3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
1IJ6A 4JWQA 3VRNA 3CGAA 1SL7A 4XYNA 1NYAA 2LVKA 1V1FA 1MR8A 3K21A 2JTZA 2LE9B 2IS9A 2PSRA 3SG6A 2SASA 4MBEA 3BOWB 1BT6A 1DJWA 1OZSA 2AUCA 2V53A 3EVUA 4YI9A 1JUOA 4MEWA 1J1DA 1S1EA 1FW4A 4DS7A 3BUMB 1CLLA 1OSAA 3OX5A 2K2AA 1FF1A 1LXFC 3AAJA 1K8UA 1AJ4A 3BUOB 1K95A 1RTP1 2LP3A 3KHEA 1L2OC 2LLTA 1B8LA 5CSJA 5ER4X 1YX8A 2JTTA 4YBHB 3D0YB 4WQ3A 1NX3A 2LM5A 1L7ZA 1H4BA 2SCPA 1U5IA 3H4SE 1CMFA 1NSHA 1M45A 1QX5B 1C7WA 1NX0A 1UWOA 4I5LB 2L51A 1TCFA 1UHJA 4C0LA 2MBXA 1M63B 2M49B 1YUSA 1AK8A 2BCBA 1F55A 2AAOA 1S5GZ 4ICBA 2KOTA 4N1GA 3TS5B 2JNFA 1HQVA 5AERA 5I2QA 2AMIA 1K93D 1J7QA 4M2PA 1SL9A 2K2FA 2E30A 3I5HC 5HKWA 2JU0A 4PALA 1XK4C 2WCBA 4YGDB 3C1VA 1CKKA 5D7FA 4GNKB 4NDCA 2M7NA 3CLNA 1X02A 1CDPA 3GK1A 1XO5A 1A29A 2L5XB 1EXRA 1PALA 3AKBA 4ORCB 5AXIA 1OMRA 4ETOA 2FOTA 3KPXA 3VRQA 1TOPA 1JBAA 3PM8A 1B7TY 4CIDA 1QATA 1KWOB 2BBNA 4DUQA 2VRGA 2KAVA 2LNKA 4QJ4B 4BY4A 1IQ3A 1S36A 1BF5A 2PRUA 3I5GB 4GGFA 2JT0A 1DMOA 3SG7A 1QVIY 1C7VA 2FCEA 1S6CA 1C07A 1L2OB 1ZMZA 4DRWA 3NSLA 1G4YR 2MHHA 1DJYA 1YURA 2QPTA 1UHHA 2NCOA 4NQGA 4ZCUA 1CB1A 2KAXA 1W7JB 2G9BA 1J1EA 1SYMA 4OV2A 3SG2A 1QJTA 2LANA 2KFGA 4USLA 1OQPA 2ZKMX 3TUYC 3TS5C 4GBAA 4GUKA 2NZ0A 5F6TA 3LCPC 3A4UB 1SCVA 3TDZA 5CSIA 1TNWA 1EG3A 4GAOA 2JT8A 2K7DA 1AHRA 1ALVA 2L4HA 4I5JA 4HSZA 4N5XA 3BUWB 2WC8A 4D1EA 3EK4A 2JT3A 5KU1A 1XFXO 1IGVA 1N2DA 2JQ6A 3SG5A 3JTDB 1NPQA 4UPGA 1MHOA 1SKTA 1F4OA 1XFYO 2R2IA 3BOWA 3LLEA 2G2BA 1LKJA 2JXLA 2L0PA 2BCXA 3F45A 2EHBA 1BOCA 2QACA 1KCYA 1DVIA 1OZOA 1Y6WA 2MA2A 4ORAB 2BECA 1QTXA 2F2PA 1IQ5A 2LUCA 5AFPA 2CTNA 2Q91A 3OB1B 4HREE 2H61A 3WHUB 4DIRA 1CDLA 2OTGB 3EVRA 1NCYA 1OE9B 4TNCA 2COLB 1N65A 1SPYA 2WCFA 1W7IB 2A4JA 4OCIA 1JWDA 3I5IC 5CSNA 1DJIA 1MWNA 3CR4X 1KK7Z 2CXJA 1DGVA 2MRDA 3DF0B 1BMOA 1OOJA 2WNDA 4GGFC 2D8NA 2LVIA 1YVHA 3LK1A 4PE7A 2M97A 5KTYA 2CNPA 3PN7B 2KGBC 3WXAA 2K7CA 4PE1A 4M2OA 3TZ1A 1B8RA 2M8UA 2OPOA 1F8HA 4HRGA 3O78A 2KBIA 5HYDA 3OP0A 2MLFC 3BUXB 1IG5A 5KSZA 2MJWB 1TRFA 3D0YA 1HT9A 1EL4A 1G8IA 1EH2A 1DJHA 1QLSA 2KI4B 3VGOA 4M2QA 1CDMA 4GPLB 4I5NB 2LMVA 3EKJA 2LMTA 2M9GA 3AKAA 1QX7A 1Q80A 3I5GC 1BLQA 2B1UA 4NDBA 1IRJA 2ZRTA 3NSIA 2KFFA 1B4CA 3I5IB 2NXQA 1K9UA 2H61C 5AANA 2PASA 1QV0A 1A75A 4MRXA 2NCPA 5FYXA 4ZCVA 3QRXA 2JRFA 4JQ0D 2LP2A 2O60A 5D69A 1JFKA 2O5GA 5I8NA 2HQ8A 2LLUA 1DT7B 4QJ5B 1YRUB 1CFDA 1QXPA 2M29A 2BL0C 1WY9A 1PRWA 3CWGA 2KHNA 2BL0B 4FTGA 3I5HB 1CNPA 1SCMB 2L98A 1CFFA 1LA0A 4GFTA 2LC5A 1RROA 4PCWA 3O6BA 1N0YA 1ZFSA 2MAZA 2LHLA 3ICBA 5J3XA 2LVVA 2HETA 4CPVA 5B8IB 1B7TZ 2WORA 1PSRA 2ZNEA 1Y1UA 1RJVA 1S6JA 3BYAA 4E68A 2L50A 2BCAA 2HQWA 4AQJA 3TDUA 3CTNA 3LL8B 1J7RA 4XJKA 1TIZA 4P2YB 1IJ5A 4OVNF 3FWCA 5CPVA 4MZJA 1F71A 2JPTA 2K7OA 2LV7A 4P5OE 1CFPA 2ZN8A 3RM1A 1XA5A 2I7AA 5PALA 1WRKA 5JOLA 1FI6A 1UUSA 1ZACA 2BE4A 1SMGA 4JPZB 3DVMA 1MF8B 3WHTB 1XYDA 4Q04A 3FWBA 1MQ1A 1IWQA 2WOSA 1ALWA 1NP8A 2F3ZA 1KK8C 2KYFA 1KQMB 2Y1MA 3KF9A 2NLNA 4DCKA 3VROA 1OMDA 1KQVA 1K9KA 1OMVA 3HX4A 2JZIA 2I94A 2ZFDA 5G08A 3EK8A 1JC2A 1UHKA 2ISDA 2LCPA 1K90D 1QV1A 5HLVA 2BE6A 3D10A 3IQQA 1S5GY 5HKZA 2KNEA 1M46A 3SIAA 4C0JA 1QX2A 1DGUA 2GV5A 3OB2B 2LAPA 1A4PA 1SY9A 1SW8A 3PSRA 1KSMA 4MZLA 2BBMA 1JSAA 3VRPA 2KQ6A 3SJSA 1GGWA 3EK7A 2M1UA 4NDDA 2L4IA 1PVAA 1FPWA 2ZN9A 4F0ZB 1PULA 1LINA 1YVLA 1DJXA 4XJKB 3I5FB 1NX1A 1WLZA 1CLMA 1RFJA 1YUTA 1ODBA 4C0KA 4MRYA 1DF0B 4PHJA 5I2LA 1R6PA 1UP5A 2M7LA 5AEQA 4PE4A 1KWOC 5GQQC 4L9MA 1JFJA 3NXAA 1TNPA 1M39A 1CFCA 5BPJA 2K8MB 4CLNA 2LUXA 2Y4QA 3IF7A 3JVTC 5JJGA 1GJYA 4A4CA 2OS8B 1S3PA 1TNQA 3CR2A 3EKHA 4MZKA 1G33A 3BUNB 1TCOB 4U8DA 2LVJA 2PMYA 3CR5X 1KFXL 2I2RE 3GOFA 2KI6D 3E3RA 3JTDC 1DF0A 4YI8A 1CDNA 1SL8A 1PK0D 1CMGA 2KYCA 1B8CA 3OHMB 1EG4A 3PALA 1Y0VH 4YGBB 2HF5A 3LK0A 1NWDA 3A8RA 3KO0A 2PVBA 4PHNA 3DVJA 1SK6D 2JXCA 1YR5A 3PFVA 4ORBB 3BXKA 4OR9B 5DKQA 1IH0A 3MSEB 1SCMC 5CSFA 3TUYB 1M31A 1A2XA 1FBVA 1E8AA 1XFVO 1KSOA 1DTLA 1AUIB 1KFUL 1R2UA 5TNCA 1PSBA 1CTRA 1SR6B 4R1EA 1TN4A 1QASA 2KBMA 4QJ3B 2RGIA 3DF0A 4AQIA 3IQOA 1QVIZ 2F3YA 2Y5IA 2KDHA 4YGEB 4YGAA 1YX7A 1B9AA 2KSPA 1ZUZA 2LHIA 1QS7A 1NUBA 1RK9A 1LA3A 2KQYA 1A03A 3DVEA 2BKIB 3PN7C 4MVFA 2KAYA 1CM4A 5DKNA 4AOMA 1TTXA 2JC2A 2CCMA 4MLWA 2KGRA 3SG4A 2EC6B 2HPSA 2Y1NA 1XK4A 5K89A 1CLBA 2PALA 2FJUB 1JF2A 1UURA 2EC6C 1KQMC 2ZRSA 3SIBA 3TDIA 1A75B 1JF0A 2JULA 2E6WA 2F33A 3ZWHA 1D1OA 1H8BA 1MXEA 1WDCC 3CS1A 4CFRA 3I5FC 1F4QA 4PHKA 2BKHB 1SR6C 3NSKA 1NX2A 1MUXA 5HKYA 3CZTX 3JVTB 1PVBA 3ZNIA 2MLEC 5DKRA 1AP4A 1QIVA 1BU3A 4MSPA 1DJZA 4I5KA 4YGCB 2EGDA 2K7BA 2CT9A 3VRRA 1WLMA 1Y1AA 2DOQA 1TNXA 2FCDA 1CM1A 3PLFB 3FIAA 1AJ5A 1U5IB 2H2KA 3GK2A 3O4YA 1BODA 1NCXA 1K96A 4CFQA 3RLZA 2LMUA 3DVKA 1BG1A 1BR4B 2L2EA 4PDZA 3SG3A 2GGMA 1KK8B 1YUUA 1NCZA 2P6BB 1VRKA 1IKUA 1UHIA 4N1FA 4WRIA 1AVSA 2OTGC 2K0JA 2LLSA 1EJ3A 2KFHA 1XFWO 1F54A 1K94A 3FS7A 2TN4A 2M3WA 1QLKA 1SNLA 1V1GA 2OS8C 4MN0A 1DJGA 4YRUA 2F8PA 3OX6A 5I2OA 1B1GA 1KFUS 2K61A 2ZNDA 1WRZA 1KK7Y 1BR1B 1RWYA 2JOJA 3EVVA 3O2PA 1J7OA 1GQMA 4BY5A 1QIWA 5HLOA 1NIWA 1XFUO 1WRLA 2M1KB 2M0RA 3DD4A 3HCMA 2KI6C 1K2HA 1UHNA 1SRAA 1GGZA 2JWWA 2JNXA 4FQOA 3WNXB 1SBJA 1Y1XA 4GGNA 1ZOTB 2I18A 4WQ2A 2WCEA 1YTZC 4OKHA 1XFZO 1J55A 1S26D 4A4BA 2CBLA 1LVCD 3BQ3A 3NSOA 2KI4C 1F70A 1XVJA 1B47A 4HRHA 1MXLC 1KFXS 1WDCB 1K9PA 3AAKA 4PE0A 3GK4X 2F2OA 1FI5A 1S6IA 4IL1A 3M0WA 5IBWA 1J7PA 1RECA 3PATA 2GGZA 4PHMA 3KEVA 1BJFA 5ER5A 1YRTB 2Q4UA
