3GK2A

X-ray structure of bovine sbi279,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk2A00
4MRYA 1YURA 2KGBC 1J7QA 1NPQA 2LP3A 4HREE 4OV2A 4DS7A 3MSEB 1SL7A 1TNPA 2OS8B 1A75A 1Q80A 1SK6D 1A03A 2MLFC 1IKUA 3CGAA 1CM1A 1JFKA 1OQPA 4P2YB 1QIWA 3PFVA 1UURA 1NX3A 1N2DA 2JULA 1A75B 2M97A 3PSRA 3OB1B 1BMOA 4NQGA 2KGRA 4GGFC 5K89A 2WNDA 2OTGB 3JVTB 1TIZA 4WRIA 1QVIY 1MUXA 2OPOA 4GPLB 2HF5A 1CMGA 1XFYO 2NZ0A 3IQOA 1AUIB 1MQ1A 4NDCA 1NCYA 2JNFA 2V53A 1S1EA 2L2EA 3PM8A 3ZNIA 2F8PA 1S36A 1XK4C 2KQYA 2MHHA 4BY4A 1K95A 1L2OB 1PULA 4D1EA 2E6WA 3HCMA 3SIBA 3CR2A 3VRRA 1RJVA 2WCFA 2AMIA 5G08A 1NX0A 1B8LA 1RECA 4M2QA 1QLSA 4NDBA 1YVLA 2KDHA 1C7VA 1R6PA 1B8CA 2JNXA 1BLQA 1ODBA 4MRXA 2LP2A 2LVJA 4FQOA 1K9UA 4DRWA 4PE1A 2KFHA 1IJ6A 4MEWA 2M29A 4ICBA 1SR6C 3TUYC 3JTDB 1RFJA 4HSZA 2DOQA 3SG5A 2LVVA 3EK7A 4PHJA 3ICBA 1AJ4A 1PVAA 1Y0VH 5CPVA 2MRDA 1TTXA 2M9GA 2ISDA 1XFZO 1BU3A 4I5KA 3OX5A 1IQ5A 3SG7A 2HQ8A 1QTXA 2M1UA 1K8UA 2EC6C 1HQVA 4PALA 2I2RE 1MR8A 4CFQA 2LMVA 1KFXL 3EVUA 4PHNA 1OMVA 4HRGA 3I5FB 3AKAA 2KYFA 5DKNA 2GV5A 2KAXA 3BUNB 5I2QA 2F2OA 3OB2B 2KOTA 1IWQA 1SL8A 3LK1A 1KK8C 1QXPA 1DJIA 2IS9A 3O6BA 5FYXA 1IRJA 1J1DA 2SCPA 1CLMA 1RROA 1GGWA 1XFUO 2GGMA 2G2BA 3WHTB 1N65A 1TNQA 1TOPA 3CZTX 1IG5A 3I5IC 1SW8A 3NSLA 5I8NA 1Y1UA 1DJHA 3H4SE 1WRZA 2KAYA 1XFXO 3I5HC 2BE6A 2L5XB 1BF5A 1FPWA 1DVIA 5BPJA 5IBWA 1FI6A 4I5LB 2JOJA 1RK9A 1ALVA 1ZUZA 1WDCB 1X02A 2KBIA 2PMYA 3NSOA 4MZKA 4MVFA 3EKHA 1RTP1 1Y6WA 3A8RA 1M46A 2F3ZA 2COLB 2CBLA 1IH0A 4GGNA 3CR4X 1K90D 1DJZA 4OVNF 2BKIB 1DT7B 1KQVA 4PE7A 1QX2A 3SG2A 2WCEA 1S26D 1R2UA 1RWYA 1UUSA 1AK8A 3KPXA 2BECA 2Y1NA 2KI4B 1D1OA 3AAJA 4N5XA 1J55A 1YRUB 2NCOA 4UPGA 1OZSA 4ZCUA 4GUKA 2FOTA 4P5OE 1QX7A 1G33A 1G4YR 4ORAB 2KI6D 2P6BB 5HLOA 3TZ1A 4ORBB 3FS7A 1B9AA 1JSAA 1PRWA 3SG4A 4PE4A 2JT0A 1YX8A 1CM4A 3SIAA 4XJKB 3DD4A 1DJXA 1PALA 2BCXA 2Q4UA 3I5GB 5DKQA 1DF0A 1DGUA 3E3RA 1WRLA 1GGZA 2KBMA 1UP5A 2MA2A 1NP8A 1NIWA 3D0YA 1XVJA 1DF0B 1F4OA 2LLUA 1U5IA 2PVBA 3WXAA 2BCAA 2LHIA 2KSPA 1EH2A 1EJ3A 3D0YB 1IJ5A 1U5IB 1ZACA 2M49B 2K2FA 3KO0A 2BL0B 5D69A 1SL9A 2L4HA 3TS5C 2M7NA 1CFPA 4PDZA 1J1EA 1NUBA 4IL1A 1B47A 2JTZA 2OS8C 4USLA 1M63B 1F4QA 2LNKA 3GK4X 3BUWB 5AERA 4TNCA 1J7OA 5ER4X 1KSOA 4ORCB 2VRGA 4C0JA 1YRTB 1FF1A 2HETA 1WLZA 1S6JA 5I2OA 2PASA 4MLWA 3JVTC 1AJ5A 1LA3A 2MJWB 1SNLA 1CB1A 1UHNA 1QS7A 4QJ3B 3D10A 3BUOB 1CTRA 2E30A 1Y1AA 2K0JA 3KHEA 1S6CA 3AAKA 4MBEA 2CNPA 4ZCVA 2KFFA 1KQMB 4MZLA 5AANA 3PATA 1PSRA 2JXCA 2CT9A 3NSIA 1F54A 1B7TZ 1MXLC 5HKYA 3FIAA 4AOMA 1CDPA 1EXRA 2H61A 4F0ZB 5AFPA 1S6IA 2F3YA 3BXKA 4CLNA 1BG1A 1DGVA 2CXJA 5TNCA 1E8AA 4R1EA 1GJYA 1K93D 1UHKA 1SKTA 2KYCA 2Q91A 5HYDA 3FWBA 2TN4A 2ZN8A 1N0YA 1XYDA 3EK4A 1K2HA 2LE9B 3WHUB 2GGZA 1TCFA 1SY9A 2K7BA 3EVRA 2M8UA 2EC6B 5CSJA 2G9BA 5AXIA 1EL4A 1NWDA 1BT6A 1L7ZA 2FCDA 2ZN9A 1A2XA 1PSBA 1QJTA 2QPTA 1TRFA 2K2AA 4I5NB 2PSRA 1KK8B 5B8IB 3TDIA 2H2KA 1QV1A 1UHIA 3VROA 3OP0A 3CWGA 1TNWA 4U8DA 5GQQC 4Q04A 1NX1A 2JZIA 2SASA 3I5IB 4E68A 1V1GA 1VRKA 5J3XA 1B7TY 1BODA 2CTNA 5HKWA 1TN4A 3A4UB 1CFDA 5CSIA 1GQMA 2D8NA 5CSNA 3VRQA 2KI6C 2L98A 3O2PA 1F8HA 2M1KB 4PCWA 1JBAA 4A4CA 1YUSA 1YTZC 2WC8A 2EGDA 1A4PA 2ZKMX 3GK2A 3QRXA 4WQ3A 1ZFSA 3KEVA 1LKJA 1UHHA 1CNPA 1AHRA 2I18A 1B1GA 1SMGA 4M2OA 2I7AA 4QJ4B 2PRUA 1DJGA 1LA0A 2JTTA 3K21A 4CPVA 4WQ2A 1K9KA 3PN7B 2L4IA 3CR5X 2LUXA 4AQJA 4DCKA 1F71A 1KWOB 1MF8B 4OR9B 2KQ6A 3OHMB 2LUCA 1CFCA 1QIVA 3DF0A 4YRUA 4FTGA 2HPSA 1YUTA 1TCOB 2NCPA 1WY9A 3CTNA 1SCMB 3DF0B 1QLKA 1KCYA 1K94A 1HT9A 4XJKA 4CFRA 4PE0A 3RM1A 1BJFA 4DUQA 1B4CA 1M39A 1CLLA 2K7DA 4JPZB 4CIDA 4YGDB 2R2IA 2MBXA 1OZOA 1UHJA 5JJGA 3LCPC 3DVJA 2K61A 1OE9B 1YX7A 4GGFA 1YR5A 1IQ3A 1YVHA 5HLVA 1CFFA 3EVVA 3KF9A 5JOLA 1H4BA 1KSMA 2JU0A 4GNKB 1JF2A 1CMFA 1DJWA 2O5GA 2LVIA 2ZFDA 2LHLA 2JPTA 3IQQA 1FW4A 1KFXS 3TUYB 3TS5B 4PHMA 1K96A 4N1FA 5D7FA 5KU1A 3I5GC 1IGVA 1QATA 1XK4A 2JRFA 3RLZA 1KFUL 2LANA 1LXFC 2LV7A 4YGAA 2Y5IA 4BY5A 1W7JB 2KAVA 1MWNA 1V1FA 1FBVA 2JT8A 1ALWA 1KK7Z 3VRNA 4AQIA 2OTGC 2LVKA 4ETOA 2BL0C 4MZJA 1SBJA 3C1VA 2M0RA 2LLTA 4GFTA 2HQWA 1J7RA 2LMUA 2FJUB 2WORA 3TDZA 2K7CA 4XYNA 4YI8A 1BR1B 1L2OC 3BYAA 1B8RA 3BUXB 1A29A 2WCBA 1NYAA 1WRKA 1XA5A 1SR6B 2K7OA 2JWWA 1S5GZ 1NX2A 2KNEA 2L51A 1M31A 1BR4B 2ZRSA 5AEQA 3BQ3A 4QJ5B 2BKHB 4YBHB 2L0PA 3CLNA 1JF0A 1XO5A 1KQMC 1OMRA 3DVKA 1XFWO 1LVCD 1SYMA 2O60A 3OX6A 4JWQA 2LC5A 1OMDA 1G8IA 3JTDC 1SRAA 2NXQA 1KK7Y 1CKKA 1YUUA 3BOWA 1CDNA 4NDDA 3LLEA 2QACA 2M3WA 1JWDA 3VGOA 1PVBA 2H61C 2A4JA 1EG3A 3BOWB 3PLFB 3O78A 2WOSA 1CDMA 3FWCA 2PALA 2JT3A 3F45A 1DTLA 3EKJA 4MSPA 3VRPA 2CCMA 4MN0A 2KHNA 2L50A 3ZWHA 1QX5B 3I5FC 2MAZA 4YGCB 4DIRA 3I5HB 5PALA 1PK0D 1W7IB 1MHOA 1S5GY 2K8MB 3PALA 1TNXA 2M7LA 3M0WA 2AUCA 5ER5A 1WLMA 1AVSA 4YGEB 3WNXB 1J7PA 1OSAA 2BBNA 2F33A 3SJSA 5KSZA 3LK0A 1BOCA 3IF7A 2F2PA 3DVMA 1DJYA 1C7WA 4N1GA 2EHBA 2MLEC 3DVEA 1XFVO 1JFJA 1CLBA 4PHKA 1KFUS 4OCIA 4M2PA 1NCXA 1FI5A 1CDLA 1QASA 4YI9A 5I2LA 1H8BA 1JUOA 3NXAA 2JQ6A 2RGIA 2ZRTA 1EG4A 3AKBA 1WDCC 1K9PA 1Y1XA 5CSFA 2I94A 2JC2A 4YGBB 2JXLA 3GOFA 1UWOA 2Y4QA 1ZMZA 4OKHA 1AP4A 2LM5A 2LMTA 1NSHA 1ZOTB 4C0LA 1NCZA 2BE4A 1C07A 5KTYA 3SG6A 2BCBA 5F6TA 1QV0A 1LINA 1QVIZ 2KFGA 1SCVA 3BUMB 3CS1A 3GK1A 3NSKA 3PN7C 2KI4C 3SG3A 2LAPA 1KWOC 4GAOA 4HRHA 4C0KA 1S3PA 2BBMA 3HX4A 3O4YA 1DMOA 2ZNDA 3LL8B 4GBAA 2FCEA 2NLNA 2Y1MA 1F70A 3TDUA 4JQ0D 1OOJA 4I5JA 1F55A 2AAOA 1SCMC 1SPYA 2LCPA 3EK8A 5HKZA 4A4BA 2LLSA 4L9MA 5DKRA 1MXEA 1JC2A 2ZNEA 1M45A 2B1UA
