB 3BYAA 2LLSA 5ER4X 3TS5B 1RFJA 5KU1A 3PSRA 2KFGA 1TIZA 1FBVA 5CSFA 2KI6C 1A29A 1A75B 1AUIB 2LANA 2LM5A 1YX8A 1JBAA 1CDLA 1WLMA 3NSLA 2LE9B 1PK0D 2HETA 1CDPA 2L4HA 2JQ6A 3EK7A 2JULA 1IGVA 2EC6C 1YUTA 4TNCA 1YUSA 3JTDC 4MVFA 2BL0C 3EK8A 4MRXA 2BBNA 4Q04A 3JVTC 1A03A 1NUBA 1SPYA 1CFPA 1F70A 2LP2A 2L2EA 2KI6D 2JC2A 2PMYA 2IS9A 2BKIB 1UHNA 4YGBB 1XO5A 2COLB 3BOWA 1XFUO 2HQ8A 2BCBA 1BT6A 2ZNDA 3CGAA 3WXAA 1L2OC 1B8CA 1UHKA 3KF9A 3KPXA 3K21A 2LHIA 3GK2A 5HKWA 3EVVA 3DF0B 2PASA 2OTGB 1BU3A 2K2AA 4ORCB 1BF5A 4N1FA 2MLFC 1OMVA 1M39A 1TCOB 1WRKA 1QIWA 1UP5A 2KAXA 2WC8A 3BOWB 1J7RA 2OS8B 2JT0A 2M1KB 3HCMA 1E8AA 3OX5A 1R2UA 4DS7A 5K89A 1N0YA 5BPJA 1B47A 4CFRA 1NX3A 3O4YA 5J3XA 2CTNA 3I5HB 1XFXO 1KWOC 1S1EA 2HQWA 1AJ5A 3IQOA 1AJ4A 1B9AA 4PHNA 1PRWA 1K8UA 3GOFA 1S6CA 5CSIA 2AAOA 3ICBA 3FWBA 2ZNEA 4OCIA 2LUCA 1NX0A 1F8HA 3OX6A 4ZCVA 5AERA 2PRUA 1J7QA 1FF1A 2MJWB 1NYAA 1CLMA 1QV0A 4PE1A 1JFJA 4PE4A 4P5OE 2ISDA 1FI5A 3D10A 2KGBC 3LK0A 1VRKA 2WCEA 3CTNA 2H61C 3I5GB 3SIAA 1YVLA 1QXPA 1QLSA 1SL8A 2EC6B 4GBAA 2M97A 1IJ5A 2KFHA 3EKJA 1WDCB 2BL0B 4NDBA 5PALA 1KK8B 2MRDA 1UHIA 2AMIA 2KSPA 3FIAA 2M7NA 3JVTB 4HRHA 1G33A 2PALA 2TN4A 1EJ3A 1ZUZA 2M7LA 2F8PA 2Y1NA 3OB2B 3OB1B 4DCKA 2HPSA 1MF8B 3BUOB 3LL8B 2GGZA 1TTXA 1QATA 3M0WA 3O2PA 1FPWA 2KFFA 2KBMA 4MN0A 1CM4A 1PULA 2O5GA 4U8DA 2CCMA 1KK7Z 1MQ1A 1EH2A 1V1FA 1WRLA 4YGAA 3WHTB 1GJYA 1SW8A 1QV1A 1J1DA 1J7PA 1NCXA 2ZN9A 3I5FC 1S5GZ 2EGDA 2L0PA 2K8MB 4PHJA 2HF5A 5JJGA 1HQVA 1UHHA 2FOTA 3PLFB 2MA2A 3IQQA 4M2QA 2DOQA 2BKHB 3VRNA 1UUSA 2M1UA 3O6BA 1BODA 1PSBA 3KHEA 5D7FA 2JOJA 2H61A 1XFWO 1SCMC 4UPGA 2FJUB 4MZJA 2O60A 2KYFA 4PDZA 1TOPA 5AEQA 1CFCA 1KQMC 4GAOA 3AKAA 3BUNB 1H8BA 2MAZA 1K9KA 2R2IA 2B1UA 1ZMZA 1S26D 4I5NB 1Y6WA 2L4IA 1MXLC 4MRYA 5CPVA 2KAVA 2ZRTA 3EVRA 3I5IB 1B7TY 4CFQA 5I8NA 2L50A 2CNPA 4AOMA 1QJTA 1DMOA 2LCPA 1ZFSA 1FI6A 1A2XA 2WCBA 2LC5A 3TZ1A 1CFDA 1TNXA 2NLNA 2KDHA 5I2OA 2F2OA 2I7AA 1OOJA 2FCEA 1YR5A 2I18A 1OQPA 1S6JA 1WLZA 4YGCB 3NSKA 3PFVA 3GK4X 2MLEC 2G2BA 1YUUA 2CT9A 3ZWHA 1N65A 1NPQA 5ER5A 3BQ3A 2H2KA 1S6IA 3PATA 2KOTA 4HSZA 1J7OA 1KFXL 2QPTA 4YGDB 1KFUL 1B8RA 1YTZC 1KFXS 1L7ZA 5KTYA 1EL4A 1DJZA 1KFUS 2M49B 1DJGA 1OSAA 1MWNA 4FTGA 1Y1XA 1PALA 3PN7B 4PE0A 1S36A 2V53A 1F55A 2KNEA 1SNLA 4YGEB 1M63B 5I2LA 1DVIA 2A4JA 2M9GA 5HYDA 5HKZA 3TUYB 1RROA 3GK1A 5F6TA 2EHBA 1BJFA 2JZIA 1ODBA 3PALA 4PCWA 1SCMB 2KAYA 3BUWB 5B8IB 2G9BA 2JWWA 2CXJA 1YRTB 4FQOA 1BR4B 5FYXA 3WHUB 4GUKA 3CR4X 1KQMB 3KEVA 4NDDA 1H4BA 4PHMA 1KSOA 1IQ3A 1FW4A 2K7CA 1B4CA 2JTTA 1QS7A 1XYDA 4YI9A 2LMUA 2KYCA 3VROA 2JXLA 1K95A 3D0YA 4DUQA 1F54A 4HREE 2KI4C 4CPVA 1CMFA 1XK4C 1G8IA 4WQ2A 1TRFA 4NDCA 2JTZA 2Y5IA 1TNQA 1Q80A 2LP3A 1GGZA 1SBJA 3KO0A 4OV2A 4WRIA 1A4PA 1BMOA 2F3ZA 2JXCA 1YRUB 3NXAA 3WNXB 3DVJA 1RJVA
chains in the Genus database with same CATH superfamily
1NSHA 1K9UA 2KQYA 2K61A 1LA0A 2GGMA 5DKQA 1GGWA 1EXRA 1QASA 2LMTA 1DGUA 3JTDB 1WY9A 4OVNF 5TNCA 1NIWA 1SR6C 1J55A 1Z4HA 1DGVA 5AXIA 3S0AA 3FS7A 1DJYA 4PALA 3BJHA 1QX7A 1CLLA 5CSJA 5DKNA 2Y4QA 3AKBA 2WNDA 3S0DA 4ETOA 4XYNA 3ZNIA 3NGVA 2JPOA 3TS5C 1CFFA 4I5JA 2ZRSA 2K7OA 1L2OB 4AQJA 1OZSA 2WCKA 3MSEB 1ZOTB 1JSAA 2KQ6A 2QEOA 3NSIA 1F71A 1NX2A 2F2PA 3SG2A 4ZCUA 3SS4A 3EKHA 5JOLA 4QJ3B 1SYMA 3QMEA 4MZLA 1OOHA 1XA5A 4MBEA 4R1EA 3SIBA 1RTP1 2F33A 1PVBA 1M46A 1AK8A 4A4CA 4C0KA 1C7WA 3HX4A 1IG5A 1XK4A 1J1EA 5DKRA 4GNKB 3V2LA 1BLQA 4USLA 1EG4A 1KWOB 5D69A 3LK1A 2BE4A 2LV7A 3DZTA 1SY9A 1U5IA 3AAJA 3IF7A 4OR9B 3SG4A 1IWQA 1C3ZA 1DJIA 1PSRA 1QVIY 3FE6A 4DRWA 4L9MA 2LVKA 1ORGA 1TCFA 3CS1A 2BCAA 3TDZA 1PVAA 1B7TZ 2K2FA 1Y1UA 3SJSA 4AQIA 1CB1A 1KK7Y 1K96A 4A4BA 4C0LA 2K0JA 1CLBA 3DVEA 1DEKA 2BECA 1DTLA 1QLKA 1U5IB 1OMDA 2OPOA 1DJXA 2LVVA 1XFYO 4M2PA 1KSMA 1S5GY 1B1GA 2LAPA 1WRZA 3IVTA 5FI6A 1HT9A 2OS8C 2LMVA 3A4UB 4INWA 1SKTA 4PHKA 1SR6B 1NX1A 3SS3A 1AP4A 3NSOA 2L5XB 2NCPA 3A8RA 3TDIA 3LLEA 2M8UA 1UHJA 3DD4A 1DT7B 2JNFA 1SRAA 3SG7A 1DELA 2L98A 3EVUA 4OKHA 2KHNA 1UURA 1W9ZA 2QEBA 1QWVA 2BNXA 3BXKA 1ALVA 2M0RA 3UO9A 3VRQA 4MLWA 4C0JA 2KGRA 3OBVA 1CKKA 1BR1B 2WOSA 1LA3A 1RWYA 2I94A 1BG1A 1CMGA 3S0BA 4GGFC 2NCOA 1XVJA 1K93D 1Y1AA 2JT8A 2KLDA 3D78A 4E68A 2LHLA 2LLUA 1TWOA 1GQMA 3S0FA 1JF0A 3I5GC 1K94A 3I5FB 4JKTA 5GQQC 3TDUA 2Q4UA 2QEHA 2WCJA 1KQVA 2WCLA 2I2RE 3PM8A 2JRFA 4MSPA 5HLOA 4P2YB 3R1VA 5AANA 1XFZO 2AUCA 3OHMB 1DJHA 2JPTA 1WDCC 3LCPC 1KK8C 1NCYA 1SMGA 1NWDA 1SSEB 3SG3A 4QJ5B 4F0ZB 3DYEA 2KPHA 3DF0A 2RGIA 1TNPA 2LNKA 3E3RA 3K1EA 2JU0A 3BFBA 1TUZA 1QX5B 1LINA 3B6XA 3DVKA 1G4YR 3VRPA 1K9PA 2LVIA 1AVSA 4JPZB 1UWOA 1K90D 2WC5A 5I2QA 1TUJA 3CR2A 1SK6D 1D1OA 1B8LA 2D8NA 2P71A 2ZKMX 1X02A 1CDMA 4PE7A 3CZ0A 1IKUA 3FWCA 1CTRA 4GPLB 1KCYA 3CR5X 2LLTA 1IQ5A 2PSRA 3S0GA 3PJIA 1N2DA 1YURA 1CNPA 4ORAB 3B86A 1JF2A 1W7JB 2SCPA 2VRGA 3VRRA 1F4OA 2LVJA 1CDNA 1MR8A 1M31A 1C7VA 1YX7A 2NZ0A 2F3YA 1AHRA 4GGFA 3D0YB 4I5LB 1QIVA 1V1GA 1CM1A 3H4SE 4WQ3A 3SG5A 2GTEA 2NXQA 2WORA 4YBHB 2L51A 2PYQA 2Y1MA 4BY5A 1IRJA 1JFKA 4N1GA 2CBLA 2P6BB 1MHOA 3FE8A 4BY4A 3O78A 