chains in the Genus database with same CATH superfamily
1IJ6A 4JWQA 3VRNA 3CGAA 1SL7A 4XYNA 1NYAA 2LVKA 1V1FA 4F7FA 1MR8A 3FE6A 3K21A 2JTZA 2LE9B 2IS9A 2PSRA 3SG6A 2SASA 4MBEA 3BOWB 1BT6A 1DJWA 1OZSA 2AUCA 2V53A 3EVUA 1T14A 4YI9A 1JUOA 4MEWA 1J1DA 1S1EA 1FW4A 4DS7A 3BUMB 1CLLA 1OSAA 3B87A 3OX5A 2K2AA 1FF1A 1LXFC 3AAJA 1AJ4A 1K8UA 3BUOB 1K95A 1RTP1 2LP3A 3D75A 3KHEA 1L2OC 2LLTA 1B8LA 3EG5B 5CSJA 5ER4X 1YX8A 2JTTA 4YBHB 3D0YB 4WQ3A 1NX3A 2LM5A 1L7ZA 4INWA 1H4BA 2SCPA 1U5IA 3BFHA 3H4SE 1NSHA 1M45A 1CMFA 3RZSA 2WCMA 3CDNA 1QX5B 1C7WA 1NX0A 1UWOA 4I5LB 2L51A 1TCFA 1UHJA 4C0LA 2MBXA 1M63B 2M49B 1YUSA 1AK8A 2BCBA 1F55A 2AAOA 3R1VA 1S5GZ 4ICBA 2KOTA 4N1GA 3TS5B 2JNFA 3CZ0A 1HQVA 5AERA 5I2QA 2AMIA 1K93D 1J7QA 4M2PA 1SL9A 2K2FA 2E30A 3I5HC 5HKWA 2JU0A 4PALA 1XK4C 2WCBA 4YGDB 3C1VA 3FE8A 1CKKA 5D7FA 4GNKB 4NDCA 2M7NA 3CLNA 1X02A 3BFAA 1CDPA 3GK1A 1XO5A 1A29A 2L5XB 1EXRA 1PALA 3AKBA 4ORCB 3NHIA 2P70A 5AXIA 1OMRA 4ETOA 2FOTA 3KPXA 3VRQA 1TOPA 1JBAA 3PM8A 3QMEA 1B7TY 4KYNA 4CIDA 3B7AA 1QATA 1KWOB 3Q8IA 2BBNA 4DUQA 2VRGA 2KAVA 2LNKA 4QJ4B 4BY4A 1IQ3A 1S36A 1BF5A 2PRUA 3D78A 3I5GB 4GGFA 2JT0A 3B6XA 3N7HA 1DMOA 3SG7A 2PQLA 1QVIY 1C7VA 2FCEA 1S6CA 5EL2A 1C07A 1L2OB 1ZMZA 4DRWA 3NSLA 1G4YR 2MHHA 1DJYA 1YURA 2QPTA 1UHHA 2NCOA 4NQGA 4ZCUA 1CB1A 2KAXA 1W7JB 2G9BA 1J1EA 1SYMA 4OV2A 3SG2A 1QJTA 2LANA 2KFGA 1TWOA 4USLA 1OQPA 2ZKMX 3TUYC 3TS5C 4GBAA 4GUKA 2NZ0A 5F6TA 3LCPC 3S0BA 3A4UB 1SCVA 3TDZA 5CSIA 1TNWA 1EG3A 4GAOA 2JT8A 2K7DA 3BFBA 1AHRA 1ALVA 2L4HA 4I5JA 4HSZA 4N5XA 3BUWB 2WC8A 1TUZA 4D1EA 3EK4A 2JT3A 5KU1A 1XFXO 1IGVA 2QEVA 1N2DA 2JQ6A 3SG5A 3JTDB 1NPQA 4UPGA 1OOIX 1MHOA 1SKTA 1F4OA 1XFYO 2QEBA 2R2IA 3SS3A 1IIOA 3S0EA 3BOWA 3D73A 3LLEA 2G2BA 1LKJA 2JXLA 2L0PA 2BCXA 3F45A 2EHBA 1BOCA 2QACA 1KCYA 1DVIA 1OZOA 1Y6WA 2MA2A 4ORAB 2BECA 1QTXA 2F2PA 1IQ5A 2LUCA 5AFPA 2CTNA 2Q91A 3OB1B 4HREE 2H61A 3WHUB 4DIRA 1CDLA 2OTGB 3EVRA 1NCYA 1OE9B 4TNCA 2COLB 1N65A 2WCKA 5FI7A 1SPYA 1XFRA 1W7IB 2A4JA 2WCFA 3L4LA 4IJ7A 4OCIA 1JWDA 3I5IC 5CSNA 1DJIA 1MWNA 3DZTA 3CR4X 1KK7Z 2CXJA 1DGVA 2MRDA 2KPHA 3DF0B 1BMOA 1OOJA 2WNDA 4GGFC 2D8NA 2LVIA 1YVHA 1SSEB 3LK1A 4PE7A 2M97A 5KTYA 1GM0A 2CNPA 3PN7B 2KGBC 3WXAA 2K7CA 4PE1A 4M2OA 3TZ1A 1B8RA 2M8UA 2OPOA 3IVTA 4HRGA 3O78A 2KBIA 5HYDA 3OP0A 2MLFC 3BUXB 1IG5A 5KSZA 2MJWB 1TRFA 3D0YA 1HT9A 1EL4A 1G8IA 1EH2A 1DJHA 1QLSA 2KI4B 3VGOA 5FI6A 4M2QA 3S0FA 1CDMA 1Z2CB 4GPLB 4I5NB 4INXA 2LMVA 3EKJA 2LMTA 2M9GA 3AKAA 1QX7A 1Q80A 3I5GC 1BLQA 2B1UA 4NDBA 1IRJA 2ZRTA 3NSIA 2KFFA 1B4CA 3I5IB 2NXQA 1K9UA 2H61C 5AANA 2PASA 1QV0A 1A75A 3B88A 3O4XA 4MRXA 2NCPA 5FYXA 4ZCVA 3QRXA 2JRFA 4JQ0D 2LP2A 2O60A 5D69A 1JFKA 2O5GA 5DICA 2HQ8A 5I8NA 2LLUA 1DT7B 4QJ5B 1YRUB 1CFDA 1QXPA 2M29A 2BL0C 1WY9A 1PRWA 3CWGA 2KHNA 2BL0B 4FTGA 1C3ZA 3R1PA 3I5HB 1CNPA 1SCMB 2L98A 3L47A 2L2CA 1CFFA 1LA0A 5I94A 3V2LA 2H8VA 4GFTA 2LC5A 3CZ2A 1RROA 4PCWA 3O6BA 1N0YA 1ZFSA 2MAZA 2LHLA 3BJHA 3ICBA 2LVVA 2HETA 5J3XA 4CPVA 1B7TZ 5B8IB 2WORA 1PSRA 2ZNEA 1Y1UA 1RJVA 1S6JA 3BYAA 4E68A 2L50A 2BCAA 2HQWA 4AQJA 3TDUA 3CTNA 3LL8B 1J7RA 4XJKA 1TIZA 4P2YB 1IJ5A 4OVNF 3FWCA 5CPVA 4MZJA 1F71A 2JPTA 2K7OA 2LV7A 4FQTA 4P5OE 1DELA 2ZN8A 1CFPA 3RM1A 1XA5A 2I7AA 5PALA 1WRKA 2FJYA 5JOLA 1FI6A 1UUSA 1ZACA 2BE4A 1SMGA 4JPZB 3DVMA 2QEHA 1MF8B 3WHTB 1XYDA 4Q04A 3FWBA 1MQ1A 1IWQA 2WOSA 1DQEA 1ALWA 1NP8A 2F3ZA 1KK8C 2KYFA 2YGUA 1KQMB 2Y1MA 3KF9A 2NLNA 4DCKA 3VROA 1OMDA 1KQVA 1K9KA 1QWVA 1OMVA 3HX4A 2JZIA 2I94A 2ZFDA 3CZ1A 5G08A 3EK8A 3PM2A 1JC2A 1DC1A 1UHKA 2ISDA 2LCPA 1K90D 1QV1A 5HLVA 2BE6A 3D10A 3IQQA 1S5GY 5HKZA 2KNEA 1M46A 3SIAA 4C0JA 1QX2A 1DGUA 2GV5A 1ORGA 3OB2B 3PJIA 2LAPA 1A4PA 1SY9A 1SW8A 3PSRA 1KSMA 4MZLA 2BBMA 1JSAA 3VRPA 2L5YA 2KQ6A 3SJSA 1GGWA 3EK7A 2M1UA 4NDDA 3S0GA 2L4IA 1PVAA 1FPWA 3SS4A 2ZN9A 1OOHA 3CYZA 4F0ZB 1OW4A 1PULA 1LINA 1YVLA 3DY9A 1DJXA 5FI2A 3SS5A 4XJKB 3I5FB 1NX1A 1WLZA 1CLMA 1RFJA 1YUTA 1ODBA 4C0KA 4MRYA 1DF0B 4PHJA 5I2LA 1R6PA 1UP5A 2M7LA 5AEQA 4PE4A 1KWOC 1DEKA 5GQQC 4L9MA 1JFJA 3NXAA 1TNPA 1M39A 1CFCA 5BPJA 2K8MB 4CLNA 2LUXA 2Y4QA 3IF7A 3JVTC 1C3YA 5JJGA 1GJYA 4A4CA 2OS8B 1S3PA 2PYQA 2WC6A 3CABA 1TNQA 3CR2A 3EKHA 4MZKA 1G33A 3BUNB 1TCOB 4U8DA 3UO9A 2LVJA 2PMYA 3CR5X 1KFXL 2I2RE 3GOFA 2KI6D 3E3RA 3JTDC 1DF0A 4YI8A 1CDNA 1SL8A 1PK0D 1CMGA 2KYCA 1B8CA 3OHMB 1EG4A 3PALA 1Y0VH 4YGBB 2HF5A 3LK0A 1NWDA 3FE9A 3A8RA 3KO0A 2PVBA 4PHNA 3DVJA 1SK6D 2JXCA 1YR5A 3K1EA 3PFVA 1LS8A 3BXKA 4OR9B 4ORBB 5DKQA 3MSEB 3S0DA 1IH0A 1SCMC 5CSFA 3TUYB 1M31A 1A2XA 1FBVA 3R1OA 1P28A 1E8AA 1XFVO 3OGNA 1KSOA 1DTLA 1AUIB 1KFUL 1R2UA 5TNCA 1PSBA 1CTRA 1SR6B 2KLDA 1TN4A 1QASA 2KBMA 4QJ3B 4R1EA 2RGIA 3DF0A 4AQIA 3IQOA 1QVIZ 2F3YA 2Y5IA 2KDHA 4YGEB 4YGAA 1YX7A 1B9AA 2KSPA 2QEOA 1ZUZA 2LHIA 3L4AA 1QS7A 1NUBA 1RK9A 3DYEA 1LA3A 2KQYA 1A03A 3S0AA 3DVEA 2BKIB 3PN7C 4MVFA 2KAYA 1CM4A 5DKNA 4AOMA 1TTXA 2JC2A 2CCMA 4MLWA 2BNXA 2KGRA 3SG4A 2EC6B 2HPSA 2Y1NA 1XK4A 5K89A 1CLBA 2PALA 2FJUB 1JF2A 1UURA 2EC6C 1KQMC 2ZRSA 3SIBA 3TDIA 2WCJA 3R72A 3NHTA 1A75B 1JF0A 2JULA 2E6WA 2F33A 2WCHA 1OOFA 3ZWHA 1D1OA 1H8BA 1MXEA 1WDCC 3CS1A 2K60A 4CFRA 3I5FC 1F4QA 4PHKA 2BAPA 1W9ZA 2BKHB 1TUJA 1SR6C 3NSKA 2GTEA 1NX2A 1MUXA 5HKYA 3CZTX 3JVTB 3VB1A 1PVBA 3ZNIA 2MLEC 5DKRA 1AP4A 1QIVA 1BU3A 3NGVA 4MSPA 1DJZA 4I5KA 4YGCB 