chains in the Genus database with same CATH superfamily
4MRYA 3FE6A 1YURA 2KGBC 1J7QA 1NPQA 2LP3A 4HREE 4OV2A 1XFRA 4DS7A 2WCJA 3IVTA 3MSEB 1SL7A 1TNPA 2OS8B 1A75A 1Q80A 1SK6D 1A03A 3D77A 2MLFC 1IKUA 2H8VA 3CGAA 1CM1A 1JFKA 1OQPA 3CDNA 4P2YB 1QIWA 3PFVA 1UURA 1NX3A 1N2DA 2JULA 1A75B 2M97A 3PSRA 3B6XA 3OB1B 1BMOA 4NQGA 2KGRA 4GGFC 5K89A 3Q8IA 2WNDA 2OTGB 3JVTB 1TIZA 2QEBA 3R1PA 4WRIA 1QVIY 1MUXA 2OPOA 4GPLB 2HF5A 1CMGA 1XFYO 3D75A 2NZ0A 3S0AA 3IQOA 1AUIB 1MQ1A 4NDCA 1NCYA 2JNFA 2V53A 1S1EA 2L2EA 3PM8A 3ZNIA 2F8PA 1S36A 1XK4C 2KQYA 2MHHA 4BY4A 1K95A 1L2OB 1PULA 4D1EA 2GTEA 2E6WA 3HCMA 1TUZA 3CR2A 3SIBA 3VRRA 1RJVA 2QEVA 2WCFA 5D3OA 2AMIA 5G08A 1NX0A 1B8LA 2JPOA 1RECA 4M2QA 1QLSA 4NDBA 1YVLA 2KDHA 1C7VA 1R6PA 2KLEA 1B8CA 2JNXA 1BLQA 1ODBA 4MRXA 2LP2A 3D78A 2LVJA 4FQOA 1K9UA 4DRWA 4PE1A 2KFHA 1IJ6A 4JKTA 4MEWA 3S0BA 2M29A 3BFBA 1SR6C 4ICBA 3TUYC 3JTDB 2P71A 1RFJA 4HSZA 3TS5C 2DOQA 3SG5A 2LVVA 3EK7A 3FE9A 4PHJA 3ICBA 5I94A 1AJ4A 1PVAA 1Y0VH 5CPVA 2MRDA 1TTXA 2M9GA 2ISDA 1XFZO 1BU3A 3UNWA 4I5KA 3OX5A 1IQ5A 3SG7A 2HQ8A 1DEKA 1QTXA 1Z4HA 4KYNA 2M1UA 1K8UA 2EC6C 1HQVA 4PALA 2I2RE 1MR8A 4CFQA 1T14A 2LMVA 1KFXL 3EVUA 4PHNA 1W9ZA 1OMVA 4HRGA 3I5FB 3AKAA 1DQEA 2KYFA 5DKNA 2GV5A 2KAXA 3BUNB 5I2QA 2F2OA 3OB2B 1DC1A 2KOTA 1IWQA 1SL8A 3LK1A 1KK8C 1QXPA 3N7HA 1OOFA 1DJIA 2IS9A 3O6BA 5FYXA 1IRJA 1J1DA 2SCPA 1CLMA 5HL1A 2KLDA 1RROA 1GGWA 1XFUO 2GGMA 2G2BA 3WHTB 1N65A 1TNQA 1TOPA 3CZTX 1IG5A 3I5IC 1SW8A 3NSLA 5I8NA 1Y1UA 1DJHA 3H4SE 1WRZA 2KAYA 1XFXO 3O4XA 3I5HC 2BE6A 2L5XB 1BF5A 1FPWA 2WC6A 1DVIA 5BPJA 5IBWA 1FI6A 4I5LB 3OBVA 2JOJA 1RK9A 1ALVA 1ZUZA 1WDCB 1X02A 2KBIA 2PMYA 3NSOA 4MZKA 4MVFA 3EKHA 3BFAA 1RTP1 1Y6WA 2WCMA 3A8RA 1M46A 2F3ZA 2COLB 2CBLA 1IH0A 4GGNA 1OOIX 3CR4X 1K90D 1DJZA 4OVNF 3D74A 2BKIB 3FE8A 1DT7B 1KQVA 4PE7A 1QX2A 3SG2A 2WCEA 1S26D 1R2UA 1RWYA 1UUSA 1AK8A 3KPXA 2BECA 2Y1NA 2KI4B 1D1OA 3AAJA 4N5XA 1J55A 1YRUB 2NCOA 4F7FA 1OZSA 4ZCUA 4UPGA 4GUKA 2FOTA 4P5OE 1QX7A 1G33A 1G4YR 3SS5A 3DYEA 4ORAB 2KI6D 1OOGA 2P6BB 5HLOA 5FI7A 3TZ1A 4ORBB 3FS7A 3S0DA 1B9AA 1JSAA 1PRWA 3SG4A 4PE4A 2JT0A 1YX8A 1CM4A 3SIAA 4XJKB 3DD4A 1DJXA 1PALA 2BCXA 2Q4UA 3I5GB 5DKQA 1DF0A 1DGUA 3B7AA 2P70A 3E3RA 4PT1A 1WRLA 1GGZA 2KBMA 1UP5A 2MA2A 1NP8A 4INWA 1NIWA 3B88A 3S0GA 3D0YA 1XVJA 1DF0B 2L5YA 1F4OA 2LLUA 1U5IA 2PVBA 3WXAA 2BCAA 2LHIA 2KSPA 1EH2A 1EJ3A 1QWVA 3D0YB 1IJ5A 4INXA 1GM0A 1U5IB 1ZACA 2M49B 2K2FA 2PYQA 2BL0B 3KO0A 1SL9A 2L4HA 5D69A 4OZDA 2M7NA 1CFPA 4PDZA 1J1EA 1NUBA 4IL1A 1B47A 2JTZA 2OS8C 4USLA 1LS8A 1M63B 5DICA 1F4QA 2LNKA 3GK4X 1TUJA 3BUWB 3S0EA 4TNCA 5AERA 1J7OA 5ER4X 1KSOA 2BNXA 4ORCB 3L4AA 2VRGA 4C0JA 1YRTB 1FF1A 2HETA 1WLZA 1S6JA 5I2OA 2PASA 4MLWA 3JVTC 1AJ5A 3B87A 1LA3A 2MJWB 3D76A 1SNLA 1CB1A 1UHNA 1QS7A 4QJ3B 3D10A 3BUOB 1CTRA 2E30A 1Y1AA 2K0JA 3KHEA 1S6CA 3AAKA 2QEOA 4MBEA 2CNPA 4ZCVA 2KFFA 1KQMB 4MZLA 5AANA 3PATA 1PSRA 2JXCA 2CT9A 3NSIA 1F54A 1B7TZ 1MXLC 5HKYA 3FIAA 4AOMA 1CDPA 1EXRA 2H61A 4F0ZB 5AFPA 1S6IA 2F3YA 3BXKA 4CLNA 1BG1A 1DGVA 2CXJA 5TNCA 1E8AA 4R1EA 1GJYA 1K93D 1UHKA 1SKTA 2FJYA 2KYCA 2Q91A 5HYDA 3FWBA 3CZ1A 2TN4A 2ZN8A 1N0YA 1XYDA 3EK4A 1K2HA 2LE9B 3WHUB 2GGZA 1TCFA 1SY9A 2K7BA 3VB1A 3EVRA 2M8UA 2EC6B 5CSJA 2G9BA 5AXIA 1EL4A 1NWDA 1BT6A 1L7ZA 5FI2A 3DY9A 2FCDA 2ZN9A 1Z2CB 1A2XA 1PSBA 2KPHA 1QJTA 2QPTA 1TRFA 2K2AA 4IJ7A 4I5NB 2PSRA 1KK8B 5EL2A 5B8IB 3TDIA 2H2KA 1QV1A 1UHIA 3VROA 3OP0A 3EG5B 3CWGA 1TNWA 4U8DA 5GQQC 1IIOA 4Q04A 1NX1A 2JZIA 2SASA 3I5IB 4E68A 1V1GA 1VRKA 5J3XA 1B7TY 1BODA 2CTNA 5HKWA 1TN4A 3A4UB 3BJHA 1CFDA 5CSIA 1GQMA 2D8NA 5CSNA 3VRQA 2KI6C 2L98A 3L4LA 3O2PA 1F8HA 2M1KB 4PCWA 1JBAA 4A4CA 3NHIA 1YUSA 4JD9A 1YTZC 2WC8A 2EGDA 3B86A 1A4PA 2ZKMX 3R72A 3GK2A 3QRXA 4WQ3A 1ZFSA 3KEVA 1LKJA 1UHHA 1CNPA 1AHRA 2I18A 1B1GA 1SMGA 4M2OA 2I7AA 4QJ4B 1TWOA 2PRUA 3SS3A 1DJGA 1LA0A 2JTTA 3K21A 4CPVA 4WQ2A 1K9KA 3PN7B 2L4IA 3CR5X 2LUXA 4AQJA 4DCKA 3SS4A 1F71A 1KWOB 1MF8B 4OR9B 2KQ6A 3OHMB 2LUCA 1CFCA 1QIVA 3DF0A 4YRUA 4FTGA 2HPSA 1YUTA 1TCOB 2NCPA 1WY9A 3BFHA 3CTNA 1SCMB 3D73A 3DF0B 1QLKA 1KCYA 1K94A 1HT9A 1C3YA 4XJKA 4CFRA 4PE0A 2WCKA 3S0FA 3RM1A 1BJFA 4DUQA 1B4CA 3RZSA 1M39A 1CLLA 2K7DA 4JPZB 4CIDA 4YGDB 2R2IA 3CZ0A 2MBXA 1OZOA 1UHJA 5JJGA 3LCPC 3DVJA 2K61A 1OE9B 1YX7A 4GGFA 1YR5A 1IQ3A 1YVHA 3K1EA 5HLVA 1CFFA 3EVVA 3KF9A 5JOLA 1H4BA 1KSMA 2JU0A 4GNKB 1JF2A 1CMFA 1DJWA 2O5GA 3NGVA 2LVIA 2ZFDA 2WCLA 2LHLA 2JPTA 3IQQA 1FW4A 1KFXS 3TUYB 3TS5B 4PHMA 1K96A 4N1FA 2YGUA 3DZTA 5D7FA 5KU1A 3I5GC 1IGVA 1QATA 1XK4A 3CABA 2JRFA 3RLZA 1KFUL 1ORGA 1LXFC 2LANA 2LV7A 3PM2A 2QDIA 2Y5IA 4YGAA 4BY5A 1W7JB 3R1VA 2KAVA 1MWNA 1V1FA 1FBVA 2JT8A 1ALWA 1KK7Z 3VRNA 4AQIA 2OTGC 1OOHA 2LVKA 4ETOA 2BL0C 4MZJA 3CYZA 1SBJA 3QMEA 2ERBA 3C1VA 2M0RA 4FQTA 2LLTA 1C3ZA 4GFTA 2HQWA 1J7RA 2LMUA 2FJUB 2WORA 3TDZA 2K7CA 4XYNA 4YI8A 1BR1B 1L2OC 3BYAA 1B8RA 3BUXB 1A29A 2WCBA 3PJIA 1NYAA 1WRKA 1XA5A 1SR6B 2K7OA 2JWWA 1S5GZ 1NX2A 2KNEA 2L51A 5FI6A 1M31A 1BR4B 2ZRSA 5AEQA 3BQ3A 4QJ5B 2BKHB 4YBHB 2L0PA 3CLNA 1JF0A 1XO5A 1KQMC 1OMRA 3DVKA 1XFWO 1LVCD 1SYMA 2O60A 3OX6A 4JWQA 2LC5A 1P28A 1OMDA 1G8IA 3JTDC 1SRAA 2NXQA 1KK7Y 1CKKA 1YUUA 3BOWA 1CDNA 4NDDA 3OGNA 3LLEA 2QACA 2M3WA 1JWDA 3VGOA 1PVBA 2H61C 2A4JA 3V2LA 1EG3A 3BOWB 3PLFB 3O78A 