4ICBA 1XFVO 1IJ6A 3RLZA 3SG6A 1JUOA 1W7IB 2H8VA 3B7AA 4YI8A 5HKYA 2SASA 1JC2A 4INXA 1MUXA 3Q8IA 2BE6A 1NP8A 2K7DA 2JT3A 3I5IC 4CIDA 3EK4A 1SL9A 1NCZA 1RK9A 1ALWA 3OP0A 2E30A 2LUXA 3CWGA 2BCXA 4N5XA 1QTXA 2Q91A 4GFTA 5HLVA 2L2CA 3PM2A 3F45A 2ZN8A 4M2OA 4DIRA 1Y0VH 1OMRA 2KBIA 1QVIZ 3L4AA 2PVBA 4YRUA 3CZTX 1C07A 1QX2A 1TN4A 2GV5A 3DVMA 1DF0A 2FJYA 4JQ0D 5G08A 2WCFA 4QJ4B 1EG3A 5IBWA 1LXFC 2JNXA 3UNWA 3AAKA 1F4QA 3EG5B 4XJKA 5AFPA 4CLNA 1ZACA 4HRGA 2ERBA 2KI4B 2M29A 3C1VA 3CABA 3PN7C 1S3PA 4MZKA 1MXEA 2OTGC 1YVHA 4IL1A 1DF0B 1LKJA 4GGNA 5KSZA 2QACA 2MHHA 1DQEA 1RECA 4ORBB 4XJKB 4MEWA 3TUYC 1JWDA 1OZOA 1TNWA 2E6WA 1SCVA 3VGOA 2PQLA 4NQGA 1M45A 5CSNA 1IH0A 1SL7A 4D1EA 1BOCA 2BBMA 1LVCD 2ZFDA 1R6PA 1K2HA 3I5HC 2FCDA 3RM1A 3QRXA 2K7BA 4I5KA 1A75A 3CLNA 3BUMB 4JWQA 5FI2A 2MBXA 2M3WA 1DJWA 1OE9B 3BUXB 3BYAA 2LLSA 1P28A 5FI7A 5ER4X 3TS5B 1RFJA 3DY9A 5KU1A 3PSRA 2KFGA 1TIZA 1FBVA 5CSFA 2KI6C 1A29A 1A75B 1AUIB 2LANA 2LM5A 1YX8A 1JBAA 1CDLA 1WLMA 3NSLA 2LE9B 1PK0D 2HETA 1CDPA 3R1OA 2L4HA 2JQ6A 3EK7A 2KLEA 3L47A 2JULA 1IGVA 2EC6C 1YUTA 4TNCA 1YUSA 3JTDC 1XFRA 4MVFA 4PT1A 2BL0C 3EK8A 3R1PA 2BBNA 4MRXA 4Q04A 3JVTC 1A03A 1NUBA 1SPYA 1CFPA 1F70A 2LP2A 2L2EA 2KI6D 2JC2A 2PMYA 2IS9A 2BKIB 1UHNA 4YGBB 1XO5A 2COLB 3BOWA 1XFUO 2HQ8A 2BCBA 1BT6A 2WCMA 2ZNDA 3CGAA 3WXAA 1L2OC 1B8CA 1UHKA 3KF9A 3KPXA 4IJ7A 3K21A 2LHIA 3GK2A 5HKWA 3EVVA 3DF0B 2PASA 3FE9A 2OTGB 1BU3A 2K2AA 4ORCB 1BF5A 4FQTA 4N1FA 2MLFC 1OMVA 1M39A 1TCOB 1WRKA 1QIWA 1Z2CB 1UP5A 2KAXA 2WC8A 3BOWB 1J7RA 2OS8B 2JT0A 2M1KB 3HCMA 1E8AA 3CYZA 1R2UA 3OX5A 4DS7A 5K89A 1N0YA 5BPJA 1B47A 4CFRA 1NX3A 2QEVA 3O4YA 5J3XA 2CTNA 3I5HB 1XFXO 1KWOC 1S1EA 2HQWA 1AJ5A 3IQOA 1AJ4A 1B9AA 4PHNA 1PRWA 1K8UA 3GOFA 1S6CA 5CSIA 2AAOA 3ICBA 3D75A 2ZNEA 3FWBA 2LUCA 4OCIA 1NX0A 1F8HA 3OX6A 4ZCVA 5AERA 2PRUA 1J7QA 1FF1A 2MJWB 1NYAA 1CLMA 1QV0A 4PE1A 5D3OA 1JFJA 4PE4A 4P5OE 2ISDA 1FI5A 3D10A 2KGBC 3LK0A 1VRKA 4KYNA 2WCEA 3CTNA 2H61C 3I5GB 3SIAA 1YVLA 1QXPA 1QLSA 1SL8A 2EC6B 3VB1A 4GBAA 2M97A 1IJ5A 2KFHA 3EKJA 1WDCB 2BL0B 4NDBA 5PALA 5I94A 1KK8B 2MRDA 1UHIA 2AMIA 2KSPA 3FIAA 2M7NA 3JVTB 4HRHA 1G33A 2PALA 2TN4A 1EJ3A 1ZUZA 2BAPA 2F8PA 2Y1NA 3OB2B 3OB1B 3O4XA 2M7LA 2HPSA 1MF8B 3BUOB 3NHIA 3LL8B 2GGZA 1TTXA 1QATA 3M0WA 3O2PA 1FPWA 5DICA 2KFFA 2KBMA 3L4LA 4MN0A 1CM4A 3B88A 1PULA 2O5GA 3SS5A 4U8DA 1MQ1A 1KK7Z 1OOFA 2CCMA 1V1FA 1WRLA 4YGAA 1EH2A 3D77A 3N7HA 3WHTB 1GJYA 1SW8A 1QV1A 1J1DA 1J7PA 1NCXA 2ZN9A 3I5FC 1S5GZ 2EGDA 2L0PA 2K8MB 4PHJA 3CZ1A 2HF5A 5JJGA 3D73A 1HQVA 1UHHA 1LS8A 2P70A 2FOTA 3NHTA 2MA2A 3PLFB 3IQQA 4M2QA 2DOQA 2BKHB 3VRNA 2WCHA 1UUSA 2M1UA 3O6BA 1BODA 3R72A 1PSBA 3KHEA 5D7FA 2JOJA 2H61A 1XFWO 1SCMC 3BFHA 4UPGA 2FJUB 3D76A 2O60A 4MZJA 2KYFA 3CZ2A 1TOPA 4PDZA 5AEQA 3S0EA 1CFCA 4JD9A 1KQMC 3D74A 4GAOA 3AKAA 3BUNB 1H8BA 2MAZA 1K9KA 2R2IA 2B1UA 1ZMZA 1S26D 4I5NB 1Y6WA 2L4IA 1MXLC 3B87A 4MRYA 5CPVA 2KAVA 2ZRTA 3EVRA 3I5IB 1B7TY 1IIOA 4CFQA 1OOIX 2L50A 2CNPA 4AOMA 1QJTA 5I8NA 2LCPA 1DMOA 1ZFSA 1FI6A 1A2XA 2WCBA 2LC5A 3TZ1A 1CFDA 1TNXA 2NLNA 2KDHA 5I2OA 2WC6A 2F2OA 2I7AA 3BFAA 1OOJA 2FCEA 3RZSA 1GM0A 1YR5A 2L5YA 2I18A 1OQPA 1S6JA 1WLZA 4YGCB 3NSKA 3PFVA 3GK4X 2MLEC 2G2BA 1YUUA 2CT9A 3ZWHA 1N65A 1NPQA 5ER5A 3BQ3A 2H2KA 1S6IA 3PATA 4DCKA 2KOTA 4HSZA 1J7OA 1KFXL 2QPTA 4YGDB 1KFUL 1B8RA 1YTZC 1KFXS 1C3YA 1L7ZA 5KTYA 1EL4A 1DJZA 1KFUS 2M49B 1DJGA 1OSAA 1MWNA 4FTGA 1Y1XA 1PALA 3PN7B 4PE0A 1S36A 2V53A 1F55A 2KNEA 1SNLA 3OGNA 4YGEB 1M63B 1OOGA 5I2LA 1DVIA 2A4JA 2M9GA 5EL2A 5HYDA 5HKZA 3TUYB 1RROA 3GK1A 5F6TA 2EHBA 1BJFA 2JZIA 1ODBA 3PALA 4PCWA 1SCMB 2KAYA 2QDIA 3BUWB 5B8IB 2G9BA 2JWWA 2CXJA 1YRTB 4FQOA 1BR4B 2K60A 1OW4A 5FYXA 3WHUB 3CDNA 4GUKA 3CR4X 1KQMB 3KEVA 4NDDA 2YGUA 1H4BA 4PHMA 1KSOA 1IQ3A 1FW4A 3DXLA 1DC1A 2K7CA 1B4CA 2JTTA 4F7FA 1QS7A 1XYDA 4YI9A 2LMUA 2KYCA 3VROA 2JXLA 1K95A 3D0YA 4DUQA 1F54A 4HREE 2KI4C 4CPVA 4OZDA 1XK4C 1G8IA 1CMFA 4WQ2A 1TRFA 4NDCA 2JTZA 2Y5IA 1TNQA 1Q80A 2LP3A 1GGZA 1SBJA 3KO0A 4OV2A 4WRIA 5HL1A 1A4PA 1BMOA 2F3ZA 2JXCA 1YRUB 3NXAA 3WNXB 3DVJA 1T14A 1RJVA
chains in the Genus database with same CATH topology
1NSHA 1K9UA 2KQYA 2K61A 1LA0A 2GGMA 5DKQA 1GGWA 1EXRA 1QASA 2LMTA 1DGUA 3JTDB 1WY9A 4OVNF 5TNCA 1NIWA 1SR6C 1J55A 1DGVA 5AXIA 3FS7A 1DJYA 4PALA 1QX7A 1CLLA 5CSJA 5DKNA 2Y4QA 3AKBA 2WNDA 4ETOA 4XYNA 3ZNIA 3TS5C 1CFFA 4I5JA 2ZRSA 2K7OA 1L2OB 4AQJA 1OZSA 3MSEB 1ZOTB 1JSAA 2KQ6A 3NSIA 1F71A 1NX2A 2F2PA 3SG2A 4ZCUA 3EKHA 5JOLA 4QJ3B 1SYMA 4MZLA 4MBEA 1XA5A 4R1EA 3SIBA 1RTP1 2F33A 1PVBA 1M46A 1AK8A 4A4CA 4C0KA 1C7WA 3HX4A 1IG5A 1XK4A 1J1EA 5DKRA 4GNKB 1BLQA 4USLA 1EG4A 1KWOB 5D69A 3LK1A 2BE4A 2LV7A 1SY9A 1U5IA 3AAJA 3IF7A 4OR9B 3SG4A 1IWQA 1DJIA 1PSRA 1QVIY 4DRWA 4L9MA 2LVKA 1TCFA 3CS1A 2BCAA 3TDZA 1PVAA 1B7TZ 2K2FA 1Y1UA 3SJSA 4AQIA 1CB1A 1KK7Y 1K96A 4A4BA 4C0LA 2K0JA 1CLBA 3DVEA 2BECA 1DTLA 1QLKA 1U5IB 1OMDA 2OPOA 1DJXA 2LVVA 1XFYO 4M2PA 1KSMA 1S5GY 1B1GA 2LAPA 1WRZA 1HT9A 2OS8C 2LMVA 3A4UB 4PHKA 1SKTA 1AP4A 1SR6B 1NX1A 3NSOA 2L5XB 2NCPA 3A8RA 