1F8HA 2EGDA 2K7BA 2CT9A 3VRRA 1WLMA 1Y1AA 2DOQA 1TNXA 2FCDA 1CM1A 3PLFB 3FIAA 1AJ5A 1U5IB 2H2KA 3GK2A 3O4YA 1BODA 1NCXA 1K96A 4CFQA 3RLZA 2LMUA 3DVKA 1BG1A 1BR4B 5HL1A 2L2EA 4PDZA 3SG3A 4JKTA 5D3OA 2WC5A 2GGMA 1KK8B 1YUUA 1NCZA 2P6BB 1VRKA 1IKUA 3OBVA 2KLEA 1UHIA 4N1FA 4WRIA 1AVSA 2OTGC 2K0JA 2LLSA 1EJ3A 2KFHA 1XFWO 1F54A 1K94A 3FS7A 2TN4A 2M3WA 1QLKA 1SNLA 1V1GA 2OS8C 4MN0A 1DJGA 4YRUA 2F8PA 3OX6A 5I2OA 1B1GA 1KFUS 2K61A 2ZNDA 1WRZA 1KK7Y 1BR1B 1RWYA 2JOJA 3EVVA 3O2PA 1J7OA 1GQMA 1OOGA 4BY5A 1QIWA 5HLOA 1NIWA 1XFUO 1WRLA 2M1KB 4OZDA 4PT1A 2M0RA 3DD4A 3HCMA 2KI6C 3D76A 1K2HA 1UHNA 1SRAA 1GGZA 2JWWA 2JNXA 4FQOA 3WNXB 1SBJA 1Y1XA 2ERBA 1ZOTB 2I18A 4GGNA 2WCEA 4WQ2A 2P71A 4JD9A 1YTZC 4OKHA 1XFZO 1J55A 1S26D 1Z4HA 4A4BA 2CBLA 1LVCD 3BQ3A 3D74A 2KI4C 3NSOA 1F70A 1XVJA 1B47A 4HRHA 1MXLC 1KFXS 2QDIA 1WDCB 1K9PA 3AAKA 4PE0A 3GK4X 2F2OA 1FI5A 1S6IA 2JPOA 3D77A 3DXLA 4IL1A 3M0WA 5IBWA 1J7PA 1RECA 2WCLA 3B86A 3PATA 2GGZA 4PHMA 3KEVA 1BJFA 3UNWA 5ER5A 1YRTB 2Q4UA
chains in the Genus database with same CATH topology
1IJ6A 4JWQA 3VRNA 3CGAA 1SL7A 4XYNA 1NYAA 2LVKA 1V1FA 1MR8A 3K21A 2JTZA 2LE9B 2IS9A 2PSRA 3SG6A 2SASA 4MBEA 3BOWB 1BT6A 1DJWA 1OZSA 2AUCA 2V53A 3EVUA 4YI9A 1JUOA 4MEWA 1J1DA 1S1EA 1FW4A 4DS7A 3BUMB 1CLLA 1OSAA 3OX5A 2K2AA 1FF1A 1LXFC 3AAJA 1K8UA 1AJ4A 3BUOB 1K95A 1RTP1 2LP3A 3KHEA 1L2OC 2LLTA 1B8LA 5CSJA 5ER4X 1YX8A 2JTTA 4YBHB 3D0YB 4WQ3A 1NX3A 2LM5A 1L7ZA 1H4BA 2SCPA 1U5IA 3H4SE 1CMFA 1NSHA 1M45A 1QX5B 1C7WA 1NX0A 1UWOA 4I5LB 2L51A 1TCFA 1UHJA 4C0LA 2MBXA 1M63B 2M49B 1YUSA 1AK8A 2BCBA 1F55A 2AAOA 1S5GZ 4ICBA 2KOTA 4N1GA 3TS5B 2JNFA 1HQVA 5AERA 5I2QA 2AMIA 1K93D 1J7QA 4M2PA 1SL9A 2K2FA 2E30A 3I5HC 5HKWA 2JU0A 4PALA 1XK4C 2WCBA 4YGDB 3C1VA 1CKKA 5D7FA 4GNKB 4NDCA 2M7NA 3CLNA 1X02A 1CDPA 3GK1A 1XO5A 1A29A 2L5XB 1EXRA 1PALA 3AKBA 4ORCB 5AXIA 1OMRA 4ETOA 2FOTA 3KPXA 3VRQA 1TOPA 1JBAA 3PM8A 1B7TY 4CIDA 1QATA 1KWOB 2BBNA 4DUQA 2VRGA 2KAVA 2LNKA 4QJ4B 4BY4A 1IQ3A 1S36A 1BF5A 2PRUA 3I5GB 4GGFA 2JT0A 1DMOA 3SG7A 1QVIY 1C7VA 2FCEA 1S6CA 1C07A 1L2OB 1ZMZA 4DRWA 3NSLA 1G4YR 2MHHA 1DJYA 1YURA 2QPTA 1UHHA 2NCOA 4NQGA 4ZCUA 1CB1A 2KAXA 1W7JB 2G9BA 1J1EA 1SYMA 4OV2A 3SG2A 1QJTA 2LANA 2KFGA 4USLA 1OQPA 2ZKMX 3TUYC 3TS5C 4GBAA 4GUKA 2NZ0A 5F6TA 3LCPC 3A4UB 1SCVA 3TDZA 5CSIA 1TNWA 1EG3A 4GAOA 2JT8A 2K7DA 1AHRA 1ALVA 2L4HA 4I5JA 4HSZA 4N5XA 3BUWB 2WC8A 4D1EA 3EK4A 2JT3A 5KU1A 1XFXO 1IGVA 1N2DA 2JQ6A 3SG5A 3JTDB 1NPQA 4UPGA 1MHOA 1SKTA 1F4OA 1XFYO 2R2IA 3BOWA 3LLEA 2G2BA 1LKJA 2JXLA 2L0PA 2BCXA 3F45A 2EHBA 1BOCA 2QACA 1KCYA 1DVIA 1OZOA 1Y6WA 2MA2A 4ORAB 2BECA 1QTXA 2F2PA 1IQ5A 2LUCA 5AFPA 2CTNA 2Q91A 3OB1B 4HREE 2H61A 3WHUB 4DIRA 1CDLA 2OTGB 3EVRA 1NCYA 1OE9B 4TNCA 2COLB 1N65A 1SPYA 2WCFA 1W7IB 2A4JA 4OCIA 1JWDA 3I5IC 5CSNA 1DJIA 1MWNA 3CR4X 1KK7Z 2CXJA 1DGVA 2MRDA 3DF0B 1BMOA 1OOJA 2WNDA 4GGFC 2D8NA 2LVIA 1YVHA 3LK1A 4PE7A 2M97A 5KTYA 2CNPA 3PN7B 2KGBC 3WXAA 2K7CA 4PE1A 4M2OA 3TZ1A 1B8RA 2M8UA 2OPOA 1F8HA 4HRGA 3O78A 2KBIA 5HYDA 3OP0A 2MLFC 3BUXB 1IG5A 5KSZA 2MJWB 1TRFA 3D0YA 1HT9A 1EL4A 1G8IA 1EH2A 1DJHA 1QLSA 2KI4B 3VGOA 4M2QA 1CDMA 4GPLB 4I5NB 2LMVA 3EKJA 2LMTA 2M9GA 3AKAA 1QX7A 1Q80A 3I5GC 1BLQA 2B1UA 4NDBA 1IRJA 2ZRTA 3NSIA 2KFFA 1B4CA 3I5IB 2NXQA 1K9UA 2H61C 5AANA 2PASA 1QV0A 1A75A 4MRXA 2NCPA 5FYXA 4ZCVA 3QRXA 2JRFA 4JQ0D 2LP2A 2O60A 5D69A 1JFKA 2O5GA 5I8NA 2HQ8A 2LLUA 1DT7B 4QJ5B 1YRUB 1CFDA 1QXPA 2M29A 2BL0C 1WY9A 1PRWA 3CWGA 2KHNA 2BL0B 4FTGA 3I5HB 1CNPA 1SCMB 2L98A 1CFFA 1LA0A 4GFTA 2LC5A 1RROA 4PCWA 3O6BA 1N0YA 1ZFSA 2MAZA 2LHLA 3ICBA 5J3XA 2LVVA 2HETA 4CPVA 5B8IB 1B7TZ 2WORA 1PSRA 2ZNEA 1Y1UA 1RJVA 1S6JA 3BYAA 4E68A 2L50A 2BCAA 2HQWA 4AQJA 3TDUA 3CTNA 3LL8B 1J7RA 4XJKA 1TIZA 4P2YB 1IJ5A 4OVNF 3FWCA 5CPVA 4MZJA 1F71A 2JPTA 2K7OA 2LV7A 4P5OE 1CFPA 2ZN8A 3RM1A 1XA5A 2I7AA 5PALA 1WRKA 5JOLA 1FI6A 1UUSA 1ZACA 2BE4A 1SMGA 4JPZB 3DVMA 1MF8B 3WHTB 1XYDA 4Q04A 3FWBA 1MQ1A 1IWQA 2WOSA 1ALWA 1NP8A 2F3ZA 1KK8C 2KYFA 1KQMB 2Y1MA 3KF9A 2NLNA 4DCKA 3VROA 1OMDA 1KQVA 1K9KA 1OMVA 3HX4A 2JZIA 2I94A 2ZFDA 5G08A 3EK8A 1JC2A 1UHKA 2ISDA 2LCPA 1K90D 1QV1A 5HLVA 2BE6A 3D10A 3IQQA 1S5GY 5HKZA 2KNEA 1M46A 3SIAA 4C0JA 1QX2A 1DGUA 2GV5A 3OB2B 2LAPA 1A4PA 1SY9A 1SW8A 3PSRA 1KSMA 4MZLA 2BBMA 1JSAA 3VRPA 2KQ6A 3SJSA 1GGWA 3EK7A 2M1UA 4NDDA 2L4IA 1PVAA 1FPWA 2ZN9A 4F0ZB 1PULA 1LINA 1YVLA 1DJXA 4XJKB 3I5FB 1NX1A 1WLZA 1CLMA 1RFJA 1YUTA 1ODBA 4C0KA 4MRYA 1DF0B 4PHJA 5I2LA 1R6PA 1UP5A 2M7LA 5AEQA 4PE4A 1KWOC 5GQQC 4L9MA 1JFJA 3NXAA 1TNPA 1M39A 1CFCA 5BPJA 2K8MB 4CLNA 2LUXA 2Y4QA 3IF7A 3JVTC 5JJGA 1GJYA 4A4CA 2OS8B 1S3PA 1TNQA 3CR2A 3EKHA 4MZKA 1G33A 3BUNB 1TCOB 4U8DA 2LVJA 2PMYA 3CR5X 1KFXL 2I2RE 3GOFA 2KI6D 3E3RA 3JTDC 1DF0A 4YI8A 1CDNA 1SL8A 1PK0D 1CMGA 2KYCA 1B8CA 3OHMB 1EG4A 3PALA 1Y0VH 4YGBB 2HF5A 3LK0A 1NWDA 3A8RA 3KO0A 2PVBA 4PHNA 3DVJA 1SK6D 2JXCA 1YR5A 3PFVA 4ORBB 3BXKA 4OR9B 5DKQA 1IH0A 3MSEB 1SCMC 5CSFA 3TUYB 1M31A 1A2XA 1FBVA 1E8AA 1XFVO 1KSOA 1DTLA 1AUIB 1KFUL 1R2UA 5TNCA 1PSBA 1CTRA 1SR6B 4R1EA 1TN4A 1QASA 2KBMA 4QJ3B 2RGIA 3DF0A 4AQIA 3IQOA 1QVIZ 2F3YA 2Y5IA 2KDHA 4YGEB 4YGAA 1YX7A 1B9AA 2KSPA 1ZUZA 2LHIA 1QS7A 1NUBA 1RK9A 1LA3A 2KQYA 1A03A 3DVEA 2BKIB 3PN7C 4MVFA 2KAYA 1CM4A 5DKNA 4AOMA 1TTXA 2JC2A 2CCMA 4MLWA 2KGRA 3SG4A 2EC6B 2HPSA 2Y1NA 1XK4A 5K89A 1CLBA 2PALA 2FJUB 1JF2A 1UURA 2EC6C 1KQMC 2ZRSA 3SIBA 