2WOSA 1CDMA 3FWCA 2PALA 2JT3A 3F45A 1DTLA 3EKJA 4MSPA 3VRPA 2CCMA 4MN0A 2KHNA 2L50A 2BAPA 3ZWHA 1QX5B 3I5FC 2MAZA 4YGCB 4DIRA 3I5HB 2PQLA 5PALA 1PK0D 1W7IB 1MHOA 1S5GY 2K8MB 3PALA 1TNXA 2M7LA 3M0WA 2AUCA 5ER5A 1WLMA 1AVSA 4YGEB 3WNXB 1J7PA 1OSAA 2BBNA 2F33A 3SJSA 2K60A 2WC5A 5KSZA 2WCHA 3LK0A 1BOCA 3IF7A 2F2PA 3DVMA 1DJYA 1C7WA 3R1OA 4N1GA 2EHBA 2MLEC 3DVEA 1XFVO 1JFJA 1CLBA 4PHKA 1KFUS 4OCIA 4M2PA 3UO9A 1NCXA 1FI5A 1CDLA 1QASA 4YI9A 5I2LA 1H8BA 1JUOA 3NXAA 2JQ6A 2RGIA 2ZRTA 1EG4A 3CZ2A 3AKBA 1WDCC 1K9PA 1Y1XA 5CSFA 2I94A 2JC2A 4YGBB 2QEHA 2JXLA 3GOFA 1UWOA 2Y4QA 3L47A 3NHTA 1ZMZA 1OW4A 4OKHA 1AP4A 2LM5A 2LMTA 1DELA 1NSHA 1ZOTB 4C0LA 1NCZA 2BE4A 1C07A 5KTYA 3SG6A 2BCBA 5F6TA 1QV0A 1LINA 1QVIZ 2KFGA 3DXLA 1SCVA 3BUMB 3CS1A 3GK1A 3NSKA 3PN7C 2KI4C 3SG3A 2LAPA 1KWOC 4GAOA 4HRHA 4C0KA 1S3PA 2BBMA 3HX4A 3O4YA 1DMOA 1SSEB 2ZNDA 3LL8B 4GBAA 2FCEA 2NLNA 2Y1MA 1F70A 3TDUA 4JQ0D 1OOJA 4I5JA 1F55A 2AAOA 1SCMC 1SPYA 2L2CA 2LCPA 3EK8A 5HKZA 2LLSA 4A4BA 4L9MA 5DKRA 1MXEA 1JC2A 2ZNEA 1M45A 2B1UA
chains in the Genus database with same CATH topology
4MRYA 1YURA 2KGBC 1J7QA 1NPQA 2LP3A 4HREE 4OV2A 4DS7A 3MSEB 1SL7A 1TNPA 2OS8B 1A75A 1Q80A 1SK6D 1A03A 2MLFC 1IKUA 3CGAA 1CM1A 1JFKA 1OQPA 4P2YB 1QIWA 3PFVA 1UURA 1NX3A 1N2DA 2JULA 1A75B 2M97A 3PSRA 3OB1B 1BMOA 4NQGA 2KGRA 4GGFC 5K89A 2WNDA 2OTGB 3JVTB 1TIZA 4WRIA 1QVIY 1MUXA 2OPOA 4GPLB 2HF5A 1CMGA 1XFYO 2NZ0A 3IQOA 1AUIB 1MQ1A 4NDCA 1NCYA 2JNFA 2V53A 1S1EA 2L2EA 3PM8A 3ZNIA 2F8PA 1S36A 1XK4C 2KQYA 2MHHA 4BY4A 1K95A 1L2OB 1PULA 4D1EA 2E6WA 3HCMA 3SIBA 3CR2A 3VRRA 1RJVA 2WCFA 2AMIA 5G08A 1NX0A 1B8LA 1RECA 4M2QA 1QLSA 4NDBA 1YVLA 2KDHA 1C7VA 1R6PA 1B8CA 2JNXA 1BLQA 1ODBA 4MRXA 2LP2A 2LVJA 4FQOA 1K9UA 4DRWA 4PE1A 2KFHA 1IJ6A 4MEWA 2M29A 4ICBA 1SR6C 3TUYC 3JTDB 1RFJA 4HSZA 2DOQA 3SG5A 2LVVA 3EK7A 4PHJA 3ICBA 1AJ4A 1PVAA 1Y0VH 5CPVA 2MRDA 1TTXA 2M9GA 2ISDA 1XFZO 1BU3A 4I5KA 3OX5A 1IQ5A 3SG7A 2HQ8A 1QTXA 2M1UA 1K8UA 2EC6C 1HQVA 4PALA 2I2RE 1MR8A 4CFQA 2LMVA 1KFXL 3EVUA 4PHNA 1OMVA 4HRGA 3I5FB 3AKAA 2KYFA 5DKNA 2GV5A 2KAXA 3BUNB 5I2QA 2F2OA 3OB2B 2KOTA 1IWQA 1SL8A 3LK1A 1KK8C 1QXPA 1DJIA 2IS9A 3O6BA 5FYXA 1IRJA 1J1DA 2SCPA 1CLMA 1RROA 1GGWA 1XFUO 2GGMA 2G2BA 3WHTB 1N65A 1TNQA 1TOPA 3CZTX 1IG5A 3I5IC 1SW8A 3NSLA 5I8NA 1Y1UA 1DJHA 3H4SE 1WRZA 2KAYA 1XFXO 3I5HC 2BE6A 2L5XB 1BF5A 1FPWA 1DVIA 5BPJA 5IBWA 1FI6A 4I5LB 2JOJA 1RK9A 1ALVA 1ZUZA 1WDCB 1X02A 2KBIA 2PMYA 3NSOA 4MZKA 4MVFA 3EKHA 1RTP1 1Y6WA 3A8RA 1M46A 2F3ZA 2COLB 2CBLA 1IH0A 4GGNA 3CR4X 1K90D 1DJZA 4OVNF 2BKIB 1DT7B 1KQVA 4PE7A 1QX2A 3SG2A 2WCEA 1S26D 1R2UA 1RWYA 1UUSA 1AK8A 3KPXA 2BECA 2Y1NA 2KI4B 1D1OA 3AAJA 4N5XA 1J55A 1YRUB 2NCOA 4UPGA 1OZSA 4ZCUA 4GUKA 2FOTA 4P5OE 1QX7A 1G33A 1G4YR 4ORAB 2KI6D 2P6BB 5HLOA 3TZ1A 4ORBB 3FS7A 1B9AA 1JSAA 1PRWA 3SG4A 4PE4A 2JT0A 1YX8A 1CM4A 3SIAA 4XJKB 3DD4A 1DJXA 1PALA 2BCXA 2Q4UA 3I5GB 5DKQA 1DF0A 1DGUA 3E3RA 1WRLA 1GGZA 2KBMA 1UP5A 2MA2A 1NP8A 1NIWA 3D0YA 1XVJA 1DF0B 1F4OA 2LLUA 1U5IA 2PVBA 3WXAA 2BCAA 2LHIA 2KSPA 1EH2A 1EJ3A 3D0YB 1IJ5A 1U5IB 1ZACA 2M49B 2K2FA 3KO0A 2BL0B 5D69A 1SL9A 2L4HA 3TS5C 2M7NA 1CFPA 4PDZA 1J1EA 1NUBA 4IL1A 1B47A 2JTZA 2OS8C 4USLA 1M63B 1F4QA 2LNKA 3GK4X 3BUWB 5AERA 4TNCA 1J7OA 5ER4X 1KSOA 4ORCB 2VRGA 4C0JA 1YRTB 1FF1A 2HETA 1WLZA 1S6JA 5I2OA 2PASA 4MLWA 3JVTC 1AJ5A 1LA3A 2MJWB 1SNLA 1CB1A 1UHNA 1QS7A 4QJ3B 3D10A 3BUOB 1CTRA 2E30A 1Y1AA 2K0JA 3KHEA 1S6CA 3AAKA 4MBEA 2CNPA 4ZCVA 2KFFA 1KQMB 4MZLA 5AANA 3PATA 1PSRA 2JXCA 2CT9A 3NSIA 1F54A 1B7TZ 1MXLC 5HKYA 3FIAA 4AOMA 1CDPA 1EXRA 2H61A 4F0ZB 5AFPA 1S6IA 2F3YA 3BXKA 4CLNA 1BG1A 1DGVA 2CXJA 5TNCA 1E8AA 4R1EA 1GJYA 1K93D 1UHKA 1SKTA 2KYCA 2Q91A 5HYDA 3FWBA 2TN4A 2ZN8A 1N0YA 1XYDA 3EK4A 1K2HA 2LE9B 3WHUB 2GGZA 1TCFA 1SY9A 2K7BA 3EVRA 2M8UA 2EC6B 5CSJA 2G9BA 5AXIA 1EL4A 1NWDA 1BT6A 1L7ZA 2FCDA 2ZN9A 1A2XA 1PSBA 1QJTA 2QPTA 1TRFA 2K2AA 4I5NB 2PSRA 1KK8B 5B8IB 3TDIA 2H2KA 1QV1A 1UHIA 3VROA 3OP0A 3CWGA 1TNWA 4U8DA 5GQQC 4Q04A 1NX1A 2JZIA 2SASA 3I5IB 4E68A 1V1GA 1VRKA 5J3XA 1B7TY 1BODA 2CTNA 5HKWA 1TN4A 3A4UB 1CFDA 5CSIA 1GQMA 2D8NA 5CSNA 3VRQA 2KI6C 2L98A 3O2PA 1F8HA 2M1KB 4PCWA 1JBAA 4A4CA 1YUSA 1YTZC 2WC8A 2EGDA 1A4PA 2ZKMX 3GK2A 3QRXA 4WQ3A 1ZFSA 3KEVA 1LKJA 1UHHA 1CNPA 1AHRA 2I18A 1B1GA 1SMGA 4M2OA 2I7AA 4QJ4B 2PRUA 1DJGA 1LA0A 2JTTA 3K21A 4CPVA 4WQ2A 1K9KA 3PN7B 2L4IA 3CR5X 2LUXA 4AQJA 4DCKA 1F71A 1KWOB 1MF8B 4OR9B 2KQ6A 3OHMB 2LUCA 1CFCA 1QIVA 3DF0A 4YRUA 4FTGA 2HPSA 1YUTA 1TCOB 2NCPA 1WY9A 3CTNA 1SCMB 3DF0B 1QLKA 1KCYA 1K94A 1HT9A 4XJKA 4CFRA 4PE0A 3RM1A 1BJFA 4DUQA 1B4CA 1M39A 1CLLA 2K7DA 4JPZB 4CIDA 4YGDB 2R2IA 2MBXA 1OZOA 1UHJA 5JJGA 3LCPC 3DVJA 2K61A 1OE9B 1YX7A 4GGFA 1YR5A 1IQ3A 1YVHA 5HLVA 1CFFA 3EVVA 3KF9A 5JOLA 1H4BA 1KSMA 2JU0A 4GNKB 1JF2A 1CMFA 1DJWA 2O5GA 2LVIA 2ZFDA 2LHLA 2JPTA 3IQQA 1FW4A 1KFXS 3TUYB 3TS5B 4PHMA 1K96A 4N1FA 5D7FA 5KU1A 3I5GC 1IGVA 1QATA 1XK4A 2JRFA 3RLZA 1KFUL 2LANA 1LXFC 2LV7A 4YGAA 2Y5IA 4BY5A 1W7JB 2KAVA 1MWNA 1V1FA 1FBVA 2JT8A 1ALWA 1KK7Z 3VRNA 4AQIA 2OTGC 2LVKA 4ETOA 2BL0C 4MZJA 1SBJA 3C1VA 2M0RA 2LLTA 4GFTA 2HQWA 1J7RA 2LMUA 2FJUB 2WORA 3TDZA 2K7CA 4XYNA 4YI8A 1BR1B 1L2OC 3BYAA 1B8RA 3BUXB 1A29A 2WCBA 1NYAA 1WRKA 1XA5A 1SR6B 2K7OA 2JWWA 1S5GZ 1NX2A 2KNEA 2L51A 1M31A 1BR4B 2ZRSA 5AEQA 3BQ3A 4QJ5B 2BKHB 4YBHB 2L0PA 3CLNA 1JF0A 1XO5A 1KQMC 1OMRA 3DVKA 1XFWO 1LVCD 1SYMA 2O60A 