3TDIA 3LLEA 2M8UA 1UHJA 3DD4A 1DT7B 2JNFA 1SRAA 3SG7A 2L98A 3EVUA 4OKHA 2KHNA 1UURA 1JC2A 3BXKA 4C0JA 1ALVA 2M0RA 3VRQA 4MLWA 2KGRA 1CKKA 1BR1B 2WOSA 1LA3A 1RWYA 2I94A 1BG1A 1CMGA 4GGFC 2NCOA 1XVJA 1K93D 1Y1AA 2JT8A 4E68A 2LHLA 2LLUA 1GQMA 1JF0A 3I5GC 1K94A 3I5FB 5GQQC 3TDUA 1KQVA 2Q4UA 3PM8A 2I2RE 2JRFA 4MSPA 5HLOA 4P2YB 5AANA 1XFZO 2AUCA 3OHMB 1DJHA 2JPTA 1WDCC 3LCPC 1KK8C 1NCYA 1SMGA 1NWDA 3SG3A 4QJ5B 4F0ZB 3DF0A 2RGIA 1TNPA 2LNKA 3E3RA 2JU0A 3DVKA 1QX5B 1LINA 1G4YR 3VRPA 1K9PA 2LVIA 1AVSA 4JPZB 1UWOA 1K90D 5I2QA 3CR2A 1SK6D 1D1OA 1B8LA 2D8NA 2ZKMX 4PE7A 1X02A 1CDMA 1IKUA 3FWCA 1CTRA 4GPLB 1KCYA 3CR5X 2LLTA 1IQ5A 2PSRA 1CNPA 1N2DA 1YURA 4ORAB 1JF2A 1W7JB 2SCPA 2VRGA 3VRRA 1F4OA 2LVJA 1CDNA 1MR8A 1M31A 1C7VA 1YX7A 2NZ0A 2F3YA 1AHRA 4GGFA 3D0YB 4I5LB 1QIVA 1V1GA 1CM1A 3H4SE 4WQ3A 3SG5A 2NXQA 2WORA 4YBHB 2L51A 2Y1MA 4BY5A 1IRJA 1JFKA 4N1GA 2CBLA 2P6BB 1MHOA 4BY4A 3O78A 4ICBA 1XFVO 1IJ6A 3RLZA 3SG6A 1JUOA 1W7IB 4YI8A 5HKYA 2SASA 1MUXA 2BE6A 1NP8A 2K7DA 2JT3A 3I5IC 4CIDA 3EK4A 1SL9A 1NCZA 1RK9A 1ALWA 3OP0A 2E30A 2LUXA 3CWGA 2BCXA 4N5XA 1QTXA 2Q91A 4GFTA 5HLVA 3F45A 2ZN8A 4M2OA 4DIRA 1Y0VH 1OMRA 2KBIA 1QVIZ 2PVBA 4YRUA 3CZTX 1C07A 1QX2A 1TN4A 2GV5A 3DVMA 1DF0A 4JQ0D 5G08A 2WCFA 4QJ4B 1EG3A 5IBWA 1LXFC 2JNXA 3AAKA 1F4QA 5AFPA 4XJKA 4CLNA 1ZACA 4HRGA 3C1VA 2KI4B 2M29A 3PN7C 1S3PA 4MZKA 1MXEA 2OTGC 1YVHA 4IL1A 1DF0B 1LKJA 4GGNA 5KSZA 2QACA 2MHHA 1RECA 4ORBB 4XJKB 4MEWA 3TUYC 1JWDA 1OZOA 1TNWA 2E6WA 1SCVA 3VGOA 4NQGA 1M45A 5CSNA 1IH0A 1SL7A 4D1EA 1BOCA 2BBMA 1LVCD 2ZFDA 1R6PA 1K2HA 3I5HC 2FCDA 3RM1A 3QRXA 2K7BA 4I5KA 1A75A 3CLNA 3BUMB 4JWQA 2MBXA 2M3WA 1DJWA 1OE9B 3BUXB 3BYAA 2LLSA 5ER4X 3TS5B 1RFJA 5KU1A 3PSRA 2KFGA 1TIZA 1FBVA 5CSFA 2KI6C 1A29A 1A75B 1AUIB 2LANA 2LM5A 1YX8A 1JBAA 1CDLA 1WLMA 3NSLA 2LE9B 1PK0D 2HETA 1CDPA 2L4HA 2JQ6A 3EK7A 2JULA 1IGVA 2EC6C 1YUTA 4TNCA 1YUSA 3JTDC 4MVFA 2BL0C 3EK8A 4MRXA 2BBNA 4Q04A 3JVTC 1A03A 1NUBA 1SPYA 1CFPA 1F70A 2LP2A 2L2EA 2KI6D 2JC2A 2PMYA 2IS9A 2BKIB 1UHNA 4YGBB 1XO5A 2COLB 3BOWA 1XFUO 2HQ8A 2BCBA 1BT6A 2ZNDA 3CGAA 3WXAA 1L2OC 1B8CA 1UHKA 3KF9A 3KPXA 3K21A 2LHIA 3GK2A 5HKWA 3EVVA 3DF0B 2PASA 2OTGB 1BU3A 2K2AA 4ORCB 1BF5A 4N1FA 2MLFC 1OMVA 1M39A 1TCOB 1WRKA 1QIWA 1UP5A 2KAXA 2WC8A 3BOWB 1J7RA 2OS8B 2JT0A 2M1KB 3HCMA 1E8AA 3OX5A 1R2UA 4DS7A 5K89A 1N0YA 5BPJA 1B47A 4CFRA 1NX3A 3O4YA 5J3XA 2CTNA 3I5HB 1XFXO 1KWOC 1S1EA 2HQWA 1AJ5A 3IQOA 1AJ4A 1B9AA 4PHNA 1PRWA 1K8UA 3GOFA 1S6CA 5CSIA 2AAOA 3ICBA 3FWBA 2ZNEA 4OCIA 2LUCA 1NX0A 1F8HA 3OX6A 4ZCVA 5AERA 2PRUA 1J7QA 1FF1A 2MJWB 1NYAA 1CLMA 1QV0A 4PE1A 1JFJA 4PE4A 4P5OE 2ISDA 1FI5A 3D10A 2KGBC 3LK0A 1VRKA 2WCEA 3CTNA 2H61C 3I5GB 3SIAA 1YVLA 1QXPA 1QLSA 1SL8A 2EC6B 4GBAA 2M97A 1IJ5A 2KFHA 3EKJA 1WDCB 2BL0B 4NDBA 5PALA 1KK8B 2MRDA 1UHIA 2AMIA 2KSPA 3FIAA 2M7NA 3JVTB 4HRHA 1G33A 2PALA 2TN4A 1EJ3A 1ZUZA 2M7LA 2F8PA 2Y1NA 3OB2B 3OB1B 4DCKA 2HPSA 1MF8B 3BUOB 3LL8B 2GGZA 1TTXA 1QATA 3M0WA 3O2PA 1FPWA 2KFFA 2KBMA 4MN0A 1CM4A 1PULA 2O5GA 4U8DA 2CCMA 1KK7Z 1MQ1A 1EH2A 1V1FA 1WRLA 4YGAA 3WHTB 1GJYA 1SW8A 1QV1A 1J1DA 1J7PA 1NCXA 2ZN9A 3I5FC 1S5GZ 2EGDA 2L0PA 2K8MB 4PHJA 2HF5A 5JJGA 1HQVA 1UHHA 2FOTA 3PLFB 2MA2A 3IQQA 4M2QA 2DOQA 2BKHB 3VRNA 1UUSA 2M1UA 3O6BA 1BODA 1PSBA 3KHEA 5D7FA 2JOJA 2H61A 1XFWO 1SCMC 4UPGA 2FJUB 4MZJA 2O60A 2KYFA 4PDZA 1TOPA 5AEQA 1CFCA 1KQMC 4GAOA 3AKAA 3BUNB 1H8BA 2MAZA 1K9KA 2R2IA 2B1UA 1ZMZA 1S26D 4I5NB 1Y6WA 2L4IA 1MXLC 4MRYA 5CPVA 2KAVA 2ZRTA 3EVRA 3I5IB 1B7TY 4CFQA 5I8NA 2L50A 2CNPA 4AOMA 1QJTA 1DMOA 2LCPA 1ZFSA 1FI6A 1A2XA 2WCBA 2LC5A 3TZ1A 1CFDA 1TNXA 2NLNA 2KDHA 5I2OA 2F2OA 2I7AA 1OOJA 2FCEA 1YR5A 2I18A 1OQPA 1S6JA 1WLZA 4YGCB 3NSKA 3PFVA 3GK4X 2MLEC 2G2BA 1YUUA 2CT9A 3ZWHA 1N65A 1NPQA 5ER5A 3BQ3A 2H2KA 1S6IA 3PATA 2KOTA 4HSZA 1J7OA 1KFXL 2QPTA 4YGDB 1KFUL 1B8RA 1YTZC 1KFXS 1L7ZA 5KTYA 1EL4A 1DJZA 1KFUS 2M49B 1DJGA 1OSAA 1MWNA 4FTGA 1Y1XA 1PALA 3PN7B 4PE0A 1S36A 2V53A 1F55A 2KNEA 1SNLA 4YGEB 1M63B 5I2LA 1DVIA 2A4JA 2M9GA 5HYDA 5HKZA 3TUYB 1RROA 3GK1A 5F6TA 2EHBA 1BJFA 2JZIA 1ODBA 3PALA 4PCWA 1SCMB 2KAYA 3BUWB 5B8IB 2G9BA 2JWWA 2CXJA 1YRTB 4FQOA 1BR4B 5FYXA 3WHUB 4GUKA 3CR4X 1KQMB 3KEVA 4NDDA 1H4BA 4PHMA 1KSOA 1IQ3A 1FW4A 2K7CA 1B4CA 2JTTA 1QS7A 1XYDA 4YI9A 2LMUA 2KYCA 3VROA 2JXLA 1K95A 3D0YA 4DUQA 1F54A 4HREE 2KI4C 4CPVA 1CMFA 1XK4C 1G8IA 4WQ2A 1TRFA 4NDCA 2JTZA 2Y5IA 1TNQA 1Q80A 2LP3A 1GGZA 1SBJA 3KO0A 4OV2A 4WRIA 1A4PA 1BMOA 2F3ZA 2JXCA 1YRUB 3NXAA 3WNXB 3DVJA 1RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSH A;  1K9U A;  2KQY A;  2K61 A;  1LA0 A;  2GGM A;  5DKQ A;  1GGW A;  1EXR A;  1QAS A;  2LMT A;  1DGU A;  3JTD B;  1WY9 A;  4OVN F;  5TNC A;  1NIW A;  1SR6 C;  1J55 A;  1DGV A;  5AXI A;  3FS7 A;  1DJY A;  4PAL A;  1QX7 A;  1CLL A;  5CSJ A;  5DKN A;  2Y4Q A;  3AKB A;  2WND A;  4ETO A;  4XYN A;  3ZNI A;  3TS5 C;  1CFF A;  4I5J A;  2ZRS A;  2K7O A;  1L2O B;  4AQJ A;  1OZS A;  3MSE B;  1ZOT B;  1JSA A;  2KQ6 A;  3NSI A;  1F71 A;  1NX2 A;  2F2P A;  3SG2 A;  4ZCU A;  3EKH A;  5JOL