3TDIA 1A75B 1JF0A 2JULA 2E6WA 2F33A 3ZWHA 1D1OA 1H8BA 1MXEA 1WDCC 3CS1A 4CFRA 3I5FC 1F4QA 4PHKA 2BKHB 1SR6C 3NSKA 1NX2A 1MUXA 5HKYA 3CZTX 3JVTB 1PVBA 3ZNIA 2MLEC 5DKRA 1AP4A 1QIVA 1BU3A 4MSPA 1DJZA 4I5KA 4YGCB 2EGDA 2K7BA 2CT9A 3VRRA 1WLMA 1Y1AA 2DOQA 1TNXA 2FCDA 1CM1A 3PLFB 3FIAA 1AJ5A 1U5IB 2H2KA 3GK2A 3O4YA 1BODA 1NCXA 1K96A 4CFQA 3RLZA 2LMUA 3DVKA 1BG1A 1BR4B 2L2EA 4PDZA 3SG3A 2GGMA 1KK8B 1YUUA 1NCZA 2P6BB 1VRKA 1IKUA 1UHIA 4N1FA 4WRIA 1AVSA 2OTGC 2K0JA 2LLSA 1EJ3A 2KFHA 1XFWO 1F54A 1K94A 3FS7A 2TN4A 2M3WA 1QLKA 1SNLA 1V1GA 2OS8C 4MN0A 1DJGA 4YRUA 2F8PA 3OX6A 5I2OA 1B1GA 1KFUS 2K61A 2ZNDA 1WRZA 1KK7Y 1BR1B 1RWYA 2JOJA 3EVVA 3O2PA 1J7OA 1GQMA 4BY5A 1QIWA 5HLOA 1NIWA 1XFUO 1WRLA 2M1KB 2M0RA 3DD4A 3HCMA 2KI6C 1K2HA 1UHNA 1SRAA 1GGZA 2JWWA 2JNXA 4FQOA 3WNXB 1SBJA 1Y1XA 4GGNA 1ZOTB 2I18A 4WQ2A 2WCEA 1YTZC 4OKHA 1XFZO 1J55A 1S26D 4A4BA 2CBLA 1LVCD 3BQ3A 3NSOA 2KI4C 1F70A 1XVJA 1B47A 4HRHA 1MXLC 1KFXS 1WDCB 1K9PA 3AAKA 4PE0A 3GK4X 2F2OA 1FI5A 1S6IA 4IL1A 3M0WA 5IBWA 1J7PA 1RECA 3PATA 2GGZA 4PHMA 3KEVA 1BJFA 5ER5A 1YRTB 2Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ6 A;  4JWQ A;  3VRN A;  3CGA A;  1SL7 A;  4XYN A;  1NYA A;  2LVK A;  1V1F A;  1MR8 A;  3K21 A;  2JTZ A;  2LE9 B;  2IS9 A;  2PSR A;  3SG6 A;  2SAS A;  4MBE A;  3BOW B;  1BT6 A;  1DJW A;  1OZS A;  2AUC A;  2V53 A;  3EVU A;  4YI9 A;  1JUO A;  4MEW A;  1J1D A;  1S1E A;  1FW4 A;  4DS7 A;  3BUM B;  1CLL A;  1OSA A;  3OX5 A;  2K2A A;  1FF1 A;  1LXF C;  3AAJ A;  1K8U A;  1AJ4 A;  3BUO B;  1K95 A;  1RTP 1;  2LP3 A;  3KHE A;  1L2O C;  2LLT A;  1B8L A;  5CSJ A;  5ER4 X;  1YX8 A;  2JTT A;  4YBH B;  3D0Y B;  4WQ3 A;  1NX3 A;  2LM5 A;  1L7Z A;  1H4B A;  2SCP A;  1U5I A;  3H4S E;  1CMF A;  1NSH A;  1M45 A;  1QX5 B;  1C7W A;  1NX0 A;  1UWO A;  4I5L B;  2L51 A;  1TCF A;  1UHJ A;  4C0L A;  2MBX A;  1M63 B;  2M49 B;  1YUS A;  1AK8 A;  2BCB A;  1F55 A;  2AAO A;  1S5G Z;  4ICB A;  2KOT A;  4N1G A;  3TS5 B;  2JNF A;  1HQV A;  5AER A;  5I2Q A;  2AMI A;  1K93 D;  1J7Q A;  4M2P A;  1SL9 A;  2K2F A;  2E30 A;  3I5H C;  5HKW A;  2JU0 A;  4PAL A;  1XK4 C;  2WCB A;  4YGD B;  3C1V A;  1CKK A;  5D7F A;  4GNK B;  4NDC A;  2M7N A;  3CLN A;  1X02 A;  1CDP A;  3GK1 A;  1XO5 A;  1A29 A;  2L5X B;  1EXR A;  1PAL A;  3AKB A;  4ORC B;  5AXI A;  1OMR A;  4ETO A;  2FOT A;  3KPX A;  3VRQ A;  1TOP A;  1JBA A;  3PM8 A;  1B7T Y;  4CID A;  1QAT A;  1KWO B;  2BBN A;  4DUQ A;  2VRG A;  2KAV A;  2LNK A;  4QJ4 B;  4BY4 A;  1IQ3 A;  1S36 A;  1BF5 A;  2PRU A;  3I5G B;  4GGF A;  2JT0 A;  1DMO A;  3SG7 A;  1QVI Y;  1C7V A;  2FCE A;  1S6C A;  1C07 A;  1L2O B;  1ZMZ A;  4DRW A;  3NSL A;  1G4Y R;  2MHH A;  1DJY A;  1YUR A;  2QPT A;  1UHH A;  2NCO A;  4NQG A;  4ZCU A;  1CB1 A;  2KAX A;  1W7J B;  2G9B A;  1J1E A;  1SYM A;  4OV2 A;  3SG2 A;  1QJT A;  2LAN A;  2KFG A;  4USL A;  1OQP A;  2ZKM X;  3TUY C;  3TS5 C;  4GBA A;  4GUK A;  2NZ0 A;  5F6T A;  3LCP C;  3A4U B;  1SCV A;  3TDZ A;  5CSI A;  1TNW A;  1EG3 A;  4GAO A;  2JT8 A;  2K7D A;  1AHR A;  1ALV A;  2L4H A;  4I5J A;  4HSZ A;  4N5X A;  3BUW B;  2WC8 A;  4D1E A;  3EK4 A;  2JT3 A;  5KU1 A;  1XFX O;  1IGV A;  1N2D A;  2JQ6 A;  3SG5 A;  3JTD B;  1NPQ A;  4UPG A;  1MHO A;  1SKT A;  1F4O A;  1XFY O;  2R2I A;  3BOW A;  3LLE A;  2G2B A;  1LKJ A;  2JXL A;  2L0P A;  2BCX A;  3F45 A;  2EHB A;  1BOC A;  2QAC A;  1KCY A;  1DVI A;  1OZO A;  1Y6W A;  2MA2 A;  4ORA B;  2BEC A;  1QTX A;  2F2P A;  1IQ5 A;  2LUC A;  5AFP A;  2CTN A;  2Q91 A;  3OB1 B;  4HRE E;  2H61 A;  3WHU B;  4DIR A;  1CDL A;  2OTG B;  3EVR A;  1NCY A;  1OE9 B;  4TNC A;  2COL B;  1N65 A;  1SPY A;  2WCF A;  1W7I B;  2A4J A;  4OCI A;  1JWD A;  3I5I C;  5CSN A;  1DJI A;  1MWN A;  3CR4 X;  1KK7 Z;  2CXJ A;  1DGV A;  2MRD A;  3DF0 B;  1BMO A;  1OOJ A;  2WND A;  4GGF C;  2D8N A;  2LVI A;  1YVH A;  3LK1 A;  4PE7 A;  2M97 A;  5KTY A;  2CNP A;  3PN7 B;  2KGB C;  3WXA A;  2K7C A;  4PE1 A;  4M2O A;  3TZ1 A;  1B8R A;  2M8U A;  2OPO A;  1F8H A;  4HRG A;  3O78 A;  2KBI A;  5HYD A;  3OP0 A;  2MLF C;  3BUX B;  1IG5 A;  5KSZ A;  2MJW B;  1TRF A;  3D0Y A;  1HT9 A;  1EL4 A;  1G8I A;  1EH2 A;  1DJH A;  1QLS A;  2KI4 B;  3VGO A;  4M2Q A;  1CDM A;  4GPL B;  4I5N B;  2LMV A;  3EKJ A;  2LMT A;  2M9G A;  3AKA A;  1QX7 A;  1Q80 A;  3I5G C;  1BLQ A;  2B1U A;  4NDB A;  1IRJ A;  2ZRT A;  3NSI A;  2KFF A;  1B4C A;  3I5I B;  2NXQ A;  1K9U A;  2H61 C;  5AAN A;  2PAS A;  1QV0 A;  1A75 A;  4MRX A;  2NCP A;  5FYX A;  4ZCV A;  3QRX A;  2JRF A;  4JQ0 D;  2LP2 A;  2O60 A;  5D69 A;  1JFK A;  2O5G A;  5I8N A;  2HQ8 A;  2LLU A;  1DT7 B;  4QJ5 B;  1YRU B;  1CFD A;  1QXP A;  2M29 A;  2BL0 C;  1WY9 A;  1PRW A;  3CWG A;  2KHN A;  2BL0 B;  4FTG A;  3I5H B;  1CNP A;  1SCM B;  2L98 A;  1CFF A;  1LA0 A;  4GFT A;  2LC5 A;  1RRO A;  4PCW A;  3O6B A;  1N0Y A;  1ZFS A;  2MAZ A;  2LHL A;  3ICB A;  5J3X A;  2LVV A;  2HET A;  4CPV A;  5B8I B;  1B7T Z;  2WOR A;  1PSR A;  2ZNE A;  1Y1U A;  1RJV A;  1S6J A;  3BYA A;  4E68 A;  2L50 A;  2BCA A;  2HQW A;  4AQJ A;  3TDU A;  3CTN A;  3LL8 B;  1J7R A;  4XJK A;  1TIZ A;  4P2Y B;  1IJ5 A;  4OVN F;  3FWC A;  5CPV A;  4MZJ A;  1F71 A;  2JPT A;  2K7O A;  2LV7 A;  4P5O E;  1CFP A;  2ZN8 A;  3RM1 A;  1XA5 A;  2I7A A;  5PAL A;  1WRK A;  5JOL A;  1FI6 A;  1UUS A;  1ZAC A;  2BE4 A;  1SMG A;  4JPZ B;  