3OX6A 4JWQA 2LC5A 1OMDA 1G8IA 3JTDC 1SRAA 2NXQA 1KK7Y 1CKKA 1YUUA 3BOWA 1CDNA 4NDDA 3LLEA 2QACA 2M3WA 1JWDA 3VGOA 1PVBA 2H61C 2A4JA 1EG3A 3BOWB 3PLFB 3O78A 2WOSA 1CDMA 3FWCA 2PALA 2JT3A 3F45A 1DTLA 3EKJA 4MSPA 3VRPA 2CCMA 4MN0A 2KHNA 2L50A 3ZWHA 1QX5B 3I5FC 2MAZA 4YGCB 4DIRA 3I5HB 5PALA 1PK0D 1W7IB 1MHOA 1S5GY 2K8MB 3PALA 1TNXA 2M7LA 3M0WA 2AUCA 5ER5A 1WLMA 1AVSA 4YGEB 3WNXB 1J7PA 1OSAA 2BBNA 2F33A 3SJSA 5KSZA 3LK0A 1BOCA 3IF7A 2F2PA 3DVMA 1DJYA 1C7WA 4N1GA 2EHBA 2MLEC 3DVEA 1XFVO 1JFJA 1CLBA 4PHKA 1KFUS 4OCIA 4M2PA 1NCXA 1FI5A 1CDLA 1QASA 4YI9A 5I2LA 1H8BA 1JUOA 3NXAA 2JQ6A 2RGIA 2ZRTA 1EG4A 3AKBA 1WDCC 1K9PA 1Y1XA 5CSFA 2I94A 2JC2A 4YGBB 2JXLA 3GOFA 1UWOA 2Y4QA 1ZMZA 4OKHA 1AP4A 2LM5A 2LMTA 1NSHA 1ZOTB 4C0LA 1NCZA 2BE4A 1C07A 5KTYA 3SG6A 2BCBA 5F6TA 1QV0A 1LINA 1QVIZ 2KFGA 1SCVA 3BUMB 3CS1A 3GK1A 3NSKA 3PN7C 2KI4C 3SG3A 2LAPA 1KWOC 4GAOA 4HRHA 4C0KA 1S3PA 2BBMA 3HX4A 3O4YA 1DMOA 2ZNDA 3LL8B 4GBAA 2FCEA 2NLNA 2Y1MA 1F70A 3TDUA 4JQ0D 1OOJA 4I5JA 1F55A 2AAOA 1SCMC 1SPYA 2LCPA 3EK8A 5HKZA 4A4BA 2LLSA 4L9MA 5DKRA 1MXEA 1JC2A 2ZNEA 1M45A 2B1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRY A;  1YUR A;  2KGB C;  1J7Q A;  1NPQ A;  2LP3 A;  4HRE E;  4OV2 A;  4DS7 A;  3MSE B;  1SL7 A;  1TNP A;  2OS8 B;  1A75 A;  1Q80 A;  1SK6 D;  1A03 A;  2MLF C;  1IKU A;  3CGA A;  1CM1 A;  1JFK A;  1OQP A;  4P2Y B;  1QIW A;  3PFV A;  1UUR A;  1NX3 A;  1N2D A;  2JUL A;  1A75 B;  2M97 A;  3PSR A;  3OB1 B;  1BMO A;  4NQG A;  2KGR A;  4GGF C;  5K89 A;  2WND A;  2OTG B;  3JVT B;  1TIZ A;  4WRI A;  1QVI Y;  1MUX A;  2OPO A;  4GPL B;  2HF5 A;  1CMG A;  1XFY O;  2NZ0 A;  3IQO A;  1AUI B;  1MQ1 A;  4NDC A;  1NCY A;  2JNF A;  2V53 A;  1S1E A;  2L2E A;  3PM8 A;  3ZNI A;  2F8P A;  1S36 A;  1XK4 C;  2KQY A;  2MHH A;  4BY4 A;  1K95 A;  1L2O B;  1PUL A;  4D1E A;  2E6W A;  3HCM A;  3SIB A;  3CR2 A;  3VRR A;  1RJV A;  2WCF A;  2AMI A;  5G08 A;  1NX0 A;  1B8L A;  1REC A;  4M2Q A;  1QLS A;  4NDB A;  1YVL A;  2KDH A;  1C7V A;  1R6P A;  1B8C A;  2JNX A;  1BLQ A;  1ODB A;  4MRX A;  2LP2 A;  2LVJ A;  4FQO A;  1K9U A;  4DRW A;  4PE1 A;  2KFH A;  1IJ6 A;  4MEW A;  2M29 A;  4ICB A;  1SR6 C;  3TUY C;  3JTD B;  1RFJ A;  4HSZ A;  2DOQ A;  3SG5 A;  2LVV A;  3EK7 A;  4PHJ A;  3ICB A;  1AJ4 A;  1PVA A;  1Y0V H;  5CPV A;  2MRD A;  1TTX A;  2M9G A;  2ISD A;  1XFZ O;  1BU3 A;  4I5K A;  3OX5 A;  1IQ5 A;  3SG7 A;  2HQ8 A;  1QTX A;  2M1U A;  1K8U A;  2EC6 C;  1HQV A;  4PAL A;  2I2R E;  1MR8 A;  4CFQ A;  2LMV A;  1KFX L;  3EVU A;  4PHN A;  1OMV A;  4HRG A;  3I5F B;  3AKA A;  2KYF A;  5DKN A;  2GV5 A;  2KAX A;  3BUN B;  5I2Q A;  2F2O A;  3OB2 B;  2KOT A;  1IWQ A;  1SL8 A;  3LK1 A;  1KK8 C;  1QXP A;  1DJI A;  2IS9 A;  3O6B A;  5FYX A;  1IRJ A;  1J1D A;  2SCP A;  1CLM A;  1RRO A;  1GGW A;  1XFU O;  2GGM A;  2G2B A;  3WHT B;  1N65 A;  1TNQ A;  1TOP A;  3CZT X;  1IG5 A;  3I5I C;  1SW8 A;  3NSL A;  5I8N A;  1Y1U A;  1DJH A;  3H4S E;  1WRZ A;  2KAY A;  1XFX O;  3I5H C;  2BE6 A;  2L5X B;  1BF5 A;  1FPW A;  1DVI A;  5BPJ A;  5IBW A;  1FI6 A;  4I5L B;  2JOJ A;  1RK9 A;  1ALV A;  1ZUZ A;  1WDC B;  1X02 A;  2KBI A;  2PMY A;  3NSO A;  4MZK A;  4MVF A;  3EKH A;  1RTP 1;  1Y6W A;  3A8R A;  1M46 A;  2F3Z A;  2COL B;  2CBL A;  1IH0 A;  4GGN A;  3CR4 X;  1K90 D;  1DJZ A;  4OVN F;  2BKI B;  1DT7 B;  1KQV A;  4PE7 A;  1QX2 A;  3SG2 A;  2WCE A;  1S26 D;  1R2U A;  1RWY A;  1UUS A;  1AK8 A;  3KPX A;  2BEC A;  2Y1N A;  2KI4 B;  1D1O A;  3AAJ A;  4N5X A;  1J55 A;  1YRU B;  2NCO A;  4UPG A;  1OZS A;  4ZCU A;  4GUK A;  2FOT A;  4P5O E;  1QX7 A;  1G33 A;  1G4Y R;  4ORA B;  2KI6 D;  2P6B B;  5HLO A;  3TZ1 A;  4ORB B;  3FS7 A;  1B9A A;  1JSA A;  1PRW A;  3SG4 A;  4PE4 A;  2JT0 A;  1YX8 A;  1CM4 A;  3SIA A;  4XJK B;  3DD4 A;  1DJX A;  1PAL A;  2BCX A;  2Q4U A;  3I5G B;  5DKQ A;  1DF0 A;  1DGU A;  3E3R A;  1WRL A;  1GGZ A;  2KBM A;  1UP5 A;  2MA2 A;  1NP8 A;  1NIW A;  3D0Y A;  1XVJ A;  1DF0 B;  1F4O A;  2LLU A;  1U5I A;  2PVB A;  3WXA A;  2BCA A;  2LHI A;  2KSP A;  1EH2 A;  1EJ3 A;  3D0Y B;  1IJ5 A;  1U5I B;  1ZAC A;  2M49 B;  2K2F A;  3KO0 A;  2BL0 B;  5D69 A;  1SL9 A;  2L4H A;  3TS5 C;  2M7N A;  1CFP A;  4PDZ A;  1J1E A;  1NUB A;  4IL1 A;  1B47 A;  2JTZ A;  2OS8 C;  4USL A;  1M63 B;  1F4Q A;  2LNK A;  3GK4 X;  3BUW B;  5AER A;  4TNC A;  1J7O A;  5ER4 X;  1KSO A;  4ORC B;  2VRG A;  4C0J A;  1YRT B;  1FF1 A;  2HET A;  1WLZ A;  1S6J A;  5I2O A;  2PAS A;  4MLW A;  3JVT C;  1AJ5 A;  1LA3 A;  2MJW B;  1SNL A;  1CB1 A;  1UHN A;  1QS7 A;  4QJ3 B;  3D10 A;  3BUO B;  1CTR A;  2E30 A;  1Y1A A;  2K0J A;  3KHE A;  1S6C A;  3AAK A;  4MBE A;  2CNP A;  4ZCV A;  2KFF A;  1KQM B;  4MZL A;  5AAN A;  3PAT A;  1PSR A;  2JXC A;  2CT9 A;  3NSI A;  1F54 A;  1B7T Z;  1MXL C;  5HKY A;  3FIA A;  4AOM A;  1CDP A;  1EXR A;  2H61 A;  4F0Z B;  5AFP A;  1S6I A;  2F3Y A;  3BXK A;  4CLN A;  1BG1 A;  1DGV A;  2CXJ A;  5TNC A;  1E8A A;  4R1E A;  1GJY A;  1K93 D;  1UHK A;  1SKT A;  2KYC A;  2Q91 A;  5HYD A;  3FWB A;  2TN4 A;  2ZN8 A;  1N0Y A;  1XYD A;  3EK4 A;  1K2H A;  2LE9 B;  3WHU B;  2GGZ A;  1TCF A;  1SY9 A;  2K7B A;  3EVR A;  2M8U A;  2EC6 B;  5CSJ A;  2G9B A;  5AXI A;  1EL4 A;  1NWD A;  1BT6 A;  1L7Z A;  2FCD A;  2ZN9 A;  1A2X A;  1PSB A;  1QJT A;  2QPT A;  1TRF A;  2K2A A;  4I5N B;  2PSR A;  1KK8 B;  