A;  4QJ3 B;  1SYM A;  4MZL A;  4MBE A;  1XA5 A;  4R1E A;  3SIB A;  1RTP 1;  2F33 A;  1PVB A;  1M46 A;  1AK8 A;  4A4C A;  4C0K A;  1C7W A;  3HX4 A;  1IG5 A;  1XK4 A;  1J1E A;  5DKR A;  4GNK B;  1BLQ A;  4USL A;  1EG4 A;  1KWO B;  5D69 A;  3LK1 A;  2BE4 A;  2LV7 A;  1SY9 A;  1U5I A;  3AAJ A;  3IF7 A;  4OR9 B;  3SG4 A;  1IWQ A;  1DJI A;  1PSR A;  1QVI Y;  4DRW A;  4L9M A;  2LVK A;  1TCF A;  3CS1 A;  2BCA A;  3TDZ A;  1PVA A;  1B7T Z;  2K2F A;  1Y1U A;  3SJS A;  4AQI A;  1CB1 A;  1KK7 Y;  1K96 A;  4A4B A;  4C0L A;  2K0J A;  1CLB A;  3DVE A;  2BEC A;  1DTL A;  1QLK A;  1U5I B;  1OMD A;  2OPO A;  1DJX A;  2LVV A;  1XFY O;  4M2P A;  1KSM A;  1S5G Y;  1B1G A;  2LAP A;  1WRZ A;  1HT9 A;  2OS8 C;  2LMV A;  3A4U B;  4PHK A;  1SKT A;  1AP4 A;  1SR6 B;  1NX1 A;  3NSO A;  2L5X B;  2NCP A;  3A8R A;  3TDI A;  3LLE A;  2M8U A;  1UHJ A;  3DD4 A;  1DT7 B;  2JNF A;  1SRA A;  3SG7 A;  2L98 A;  3EVU A;  4OKH A;  2KHN A;  1UUR A;  1JC2 A;  3BXK A;  4C0J A;  1ALV A;  2M0R A;  3VRQ A;  4MLW A;  2KGR A;  1CKK A;  1BR1 B;  2WOS A;  1LA3 A;  1RWY A;  2I94 A;  1BG1 A;  1CMG A;  4GGF C;  2NCO A;  1XVJ A;  1K93 D;  1Y1A A;  2JT8 A;  4E68 A;  2LHL A;  2LLU A;  1GQM A;  1JF0 A;  3I5G C;  1K94 A;  3I5F B;  5GQQ C;  3TDU A;  1KQV A;  2Q4U A;  3PM8 A;  2I2R E;  2JRF A;  4MSP A;  5HLO A;  4P2Y B;  5AAN A;  1XFZ O;  2AUC A;  3OHM B;  1DJH A;  2JPT A;  1WDC C;  3LCP C;  1KK8 C;  1NCY A;  1SMG A;  1NWD A;  3SG3 A;  4QJ5 B;  4F0Z B;  3DF0 A;  2RGI A;  1TNP A;  2LNK A;  3E3R A;  2JU0 A;  3DVK A;  1QX5 B;  1LIN A;  1G4Y R;  3VRP A;  1K9P A;  2LVI A;  1AVS A;  4JPZ B;  1UWO A;  1K90 D;  5I2Q A;  3CR2 A;  1SK6 D;  1D1O A;  1B8L A;  2D8N A;  2ZKM X;  4PE7 A;  1X02 A;  1CDM A;  1IKU A;  3FWC A;  1CTR A;  4GPL B;  1KCY A;  3CR5 X;  2LLT A;  1IQ5 A;  2PSR A;  1CNP A;  1N2D A;  1YUR A;  4ORA B;  1JF2 A;  1W7J B;  2SCP A;  2VRG A;  3VRR A;  1F4O A;  2LVJ A;  1CDN A;  1MR8 A;  1M31 A;  1C7V A;  1YX7 A;  2NZ0 A;  2F3Y A;  1AHR A;  4GGF A;  3D0Y B;  4I5L B;  1QIV A;  1V1G A;  1CM1 A;  3H4S E;  4WQ3 A;  3SG5 A;  2NXQ A;  2WOR A;  4YBH B;  2L51 A;  2Y1M A;  4BY5 A;  1IRJ A;  1JFK A;  4N1G A;  2CBL A;  2P6B B;  1MHO A;  4BY4 A;  3O78 A;  4ICB A;  1XFV O;  1IJ6 A;  3RLZ A;  3SG6 A;  1JUO A;  1W7I B;  4YI8 A;  5HKY A;  2SAS A;  1MUX A;  2BE6 A;  1NP8 A;  2K7D A;  2JT3 A;  3I5I C;  4CID A;  3EK4 A;  1SL9 A;  1NCZ A;  1RK9 A;  1ALW A;  3OP0 A;  2E30 A;  2LUX A;  3CWG A;  2BCX A;  4N5X A;  1QTX A;  2Q91 A;  4GFT A;  5HLV A;  3F45 A;  2ZN8 A;  4M2O A;  4DIR A;  1Y0V H;  1OMR A;  2KBI A;  1QVI Z;  2PVB A;  4YRU A;  3CZT X;  1C07 A;  1QX2 A;  1TN4 A;  2GV5 A;  3DVM A;  1DF0 A;  4JQ0 D;  5G08 A;  2WCF A;  4QJ4 B;  1EG3 A;  5IBW A;  1LXF C;  2JNX A;  3AAK A;  1F4Q A;  5AFP A;  4XJK A;  4CLN A;  1ZAC A;  4HRG A;  3C1V A;  2KI4 B;  2M29 A;  3PN7 C;  1S3P A;  4MZK A;  1MXE A;  2OTG C;  1YVH A;  4IL1 A;  1DF0 B;  1LKJ A;  4GGN A;  5KSZ A;  2QAC A;  2MHH A;  1REC A;  4ORB B;  4XJK B;  4MEW A;  3TUY C;  1JWD A;  1OZO A;  1TNW A;  2E6W A;  1SCV A;  3VGO A;  4NQG A;  1M45 A;  5CSN A;  1IH0 A;  1SL7 A;  4D1E A;  1BOC A;  2BBM A;  1LVC D;  2ZFD A;  1R6P A;  1K2H A;  3I5H C;  2FCD A;  3RM1 A;  3QRX A;  2K7B A;  4I5K A;  1A75 A;  3CLN A;  3BUM B;  4JWQ A;  2MBX A;  2M3W A;  1DJW A;  1OE9 B;  3BUX B;  3BYA A;  2LLS A;  5ER4 X;  3TS5 B;  1RFJ A;  5KU1 A;  3PSR A;  2KFG A;  1TIZ A;  1FBV A;  5CSF A;  2KI6 C;  1A29 A;  1A75 B;  1AUI B;  2LAN A;  2LM5 A;  1YX8 A;  1JBA A;  1CDL A;  1WLM A;  3NSL A;  2LE9 B;  1PK0 D;  2HET A;  1CDP A;  2L4H A;  2JQ6 A;  3EK7 A;  2JUL A;  1IGV A;  2EC6 C;  1YUT A;  4TNC A;  1YUS A;  3JTD C;  4MVF A;  2BL0 C;  3EK8 A;  4MRX A;  2BBN A;  4Q04 A;  3JVT C;  1A03 A;  1NUB A;  1SPY A;  1CFP A;  1F70 A;  2LP2 A;  2L2E A;  2KI6 D;  2JC2 A;  2PMY A;  2IS9 A;  2BKI B;  1UHN A;  4YGB B;  1XO5 A;  2COL B;  3BOW A;  1XFU O;  2HQ8 A;  2BCB A;  1BT6 A;  2ZND A;  3CGA A;  3WXA A;  1L2O C;  1B8C A;  1UHK A;  3KF9 A;  3KPX A;  3K21 A;  2LHI A;  3GK2 A;  5HKW A;  3EVV A;  3DF0 B;  2PAS A;  2OTG B;  1BU3 A;  2K2A A;  4ORC B;  1BF5 A;  4N1F A;  2MLF C;  1OMV A;  1M39 A;  1TCO B;  1WRK A;  1QIW A;  1UP5 A;  2KAX A;  2WC8 A;  3BOW B;  1J7R A;  2OS8 B;  2JT0 A;  2M1K B;  3HCM A;  1E8A A;  3OX5 A;  1R2U A;  4DS7 A;  5K89 A;  1N0Y A;  5BPJ A;  1B47 A;  4CFR A;  1NX3 A;  3O4Y A;  5J3X A;  2CTN A;  3I5H B;  1XFX O;  1KWO C;  1S1E A;  2HQW A;  1AJ5 A;  3IQO A;  1AJ4 A;  1B9A A;  4PHN A;  1PRW A;  1K8U A;  3GOF A;  1S6C A;  5CSI A;  2AAO A;  3ICB A;  3FWB A;  2ZNE A;  4OCI A;  2LUC A;  1NX0 A;  1F8H A;  3OX6 A;  4ZCV A;  5AER A;  2PRU A;  1J7Q A;  1FF1 A;  2MJW B;  1NYA A;  1CLM A;  1QV0 A;  4PE1 A;  1JFJ A;  4PE4 A;  4P5O E;  2ISD A;  1FI5 A;  3D10 A;  2KGB C;  3LK0 A;  1VRK A;  2WCE A;  3CTN A;  2H61 C;  3I5G B;  3SIA A;  1YVL A;  1QXP A;  1QLS A;  1SL8 A;  2EC6 B;  4GBA A;  2M97 A;  1IJ5 A;  2KFH A;  3EKJ A;  1WDC B;  2BL0 B;  4NDB A;  5PAL A;  1KK8 B;  