3DVM A;  1MF8 B;  3WHT B;  1XYD A;  4Q04 A;  3FWB A;  1MQ1 A;  1IWQ A;  2WOS A;  1ALW A;  1NP8 A;  2F3Z A;  1KK8 C;  2KYF A;  1KQM B;  2Y1M A;  3KF9 A;  2NLN A;  4DCK A;  3VRO A;  1OMD A;  1KQV A;  1K9K A;  1OMV A;  3HX4 A;  2JZI A;  2I94 A;  2ZFD A;  5G08 A;  3EK8 A;  1JC2 A;  1UHK A;  2ISD A;  2LCP A;  1K90 D;  1QV1 A;  5HLV A;  2BE6 A;  3D10 A;  3IQQ A;  1S5G Y;  5HKZ A;  2KNE A;  1M46 A;  3SIA A;  4C0J A;  1QX2 A;  1DGU A;  2GV5 A;  3OB2 B;  2LAP A;  1A4P A;  1SY9 A;  1SW8 A;  3PSR A;  1KSM A;  4MZL A;  2BBM A;  1JSA A;  3VRP A;  2KQ6 A;  3SJS A;  1GGW A;  3EK7 A;  2M1U A;  4NDD A;  2L4I A;  1PVA A;  1FPW A;  2ZN9 A;  4F0Z B;  1PUL A;  1LIN A;  1YVL A;  1DJX A;  4XJK B;  3I5F B;  1NX1 A;  1WLZ A;  1CLM A;  1RFJ A;  1YUT A;  1ODB A;  4C0K A;  4MRY A;  1DF0 B;  4PHJ A;  5I2L A;  1R6P A;  1UP5 A;  2M7L A;  5AEQ A;  4PE4 A;  1KWO C;  5GQQ C;  4L9M A;  1JFJ A;  3NXA A;  1TNP A;  1M39 A;  1CFC A;  5BPJ A;  2K8M B;  4CLN A;  2LUX A;  2Y4Q A;  3IF7 A;  3JVT C;  5JJG A;  1GJY A;  4A4C A;  2OS8 B;  1S3P A;  1TNQ A;  3CR2 A;  3EKH A;  4MZK A;  1G33 A;  3BUN B;  1TCO B;  4U8D A;  2LVJ A;  2PMY A;  3CR5 X;  1KFX L;  2I2R E;  3GOF A;  2KI6 D;  3E3R A;  3JTD C;  1DF0 A;  4YI8 A;  1CDN A;  1SL8 A;  1PK0 D;  1CMG A;  2KYC A;  1B8C A;  3OHM B;  1EG4 A;  3PAL A;  1Y0V H;  4YGB B;  2HF5 A;  3LK0 A;  1NWD A;  3A8R A;  3KO0 A;  2PVB A;  4PHN A;  3DVJ A;  1SK6 D;  2JXC A;  1YR5 A;  3PFV A;  4ORB B;  3BXK A;  4OR9 B;  5DKQ A;  1IH0 A;  3MSE B;  1SCM C;  5CSF A;  3TUY B;  1M31 A;  1A2X A;  1FBV A;  1E8A A;  1XFV O;  1KSO A;  1DTL A;  1AUI B;  1KFU L;  1R2U A;  5TNC A;  1PSB A;  1CTR A;  1SR6 B;  4R1E A;  1TN4 A;  1QAS A;  2KBM A;  4QJ3 B;  2RGI A;  3DF0 A;  4AQI A;  3IQO A;  1QVI Z;  2F3Y A;  2Y5I A;  2KDH A;  4YGE B;  4YGA A;  1YX7 A;  1B9A A;  2KSP A;  1ZUZ A;  2LHI A;  1QS7 A;  1NUB A;  1RK9 A;  1LA3 A;  2KQY A;  1A03 A;  3DVE A;  2BKI B;  3PN7 C;  4MVF A;  2KAY A;  1CM4 A;  5DKN A;  4AOM A;  1TTX A;  2JC2 A;  2CCM A;  4MLW A;  2KGR A;  3SG4 A;  2EC6 B;  2HPS A;  2Y1N A;  1XK4 A;  5K89 A;  1CLB A;  2PAL A;  2FJU B;  1JF2 A;  1UUR A;  2EC6 C;  1KQM C;  2ZRS A;  3SIB A;  3TDI A;  1A75 B;  1JF0 A;  2JUL A;  2E6W A;  2F33 A;  3ZWH A;  1D1O A;  1H8B A;  1MXE A;  1WDC C;  3CS1 A;  4CFR A;  3I5F C;  1F4Q A;  4PHK A;  2BKH B;  1SR6 C;  3NSK A;  1NX2 A;  1MUX A;  5HKY A;  3CZT X;  3JVT B;  1PVB A;  3ZNI A;  2MLE C;  5DKR A;  1AP4 A;  1QIV A;  1BU3 A;  4MSP A;  1DJZ A;  4I5K A;  4YGC B;  2EGD A;  2K7B A;  2CT9 A;  3VRR A;  1WLM A;  1Y1A A;  2DOQ A;  1TNX A;  2FCD A;  1CM1 A;  3PLF B;  3FIA A;  1AJ5 A;  1U5I B;  2H2K A;  3GK2 A;  3O4Y A;  1BOD A;  1NCX A;  1K96 A;  4CFQ A;  3RLZ A;  2LMU A;  3DVK A;  1BG1 A;  1BR4 B;  2L2E A;  4PDZ A;  3SG3 A;  2GGM A;  1KK8 B;  1YUU A;  1NCZ A;  2P6B B;  1VRK A;  1IKU A;  1UHI A;  4N1F A;  4WRI A;  1AVS A;  2OTG C;  2K0J A;  2LLS A;  1EJ3 A;  2KFH A;  1XFW O;  1F54 A;  1K94 A;  3FS7 A;  2TN4 A;  2M3W A;  1QLK A;  1SNL A;  1V1G A;  2OS8 C;  4MN0 A;  1DJG A;  4YRU A;  2F8P A;  3OX6 A;  5I2O A;  1B1G A;  1KFU S;  2K61 A;  2ZND A;  1WRZ A;  1KK7 Y;  1BR1 B;  1RWY A;  2JOJ A;  3EVV A;  3O2P A;  1J7O A;  1GQM A;  4BY5 A;  1QIW A;  5HLO A;  1NIW A;  1XFU O;  1WRL A;  2M1K B;  2M0R A;  3DD4 A;  3HCM A;  2KI6 C;  1K2H A;  1UHN A;  1SRA A;  1GGZ A;  2JWW A;  2JNX A;  4FQO A;  3WNX B;  1SBJ A;  1Y1X A;  4GGN A;  1ZOT B;  2I18 A;  4WQ2 A;  2WCE A;  1YTZ C;  4OKH A;  1XFZ O;  1J55 A;  1S26 D;  4A4B A;  2CBL A;  1LVC D;  3BQ3 A;  3NSO A;  2KI4 C;  1F70 A;  1XVJ A;  1B47 A;  4HRH A;  1MXL C;  1KFX S;  1WDC B;  1K9P A;  3AAK A;  4PE0 A;  3GK4 X;  2F2O A;  1FI5 A;  1S6I A;  4IL1 A;  3M0W A;  5IBW A;  1J7P A;  1REC A;  3PAT A;  2GGZ A;  4PHM A;  3KEV A;  1BJF A;  5ER5 A;  1YRT B;  2Q4U A; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  4JWQ A;  3VRN A;  3CGA A;  1SL7 A;  4XYN A;  1NYA A;  2LVK A;  1V1F A;  4F7F A;  1MR8 A;  3FE6 A;  3K21 A;  2JTZ A;  2LE9 B;  2IS9 A;  2PSR A;  3SG6 A;  2SAS A;  4MBE A;  3BOW B;  1BT6 A;  1DJW A;  1OZS A;  2AUC A;  2V53 A;  3EVU A;  1T14 A;  4YI9 A;  1JUO A;  4MEW A;  1J1D A;  1S1E A;  1FW4 A;  4DS7 A;  3BUM B;  1CLL A;  1OSA A;  3B87 A;  3OX5 A;  2K2A A;  1FF1 A;  1LXF C;  3AAJ A;  1AJ4 A;  1K8U A;  3BUO B;  1K95 A;  1RTP 1;  2LP3 A;  3D75 A;  3KHE A;  1L2O C;  2LLT A;  1B8L A;  3EG5 B;  5CSJ A;  5ER4 X;  1YX8 A;  2JTT A;  4YBH B;  3D0Y B;  4WQ3 A;  1NX3 A;  2LM5 A;  1L7Z A;  4INW A;  1H4B A;  2SCP A;  1U5I A;  3BFH A;  3H4S E;  1NSH A;  1M45 A;  1CMF A;  3RZS A;  2WCM A;  3CDN A;  1QX5 B;  1C7W A;  1NX0 A;  1UWO A;  4I5L B;  2L51 A;  1TCF A;  1UHJ A;  4C0L A;  2MBX A;  1M63 B;  2M49 B;  1YUS A;  1AK8 A;  2BCB A;  1F55 A;  2AAO A;  3R1V A;  1S5G Z;  4ICB A;  2KOT A;  4N1G A;  3TS5 B;  2JNF A;  3CZ0 A;  1HQV A;  5AER A;  5I2Q A;  2AMI A;  1K93 D;  1J7Q A;  4M2P A;  1SL9 A;  2K2F A;  2E30 A;  3I5H C;  5HKW A;  2JU0 A;  4PAL A;  1XK4 C;  2WCB A;  4YGD B;  3C1V A;  3FE8 A;  1CKK A;  5D7F A;  4GNK B;  4NDC A;  2M7N A;  3CLN A;  1X02 A;  3BFA A;  1CDP A;  3GK1 A;  1XO5 A;  1A29 A;  2L5X B;  1EXR A;  1PAL A;  3AKB A;  4ORC B;  3NHI A;  2P70 A;  5AXI A;  1OMR A;  4ETO A;  2FOT A;  3KPX A;  3VRQ A;  1TOP A;  1JBA A;  3PM8 A;  3QME A;  1B7T Y;  4KYN A;  4CID A;  