5B8I B;  3TDI A;  2H2K A;  1QV1 A;  1UHI A;  3VRO A;  3OP0 A;  3CWG A;  1TNW A;  4U8D A;  5GQQ C;  4Q04 A;  1NX1 A;  2JZI A;  2SAS A;  3I5I B;  4E68 A;  1V1G A;  1VRK A;  5J3X A;  1B7T Y;  1BOD A;  2CTN A;  5HKW A;  1TN4 A;  3A4U B;  1CFD A;  5CSI A;  1GQM A;  2D8N A;  5CSN A;  3VRQ A;  2KI6 C;  2L98 A;  3O2P A;  1F8H A;  2M1K B;  4PCW A;  1JBA A;  4A4C A;  1YUS A;  1YTZ C;  2WC8 A;  2EGD A;  1A4P A;  2ZKM X;  3GK2 A;  3QRX A;  4WQ3 A;  1ZFS A;  3KEV A;  1LKJ A;  1UHH A;  1CNP A;  1AHR A;  2I18 A;  1B1G A;  1SMG A;  4M2O A;  2I7A A;  4QJ4 B;  2PRU A;  1DJG A;  1LA0 A;  2JTT A;  3K21 A;  4CPV A;  4WQ2 A;  1K9K A;  3PN7 B;  2L4I A;  3CR5 X;  2LUX A;  4AQJ A;  4DCK A;  1F71 A;  1KWO B;  1MF8 B;  4OR9 B;  2KQ6 A;  3OHM B;  2LUC A;  1CFC A;  1QIV A;  3DF0 A;  4YRU A;  4FTG A;  2HPS A;  1YUT A;  1TCO B;  2NCP A;  1WY9 A;  3CTN A;  1SCM B;  3DF0 B;  1QLK A;  1KCY A;  1K94 A;  1HT9 A;  4XJK A;  4CFR A;  4PE0 A;  3RM1 A;  1BJF A;  4DUQ A;  1B4C A;  1M39 A;  1CLL A;  2K7D A;  4JPZ B;  4CID A;  4YGD B;  2R2I A;  2MBX A;  1OZO A;  1UHJ A;  5JJG A;  3LCP C;  3DVJ A;  2K61 A;  1OE9 B;  1YX7 A;  4GGF A;  1YR5 A;  1IQ3 A;  1YVH A;  5HLV A;  1CFF A;  3EVV A;  3KF9 A;  5JOL A;  1H4B A;  1KSM A;  2JU0 A;  4GNK B;  1JF2 A;  1CMF A;  1DJW A;  2O5G A;  2LVI A;  2ZFD A;  2LHL A;  2JPT A;  3IQQ A;  1FW4 A;  1KFX S;  3TUY B;  3TS5 B;  4PHM A;  1K96 A;  4N1F A;  5D7F A;  5KU1 A;  3I5G C;  1IGV A;  1QAT A;  1XK4 A;  2JRF A;  3RLZ A;  1KFU L;  2LAN A;  1LXF C;  2LV7 A;  4YGA A;  2Y5I A;  4BY5 A;  1W7J B;  2KAV A;  1MWN A;  1V1F A;  1FBV A;  2JT8 A;  1ALW A;  1KK7 Z;  3VRN A;  4AQI A;  2OTG C;  2LVK A;  4ETO A;  2BL0 C;  4MZJ A;  1SBJ A;  3C1V A;  2M0R A;  2LLT A;  4GFT A;  2HQW A;  1J7R A;  2LMU A;  2FJU B;  2WOR A;  3TDZ A;  2K7C A;  4XYN A;  4YI8 A;  1BR1 B;  1L2O C;  3BYA A;  1B8R A;  3BUX B;  1A29 A;  2WCB A;  1NYA A;  1WRK A;  1XA5 A;  1SR6 B;  2K7O A;  2JWW A;  1S5G Z;  1NX2 A;  2KNE A;  2L51 A;  1M31 A;  1BR4 B;  2ZRS A;  5AEQ A;  3BQ3 A;  4QJ5 B;  2BKH B;  4YBH B;  2L0P A;  3CLN A;  1JF0 A;  1XO5 A;  1KQM C;  1OMR A;  3DVK A;  1XFW O;  1LVC D;  1SYM A;  2O60 A;  3OX6 A;  4JWQ A;  2LC5 A;  1OMD A;  1G8I A;  3JTD C;  1SRA A;  2NXQ A;  1KK7 Y;  1CKK A;  1YUU A;  3BOW A;  1CDN A;  4NDD A;  3LLE A;  2QAC A;  2M3W A;  1JWD A;  3VGO A;  1PVB A;  2H61 C;  2A4J A;  1EG3 A;  3BOW B;  3PLF B;  3O78 A;  2WOS A;  1CDM A;  3FWC A;  2PAL A;  2JT3 A;  3F45 A;  1DTL A;  3EKJ A;  4MSP A;  3VRP A;  2CCM A;  4MN0 A;  2KHN A;  2L50 A;  3ZWH A;  1QX5 B;  3I5F C;  2MAZ A;  4YGC B;  4DIR A;  3I5H B;  5PAL A;  1PK0 D;  1W7I B;  1MHO A;  1S5G Y;  2K8M B;  3PAL A;  1TNX A;  2M7L A;  3M0W A;  2AUC A;  5ER5 A;  1WLM A;  1AVS A;  4YGE B;  3WNX B;  1J7P A;  1OSA A;  2BBN A;  2F33 A;  3SJS A;  5KSZ A;  3LK0 A;  1BOC A;  3IF7 A;  2F2P A;  3DVM A;  1DJY A;  1C7W A;  4N1G A;  2EHB A;  2MLE C;  3DVE A;  1XFV O;  1JFJ A;  1CLB A;  4PHK A;  1KFU S;  4OCI A;  4M2P A;  1NCX A;  1FI5 A;  1CDL A;  1QAS A;  4YI9 A;  5I2L A;  1H8B A;  1JUO A;  3NXA A;  2JQ6 A;  2RGI A;  2ZRT A;  1EG4 A;  3AKB A;  1WDC C;  1K9P A;  1Y1X A;  5CSF A;  2I94 A;  2JC2 A;  4YGB B;  2JXL A;  3GOF A;  1UWO A;  2Y4Q A;  1ZMZ A;  4OKH A;  1AP4 A;  2LM5 A;  2LMT A;  1NSH A;  1ZOT B;  4C0L A;  1NCZ A;  2BE4 A;  1C07 A;  5KTY A;  3SG6 A;  2BCB A;  5F6T A;  1QV0 A;  1LIN A;  1QVI Z;  2KFG A;  1SCV A;  3BUM B;  3CS1 A;  3GK1 A;  3NSK A;  3PN7 C;  2KI4 C;  3SG3 A;  2LAP A;  1KWO C;  4GAO A;  4HRH A;  4C0K A;  1S3P A;  2BBM A;  3HX4 A;  3O4Y A;  1DMO A;  2ZND A;  3LL8 B;  4GBA A;  2FCE A;  2NLN A;  2Y1M A;  1F70 A;  3TDU A;  4JQ0 D;  1OOJ A;  4I5J A;  1F55 A;  2AAO A;  1SCM C;  1SPY A;  2LCP A;  3EK8 A;  5HKZ A;  4A4B A;  2LLS A;  4L9M A;  5DKR A;  1MXE A;  1JC2 A;  2ZNE A;  1M45 A;  2B1U A; 
#chains in the Genus database with same CATH topology
 4MRY A;  3FE6 A;  1YUR A;  2KGB C;  1J7Q A;  1NPQ A;  2LP3 A;  4HRE E;  4OV2 A;  1XFR A;  4DS7 A;  2WCJ A;  3IVT A;  3MSE B;  1SL7 A;  1TNP A;  2OS8 B;  1A75 A;  1Q80 A;  1SK6 D;  1A03 A;  3D77 A;  2MLF C;  1IKU A;  2H8V A;  3CGA A;  1CM1 A;  1JFK A;  1OQP A;  3CDN A;  4P2Y B;  1QIW A;  3PFV A;  1UUR A;  1NX3 A;  1N2D A;  2JUL A;  1A75 B;  2M97 A;  3PSR A;  3B6X A;  3OB1 B;  1BMO A;  4NQG A;  2KGR A;  4GGF C;  5K89 A;  3Q8I A;  2WND A;  2OTG B;  3JVT B;  1TIZ A;  2QEB A;  3R1P A;  4WRI A;  1QVI Y;  1MUX A;  2OPO A;  4GPL B;  2HF5 A;  1CMG A;  1XFY O;  3D75 A;  2NZ0 A;  3S0A A;  3IQO A;  1AUI B;  1MQ1 A;  4NDC A;  1NCY A;  2JNF A;  2V53 A;  1S1E A;  2L2E A;  3PM8 A;  3ZNI A;  2F8P A;  1S36 A;  1XK4 C;  2KQY A;  2MHH A;  4BY4 A;  1K95 A;  1L2O B;  1PUL A;  4D1E A;  2GTE A;  2E6W A;  3HCM A;  1TUZ A;  3CR2 A;  3SIB A;  3VRR A;  1RJV A;  2QEV A;  2WCF A;  5D3O A;  2AMI A;  5G08 A;  1NX0 A;  1B8L A;  2JPO A;  1REC A;  4M2Q A;  1QLS A;  4NDB A;  1YVL A;  2KDH A;  1C7V A;  1R6P A;  2KLE A;  1B8C A;  2JNX A;  1BLQ A;  1ODB A;  4MRX A;  2LP2 A;  3D78 A;  2LVJ A;  4FQO A;  1K9U A;  4DRW A;  4PE1 A;  2KFH A;  1IJ6 A;  4JKT A;  4MEW A;  3S0B A;  2M29 A;  3BFB A;  1SR6 C;  4ICB A;  3TUY C;  3JTD B;  2P71 A;  1RFJ A;  4HSZ A;  3TS5 C;  2DOQ A;  3SG5 A;  2LVV A;  3EK7 A;  3FE9 A;  4PHJ A;  3ICB A;  5I94 A;  1AJ4 A;  1PVA A;  1Y0V H;  5CPV A;  2MRD A;  1TTX A;  