2MRD A;  1UHI A;  2AMI A;  2KSP A;  3FIA A;  2M7N A;  3JVT B;  4HRH A;  1G33 A;  2PAL A;  2TN4 A;  1EJ3 A;  1ZUZ A;  2M7L A;  2F8P A;  2Y1N A;  3OB2 B;  3OB1 B;  4DCK A;  2HPS A;  1MF8 B;  3BUO B;  3LL8 B;  2GGZ A;  1TTX A;  1QAT A;  3M0W A;  3O2P A;  1FPW A;  2KFF A;  2KBM A;  4MN0 A;  1CM4 A;  1PUL A;  2O5G A;  4U8D A;  2CCM A;  1KK7 Z;  1MQ1 A;  1EH2 A;  1V1F A;  1WRL A;  4YGA A;  3WHT B;  1GJY A;  1SW8 A;  1QV1 A;  1J1D A;  1J7P A;  1NCX A;  2ZN9 A;  3I5F C;  1S5G Z;  2EGD A;  2L0P A;  2K8M B;  4PHJ A;  2HF5 A;  5JJG A;  1HQV A;  1UHH A;  2FOT A;  3PLF B;  2MA2 A;  3IQQ A;  4M2Q A;  2DOQ A;  2BKH B;  3VRN A;  1UUS A;  2M1U A;  3O6B A;  1BOD A;  1PSB A;  3KHE A;  5D7F A;  2JOJ A;  2H61 A;  1XFW O;  1SCM C;  4UPG A;  2FJU B;  4MZJ A;  2O60 A;  2KYF A;  4PDZ A;  1TOP A;  5AEQ A;  1CFC A;  1KQM C;  4GAO A;  3AKA A;  3BUN B;  1H8B A;  2MAZ A;  1K9K A;  2R2I A;  2B1U A;  1ZMZ A;  1S26 D;  4I5N B;  1Y6W A;  2L4I A;  1MXL C;  4MRY A;  5CPV A;  2KAV A;  2ZRT A;  3EVR A;  3I5I B;  1B7T Y;  4CFQ A;  5I8N A;  2L50 A;  2CNP A;  4AOM A;  1QJT A;  1DMO A;  2LCP A;  1ZFS A;  1FI6 A;  1A2X A;  2WCB A;  2LC5 A;  3TZ1 A;  1CFD A;  1TNX A;  2NLN A;  2KDH A;  5I2O A;  2F2O A;  2I7A A;  1OOJ A;  2FCE A;  1YR5 A;  2I18 A;  1OQP A;  1S6J A;  1WLZ A;  4YGC B;  3NSK A;  3PFV A;  3GK4 X;  2MLE C;  2G2B A;  1YUU A;  2CT9 A;  3ZWH A;  1N65 A;  1NPQ A;  5ER5 A;  3BQ3 A;  2H2K A;  1S6I A;  3PAT A;  2KOT A;  4HSZ A;  1J7O A;  1KFX L;  2QPT A;  4YGD B;  1KFU L;  1B8R A;  1YTZ C;  1KFX S;  1L7Z A;  5KTY A;  1EL4 A;  1DJZ A;  1KFU S;  2M49 B;  1DJG A;  1OSA A;  1MWN A;  4FTG A;  1Y1X A;  1PAL A;  3PN7 B;  4PE0 A;  1S36 A;  2V53 A;  1F55 A;  2KNE A;  1SNL A;  4YGE B;  1M63 B;  5I2L A;  1DVI A;  2A4J A;  2M9G A;  5HYD A;  5HKZ A;  3TUY B;  1RRO A;  3GK1 A;  5F6T A;  2EHB A;  1BJF A;  2JZI A;  1ODB A;  3PAL A;  4PCW A;  1SCM B;  2KAY A;  3BUW B;  5B8I B;  2G9B A;  2JWW A;  2CXJ A;  1YRT B;  4FQO A;  1BR4 B;  5FYX A;  3WHU B;  4GUK A;  3CR4 X;  1KQM B;  3KEV A;  4NDD A;  1H4B A;  4PHM A;  1KSO A;  1IQ3 A;  1FW4 A;  2K7C A;  1B4C A;  2JTT A;  1QS7 A;  1XYD A;  4YI9 A;  2LMU A;  2KYC A;  3VRO A;  2JXL A;  1K95 A;  3D0Y A;  4DUQ A;  1F54 A;  4HRE E;  2KI4 C;  4CPV A;  1CMF A;  1XK4 C;  1G8I A;  4WQ2 A;  1TRF A;  4NDC A;  2JTZ A;  2Y5I A;  1TNQ A;  1Q80 A;  2LP3 A;  1GGZ A;  1SBJ A;  3KO0 A;  4OV2 A;  4WRI A;  1A4P A;  1BMO A;  2F3Z A;  2JXC A;  1YRU B;  3NXA A;  3WNX B;  3DVJ A;  1RJV A; 
#chains in the Genus database with same CATH topology
 1NSH A;  1K9U A;  2KQY A;  2K61 A;  1LA0 A;  2GGM A;  5DKQ A;  1GGW A;  1EXR A;  1QAS A;  2LMT A;  1DGU A;  3JTD B;  1WY9 A;  4OVN F;  5TNC A;  1NIW A;  1SR6 C;  1J55 A;  1Z4H A;  1DGV A;  5AXI A;  3S0A A;  3FS7 A;  1DJY A;  4PAL A;  3BJH A;  1QX7 A;  1CLL A;  5CSJ A;  5DKN A;  2Y4Q A;  3AKB A;  2WND A;  3S0D A;  4ETO A;  4XYN A;  3ZNI A;  3NGV A;  2JPO A;  3TS5 C;  1CFF A;  4I5J A;  2ZRS A;  2K7O A;  1L2O B;  4AQJ A;  1OZS A;  2WCK A;  3MSE B;  1ZOT B;  1JSA A;  2KQ6 A;  2QEO A;  3NSI A;  1F71 A;  1NX2 A;  2F2P A;  3SG2 A;  4ZCU A;  3SS4 A;  3EKH A;  5JOL A;  4QJ3 B;  1SYM A;  3QME A;  4MZL A;  1OOH A;  1XA5 A;  4MBE A;  4R1E A;  3SIB A;  1RTP 1;  2F33 A;  1PVB A;  1M46 A;  1AK8 A;  4A4C A;  4C0K A;  1C7W A;  3HX4 A;  1IG5 A;  1XK4 A;  1J1E A;  5DKR A;  4GNK B;  3V2L A;  1BLQ A;  4USL A;  1EG4 A;  1KWO B;  5D69 A;  3LK1 A;  2BE4 A;  2LV7 A;  3DZT A;  1SY9 A;  1U5I A;  3AAJ A;  3IF7 A;  4OR9 B;  3SG4 A;  1IWQ A;  1C3Z A;  1DJI A;  1PSR A;  1QVI Y;  3FE6 A;  4DRW A;  4L9M A;  2LVK A;  1ORG A;  1TCF A;  3CS1 A;  2BCA A;  3TDZ A;  1PVA A;  1B7T Z;  2K2F A;  1Y1U A;  3SJS A;  4AQI A;  1CB1 A;  1KK7 Y;  1K96 A;  4A4B A;  4C0L A;  2K0J A;  1CLB A;  3DVE A;  1DEK A;  2BEC A;  1DTL A;  1QLK A;  1U5I B;  1OMD A;  2OPO A;  1DJX A;  2LVV A;  1XFY O;  4M2P A;  1KSM A;  1S5G Y;  1B1G A;  2LAP A;  1WRZ A;  3IVT A;  5FI6 A;  1HT9 A;  2OS8 C;  2LMV A;  3A4U B;  4INW A;  1SKT A;  4PHK A;  1SR6 B;  1NX1 A;  3SS3 A;  1AP4 A;  3NSO A;  2L5X B;  2NCP A;  3A8R A;  3TDI A;  3LLE A;  2M8U A;  1UHJ A;  3DD4 A;  1DT7 B;  2JNF A;  1SRA A;  3SG7 A;  1DEL A;  2L98 A;  3EVU A;  4OKH A;  2KHN A;  1UUR A;  1W9Z A;  2QEB A;  1QWV A;  2BNX A;  3BXK A;  1ALV A;  2M0R A;  3UO9 A;  3VRQ A;  4MLW A;  4C0J A;  2KGR A;  3OBV A;  1CKK A;  1BR1 B;  2WOS A;  1LA3 A;  1RWY A;  2I94 A;  1BG1 A;  1CMG A;  3S0B A;  4GGF C;  2NCO A;  1XVJ A;  1K93 D;  1Y1A A;  2JT8 A;  2KLD A;  3D78 A;  4E68 A;  2LHL A;  2LLU A;  1TWO A;  1GQM A;  3S0F A;  1JF0 A;  3I5G C;  1K94 A;  3I5F B;  4JKT A;  5GQQ C;  3TDU A;  2Q4U A;  2QEH A;  2WCJ A;  1KQV A;  2WCL A;  2I2R E;  3PM8 A;  2JRF A;  4MSP A;  5HLO A;  4P2Y B;  3R1V A;  5AAN A;  1XFZ O;  2AUC A;  3OHM B;  1DJH A;  2JPT A;  1WDC C;  3LCP C;  1KK8 C;  1NCY A;  1SMG A;  1NWD A;  1SSE B;  3SG3 A;  4QJ5 B;  4F0Z B;  3DYE A;  2KPH A;  3DF0 A;  2RGI A;  1TNP A;  2LNK A;  3E3R A;  3K1E A;  2JU0 