3B7A A;  1QAT A;  1KWO B;  3Q8I A;  2BBN A;  4DUQ A;  2VRG A;  2KAV A;  2LNK A;  4QJ4 B;  4BY4 A;  1IQ3 A;  1S36 A;  1BF5 A;  2PRU A;  3D78 A;  3I5G B;  4GGF A;  2JT0 A;  3B6X A;  3N7H A;  1DMO A;  3SG7 A;  2PQL A;  1QVI Y;  1C7V A;  2FCE A;  1S6C A;  5EL2 A;  1C07 A;  1L2O B;  1ZMZ A;  4DRW A;  3NSL A;  1G4Y R;  2MHH A;  1DJY A;  1YUR A;  2QPT A;  1UHH A;  2NCO A;  4NQG A;  4ZCU A;  1CB1 A;  2KAX A;  1W7J B;  2G9B A;  1J1E A;  1SYM A;  4OV2 A;  3SG2 A;  1QJT A;  2LAN A;  2KFG A;  1TWO A;  4USL A;  1OQP A;  2ZKM X;  3TUY C;  3TS5 C;  4GBA A;  4GUK A;  2NZ0 A;  5F6T A;  3LCP C;  3S0B A;  3A4U B;  1SCV A;  3TDZ A;  5CSI A;  1TNW A;  1EG3 A;  4GAO A;  2JT8 A;  2K7D A;  3BFB A;  1AHR A;  1ALV A;  2L4H A;  4I5J A;  4HSZ A;  4N5X A;  3BUW B;  2WC8 A;  1TUZ A;  4D1E A;  3EK4 A;  2JT3 A;  5KU1 A;  1XFX O;  1IGV A;  2QEV A;  1N2D A;  2JQ6 A;  3SG5 A;  3JTD B;  1NPQ A;  4UPG A;  1OOI X;  1MHO A;  1SKT A;  1F4O A;  1XFY O;  2QEB A;  2R2I A;  3SS3 A;  1IIO A;  3S0E A;  3BOW A;  3D73 A;  3LLE A;  2G2B A;  1LKJ A;  2JXL A;  2L0P A;  2BCX A;  3F45 A;  2EHB A;  1BOC A;  2QAC A;  1KCY A;  1DVI A;  1OZO A;  1Y6W A;  2MA2 A;  4ORA B;  2BEC A;  1QTX A;  2F2P A;  1IQ5 A;  2LUC A;  5AFP A;  2CTN A;  2Q91 A;  3OB1 B;  4HRE E;  2H61 A;  3WHU B;  4DIR A;  1CDL A;  2OTG B;  3EVR A;  1NCY A;  1OE9 B;  4TNC A;  2COL B;  1N65 A;  2WCK A;  5FI7 A;  1SPY A;  1XFR A;  1W7I B;  2A4J A;  2WCF A;  3L4L A;  4IJ7 A;  4OCI A;  1JWD A;  3I5I C;  5CSN A;  1DJI A;  1MWN A;  3DZT A;  3CR4 X;  1KK7 Z;  2CXJ A;  1DGV A;  2MRD A;  2KPH A;  3DF0 B;  1BMO A;  1OOJ A;  2WND A;  4GGF C;  2D8N A;  2LVI A;  1YVH A;  1SSE B;  3LK1 A;  4PE7 A;  2M97 A;  5KTY A;  1GM0 A;  2CNP A;  3PN7 B;  2KGB C;  3WXA A;  2K7C A;  4PE1 A;  4M2O A;  3TZ1 A;  1B8R A;  2M8U A;  2OPO A;  3IVT A;  4HRG A;  3O78 A;  2KBI A;  5HYD A;  3OP0 A;  2MLF C;  3BUX B;  1IG5 A;  5KSZ A;  2MJW B;  1TRF A;  3D0Y A;  1HT9 A;  1EL4 A;  1G8I A;  1EH2 A;  1DJH A;  1QLS A;  2KI4 B;  3VGO A;  5FI6 A;  4M2Q A;  3S0F A;  1CDM A;  1Z2C B;  4GPL B;  4I5N B;  4INX A;  2LMV A;  3EKJ A;  2LMT A;  2M9G A;  3AKA A;  1QX7 A;  1Q80 A;  3I5G C;  1BLQ A;  2B1U A;  4NDB A;  1IRJ A;  2ZRT A;  3NSI A;  2KFF A;  1B4C A;  3I5I B;  2NXQ A;  1K9U A;  2H61 C;  5AAN A;  2PAS A;  1QV0 A;  1A75 A;  3B88 A;  3O4X A;  4MRX A;  2NCP A;  5FYX A;  4ZCV A;  3QRX A;  2JRF A;  4JQ0 D;  2LP2 A;  2O60 A;  5D69 A;  1JFK A;  2O5G A;  5DIC A;  2HQ8 A;  5I8N A;  2LLU A;  1DT7 B;  4QJ5 B;  1YRU B;  1CFD A;  1QXP A;  2M29 A;  2BL0 C;  1WY9 A;  1PRW A;  3CWG A;  2KHN A;  2BL0 B;  4FTG A;  1C3Z A;  3R1P A;  3I5H B;  1CNP A;  1SCM B;  2L98 A;  3L47 A;  2L2C A;  1CFF A;  1LA0 A;  5I94 A;  3V2L A;  2H8V A;  4GFT A;  2LC5 A;  3CZ2 A;  1RRO A;  4PCW A;  3O6B A;  1N0Y A;  1ZFS A;  2MAZ A;  2LHL A;  3BJH A;  3ICB A;  2LVV A;  2HET A;  5J3X A;  4CPV A;  1B7T Z;  5B8I B;  2WOR A;  1PSR A;  2ZNE A;  1Y1U A;  1RJV A;  1S6J A;  3BYA A;  4E68 A;  2L50 A;  2BCA A;  2HQW A;  4AQJ A;  3TDU A;  3CTN A;  3LL8 B;  1J7R A;  4XJK A;  1TIZ A;  4P2Y B;  1IJ5 A;  4OVN F;  3FWC A;  5CPV A;  4MZJ A;  1F71 A;  2JPT A;  2K7O A;  2LV7 A;  4FQT A;  4P5O E;  1DEL A;  2ZN8 A;  1CFP A;  3RM1 A;  1XA5 A;  2I7A A;  5PAL A;  1WRK A;  2FJY A;  5JOL A;  1FI6 A;  1UUS A;  1ZAC A;  2BE4 A;  1SMG A;  4JPZ B;  3DVM A;  2QEH A;  1MF8 B;  3WHT B;  1XYD A;  4Q04 A;  3FWB A;  1MQ1 A;  1IWQ A;  2WOS A;  1DQE A;  1ALW A;  1NP8 A;  2F3Z A;  1KK8 C;  2KYF A;  2YGU A;  1KQM B;  2Y1M A;  3KF9 A;  2NLN A;  4DCK A;  3VRO A;  1OMD A;  1KQV A;  1K9K A;  1QWV A;  1OMV A;  3HX4 A;  2JZI A;  2I94 A;  2ZFD A;  3CZ1 A;  5G08 A;  3EK8 A;  3PM2 A;  1JC2 A;  1DC1 A;  1UHK A;  2ISD A;  2LCP A;  1K90 D;  1QV1 A;  5HLV A;  2BE6 A;  3D10 A;  3IQQ A;  1S5G Y;  5HKZ A;  2KNE A;  1M46 A;  3SIA A;  4C0J A;  1QX2 A;  1DGU A;  2GV5 A;  1ORG A;  3OB2 B;  3PJI A;  2LAP A;  1A4P A;  1SY9 A;  1SW8 A;  3PSR A;  1KSM A;  4MZL A;  2BBM A;  1JSA A;  3VRP A;  2L5Y A;  2KQ6 A;  3SJS A;  1GGW A;  3EK7 A;  2M1U A;  4NDD A;  3S0G A;  2L4I A;  1PVA A;  1FPW A;  3SS4 A;  2ZN9 A;  1OOH A;  3CYZ A;  4F0Z B;  1OW4 A;  1PUL A;  1LIN A;  1YVL A;  3DY9 A;  1DJX A;  5FI2 A;  3SS5 A;  4XJK B;  3I5F B;  1NX1 A;  1WLZ A;  1CLM A;  1RFJ A;  1YUT A;  1ODB A;  4C0K A;  4MRY A;  1DF0 B;  4PHJ A;  5I2L A;  1R6P A;  1UP5 A;  2M7L A;  5AEQ A;  4PE4 A;  1KWO C;  1DEK A;  5GQQ C;  4L9M A;  1JFJ A;  3NXA A;  1TNP A;  1M39 A;  1CFC A;  5BPJ A;  2K8M B;  4CLN A;  2LUX A;  2Y4Q A;  3IF7 A;  3JVT C;  1C3Y A;  5JJG A;  1GJY A;  4A4C A;  2OS8 B;  1S3P A;  2PYQ A;  2WC6 A;  3CAB A;  1TNQ A;  3CR2 A;  3EKH A;  4MZK A;  1G33 A;  3BUN B;  1TCO B;  4U8D A;  3UO9 A;  2LVJ A;  2PMY A;  3CR5 X;  1KFX L;  2I2R E;  3GOF A;  2KI6 D;  3E3R A;  3JTD C;  1DF0 A;  4YI8 A;  1CDN A;  1SL8 A;  1PK0 D;  1CMG A;  2KYC A;  1B8C A;  3OHM B;  1EG4 A;  3PAL A;  1Y0V H;  4YGB B;  2HF5 A;  3LK0 A;  1NWD A;  3FE9 A;  3A8R A;  3KO0 A;  2PVB A;  4PHN A;  3DVJ A;  1SK6 D;  2JXC A;  1YR5 A;  3K1E A;  3PFV A;  1LS8 A;  3BXK A;  4OR9 B;  4ORB B;  5DKQ A;  3MSE B;  3S0D A;  1IH0 A;  1SCM C;  5CSF A;  3TUY B;  1M31 A;  1A2X A;  1FBV A;  3R1O A;  1P28 A;  1E8A A;  1XFV O;  3OGN A;  1KSO A;  1DTL A;  1AUI B;  1KFU L;  1R2U A;  5TNC A;  1PSB A;  1CTR A;  1SR6 B;  