2M9G A;  2ISD A;  1XFZ O;  1BU3 A;  3UNW A;  4I5K A;  3OX5 A;  1IQ5 A;  3SG7 A;  2HQ8 A;  1DEK A;  1QTX A;  1Z4H A;  4KYN A;  2M1U A;  1K8U A;  2EC6 C;  1HQV A;  4PAL A;  2I2R E;  1MR8 A;  4CFQ A;  1T14 A;  2LMV A;  1KFX L;  3EVU A;  4PHN A;  1W9Z A;  1OMV A;  4HRG A;  3I5F B;  3AKA A;  1DQE A;  2KYF A;  5DKN A;  2GV5 A;  2KAX A;  3BUN B;  5I2Q A;  2F2O A;  3OB2 B;  1DC1 A;  2KOT A;  1IWQ A;  1SL8 A;  3LK1 A;  1KK8 C;  1QXP A;  3N7H A;  1OOF A;  1DJI A;  2IS9 A;  3O6B A;  5FYX A;  1IRJ A;  1J1D A;  2SCP A;  1CLM A;  5HL1 A;  2KLD A;  1RRO A;  1GGW A;  1XFU O;  2GGM A;  2G2B A;  3WHT B;  1N65 A;  1TNQ A;  1TOP A;  3CZT X;  1IG5 A;  3I5I C;  1SW8 A;  3NSL A;  5I8N A;  1Y1U A;  1DJH A;  3H4S E;  1WRZ A;  2KAY A;  1XFX O;  3O4X A;  3I5H C;  2BE6 A;  2L5X B;  1BF5 A;  1FPW A;  2WC6 A;  1DVI A;  5BPJ A;  5IBW A;  1FI6 A;  4I5L B;  3OBV A;  2JOJ A;  1RK9 A;  1ALV A;  1ZUZ A;  1WDC B;  1X02 A;  2KBI A;  2PMY A;  3NSO A;  4MZK A;  4MVF A;  3EKH A;  3BFA A;  1RTP 1;  1Y6W A;  2WCM A;  3A8R A;  1M46 A;  2F3Z A;  2COL B;  2CBL A;  1IH0 A;  4GGN A;  1OOI X;  3CR4 X;  1K90 D;  1DJZ A;  4OVN F;  3D74 A;  2BKI B;  3FE8 A;  1DT7 B;  1KQV A;  4PE7 A;  1QX2 A;  3SG2 A;  2WCE A;  1S26 D;  1R2U A;  1RWY A;  1UUS A;  1AK8 A;  3KPX A;  2BEC A;  2Y1N A;  2KI4 B;  1D1O A;  3AAJ A;  4N5X A;  1J55 A;  1YRU B;  2NCO A;  4F7F A;  1OZS A;  4ZCU A;  4UPG A;  4GUK A;  2FOT A;  4P5O E;  1QX7 A;  1G33 A;  1G4Y R;  3SS5 A;  3DYE A;  4ORA B;  2KI6 D;  1OOG A;  2P6B B;  5HLO A;  5FI7 A;  3TZ1 A;  4ORB B;  3FS7 A;  3S0D A;  1B9A A;  1JSA A;  1PRW A;  3SG4 A;  4PE4 A;  2JT0 A;  1YX8 A;  1CM4 A;  3SIA A;  4XJK B;  3DD4 A;  1DJX A;  1PAL A;  2BCX A;  2Q4U A;  3I5G B;  5DKQ A;  1DF0 A;  1DGU A;  3B7A A;  2P70 A;  3E3R A;  4PT1 A;  1WRL A;  1GGZ A;  2KBM A;  1UP5 A;  2MA2 A;  1NP8 A;  4INW A;  1NIW A;  3B88 A;  3S0G A;  3D0Y A;  1XVJ A;  1DF0 B;  2L5Y A;  1F4O A;  2LLU A;  1U5I A;  2PVB A;  3WXA A;  2BCA A;  2LHI A;  2KSP A;  1EH2 A;  1EJ3 A;  1QWV A;  3D0Y B;  1IJ5 A;  4INX A;  1GM0 A;  1U5I B;  1ZAC A;  2M49 B;  2K2F A;  2PYQ A;  2BL0 B;  3KO0 A;  1SL9 A;  2L4H A;  5D69 A;  4OZD A;  2M7N A;  1CFP A;  4PDZ A;  1J1E A;  1NUB A;  4IL1 A;  1B47 A;  2JTZ A;  2OS8 C;  4USL A;  1LS8 A;  1M63 B;  5DIC A;  1F4Q A;  2LNK A;  3GK4 X;  1TUJ A;  3BUW B;  3S0E A;  4TNC A;  5AER A;  1J7O A;  5ER4 X;  1KSO A;  2BNX A;  4ORC B;  3L4A A;  2VRG A;  4C0J A;  1YRT B;  1FF1 A;  2HET A;  1WLZ A;  1S6J A;  5I2O A;  2PAS A;  4MLW A;  3JVT C;  1AJ5 A;  3B87 A;  1LA3 A;  2MJW B;  3D76 A;  1SNL A;  1CB1 A;  1UHN A;  1QS7 A;  4QJ3 B;  3D10 A;  3BUO B;  1CTR A;  2E30 A;  1Y1A A;  2K0J A;  3KHE A;  1S6C A;  3AAK A;  2QEO A;  4MBE A;  2CNP A;  4ZCV A;  2KFF A;  1KQM B;  4MZL A;  5AAN A;  3PAT A;  1PSR A;  2JXC A;  2CT9 A;  3NSI A;  1F54 A;  1B7T Z;  1MXL C;  5HKY A;  3FIA A;  4AOM A;  1CDP A;  1EXR A;  2H61 A;  4F0Z B;  5AFP A;  1S6I A;  2F3Y A;  3BXK A;  4CLN A;  1BG1 A;  1DGV A;  2CXJ A;  5TNC A;  1E8A A;  4R1E A;  1GJY A;  1K93 D;  1UHK A;  1SKT A;  2FJY A;  2KYC A;  2Q91 A;  5HYD A;  3FWB A;  3CZ1 A;  2TN4 A;  2ZN8 A;  1N0Y A;  1XYD A;  3EK4 A;  1K2H A;  2LE9 B;  3WHU B;  2GGZ A;  1TCF A;  1SY9 A;  2K7B A;  3VB1 A;  3EVR A;  2M8U A;  2EC6 B;  5CSJ A;  2G9B A;  5AXI A;  1EL4 A;  1NWD A;  1BT6 A;  1L7Z A;  5FI2 A;  3DY9 A;  2FCD A;  2ZN9 A;  1Z2C B;  1A2X A;  1PSB A;  2KPH A;  1QJT A;  2QPT A;  1TRF A;  2K2A A;  4IJ7 A;  4I5N B;  2PSR A;  1KK8 B;  5EL2 A;  5B8I B;  3TDI A;  2H2K A;  1QV1 A;  1UHI A;  3VRO A;  3OP0 A;  3EG5 B;  3CWG A;  1TNW A;  4U8D A;  5GQQ C;  1IIO A;  4Q04 A;  1NX1 A;  2JZI A;  2SAS A;  3I5I B;  4E68 A;  1V1G A;  1VRK A;  5J3X A;  1B7T Y;  1BOD A;  2CTN A;  5HKW A;  1TN4 A;  3A4U B;  3BJH A;  1CFD A;  5CSI A;  1GQM A;  2D8N A;  5CSN A;  3VRQ A;  2KI6 C;  2L98 A;  3L4L A;  3O2P A;  1F8H A;  2M1K B;  4PCW A;  1JBA A;  4A4C A;  3NHI A;  1YUS A;  4JD9 A;  1YTZ C;  2WC8 A;  2EGD A;  3B86 A;  1A4P A;  2ZKM X;  3R72 A;  3GK2 A;  3QRX A;  4WQ3 A;  1ZFS A;  3KEV A;  1LKJ A;  1UHH A;  1CNP A;  1AHR A;  2I18 A;  1B1G A;  1SMG A;  4M2O A;  2I7A A;  4QJ4 B;  1TWO A;  2PRU A;  3SS3 A;  1DJG A;  1LA0 A;  2JTT A;  3K21 A;  4CPV A;  4WQ2 A;  1K9K A;  3PN7 B;  2L4I A;  3CR5 X;  2LUX A;  4AQJ A;  4DCK A;  3SS4 A;  1F71 A;  1KWO B;  1MF8 B;  4OR9 B;  2KQ6 A;  3OHM B;  2LUC A;  1CFC A;  1QIV A;  3DF0 A;  4YRU A;  4FTG A;  2HPS A;  1YUT A;  1TCO B;  2NCP A;  1WY9 A;  3BFH A;  3CTN A;  1SCM B;  3D73 A;  3DF0 B;  1QLK A;  1KCY A;  1K94 A;  1HT9 A;  1C3Y A;  4XJK A;  4CFR A;  4PE0 A;  2WCK A;  3S0F A;  3RM1 A;  1BJF A;  4DUQ A;  1B4C A;  3RZS A;  1M39 A;  1CLL A;  2K7D A;  4JPZ B;  4CID A;  4YGD B;  2R2I A;  3CZ0 A;  2MBX A;  1OZO A;  1UHJ A;  5JJG A;  3LCP C;  3DVJ A;  2K61 A;  1OE9 B;  1YX7 A;  4GGF A;  1YR5 A;  1IQ3 A;  1YVH A;  3K1E A;  5HLV A;  1CFF A;  3EVV A;  3KF9 A;  5JOL A;  1H4B A;  1KSM A;  2JU0 A;  4GNK B;  1JF2 A;  1CMF A;  1DJW A;  2O5G A;  3NGV A;  2LVI A;  2ZFD A;  2WCL A;  2LHL A;  2JPT A;  3IQQ A;  1FW4 A;  1KFX S;  3TUY B;  3TS5 B;  4PHM A;  1K96 A;  4N1F A;  2YGU A;  3DZT A;  5D7F A;  5KU1 A;  3I5G C;  1IGV A;  1QAT A;  1XK4 A;  3CAB A;  2JRF A;  3RLZ A;  1KFU L;  1ORG A;  1LXF C;  2LAN A;  2LV7 A;  3PM2 A;  2QDI A;  2Y5I A;  4YGA A;  4BY5 