A;  3BFB A;  1TUZ A;  1QX5 B;  1LIN A;  3B6X A;  3DVK A;  1G4Y R;  3VRP A;  1K9P A;  2LVI A;  1AVS A;  4JPZ B;  1UWO A;  1K90 D;  2WC5 A;  5I2Q A;  1TUJ A;  3CR2 A;  1SK6 D;  1D1O A;  1B8L A;  2D8N A;  2P71 A;  2ZKM X;  1X02 A;  1CDM A;  4PE7 A;  3CZ0 A;  1IKU A;  3FWC A;  1CTR A;  4GPL B;  1KCY A;  3CR5 X;  2LLT A;  1IQ5 A;  2PSR A;  3S0G A;  3PJI A;  1N2D A;  1YUR A;  1CNP A;  4ORA B;  3B86 A;  1JF2 A;  1W7J B;  2SCP A;  2VRG A;  3VRR A;  1F4O A;  2LVJ A;  1CDN A;  1MR8 A;  1M31 A;  1C7V A;  1YX7 A;  2NZ0 A;  2F3Y A;  1AHR A;  4GGF A;  3D0Y B;  4I5L B;  1QIV A;  1V1G A;  1CM1 A;  3H4S E;  4WQ3 A;  3SG5 A;  2GTE A;  2NXQ A;  2WOR A;  4YBH B;  2L51 A;  2PYQ A;  2Y1M A;  4BY5 A;  1IRJ A;  1JFK A;  4N1G A;  2CBL A;  2P6B B;  1MHO A;  3FE8 A;  4BY4 A;  3O78 A;  4ICB A;  1XFV O;  1IJ6 A;  3RLZ A;  3SG6 A;  1JUO A;  1W7I B;  2H8V A;  3B7A A;  4YI8 A;  5HKY A;  2SAS A;  1JC2 A;  4INX A;  1MUX A;  3Q8I A;  2BE6 A;  1NP8 A;  2K7D A;  2JT3 A;  3I5I C;  4CID A;  3EK4 A;  1SL9 A;  1NCZ A;  1RK9 A;  1ALW A;  3OP0 A;  2E30 A;  2LUX A;  3CWG A;  2BCX A;  4N5X A;  1QTX A;  2Q91 A;  4GFT A;  5HLV A;  2L2C A;  3PM2 A;  3F45 A;  2ZN8 A;  4M2O A;  4DIR A;  1Y0V H;  1OMR A;  2KBI A;  1QVI Z;  3L4A A;  2PVB A;  4YRU A;  3CZT X;  1C07 A;  1QX2 A;  1TN4 A;  2GV5 A;  3DVM A;  1DF0 A;  2FJY A;  4JQ0 D;  5G08 A;  2WCF A;  4QJ4 B;  1EG3 A;  5IBW A;  1LXF C;  2JNX A;  3UNW A;  3AAK A;  1F4Q A;  3EG5 B;  4XJK A;  5AFP A;  4CLN A;  1ZAC A;  4HRG A;  2ERB A;  2KI4 B;  2M29 A;  3C1V A;  3CAB A;  3PN7 C;  1S3P A;  4MZK A;  1MXE A;  2OTG C;  1YVH A;  4IL1 A;  1DF0 B;  1LKJ A;  4GGN A;  5KSZ A;  2QAC A;  2MHH A;  1DQE A;  1REC A;  4ORB B;  4XJK B;  4MEW A;  3TUY C;  1JWD A;  1OZO A;  1TNW A;  2E6W A;  1SCV A;  3VGO A;  2PQL A;  4NQG A;  1M45 A;  5CSN A;  1IH0 A;  1SL7 A;  4D1E A;  1BOC A;  2BBM A;  1LVC D;  2ZFD A;  1R6P A;  1K2H A;  3I5H C;  2FCD A;  3RM1 A;  3QRX A;  2K7B A;  4I5K A;  1A75 A;  3CLN A;  3BUM B;  4JWQ A;  5FI2 A;  2MBX A;  2M3W A;  1DJW A;  1OE9 B;  3BUX B;  3BYA A;  2LLS A;  1P28 A;  5FI7 A;  5ER4 X;  3TS5 B;  1RFJ A;  3DY9 A;  5KU1 A;  3PSR A;  2KFG A;  1TIZ A;  1FBV A;  5CSF A;  2KI6 C;  1A29 A;  1A75 B;  1AUI B;  2LAN A;  2LM5 A;  1YX8 A;  1JBA A;  1CDL A;  1WLM A;  3NSL A;  2LE9 B;  1PK0 D;  2HET A;  1CDP A;  3R1O A;  2L4H A;  2JQ6 A;  3EK7 A;  2KLE A;  3L47 A;  2JUL A;  1IGV A;  2EC6 C;  1YUT A;  4TNC A;  1YUS A;  3JTD C;  1XFR A;  4MVF A;  4PT1 A;  2BL0 C;  3EK8 A;  3R1P A;  2BBN A;  4MRX A;  4Q04 A;  3JVT C;  1A03 A;  1NUB A;  1SPY A;  1CFP A;  1F70 A;  2LP2 A;  2L2E A;  2KI6 D;  2JC2 A;  2PMY A;  2IS9 A;  2BKI B;  1UHN A;  4YGB B;  1XO5 A;  2COL B;  3BOW A;  1XFU O;  2HQ8 A;  2BCB A;  1BT6 A;  2WCM A;  2ZND A;  3CGA A;  3WXA A;  1L2O C;  1B8C A;  1UHK A;  3KF9 A;  3KPX A;  4IJ7 A;  3K21 A;  2LHI A;  3GK2 A;  5HKW A;  3EVV A;  3DF0 B;  2PAS A;  3FE9 A;  2OTG B;  1BU3 A;  2K2A A;  4ORC B;  1BF5 A;  4FQT A;  4N1F A;  2MLF C;  1OMV A;  1M39 A;  1TCO B;  1WRK A;  1QIW A;  1Z2C B;  1UP5 A;  2KAX A;  2WC8 A;  3BOW B;  1J7R A;  2OS8 B;  2JT0 A;  2M1K B;  3HCM A;  1E8A A;  3CYZ A;  1R2U A;  3OX5 A;  4DS7 A;  5K89 A;  1N0Y A;  5BPJ A;  1B47 A;  4CFR A;  1NX3 A;  2QEV A;  3O4Y A;  5J3X A;  2CTN A;  3I5H B;  1XFX O;  1KWO C;  1S1E A;  2HQW A;  1AJ5 A;  3IQO A;  1AJ4 A;  1B9A A;  4PHN A;  1PRW A;  1K8U A;  3GOF A;  1S6C A;  5CSI A;  2AAO A;  3ICB A;  3D75 A;  2ZNE A;  3FWB A;  2LUC A;  4OCI A;  1NX0 A;  1F8H A;  3OX6 A;  4ZCV A;  5AER A;  2PRU A;  1J7Q A;  1FF1 A;  2MJW B;  1NYA A;  1CLM A;  1QV0 A;  4PE1 A;  5D3O A;  1JFJ A;  4PE4 A;  4P5O E;  2ISD A;  1FI5 A;  3D10 A;  2KGB C;  3LK0 A;  1VRK A;  4KYN A;  2WCE A;  3CTN A;  2H61 C;  3I5G B;  3SIA A;  1YVL A;  1QXP A;  1QLS A;  1SL8 A;  2EC6 B;  3VB1 A;  4GBA A;  2M97 A;  1IJ5 A;  2KFH A;  3EKJ A;  1WDC B;  2BL0 B;  4NDB A;  5PAL A;  5I94 A;  1KK8 B;  2MRD A;  1UHI A;  2AMI A;  2KSP A;  3FIA A;  2M7N A;  3JVT B;  4HRH A;  1G33 A;  2PAL A;  2TN4 A;  1EJ3 A;  1ZUZ A;  2BAP A;  2F8P A;  2Y1N A;  3OB2 B;  3OB1 B;  3O4X A;  2M7L A;  2HPS A;  1MF8 B;  3BUO B;  3NHI A;  3LL8 B;  2GGZ A;  1TTX A;  1QAT A;  3M0W A;  3O2P A;  1FPW A;  5DIC A;  2KFF A;  2KBM A;  3L4L A;  4MN0 A;  1CM4 A;  3B88 A;  1PUL A;  2O5G A;  3SS5 A;  4U8D A;  1MQ1 A;  1KK7 Z;  1OOF A;  2CCM A;  1V1F A;  1WRL A;  4YGA A;  1EH2 A;  3D77 A;  3N7H A;  3WHT B;  1GJY A;  1SW8 A;  1QV1 A;  1J1D A;  1J7P A;  1NCX A;  2ZN9 A;  3I5F C;  1S5G Z;  2EGD A;  2L0P A;  2K8M B;  4PHJ A;  3CZ1 A;  2HF5 A;  5JJG A;  3D73 A;  1HQV A;  1UHH A;  1LS8 A;  2P70 A;  2FOT A;  3NHT A;  2MA2 A;  3PLF B;  3IQQ A;  4M2Q A;  2DOQ A;  2BKH B;  3VRN A;  2WCH A;  1UUS A;  2M1U A;  3O6B A;  1BOD A;  3R72 A;  1PSB A;  3KHE A;  5D7F A;  2JOJ A;  2H61 A;  1XFW O;  1SCM C;  3BFH A;  4UPG A;  2FJU B;  3D76 A;  2O60 A;  4MZJ A;  2KYF A;  3CZ2 A;  1TOP A;  4PDZ A;  5AEQ A;  3S0E A;  1CFC A;  4JD9 A;  1KQM C;  3D74 A;  4GAO A;  