2KLD A;  1TN4 A;  1QAS A;  2KBM A;  4QJ3 B;  4R1E A;  2RGI A;  3DF0 A;  4AQI A;  3IQO A;  1QVI Z;  2F3Y A;  2Y5I A;  2KDH A;  4YGE B;  4YGA A;  1YX7 A;  1B9A A;  2KSP A;  2QEO A;  1ZUZ A;  2LHI A;  3L4A A;  1QS7 A;  1NUB A;  1RK9 A;  3DYE A;  1LA3 A;  2KQY A;  1A03 A;  3S0A A;  3DVE A;  2BKI B;  3PN7 C;  4MVF A;  2KAY A;  1CM4 A;  5DKN A;  4AOM A;  1TTX A;  2JC2 A;  2CCM A;  4MLW A;  2BNX A;  2KGR A;  3SG4 A;  2EC6 B;  2HPS A;  2Y1N A;  1XK4 A;  5K89 A;  1CLB A;  2PAL A;  2FJU B;  1JF2 A;  1UUR A;  2EC6 C;  1KQM C;  2ZRS A;  3SIB A;  3TDI A;  2WCJ A;  3R72 A;  3NHT A;  1A75 B;  1JF0 A;  2JUL A;  2E6W A;  2F33 A;  2WCH A;  1OOF A;  3ZWH A;  1D1O A;  1H8B A;  1MXE A;  1WDC C;  3CS1 A;  2K60 A;  4CFR A;  3I5F C;  1F4Q A;  4PHK A;  2BAP A;  1W9Z A;  2BKH B;  1TUJ A;  1SR6 C;  3NSK A;  2GTE A;  1NX2 A;  1MUX A;  5HKY A;  3CZT X;  3JVT B;  3VB1 A;  1PVB A;  3ZNI A;  2MLE C;  5DKR A;  1AP4 A;  1QIV A;  1BU3 A;  3NGV A;  4MSP A;  1DJZ A;  4I5K A;  4YGC B;  1F8H A;  2EGD A;  2K7B A;  2CT9 A;  3VRR A;  1WLM A;  1Y1A A;  2DOQ A;  1TNX A;  2FCD A;  1CM1 A;  3PLF B;  3FIA A;  1AJ5 A;  1U5I B;  2H2K A;  3GK2 A;  3O4Y A;  1BOD A;  1NCX A;  1K96 A;  4CFQ A;  3RLZ A;  2LMU A;  3DVK A;  1BG1 A;  1BR4 B;  5HL1 A;  2L2E A;  4PDZ A;  3SG3 A;  4JKT A;  5D3O A;  2WC5 A;  2GGM A;  1KK8 B;  1YUU A;  1NCZ A;  2P6B B;  1VRK A;  1IKU A;  3OBV A;  2KLE A;  1UHI A;  4N1F A;  4WRI A;  1AVS A;  2OTG C;  2K0J A;  2LLS A;  1EJ3 A;  2KFH A;  1XFW O;  1F54 A;  1K94 A;  3FS7 A;  2TN4 A;  2M3W A;  1QLK A;  1SNL A;  1V1G A;  2OS8 C;  4MN0 A;  1DJG A;  4YRU A;  2F8P A;  3OX6 A;  5I2O A;  1B1G A;  1KFU S;  2K61 A;  2ZND A;  1WRZ A;  1KK7 Y;  1BR1 B;  1RWY A;  2JOJ A;  3EVV A;  3O2P A;  1J7O A;  1GQM A;  1OOG A;  4BY5 A;  1QIW A;  5HLO A;  1NIW A;  1XFU O;  1WRL A;  2M1K B;  4OZD A;  4PT1 A;  2M0R A;  3DD4 A;  3HCM A;  2KI6 C;  3D76 A;  1K2H A;  1UHN A;  1SRA A;  1GGZ A;  2JWW A;  2JNX A;  4FQO A;  3WNX B;  1SBJ A;  1Y1X A;  2ERB A;  1ZOT B;  2I18 A;  4GGN A;  2WCE A;  4WQ2 A;  2P71 A;  4JD9 A;  1YTZ C;  4OKH A;  1XFZ O;  1J55 A;  1S26 D;  1Z4H A;  4A4B A;  2CBL A;  1LVC D;  3BQ3 A;  3D74 A;  2KI4 C;  3NSO A;  1F70 A;  1XVJ A;  1B47 A;  4HRH A;  1MXL C;  1KFX S;  2QDI A;  1WDC B;  1K9P A;  3AAK A;  4PE0 A;  3GK4 X;  2F2O A;  1FI5 A;  1S6I A;  2JPO A;  3D77 A;  3DXL A;  4IL1 A;  3M0W A;  5IBW A;  1J7P A;  1REC A;  2WCL A;  3B86 A;  3PAT A;  2GGZ A;  4PHM A;  3KEV A;  1BJF A;  3UNW A;  5ER5 A;  1YRT B;  2Q4U A; 
#chains in the Genus database with same CATH homology
 1IJ6 A;  4JWQ A;  3VRN A;  3CGA A;  1SL7 A;  4XYN A;  1NYA A;  2LVK A;  1V1F A;  1MR8 A;  3K21 A;  2JTZ A;  2LE9 B;  2IS9 A;  2PSR A;  3SG6 A;  2SAS A;  4MBE A;  3BOW B;  1BT6 A;  1DJW A;  1OZS A;  2AUC A;  2V53 A;  3EVU A;  4YI9 A;  1JUO A;  4MEW A;  1J1D A;  1S1E A;  1FW4 A;  4DS7 A;  3BUM B;  1CLL A;  1OSA A;  3OX5 A;  2K2A A;  1FF1 A;  1LXF C;  3AAJ A;  1K8U A;  1AJ4 A;  3BUO B;  1K95 A;  1RTP 1;  2LP3 A;  3KHE A;  1L2O C;  2LLT A;  1B8L A;  5CSJ A;  5ER4 X;  1YX8 A;  2JTT A;  4YBH B;  3D0Y B;  4WQ3 A;  1NX3 A;  2LM5 A;  1L7Z A;  1H4B A;  2SCP A;  1U5I A;  3H4S E;  1CMF A;  1NSH A;  1M45 A;  1QX5 B;  1C7W A;  1NX0 A;  1UWO A;  4I5L B;  2L51 A;  1TCF A;  1UHJ A;  4C0L A;  2MBX A;  1M63 B;  2M49 B;  1YUS A;  1AK8 A;  2BCB A;  1F55 A;  2AAO A;  1S5G Z;  4ICB A;  2KOT A;  4N1G A;  3TS5 B;  2JNF A;  1HQV A;  5AER A;  5I2Q A;  2AMI A;  1K93 D;  1J7Q A;  4M2P A;  1SL9 A;  2K2F A;  2E30 A;  3I5H C;  5HKW A;  2JU0 A;  4PAL A;  1XK4 C;  2WCB A;  4YGD B;  3C1V A;  1CKK A;  5D7F A;  4GNK B;  4NDC A;  2M7N A;  3CLN A;  1X02 A;  1CDP A;  3GK1 A;  1XO5 A;  1A29 A;  2L5X B;  1EXR A;  1PAL A;  3AKB A;  4ORC B;  5AXI A;  1OMR A;  4ETO A;  2FOT A;  3KPX A;  3VRQ A;  1TOP A;  1JBA A;  3PM8 A;  1B7T Y;  4CID A;  1QAT A;  1KWO B;  2BBN A;  4DUQ A;  2VRG A;  2KAV A;  2LNK A;  4QJ4 B;  4BY4 A;  1IQ3 A;  1S36 A;  1BF5 A;  2PRU A;  3I5G B;  4GGF A;  2JT0 A;  1DMO A;  3SG7 A;  1QVI Y;  1C7V A;  2FCE A;  1S6C A;  1C07 A;  1L2O B;  1ZMZ A;  4DRW A;  3NSL A;  1G4Y R;  2MHH A;  1DJY A;  1YUR A;  2QPT A;  1UHH A;  2NCO A;  4NQG A;  4ZCU A;  1CB1 A;  2KAX A;  1W7J B;  2G9B A;  1J1E A;  1SYM A;  4OV2 A;  3SG2 A;  1QJT A;  2LAN A;  2KFG A;  4USL A;  1OQP A;  2ZKM X;  3TUY C;  3TS5 C;  4GBA A;  4GUK A;  2NZ0 A;  5F6T A;  3LCP C;  3A4U B;  1SCV A;  3TDZ A;  5CSI A;  1TNW A;  1EG3 A;  4GAO A;  2JT8 A;  2K7D A;  1AHR A;  1ALV A;  2L4H A;  4I5J A;  4HSZ A;  4N5X A;  3BUW B;  2WC8 A;  4D1E A;  3EK4 A;  2JT3 A;  5KU1 A;  1XFX O;  1IGV A;  1N2D A;  2JQ6 A;  3SG5 A;  3JTD B;  1NPQ A;  4UPG A;  1MHO A;  1SKT A;  1F4O A;  1XFY O;  2R2I A;  3BOW A;  3LLE A;  2G2B A;  1LKJ A;  2JXL A;  2L0P A;  2BCX A;  3F45 A;  2EHB A;  1BOC A;  2QAC A;  1KCY A;  1DVI A;  1OZO A;  1Y6W A;  2MA2 A;  4ORA B;  2BEC A;  1QTX A;  2F2P A;  1IQ5 A;  2LUC A;  5AFP A;  2CTN A;  2Q91 A;  3OB1 B;  4HRE E;  2H61 A;  3WHU B;  4DIR A;  1CDL A;  2OTG B;  3EVR A;  1NCY A;  1OE9 B;  4TNC A;  2COL B;  1N65 A;  1SPY A;  2WCF A;  1W7I B;  2A4J A;  4OCI A;  1JWD A;  3I5I C;  5CSN A;  1DJI A;  1MWN A;  3CR4 X;  1KK7 Z;  2CXJ A;  1DGV A;  2MRD A;  3DF0 B;  1BMO A;  1OOJ A;  2WND A;  4GGF C;  2D8N A;  2LVI A;  1YVH A;  3LK1 A;  4PE7 A;  2M97 A;  