1T14A

Crystal structure of lush from drosophila melanogaster: apo protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 45
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1t14A00
2WCMA 2QEOA 3CZ2A 3BFBA 2ERBA 3RZSA 1C3YA 2WC6A 3D77A 2QDIA 3V2LA 1OW4A 5EL2A 3OGNA 2P71A 2WC5A 3BJHA 1P28A 1XFRA 3S0FA 4JD9A 3VB1A 4INWA 3B86A 1LS8A 3S0BA 3FE6A 3B88A 3CABA 3NGVA 3BFHA 3R1PA 1GM0A 1TWOA 3BFAA 3B6XA 3NHTA 3K1EA 3FE8A 1C3ZA 2WCHA 3PJIA 3DY9A 1ORGA 3S0AA 1T14A 2WCJA 2GTEA 4PT1A 3NHIA 3DZTA 2QEBA 2QEVA 3B7AA 5DICA 3D76A 3DYEA 3FE9A 4FQTA 1QWVA 2FJYA 3D75A 4INXA 3S0GA 2QEHA 3CZ1A 2KPHA 3L4LA 2L2CA 3CYZA 2JPOA 4OZDA 3CZ0A 4F7FA 2WCLA 3B87A 3D78A 3S0EA 2WCKA 2PQLA 1TUJA 3DXLA 3R1VA 3R1OA 1OOGA 3S0DA 1OOIX 1DQEA 3QMEA 3D73A 3L47A 3CDNA 3L4AA 3D74A 3Q8IA 1OOFA 1OOHA 3R72A 2P70A 2H8VA 3N7HA
chains in the Genus database with same CATH superfamily
1SCMC 3PM8A 1F71A 2QEOA 1CDLA 1ZOTB 1C3YA 3RZSA 4YBHB 2JOJA 3WHTB 3D77A 2K0JA 3TDIA 2CTNA 2QDIA 3EVUA 5HKWA 4YGDB 5EL2A 1J1DA 1YRUB 2KLEA 1M39A 1G4YR 3GK4X 2PASA 2AAOA 4YRUA 1KK7Y 4MVFA 1F54A 1SSEB 3S0FA 3EK8A 4CFQA 1N0YA 4NQGA 1UHIA 4CPVA 1KFUS 3DVMA 4GNKB 1RTP1 3S0BA 1H4BA 1XFYO 3PFVA 5PALA 1F70A 3CABA 3E3RA 3NGVA 4TNCA 3R1PA 1LVCD 4QJ4B 1ALVA 1QX5B 1SR6B 4YI9A 4GAOA 1TTXA 5D7FA 1OMDA 4DRWA 4AQIA 4ETOA 3D10A 1XFZO 3BFAA 3JTDC 2K7DA 1M46A 4PHNA 3HCMA 3FE8A 2KBMA 3I5FC 4JKTA 4E68A 1G33A 1DJGA 1MF8B 2HPSA 2NCPA 2WCHA 5B8IB 4HRHA 3CR5X 4M2OA 2MAZA 2LVJA 3KPXA 4IJ7A 4ZCUA 3PLFB 1KFUL 2LE9B 3O2PA 2KLDA 1RROA 3BQ3A 3IF7A 1S5GZ 3DVJA 4HREE 1IH0A 1AP4A 1SRAA 2BL0B 5HKYA 3LK1A 2K61A 4PDZA 1TNXA 2WORA 3ICBA 3O4XA 3VRPA 2QEVA 1G8IA 2KFGA 1PRWA 2BECA 3AAKA 3NSKA 1TCFA 4DS7A 4DIRA 2HQ8A 2H2KA 3DYEA 1JBAA 2MLFC 3PN7C 2M1KB 2BCBA 1EG4A 4F0ZB 1EJ3A 5D69A 1DJHA 4C0KA 4WQ2A 5HLVA 1CDNA 1GGZA 4ORAB 1TNQA 5DKQA 1KFXS 5K89A 1LKJA 2PYQA 2KQ6A 3S0GA 1OE9B 2QEHA 2BCXA 1KWOB 1SK6D 1YVHA 2KPHA 1WDCC 5HYDA 1CFFA 3O78A 2LP2A 1AVSA 1UHHA 3DF0A 4OZDA 2EC6C 1B9AA 1QV0A 