3AKA A;  3BUN B;  1H8B A;  2MAZ A;  1K9K A;  2R2I A;  2B1U A;  1ZMZ A;  1S26 D;  4I5N B;  1Y6W A;  2L4I A;  1MXL C;  3B87 A;  4MRY A;  5CPV A;  2KAV A;  2ZRT A;  3EVR A;  3I5I B;  1B7T Y;  1IIO A;  4CFQ A;  1OOI X;  2L50 A;  2CNP A;  4AOM A;  1QJT A;  5I8N A;  2LCP A;  1DMO A;  1ZFS A;  1FI6 A;  1A2X A;  2WCB A;  2LC5 A;  3TZ1 A;  1CFD A;  1TNX A;  2NLN A;  2KDH A;  5I2O A;  2WC6 A;  2F2O A;  2I7A A;  3BFA A;  1OOJ A;  2FCE A;  3RZS A;  1GM0 A;  1YR5 A;  2L5Y A;  2I18 A;  1OQP A;  1S6J A;  1WLZ A;  4YGC B;  3NSK A;  3PFV A;  3GK4 X;  2MLE C;  2G2B A;  1YUU A;  2CT9 A;  3ZWH A;  1N65 A;  1NPQ A;  5ER5 A;  3BQ3 A;  2H2K A;  1S6I A;  3PAT A;  4DCK A;  2KOT A;  4HSZ A;  1J7O A;  1KFX L;  2QPT A;  4YGD B;  1KFU L;  1B8R A;  1YTZ C;  1KFX S;  1C3Y A;  1L7Z A;  5KTY A;  1EL4 A;  1DJZ A;  1KFU S;  2M49 B;  1DJG A;  1OSA A;  1MWN A;  4FTG A;  1Y1X A;  1PAL A;  3PN7 B;  4PE0 A;  1S36 A;  2V53 A;  1F55 A;  2KNE A;  1SNL A;  3OGN A;  4YGE B;  1M63 B;  1OOG A;  5I2L A;  1DVI A;  2A4J A;  2M9G A;  5EL2 A;  5HYD A;  5HKZ A;  3TUY B;  1RRO A;  3GK1 A;  5F6T A;  2EHB A;  1BJF A;  2JZI A;  1ODB A;  3PAL A;  4PCW A;  1SCM B;  2KAY A;  2QDI A;  3BUW B;  5B8I B;  2G9B A;  2JWW A;  2CXJ A;  1YRT B;  4FQO A;  1BR4 B;  2K60 A;  1OW4 A;  5FYX A;  3WHU B;  3CDN A;  4GUK A;  3CR4 X;  1KQM B;  3KEV A;  4NDD A;  2YGU A;  1H4B A;  4PHM A;  1KSO A;  1IQ3 A;  1FW4 A;  3DXL A;  1DC1 A;  2K7C A;  1B4C A;  2JTT A;  4F7F A;  1QS7 A;  1XYD A;  4YI9 A;  2LMU A;  2KYC A;  3VRO A;  2JXL A;  1K95 A;  3D0Y A;  4DUQ A;  1F54 A;  4HRE E;  2KI4 C;  4CPV A;  4OZD A;  1XK4 C;  1G8I A;  1CMF A;  4WQ2 A;  1TRF A;  4NDC A;  2JTZ A;  2Y5I A;  1TNQ A;  1Q80 A;  2LP3 A;  1GGZ A;  1SBJ A;  3KO0 A;  4OV2 A;  4WRI A;  5HL1 A;  1A4P A;  1BMO A;  2F3Z A;  2JXC A;  1YRU B;  3NXA A;  3WNX B;  3DVJ A;  1T14 A;  1RJV A; 
#chains in the Genus database with same CATH homology
 1NSH A;  1K9U A;  2KQY A;  2K61 A;  1LA0 A;  2GGM A;  5DKQ A;  1GGW A;  1EXR A;  1QAS A;  2LMT A;  1DGU A;  3JTD B;  1WY9 A;  4OVN F;  5TNC A;  1NIW A;  1SR6 C;  1J55 A;  1DGV A;  5AXI A;  3FS7 A;  1DJY A;  4PAL A;  1QX7 A;  1CLL A;  5CSJ A;  5DKN A;  2Y4Q A;  3AKB A;  2WND A;  4ETO A;  4XYN A;  3ZNI A;  3TS5 C;  1CFF A;  4I5J A;  2ZRS A;  2K7O A;  1L2O B;  4AQJ A;  1OZS A;  3MSE B;  1ZOT B;  1JSA A;  2KQ6 A;  3NSI A;  1F71 A;  1NX2 A;  2F2P A;  3SG2 A;  4ZCU A;  3EKH A;  5JOL A;  4QJ3 B;  1SYM A;  4MZL A;  4MBE A;  1XA5 A;  4R1E A;  3SIB A;  1RTP 1;  2F33 A;  1PVB A;  1M46 A;  1AK8 A;  4A4C A;  4C0K A;  1C7W A;  3HX4 A;  1IG5 A;  1XK4 A;  1J1E A;  5DKR A;  4GNK B;  1BLQ A;  4USL A;  1EG4 A;  1KWO B;  5D69 A;  3LK1 A;  2BE4 A;  2LV7 A;  1SY9 A;  1U5I A;  3AAJ A;  3IF7 A;  4OR9 B;  3SG4 A;  1IWQ A;  1DJI A;  1PSR A;  1QVI Y;  4DRW A;  4L9M A;  2LVK A;  1TCF A;  3CS1 A;  2BCA A;  3TDZ A;  1PVA A;  1B7T Z;  2K2F A;  1Y1U A;  3SJS A;  4AQI A;  1CB1 A;  1KK7 Y;  1K96 A;  4A4B A;  4C0L A;  2K0J A;  1CLB A;  3DVE A;  2BEC A;  1DTL A;  1QLK A;  1U5I B;  1OMD A;  2OPO A;  1DJX A;  2LVV A;  1XFY O;  4M2P A;  1KSM A;  1S5G Y;  1B1G A;  2LAP A;  1WRZ A;  1HT9 A;  2OS8 C;  2LMV A;  3A4U B;  4PHK A;  1SKT A;  1AP4 A;  1SR6 B;  1NX1 A;  3NSO A;  2L5X B;  2NCP A;  3A8R A;  3TDI A;  3LLE A;  2M8U A;  1UHJ A;  3DD4 A;  1DT7 B;  2JNF A;  1SRA A;  3SG7 A;  2L98 A;  3EVU A;  4OKH A;  2KHN A;  1UUR A;  1JC2 A;  3BXK A;  4C0J A;  1ALV A;  2M0R A;  3VRQ A;  4MLW A;  2KGR A;  1CKK A;  1BR1 B;  2WOS A;  1LA3 A;  1RWY A;  2I94 A;  1BG1 A;  1CMG A;  4GGF C;  2NCO A;  1XVJ A;  1K93 D;  1Y1A A;  2JT8 A;  4E68 A;  2LHL A;  2LLU A;  1GQM A;  1JF0 A;  3I5G C;  1K94 A;  3I5F B;  5GQQ C;  3TDU A;  1KQV A;  2Q4U A;  3PM8 A;  2I2R E;  2JRF A;  4MSP A;  5HLO A;  4P2Y B;  5AAN A;  1XFZ O;  2AUC A;  3OHM B;  1DJH A;  2JPT A;  1WDC C;  3LCP C;  1KK8 C;  1NCY A;  1SMG A;  1NWD A;  3SG3 A;  4QJ5 B;  4F0Z B;  3DF0 A;  2RGI A;  1TNP A;  2LNK A;  3E3R A;  2JU0 A;  3DVK A;  1QX5 B;  1LIN A;  1G4Y R;  3VRP A;  1K9P A;  2LVI A;  1AVS A;  4JPZ B;  1UWO A;  1K90 D;  5I2Q A;  3CR2 A;  1SK6 D;  1D1O A;  1B8L A;  2D8N A;  2ZKM X;  4PE7 A;  1X02 A;  1CDM A;  1IKU A;  3FWC A;  1CTR A;  4GPL B;  1KCY A;  3CR5 X;  2LLT A;  1IQ5 A;  2PSR A;  1CNP A;  1N2D A;  1YUR A;  4ORA B;  1JF2 A;  1W7J B;  2SCP A;  2VRG A;  3VRR A;  1F4O A;  2LVJ A;  1CDN A;  1MR8 A;  1M31 A;  1C7V A;  1YX7 A;  2NZ0 A;  2F3Y A;  1AHR A;  4GGF A;  3D0Y B;  4I5L B;  1QIV A;  1V1G A;  1CM1 A;  3H4S E;  4WQ3 A;  3SG5 A;  2NXQ A;  2WOR A;  4YBH B;  2L51 A;  2Y1M A;  4BY5 A;  1IRJ A;  1JFK A;  4N1G A;  2CBL A;  2P6B B;  1MHO A;  4BY4 A;  3O78 A;  4ICB A;  1XFV O;  1IJ6 A;  3RLZ A;  3SG6 A;  1JUO A;  1W7I B;  4YI8 A;  5HKY A;  2SAS A;  1MUX A;  2BE6 A;  1NP8 A;  2K7D A;  2JT3 A;  3I5I C;  4CID A;  3EK4 A;  1SL9 A;  1NCZ A;  1RK9 A;  1ALW A;  3OP0 A;  2E30 A;  2LUX A;  3CWG A;  2BCX A;  4N5X A;  1QTX A;  2Q91 A;  4GFT A;  5HLV A;  3F45 A;  2ZN8 A;  4M2O A;  4DIR A;  