A;  1W7J B;  3R1V A;  2KAV A;  1MWN A;  1V1F A;  1FBV A;  2JT8 A;  1ALW A;  1KK7 Z;  3VRN A;  4AQI A;  2OTG C;  1OOH A;  2LVK A;  4ETO A;  2BL0 C;  4MZJ A;  3CYZ A;  1SBJ A;  3QME A;  2ERB A;  3C1V A;  2M0R A;  4FQT A;  2LLT A;  1C3Z A;  4GFT A;  2HQW A;  1J7R A;  2LMU A;  2FJU B;  2WOR A;  3TDZ A;  2K7C A;  4XYN A;  4YI8 A;  1BR1 B;  1L2O C;  3BYA A;  1B8R A;  3BUX B;  1A29 A;  2WCB A;  3PJI A;  1NYA A;  1WRK A;  1XA5 A;  1SR6 B;  2K7O A;  2JWW A;  1S5G Z;  1NX2 A;  2KNE A;  2L51 A;  5FI6 A;  1M31 A;  1BR4 B;  2ZRS A;  5AEQ A;  3BQ3 A;  4QJ5 B;  2BKH B;  4YBH B;  2L0P A;  3CLN A;  1JF0 A;  1XO5 A;  1KQM C;  1OMR A;  3DVK A;  1XFW O;  1LVC D;  1SYM A;  2O60 A;  3OX6 A;  4JWQ A;  2LC5 A;  1P28 A;  1OMD A;  1G8I A;  3JTD C;  1SRA A;  2NXQ A;  1KK7 Y;  1CKK A;  1YUU A;  3BOW A;  1CDN A;  4NDD A;  3OGN A;  3LLE A;  2QAC A;  2M3W A;  1JWD A;  3VGO A;  1PVB A;  2H61 C;  2A4J A;  3V2L A;  1EG3 A;  3BOW B;  3PLF B;  3O78 A;  2WOS A;  1CDM A;  3FWC A;  2PAL A;  2JT3 A;  3F45 A;  1DTL A;  3EKJ A;  4MSP A;  3VRP A;  2CCM A;  4MN0 A;  2KHN A;  2L50 A;  2BAP A;  3ZWH A;  1QX5 B;  3I5F C;  2MAZ A;  4YGC B;  4DIR A;  3I5H B;  2PQL A;  5PAL A;  1PK0 D;  1W7I B;  1MHO A;  1S5G Y;  2K8M B;  3PAL A;  1TNX A;  2M7L A;  3M0W A;  2AUC A;  5ER5 A;  1WLM A;  1AVS A;  4YGE B;  3WNX B;  1J7P A;  1OSA A;  2BBN A;  2F33 A;  3SJS A;  2K60 A;  2WC5 A;  5KSZ A;  2WCH A;  3LK0 A;  1BOC A;  3IF7 A;  2F2P A;  3DVM A;  1DJY A;  1C7W A;  3R1O A;  4N1G A;  2EHB A;  2MLE C;  3DVE A;  1XFV O;  1JFJ A;  1CLB A;  4PHK A;  1KFU S;  4OCI A;  4M2P A;  3UO9 A;  1NCX A;  1FI5 A;  1CDL A;  1QAS A;  4YI9 A;  5I2L A;  1H8B A;  1JUO A;  3NXA A;  2JQ6 A;  2RGI A;  2ZRT A;  1EG4 A;  3CZ2 A;  3AKB A;  1WDC C;  1K9P A;  1Y1X A;  5CSF A;  2I94 A;  2JC2 A;  4YGB B;  2QEH A;  2JXL A;  3GOF A;  1UWO A;  2Y4Q A;  3L47 A;  3NHT A;  1ZMZ A;  1OW4 A;  4OKH A;  1AP4 A;  2LM5 A;  2LMT A;  1DEL A;  1NSH A;  1ZOT B;  4C0L A;  1NCZ A;  2BE4 A;  1C07 A;  5KTY A;  3SG6 A;  2BCB A;  5F6T A;  1QV0 A;  1LIN A;  1QVI Z;  2KFG A;  3DXL A;  1SCV A;  3BUM B;  3CS1 A;  3GK1 A;  3NSK A;  3PN7 C;  2KI4 C;  3SG3 A;  2LAP A;  1KWO C;  4GAO A;  4HRH A;  4C0K A;  1S3P A;  2BBM A;  3HX4 A;  3O4Y A;  1DMO A;  1SSE B;  2ZND A;  3LL8 B;  4GBA A;  2FCE A;  2NLN A;  2Y1M A;  1F70 A;  3TDU A;  4JQ0 D;  1OOJ A;  4I5J A;  1F55 A;  2AAO A;  1SCM C;  1SPY A;  2L2C A;  2LCP A;  3EK8 A;  5HKZ A;  2LLS A;  4A4B A;  4L9M A;  5DKR A;  1MXE A;  1JC2 A;  2ZNE A;  1M45 A;  2B1U A; 
#chains in the Genus database with same CATH homology
 4MRY A;  1YUR A;  2KGB C;  1J7Q A;  1NPQ A;  2LP3 A;  4HRE E;  4OV2 A;  4DS7 A;  3MSE B;  1SL7 A;  1TNP A;  2OS8 B;  1A75 A;  1Q80 A;  1SK6 D;  1A03 A;  2MLF C;  1IKU A;  3CGA A;  1CM1 A;  1JFK A;  1OQP A;  4P2Y B;  1QIW A;  3PFV A;  1UUR A;  1NX3 A;  1N2D A;  2JUL A;  1A75 B;  2M97 A;  3PSR A;  3OB1 B;  1BMO A;  4NQG A;  2KGR A;  4GGF C;  5K89 A;  2WND A;  2OTG B;  3JVT B;  1TIZ A;  4WRI A;  1QVI Y;  1MUX A;  2OPO A;  4GPL B;  2HF5 A;  1CMG A;  1XFY O;  2NZ0 A;  3IQO A;  1AUI B;  1MQ1 A;  4NDC A;  1NCY A;  2JNF A;  2V53 A;  1S1E A;  2L2E A;  3PM8 A;  3ZNI A;  2F8P A;  1S36 A;  1XK4 C;  2KQY A;  2MHH A;  4BY4 A;  1K95 A;  1L2O B;  1PUL A;  4D1E A;  2E6W A;  3HCM A;  3SIB A;  3CR2 A;  3VRR A;  1RJV A;  2WCF A;  2AMI A;  5G08 A;  1NX0 A;  1B8L A;  1REC A;  4M2Q A;  1QLS A;  4NDB A;  1YVL A;  2KDH A;  1C7V A;  1R6P A;  1B8C A;  2JNX A;  1BLQ A;  1ODB A;  4MRX A;  2LP2 A;  2LVJ A;  4FQO A;  1K9U A;  4DRW A;  4PE1 A;  2KFH A;  1IJ6 A;  4MEW A;  2M29 A;  4ICB A;  1SR6 C;  3TUY C;  3JTD B;  1RFJ A;  4HSZ A;  2DOQ A;  3SG5 A;  2LVV A;  3EK7 A;  4PHJ A;  3ICB A;  1AJ4 A;  1PVA A;  1Y0V H;  5CPV A;  2MRD A;  1TTX A;  2M9G A;  2ISD A;  1XFZ O;  1BU3 A;  4I5K A;  3OX5 A;  1IQ5 A;  3SG7 A;  2HQ8 A;  1QTX A;  2M1U A;  1K8U A;  2EC6 C;  1HQV A;  4PAL A;  2I2R E;  1MR8 A;  4CFQ A;  2LMV A;  1KFX L;  3EVU A;  4PHN A;  1OMV A;  4HRG A;  3I5F B;  3AKA A;  2KYF A;  5DKN A;  2GV5 A;  2KAX A;  3BUN B;  5I2Q A;  2F2O A;  3OB2 B;  2KOT A;  1IWQ A;  1SL8 A;  3LK1 A;  1KK8 C;  1QXP A;  1DJI A;  2IS9 A;  3O6B A;  5FYX A;  1IRJ A;  1J1D A;  2SCP A;  1CLM A;  1RRO A;  1GGW A;  1XFU O;  2GGM A;  2G2B A;  3WHT B;  1N65 A;  1TNQ A;  1TOP A;  3CZT X;  1IG5 A;  3I5I C;  1SW8 A;  3NSL A;  5I8N A;  1Y1U A;  1DJH A;  3H4S E;  1WRZ A;  2KAY A;  1XFX O;  3I5H C;  2BE6 A;  2L5X B;  1BF5 A;  1FPW A;  1DVI A;  5BPJ A;  5IBW A;  1FI6 A;  4I5L B;  2JOJ A;  1RK9 A;  1ALV A;  1ZUZ A;  1WDC B;  1X02 A;  2KBI A;  2PMY A;  3NSO A;  4MZK A;  4MVF A;  3EKH A;  1RTP 1;  1Y6W A;  3A8R A;  1M46 A;  2F3Z A;  2COL B;  2CBL A;  1IH0 A;  4GGN A;  3CR4 X;  1K90 D;  1DJZ A;  4OVN F;  2BKI B;  1DT7 B;  1KQV A;  4PE7 A;  1QX2 A;  3SG2 A;  2WCE A;  1S26 D;  1R2U A;  1RWY A;  1UUS A;  1AK8 A;  3KPX A;  2BEC A;  2Y1N A;  2KI4 B;  1D1O A;  3AAJ A;  4N5X A;  1J55 A;  1YRU B;  2NCO A;  4UPG A;  1OZS A;  4ZCU A;  4GUK A;  2FOT A;  4P5O E;  1QX7 A;  1G33 A;  1G4Y R;  4ORA B;  2KI6 D;  2P6B B;  5HLO A;  3TZ1 A;  4ORB B;  3FS7 A;  1B9A A;  1JSA A;  1PRW A;  3SG4 A;  4PE4 A;  2JT0 A;  1YX8 A;  1CM4 A;  3SIA A;  4XJK B;  3DD4 A;  1DJX A;  1PAL A;  2BCX A;  2Q4U A;  3I5G B;  5DKQ A;  1DF0 A;  1DGU A;  3E3R A;  1WRL A;  1GGZ A;  2KBM