3BUNB 1YVLA 3I5FB 4AOMA 2L4IA 2BKIB 2O60A 2WCLA 1BU3A 3B87A 4GBAA 1J55A 2KI4C 1LINA 2H61C 1OOJA 2JC2A 2LUXA 4YGBB 5I94A 1UHNA 3I5IB 1QTXA 1VRKA 3I5GC 2OS8B 1SMGA 5DKNA 3IVTA 1FI5A 1DQEA 4C0JA 1OZSA 5BPJA 3TUYC 1KFXL 3QMEA 1B4CA 1SBJA 1AJ5A 1N65A 3O6BA 3OB1B 1BJFA 3JVTC 1K9KA 1DC1A 4N1FA 3TDUA 1IRJA 2ZKMX 1K9PA 2JNXA 2LLSA 3WHUB 1Y1UA 2LHIA 2ZRSA 2P70A 1S36A 1CFDA 2H8VA 1KQMB 3HX4A 1BLQA 1K8UA 2BKHB 2L98A 2M49B 2MJWB 2WCMA 1EG3A 4I5KA 1PSBA 4JPZB 4XJKB 1AUIB 1PALA 2ERBA 2KNEA 1OSAA 2WC6A 5ER4X 5FI7A 1Y6WA 1IJ5A 2KI6D 3V2LA 1OW4A 3OGNA 2FCEA 2P71A 3OP0A 2WC5A 4GGFA 2DOQA 3F45A 3DD4A 1XFXO 3D0YB 4I5JA 4M2QA 3TS5B 1WDCB 2G2BA 1P28A 1XFRA 5CSIA 4JD9A 3TZ1A 3VB1A 1B7TZ 2JZIA 2L4HA 2HETA 1S1EA 3CR4X 1JFJA 1A2XA 3CGAA 2K7CA 2M8UA 1DVIA 3B86A 2FJUB 2ZN9A 1WLMA 3LL8B 4U8DA 3RLZA 1LS8A 4M2PA 1BF5A 1JSAA 2JT8A 3NXAA 1SL8A 2LLTA 3B88A 5HL1A 1KK8C 1H8BA 2KI4B 1QV1A 2LHLA 3LCPC 4PE0A 2FCDA 2M7NA 4MRYA 1GM0A 1KSOA 1K90D 3LK0A 4MZLA 3VRRA 1DMOA 3SS3A 1B1GA 3NHTA 4YI8A 2JTTA 2JT0A 2LP3A 1CMFA 3PJIA 1ZUZA 3C1VA 1LA3A 4OV2A 4PE4A 2JULA 2Q91A 1T14A 2ZFDA 1V1FA 3SIBA 3PSRA 2MLEC 2WCJA 5JOLA 3UNWA 1NX3A 5GQQC 3NHIA 2WCBA 1YUSA 1DF0B 1TIZA 2E30A 3KO0A 1K93D 3KHEA 1TOPA 1QS7A 1Y1XA 2QEBA 3EK7A 1C7VA 1A29A 3B7AA 1QJTA 3AKAA 3VGOA 5J3XA 5TNCA 1YTZC 3D76A 3I5HC 1XK4A 4BY4A 1QASA 1B47A 4WQ3A 4FQTA 2FJYA 2KI6C 2LVKA 3D75A 5FYXA 3A8RA 2M9GA 1YX8A 5HLOA 4MN0A 3FIAA 1CM4A 2JQ6A 4PCWA 1QLSA 1M31A 2AMIA 1KK8B 4DUQA 1ODBA 1MXLC 2PVBA 3K21A 1IQ3A 1JF0A 3CZ1A 1Z2CB 5I2LA 3L4LA 5AEQA 4BY5A 1SCMB 3VRQA 4YGAA 2OTGC 1SYMA 2F3ZA 2LMVA 2COLB 2JPOA 3CTNA 3CYZA 1E8AA 3BUXB 4USLA 2V53A 4NDCA 2F2PA 3CZ0A 1F4OA 2AUCA 3OX6A 4YGCB 1NYAA 4OCIA 1SKTA 2K8MB 2WCKA 3S0EA 2PQLA 1TUJA 3DXLA 4FQOA 2K7BA 4KYNA 1RFJA 2JPTA 3GK2A 4HRGA 1NWDA 2Q4UA 1S5GY 3R1OA 5AXIA 4A4CA 1OOGA 2F33A 4CLNA 1BODA 1ZMZA 2LLUA 2SCPA 3OBVA 2L50A 2NLNA 1L2OC 3CDNA 3L4AA 1K9UA 5HKZA 2M7LA 3DVKA 2D8NA 4QJ3B 1S6JA 1MWNA 4MLWA 3EK4A 1J7OA 1IGVA 2LMTA 1CFPA 1DGUA 2Y4QA 