5KTY A;  2CNP A;  3PN7 B;  2KGB C;  3WXA A;  2K7C A;  4PE1 A;  4M2O A;  3TZ1 A;  1B8R A;  2M8U A;  2OPO A;  1F8H A;  4HRG A;  3O78 A;  2KBI A;  5HYD A;  3OP0 A;  2MLF C;  3BUX B;  1IG5 A;  5KSZ A;  2MJW B;  1TRF A;  3D0Y A;  1HT9 A;  1EL4 A;  1G8I A;  1EH2 A;  1DJH A;  1QLS A;  2KI4 B;  3VGO A;  4M2Q A;  1CDM A;  4GPL B;  4I5N B;  2LMV A;  3EKJ A;  2LMT A;  2M9G A;  3AKA A;  1QX7 A;  1Q80 A;  3I5G C;  1BLQ A;  2B1U A;  4NDB A;  1IRJ A;  2ZRT A;  3NSI A;  2KFF A;  1B4C A;  3I5I B;  2NXQ A;  1K9U A;  2H61 C;  5AAN A;  2PAS A;  1QV0 A;  1A75 A;  4MRX A;  2NCP A;  5FYX A;  4ZCV A;  3QRX A;  2JRF A;  4JQ0 D;  2LP2 A;  2O60 A;  5D69 A;  1JFK A;  2O5G A;  5I8N A;  2HQ8 A;  2LLU A;  1DT7 B;  4QJ5 B;  1YRU B;  1CFD A;  1QXP A;  2M29 A;  2BL0 C;  1WY9 A;  1PRW A;  3CWG A;  2KHN A;  2BL0 B;  4FTG A;  3I5H B;  1CNP A;  1SCM B;  2L98 A;  1CFF A;  1LA0 A;  4GFT A;  2LC5 A;  1RRO A;  4PCW A;  3O6B A;  1N0Y A;  1ZFS A;  2MAZ A;  2LHL A;  3ICB A;  5J3X A;  2LVV A;  2HET A;  4CPV A;  5B8I B;  1B7T Z;  2WOR A;  1PSR A;  2ZNE A;  1Y1U A;  1RJV A;  1S6J A;  3BYA A;  4E68 A;  2L50 A;  2BCA A;  2HQW A;  4AQJ A;  3TDU A;  3CTN A;  3LL8 B;  1J7R A;  4XJK A;  1TIZ A;  4P2Y B;  1IJ5 A;  4OVN F;  3FWC A;  5CPV A;  4MZJ A;  1F71 A;  2JPT A;  2K7O A;  2LV7 A;  4P5O E;  1CFP A;  2ZN8 A;  3RM1 A;  1XA5 A;  2I7A A;  5PAL A;  1WRK A;  5JOL A;  1FI6 A;  1UUS A;  1ZAC A;  2BE4 A;  1SMG A;  4JPZ B;  3DVM A;  1MF8 B;  3WHT B;  1XYD A;  4Q04 A;  3FWB A;  1MQ1 A;  1IWQ A;  2WOS A;  1ALW A;  1NP8 A;  2F3Z A;  1KK8 C;  2KYF A;  1KQM B;  2Y1M A;  3KF9 A;  2NLN A;  4DCK A;  3VRO A;  1OMD A;  1KQV A;  1K9K A;  1OMV A;  3HX4 A;  2JZI A;  2I94 A;  2ZFD A;  5G08 A;  3EK8 A;  1JC2 A;  1UHK A;  2ISD A;  2LCP A;  1K90 D;  1QV1 A;  5HLV A;  2BE6 A;  3D10 A;  3IQQ A;  1S5G Y;  5HKZ A;  2KNE A;  1M46 A;  3SIA A;  4C0J A;  1QX2 A;  1DGU A;  2GV5 A;  3OB2 B;  2LAP A;  1A4P A;  1SY9 A;  1SW8 A;  3PSR A;  1KSM A;  4MZL A;  2BBM A;  1JSA A;  3VRP A;  2KQ6 A;  3SJS A;  1GGW A;  3EK7 A;  2M1U A;  4NDD A;  2L4I A;  1PVA A;  1FPW A;  2ZN9 A;  4F0Z B;  1PUL A;  1LIN A;  1YVL A;  1DJX A;  4XJK B;  3I5F B;  1NX1 A;  1WLZ A;  1CLM A;  1RFJ A;  1YUT A;  1ODB A;  4C0K A;  4MRY A;  1DF0 B;  4PHJ A;  5I2L A;  1R6P A;  1UP5 A;  2M7L A;  5AEQ A;  4PE4 A;  1KWO C;  5GQQ C;  4L9M A;  1JFJ A;  3NXA A;  1TNP A;  1M39 A;  1CFC A;  5BPJ A;  2K8M B;  4CLN A;  2LUX A;  2Y4Q A;  3IF7 A;  3JVT C;  5JJG A;  1GJY A;  4A4C A;  2OS8 B;  1S3P A;  1TNQ A;  3CR2 A;  3EKH A;  4MZK A;  1G33 A;  3BUN B;  1TCO B;  4U8D A;  2LVJ A;  2PMY A;  3CR5 X;  1KFX L;  2I2R E;  3GOF A;  2KI6 D;  3E3R A;  3JTD C;  1DF0 A;  4YI8 A;  1CDN A;  1SL8 A;  1PK0 D;  1CMG A;  2KYC A;  1B8C A;  3OHM B;  1EG4 A;  3PAL A;  1Y0V H;  4YGB B;  2HF5 A;  3LK0 A;  1NWD A;  3A8R A;  3KO0 A;  2PVB A;  4PHN A;  3DVJ A;  1SK6 D;  2JXC A;  1YR5 A;  3PFV A;  4ORB B;  3BXK A;  4OR9 B;  5DKQ A;  1IH0 A;  3MSE B;  1SCM C;  5CSF A;  3TUY B;  1M31 A;  1A2X A;  1FBV A;  1E8A A;  1XFV O;  1KSO A;  1DTL A;  1AUI B;  1KFU L;  1R2U A;  5TNC A;  1PSB A;  1CTR A;  1SR6 B;  4R1E A;  1TN4 A;  1QAS A;  2KBM A;  4QJ3 B;  2RGI A;  3DF0 A;  4AQI A;  3IQO A;  1QVI Z;  2F3Y A;  2Y5I A;  2KDH A;  4YGE B;  4YGA A;  1YX7 A;  1B9A A;  2KSP A;  1ZUZ A;  2LHI A;  1QS7 A;  1NUB A;  1RK9 A;  1LA3 A;  2KQY A;  1A03 A;  3DVE A;  2BKI B;  3PN7 C;  4MVF A;  2KAY A;  1CM4 A;  5DKN A;  4AOM A;  1TTX A;  2JC2 A;  2CCM A;  4MLW A;  2KGR A;  3SG4 A;  2EC6 B;  2HPS A;  2Y1N A;  1XK4 A;  5K89 A;  1CLB A;  2PAL A;  2FJU B;  1JF2 A;  1UUR A;  2EC6 C;  1KQM C;  2ZRS A;  3SIB A;  3TDI A;  1A75 B;  1JF0 A;  2JUL A;  2E6W A;  2F33 A;  3ZWH A;  1D1O A;  1H8B A;  1MXE A;  1WDC C;  3CS1 A;  4CFR A;  3I5F C;  1F4Q A;  4PHK A;  2BKH B;  1SR6 C;  3NSK A;  1NX2 A;  1MUX A;  5HKY A;  3CZT X;  3JVT B;  1PVB A;  3ZNI A;  2MLE C;  5DKR A;  1AP4 A;  1QIV A;  1BU3 A;  4MSP A;  1DJZ A;  4I5K A;  4YGC B;  2EGD A;  2K7B A;  2CT9 A;  3VRR A;  1WLM A;  1Y1A A;  2DOQ A;  1TNX A;  2FCD A;  1CM1 A;  3PLF B;  3FIA A;  1AJ5 A;  1U5I B;  2H2K A;  3GK2 A;  3O4Y A;  1BOD A;  1NCX A;  1K96 A;  4CFQ A;  3RLZ A;  2LMU A;  3DVK A;  1BG1 A;  1BR4 B;  2L2E A;  4PDZ A;  3SG3 A;  2GGM A;  1KK8 B;  1YUU A;  1NCZ A;  2P6B B;  1VRK A;  1IKU A;  1UHI A;  4N1F A;  4WRI A;  1AVS A;  2OTG C;  2K0J A;  2LLS A;  1EJ3 A;  2KFH A;  1XFW O;  1F54 A;  1K94 A;  3FS7 A;  2TN4 A;  2M3W A;  1QLK A;  1SNL A;  1V1G A;  2OS8 C;  4MN0 A;  1DJG A;  4YRU A;  2F8P A;  3OX6 A;  5I2O A;  1B1G A;  1KFU S;  2K61 A;  2ZND A;  1WRZ A;  1KK7 Y;  1BR1 B;  1RWY A;  2JOJ A;  3EVV A;  3O2P A;  1J7O A;  1GQM A;  4BY5 A;  1QIW A;  5HLO A;  1NIW A;  1XFU O;  1WRL A;  2M1K B;  2M0R A;  3DD4 A;  3HCM A;  2KI6 C;  1K2H A;  1UHN A;  1SRA A;  1GGZ A;  2JWW A;  2JNX A;  4FQO A;  3WNX B;  1SBJ A;  1Y1X A;  4GGN A;  1ZOT B;  2I18 A;  4WQ2 A;  2WCE A;  1YTZ C;  4OKH A;  1XFZ O;  1J55 A;  1S26 D;  4A4B A;  2CBL A;  1LVC D;  3BQ3 A;  3NSO A;  2KI4 C;  1F70 A;  1XVJ A;  1B47 A;  4HRH A;  1MXL C;  1KFX S;  1WDC B;  1K9P A;  3AAK A;  4PE0 A;  3GK4 X;  2F2O A;  1FI5 A;  1S6I A;  4IL1 A;  3M0W A;  5IBW A;  1J7P A;  1REC A;  3PAT A;  2GGZ A;  4PHM A;  3KEV A;  1BJF A;  5ER5 A;  1YRT B;  2Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...