A;  1UP5 A;  2MA2 A;  1NP8 A;  1NIW A;  3D0Y A;  1XVJ A;  1DF0 B;  1F4O A;  2LLU A;  1U5I A;  2PVB A;  3WXA A;  2BCA A;  2LHI A;  2KSP A;  1EH2 A;  1EJ3 A;  3D0Y B;  1IJ5 A;  1U5I B;  1ZAC A;  2M49 B;  2K2F A;  3KO0 A;  2BL0 B;  5D69 A;  1SL9 A;  2L4H A;  3TS5 C;  2M7N A;  1CFP A;  4PDZ A;  1J1E A;  1NUB A;  4IL1 A;  1B47 A;  2JTZ A;  2OS8 C;  4USL A;  1M63 B;  1F4Q A;  2LNK A;  3GK4 X;  3BUW B;  5AER A;  4TNC A;  1J7O A;  5ER4 X;  1KSO A;  4ORC B;  2VRG A;  4C0J A;  1YRT B;  1FF1 A;  2HET A;  1WLZ A;  1S6J A;  5I2O A;  2PAS A;  4MLW A;  3JVT C;  1AJ5 A;  1LA3 A;  2MJW B;  1SNL A;  1CB1 A;  1UHN A;  1QS7 A;  4QJ3 B;  3D10 A;  3BUO B;  1CTR A;  2E30 A;  1Y1A A;  2K0J A;  3KHE A;  1S6C A;  3AAK A;  4MBE A;  2CNP A;  4ZCV A;  2KFF A;  1KQM B;  4MZL A;  5AAN A;  3PAT A;  1PSR A;  2JXC A;  2CT9 A;  3NSI A;  1F54 A;  1B7T Z;  1MXL C;  5HKY A;  3FIA A;  4AOM A;  1CDP A;  1EXR A;  2H61 A;  4F0Z B;  5AFP A;  1S6I A;  2F3Y A;  3BXK A;  4CLN A;  1BG1 A;  1DGV A;  2CXJ A;  5TNC A;  1E8A A;  4R1E A;  1GJY A;  1K93 D;  1UHK A;  1SKT A;  2KYC A;  2Q91 A;  5HYD A;  3FWB A;  2TN4 A;  2ZN8 A;  1N0Y A;  1XYD A;  3EK4 A;  1K2H A;  2LE9 B;  3WHU B;  2GGZ A;  1TCF A;  1SY9 A;  2K7B A;  3EVR A;  2M8U A;  2EC6 B;  5CSJ A;  2G9B A;  5AXI A;  1EL4 A;  1NWD A;  1BT6 A;  1L7Z A;  2FCD A;  2ZN9 A;  1A2X A;  1PSB A;  1QJT A;  2QPT A;  1TRF A;  2K2A A;  4I5N B;  2PSR A;  1KK8 B;  5B8I B;  3TDI A;  2H2K A;  1QV1 A;  1UHI A;  3VRO A;  3OP0 A;  3CWG A;  1TNW A;  4U8D A;  5GQQ C;  4Q04 A;  1NX1 A;  2JZI A;  2SAS A;  3I5I B;  4E68 A;  1V1G A;  1VRK A;  5J3X A;  1B7T Y;  1BOD A;  2CTN A;  5HKW A;  1TN4 A;  3A4U B;  1CFD A;  5CSI A;  1GQM A;  2D8N A;  5CSN A;  3VRQ A;  2KI6 C;  2L98 A;  3O2P A;  1F8H A;  2M1K B;  4PCW A;  1JBA A;  4A4C A;  1YUS A;  1YTZ C;  2WC8 A;  2EGD A;  1A4P A;  2ZKM X;  3GK2 A;  3QRX A;  4WQ3 A;  1ZFS A;  3KEV A;  1LKJ A;  1UHH A;  1CNP A;  1AHR A;  2I18 A;  1B1G A;  1SMG A;  4M2O A;  2I7A A;  4QJ4 B;  2PRU A;  1DJG A;  1LA0 A;  2JTT A;  3K21 A;  4CPV A;  4WQ2 A;  1K9K A;  3PN7 B;  2L4I A;  3CR5 X;  2LUX A;  4AQJ A;  4DCK A;  1F71 A;  1KWO B;  1MF8 B;  4OR9 B;  2KQ6 A;  3OHM B;  2LUC A;  1CFC A;  1QIV A;  3DF0 A;  4YRU A;  4FTG A;  2HPS A;  1YUT A;  1TCO B;  2NCP A;  1WY9 A;  3CTN A;  1SCM B;  3DF0 B;  1QLK A;  1KCY A;  1K94 A;  1HT9 A;  4XJK A;  4CFR A;  4PE0 A;  3RM1 A;  1BJF A;  4DUQ A;  1B4C A;  1M39 A;  1CLL A;  2K7D A;  4JPZ B;  4CID A;  4YGD B;  2R2I A;  2MBX A;  1OZO A;  1UHJ A;  5JJG A;  3LCP C;  3DVJ A;  2K61 A;  1OE9 B;  1YX7 A;  4GGF A;  1YR5 A;  1IQ3 A;  1YVH A;  5HLV A;  1CFF A;  3EVV A;  3KF9 A;  5JOL A;  1H4B A;  1KSM A;  2JU0 A;  4GNK B;  1JF2 A;  1CMF A;  1DJW A;  2O5G A;  2LVI A;  2ZFD A;  2LHL A;  2JPT A;  3IQQ A;  1FW4 A;  1KFX S;  3TUY B;  3TS5 B;  4PHM A;  1K96 A;  4N1F A;  5D7F A;  5KU1 A;  3I5G C;  1IGV A;  1QAT A;  1XK4 A;  2JRF A;  3RLZ A;  1KFU L;  2LAN A;  1LXF C;  2LV7 A;  4YGA A;  2Y5I A;  4BY5 A;  1W7J B;  2KAV A;  1MWN A;  1V1F A;  1FBV A;  2JT8 A;  1ALW A;  1KK7 Z;  3VRN A;  4AQI A;  2OTG C;  2LVK A;  4ETO A;  2BL0 C;  4MZJ A;  1SBJ A;  3C1V A;  2M0R A;  2LLT A;  4GFT A;  2HQW A;  1J7R A;  2LMU A;  2FJU B;  2WOR A;  3TDZ A;  2K7C A;  4XYN A;  4YI8 A;  1BR1 B;  1L2O C;  3BYA A;  1B8R A;  3BUX B;  1A29 A;  2WCB A;  1NYA A;  1WRK A;  1XA5 A;  1SR6 B;  2K7O A;  2JWW A;  1S5G Z;  1NX2 A;  2KNE A;  2L51 A;  1M31 A;  1BR4 B;  2ZRS A;  5AEQ A;  3BQ3 A;  4QJ5 B;  2BKH B;  4YBH B;  2L0P A;  3CLN A;  1JF0 A;  1XO5 A;  1KQM C;  1OMR A;  3DVK A;  1XFW O;  1LVC D;  1SYM A;  2O60 A;  3OX6 A;  4JWQ A;  2LC5 A;  1OMD A;  1G8I A;  3JTD C;  1SRA A;  2NXQ A;  1KK7 Y;  1CKK A;  1YUU A;  3BOW A;  1CDN A;  4NDD A;  3LLE A;  2QAC A;  2M3W A;  1JWD A;  3VGO A;  1PVB A;  2H61 C;  2A4J A;  1EG3 A;  3BOW B;  3PLF B;  3O78 A;  2WOS A;  1CDM A;  3FWC A;  2PAL A;  2JT3 A;  3F45 A;  1DTL A;  3EKJ A;  4MSP A;  3VRP A;  2CCM A;  4MN0 A;  2KHN A;  2L50 A;  3ZWH A;  1QX5 B;  3I5F C;  2MAZ A;  4YGC B;  4DIR A;  3I5H B;  5PAL A;  1PK0 D;  1W7I B;  1MHO A;  1S5G Y;  2K8M B;  3PAL A;  1TNX A;  2M7L A;  3M0W A;  2AUC A;  5ER5 A;  1WLM A;  1AVS A;  4YGE B;  3WNX B;  1J7P A;  1OSA A;  2BBN A;  2F33 A;  3SJS A;  5KSZ A;  3LK0 A;  1BOC A;  3IF7 A;  2F2P A;  3DVM A;  1DJY A;  1C7W A;  4N1G A;  2EHB A;  2MLE C;  3DVE A;  1XFV O;  1JFJ A;  1CLB A;  4PHK A;  1KFU S;  4OCI A;  4M2P A;  1NCX A;  1FI5 A;  1CDL A;  1QAS A;  4YI9 A;  5I2L A;  1H8B A;  1JUO A;  3NXA A;  2JQ6 A;  2RGI A;  2ZRT A;  1EG4 A;  3AKB A;  1WDC C;  1K9P A;  1Y1X A;  5CSF A;  2I94 A;  2JC2 A;  4YGB B;  2JXL A;  3GOF A;  1UWO A;  2Y4Q A;  1ZMZ A;  4OKH A;  1AP4 A;  2LM5 A;  2LMT A;  1NSH A;  1ZOT B;  4C0L A;  1NCZ A;  2BE4 A;  1C07 A;  5KTY A;  3SG6 A;  2BCB A;  5F6T A;  1QV0 A;  1LIN A;  1QVI Z;  2KFG A;  1SCV A;  3BUM B;  3CS1 A;  3GK1 A;  3NSK A;  3PN7 C;  2KI4 C;  3SG3 A;  2LAP A;  1KWO C;  4GAO A;  4HRH A;  4C0K A;  1S3P A;  2BBM A;  3HX4 A;  3O4Y A;  1DMO A;  2ZND A;  3LL8 B;  4GBA A;  2FCE A;  2NLN A;  2Y1M A;  1F70 A;  3TDU A;  4JQ0 D;  1OOJ A;  4I5J A;  1F55 A;  2AAO A;  1SCM C;  1SPY A;  2LCP A;  3EK8 A;  5HKZ A;  4A4B A;  2LLS A;  4L9M A;  5DKR A;  1MXE A;  1JC2 A;  2ZNE A;  1M45 A;  2B1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...