3R72A 1CM1A 1RJVA 1YUTA 1F55A 1FF1A 1SNLA 1W7JB 1AJ4A 4GPLB 3JTDB 3N7HA 4N1GA 2L5YA 1NPQA 2P6BB 2PRUA 1SY9A 5CSNA 1S6CA 3CWGA 4NDBA 1B8RA 1OZOA 1ZFSA 1EL4A 2BCAA 3AKBA 1CFCA 3OX5A 2OPOA 1IWQA 2M3WA 1Y0VH 2BBNA 1BR4B 1K96A 1XFVO 5FI6A 1NCXA 1UUSA 1KSMA 2M29A 2NZ0A 1JWDA 3SG5A 2OTGB 1NUBA 2LVVA 1M45A 3NSIA 1A03A 1X02A 1NCZA 1BMOA 2I18A 5JJGA 1B8CA 2FOTA 4ICBA 1Z4HA 2JRFA 3FE6A 1XVJA 3SS4A 2ZNEA 3BFHA 4QJ5B 1DT7B 1FPWA 4MEWA 1R6PA 2WCEA 3PN7B 4DCKA 4A4BA 1CKKA 4XJKA 3EKJA 1TWOA 3B6XA 1N2DA 1OMVA 3K1EA 4PALA 1DJIA 1L2OB 2CBLA 4AQJA 5ER5A 1J1EA 4I5LB 3AAJA 2JT3A 1AHRA 3D0YA 1F4QA 1ORGA 1MQ1A 1RK9A 1UHJA 2BE4A 2LAPA 1TCOB 2CCMA 4P5OE 2M97A 2KFHA 4XYNA 1CMGA 1TUZA 2GTEA 2KQYA 4D1EA 1IKUA 4PT1A 2G9BA 3CR2A 1BT6A 2PALA 2B1UA 2EC6B 2KSPA 3SIAA 2H61A 2MBXA 1TN4A 2ZRTA 1K95A 1WRLA 3BOWA 5DICA 4P2YB 3BOWB 2NXQA 2LC5A 3RM1A 1KQVA 3I5GB 2KAVA 1B7TY 3TUYB 1QLKA 3FE9A 4MZKA 2HF5A 1F8HA 1MR8A 4INXA 2KAYA 1C7WA 2L0PA 3JVTB 2I7AA 2WNDA 1JF2A 1CTRA 5CSFA 3EVRA 1EXRA 1YUUA 2KBIA 1GGWA 2KYCA 1QVIY 1NSHA 2GV5A 4L9MA 1DF0A 4PHMA 3ZNIA 1CLLA 2L5XB 5AERA 1QX7A 2KYFA 2L2CA 2LMUA 2RGIA 2LVIA 1D1OA 2MRDA 4NDDA 1CB1A 5KSZA 1KK7Z 1SL9A 2ZN8A 1OMRA 2IS9A 1FI6A 1A75B 4I5NB 1QIVA 4ORBB 4WRIA 4YGEB 2K2FA 2E6WA 3D78A 2I94A 4Q04A 1LA0A 3SG7A 3UO9A 3VROA 1YR5A 1DJWA 2JXCA 3R1VA 1TRFA 3SS5A 1CNPA 1SPYA 3PALA 1J7QA 2HQWA 1WRZA 3D73A 1W7IB 2ZNDA 1S26D 1V1GA 2YGUA 1CLBA 1HQVA 1UP5A 1JUOA 1YX7A 1NX1A 1OQPA 4PE7A 4CFRA 3Q8IA 3CLNA 3BYAA 1OOFA 1OOHA 2F2OA 1XYDA 2Y1NA 3CZTX 2CT9A 2JTZA 1QX2A 3CS1A 5I8NA 2M0RA 1KWOC 1S6IA 4PE1A 5F6TA 2L51A 4R1EA 3IQQA 2KHNA 3PATA 2JWWA 1SW8A 1QXPA 2LCPA 4HSZA 1YURA 3BFBA 3CZ2A 1AK8A 1DEKA 3VRNA 1TNWA 4IL1A 4OKHA 2MA2A 2L2EA 1L7ZA 3BUOB 2M1UA 5G08A 5CSJA 1U5IA 3KEVA 1CDPA 2KGBC 1R2UA 3I5IC 5CPVA 2KDHA 3BJHA 1U5IB 2F8PA 2OS8C 2LV7A 1MXEA 3BUWB 2KFFA 5DKRA 5AANA 1IG5A 1NX2A 5IBWA 4INWA 1XFUO 2LANA 1IIOA 5D3OA 2QPTA 2A4JA 3SG3A 1DJZA 2ISDA 2Y5IA 1J7RA 3I5HB 3FWBA 3ZWHA 1NCYA 2JU0A 4CIDA 4UPGA 