1Y0V H;  1OMR A;  2KBI A;  1QVI Z;  2PVB A;  4YRU A;  3CZT X;  1C07 A;  1QX2 A;  1TN4 A;  2GV5 A;  3DVM A;  1DF0 A;  4JQ0 D;  5G08 A;  2WCF A;  4QJ4 B;  1EG3 A;  5IBW A;  1LXF C;  2JNX A;  3AAK A;  1F4Q A;  5AFP A;  4XJK A;  4CLN A;  1ZAC A;  4HRG A;  3C1V A;  2KI4 B;  2M29 A;  3PN7 C;  1S3P A;  4MZK A;  1MXE A;  2OTG C;  1YVH A;  4IL1 A;  1DF0 B;  1LKJ A;  4GGN A;  5KSZ A;  2QAC A;  2MHH A;  1REC A;  4ORB B;  4XJK B;  4MEW A;  3TUY C;  1JWD A;  1OZO A;  1TNW A;  2E6W A;  1SCV A;  3VGO A;  4NQG A;  1M45 A;  5CSN A;  1IH0 A;  1SL7 A;  4D1E A;  1BOC A;  2BBM A;  1LVC D;  2ZFD A;  1R6P A;  1K2H A;  3I5H C;  2FCD A;  3RM1 A;  3QRX A;  2K7B A;  4I5K A;  1A75 A;  3CLN A;  3BUM B;  4JWQ A;  2MBX A;  2M3W A;  1DJW A;  1OE9 B;  3BUX B;  3BYA A;  2LLS A;  5ER4 X;  3TS5 B;  1RFJ A;  5KU1 A;  3PSR A;  2KFG A;  1TIZ A;  1FBV A;  5CSF A;  2KI6 C;  1A29 A;  1A75 B;  1AUI B;  2LAN A;  2LM5 A;  1YX8 A;  1JBA A;  1CDL A;  1WLM A;  3NSL A;  2LE9 B;  1PK0 D;  2HET A;  1CDP A;  2L4H A;  2JQ6 A;  3EK7 A;  2JUL A;  1IGV A;  2EC6 C;  1YUT A;  4TNC A;  1YUS A;  3JTD C;  4MVF A;  2BL0 C;  3EK8 A;  4MRX A;  2BBN A;  4Q04 A;  3JVT C;  1A03 A;  1NUB A;  1SPY A;  1CFP A;  1F70 A;  2LP2 A;  2L2E A;  2KI6 D;  2JC2 A;  2PMY A;  2IS9 A;  2BKI B;  1UHN A;  4YGB B;  1XO5 A;  2COL B;  3BOW A;  1XFU O;  2HQ8 A;  2BCB A;  1BT6 A;  2ZND A;  3CGA A;  3WXA A;  1L2O C;  1B8C A;  1UHK A;  3KF9 A;  3KPX A;  3K21 A;  2LHI A;  3GK2 A;  5HKW A;  3EVV A;  3DF0 B;  2PAS A;  2OTG B;  1BU3 A;  2K2A A;  4ORC B;  1BF5 A;  4N1F A;  2MLF C;  1OMV A;  1M39 A;  1TCO B;  1WRK A;  1QIW A;  1UP5 A;  2KAX A;  2WC8 A;  3BOW B;  1J7R A;  2OS8 B;  2JT0 A;  2M1K B;  3HCM A;  1E8A A;  3OX5 A;  1R2U A;  4DS7 A;  5K89 A;  1N0Y A;  5BPJ A;  1B47 A;  4CFR A;  1NX3 A;  3O4Y A;  5J3X A;  2CTN A;  3I5H B;  1XFX O;  1KWO C;  1S1E A;  2HQW A;  1AJ5 A;  3IQO A;  1AJ4 A;  1B9A A;  4PHN A;  1PRW A;  1K8U A;  3GOF A;  1S6C A;  5CSI A;  2AAO A;  3ICB A;  3FWB A;  2ZNE A;  4OCI A;  2LUC A;  1NX0 A;  1F8H A;  3OX6 A;  4ZCV A;  5AER A;  2PRU A;  1J7Q A;  1FF1 A;  2MJW B;  1NYA A;  1CLM A;  1QV0 A;  4PE1 A;  1JFJ A;  4PE4 A;  4P5O E;  2ISD A;  1FI5 A;  3D10 A;  2KGB C;  3LK0 A;  1VRK A;  2WCE A;  3CTN A;  2H61 C;  3I5G B;  3SIA A;  1YVL A;  1QXP A;  1QLS A;  1SL8 A;  2EC6 B;  4GBA A;  2M97 A;  1IJ5 A;  2KFH A;  3EKJ A;  1WDC B;  2BL0 B;  4NDB A;  5PAL A;  1KK8 B;  2MRD A;  1UHI A;  2AMI A;  2KSP A;  3FIA A;  2M7N A;  3JVT B;  4HRH A;  1G33 A;  2PAL A;  2TN4 A;  1EJ3 A;  1ZUZ A;  2M7L A;  2F8P A;  2Y1N A;  3OB2 B;  3OB1 B;  4DCK A;  2HPS A;  1MF8 B;  3BUO B;  3LL8 B;  2GGZ A;  1TTX A;  1QAT A;  3M0W A;  3O2P A;  1FPW A;  2KFF A;  2KBM A;  4MN0 A;  1CM4 A;  1PUL A;  2O5G A;  4U8D A;  2CCM A;  1KK7 Z;  1MQ1 A;  1EH2 A;  1V1F A;  1WRL A;  4YGA A;  3WHT B;  1GJY A;  1SW8 A;  1QV1 A;  1J1D A;  1J7P A;  1NCX A;  2ZN9 A;  3I5F C;  1S5G Z;  2EGD A;  2L0P A;  2K8M B;  4PHJ A;  2HF5 A;  5JJG A;  1HQV A;  1UHH A;  2FOT A;  3PLF B;  2MA2 A;  3IQQ A;  4M2Q A;  2DOQ A;  2BKH B;  3VRN A;  1UUS A;  2M1U A;  3O6B A;  1BOD A;  1PSB A;  3KHE A;  5D7F A;  2JOJ A;  2H61 A;  1XFW O;  1SCM C;  4UPG A;  2FJU B;  4MZJ A;  2O60 A;  2KYF A;  4PDZ A;  1TOP A;  5AEQ A;  1CFC A;  1KQM C;  4GAO A;  3AKA A;  3BUN B;  1H8B A;  2MAZ A;  1K9K A;  2R2I A;  2B1U A;  1ZMZ A;  1S26 D;  4I5N B;  1Y6W A;  2L4I A;  1MXL C;  4MRY A;  5CPV A;  2KAV A;  2ZRT A;  3EVR A;  3I5I B;  1B7T Y;  4CFQ A;  5I8N A;  2L50 A;  2CNP A;  4AOM A;  1QJT A;  1DMO A;  2LCP A;  1ZFS A;  1FI6 A;  1A2X A;  2WCB A;  2LC5 A;  3TZ1 A;  1CFD A;  1TNX A;  2NLN A;  2KDH A;  5I2O A;  2F2O A;  2I7A A;  1OOJ A;  2FCE A;  1YR5 A;  2I18 A;  1OQP A;  1S6J A;  1WLZ A;  4YGC B;  3NSK A;  3PFV A;  3GK4 X;  2MLE C;  2G2B A;  1YUU A;  2CT9 A;  3ZWH A;  1N65 A;  1NPQ A;  5ER5 A;  3BQ3 A;  2H2K A;  1S6I A;  3PAT A;  2KOT A;  4HSZ A;  1J7O A;  1KFX L;  2QPT A;  4YGD B;  1KFU L;  1B8R A;  1YTZ C;  1KFX S;  1L7Z A;  5KTY A;  1EL4 A;  1DJZ A;  1KFU S;  2M49 B;  1DJG A;  1OSA A;  1MWN A;  4FTG A;  1Y1X A;  1PAL A;  3PN7 B;  4PE0 A;  1S36 A;  2V53 A;  1F55 A;  2KNE A;  1SNL A;  4YGE B;  1M63 B;  5I2L A;  1DVI A;  2A4J A;  2M9G A;  5HYD A;  5HKZ A;  3TUY B;  1RRO A;  3GK1 A;  5F6T A;  2EHB A;  1BJF A;  2JZI A;  1ODB A;  3PAL A;  4PCW A;  1SCM B;  2KAY A;  3BUW B;  5B8I B;  2G9B A;  2JWW A;  2CXJ A;  1YRT B;  4FQO A;  1BR4 B;  5FYX A;  3WHU B;  4GUK A;  3CR4 X;  1KQM B;  3KEV A;  4NDD A;  1H4B A;  4PHM A;  1KSO A;  1IQ3 A;  1FW4 A;  2K7C A;  1B4C A;  2JTT A;  1QS7 A;  1XYD A;  4YI9 A;  2LMU A;  2KYC A;  3VRO A;  2JXL A;  1K95 A;  3D0Y A;  4DUQ A;  1F54 A;  4HRE E;  2KI4 C;  4CPV A;  1CMF A;  1XK4 C;  1G8I A;  4WQ2 A;  1TRF A;  4NDC A;  2JTZ A;  2Y5I A;  1TNQ A;  1Q80 A;  2LP3 A;  1GGZ A;  1SBJ A;  3KO0 A;  4OV2 A;  4WRI A;  1A4P A;  1BMO A;  2F3Z A;  2JXC A;  1YRU B;  3NXA A;  3WNX B;  3DVJ A;  1RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...