2PMYA 2LM5A 3BUMB 2LUCA 4GUKA 1WLZA 4PHKA 1ALWA 1ZACA 1BR1B 1KQMC 4GGNA 3SJSA 1C3ZA 3EG5B 3SG2A 2K2AA 4MZJA 4OVNF 1IQ5A 1C07A 2QACA 3DY9A 3KF9A 1FBVA 5FI2A 3S0AA 1PULA 1SCVA 2BAPA 4OR9B 1S3PA 2O5GA 3WNXB 2PSRA 1FW4A 1TNPA 5KU1A 3TS5C 4JQ0D 3GOFA 2K7OA 1MHOA 4GGFC 1IJ6A 1J7PA 1PVBA 1JFKA 2GGMA 3H4SE 1PK0D 2F3YA 3BXKA 3DZTA 2I2RE 2K60A 3NSLA 3DF0B 1KCYA 1MUXA 1GJYA 1SL7A 3MSEB 1JC2A 2KGRA 1CLMA 1QIWA 4MSPA 3OHMB 1QATA 3LLEA 2KOTA 2KAXA 1A4PA 1WRKA 4JWQA 3SG4A 3EKHA 1QWVA 2R2IA 2EHBA 2TN4A 2SASA 1DGVA 1DELA 1GQMA 1RECA 1NP8A 4ZCVA 3GK1A 1Q80A 3NSOA 3SG6A 1CDMA 2CNPA 2GGZA 1K94A 2LNKA 3TDZA 1UWOA 1BG1A 1NX0A 2EGDA 3PM2A 1DJXA 3FS7A 1LXFC 2MHHA 5I2QA 4F7FA 2VRGA 3QRXA 1DJYA 1YRTB 2NCOA 1EH2A 1K2HA 2WCFA 3FWCA 3WXAA 2BE6A 2CXJA 1XFWO 5KTYA 1HT9A 1M63B 1SR6C 1W9ZA 3A4UB 3O4YA 3S0DA 5I2OA 1OOIX 4MRXA 1BOCA 4C0LA 4N5XA 2WC8A 1XK4C 3IQOA 1RWYA 3L47A 4MBEA 1DTLA 1PSRA 1XA5A 2BNXA 2WOSA 2Y1MA 3D74A 3EVVA 5AFPA 1NIWA 1B8LA 3M0WA 1Y1AA 4PHJA 2JNFA 4FTGA 3OB2B 1UURA 1PVAA 3DVEA 4GFTA 4ORCB 1XO5A 2BBMA 1UHKA 1A75A 1QVIZ 1WY9A 2JXLA 2BL0C
chains in the Genus database with same CATH topology
2WCMA 2QEOA 3CZ2A 3BFBA 2ERBA 3RZSA 1C3YA 2WC6A 3D77A 2QDIA 3V2LA 1OW4A 5EL2A 3OGNA 2P71A 2WC5A 3BJHA 1P28A 1XFRA 3S0FA 4JD9A 3VB1A 4INWA 3B86A 1LS8A 3S0BA 3FE6A 3B88A 3CABA 3NGVA 3BFHA 3R1PA 1GM0A 1TWOA 3BFAA 3B6XA 3NHTA 3K1EA 3FE8A 1C3ZA 2WCHA 3PJIA 3DY9A 1ORGA 3S0AA 1T14A 2WCJA 2GTEA 4PT1A 3NHIA 3DZTA 2QEBA 2QEVA 3B7AA 5DICA 3D76A 3DYEA 3FE9A 4FQTA 1QWVA 2FJYA 3D75A 4INXA 3S0GA 2QEHA 3CZ1A 2KPHA 3L4LA 2L2CA 3CYZA 2JPOA 4OZDA 3CZ0A 4F7FA 2WCLA 3B87A 3D78A 3S0EA 2WCKA 2PQLA 1TUJA 3DXLA 3R1VA 3R1OA 1OOGA 3S0DA 1OOIX 1DQEA 3QMEA 3D73A 3L47A 3CDNA 3L4AA 3D74A 3Q8IA 1OOFA 1OOHA 3R72A 2P70A 2H8VA 3N7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCM A;  2QEO A;  3CZ2 A;  3BFB A;  2ERB A;  3RZS A;  1C3Y A;  2WC6 A;  3D77 A;  2QDI A;  3V2L A;  1OW4 A;  5EL2 A;  3OGN A;  2P71 A;  2WC5 A;  3BJH A;  1P28 A;  1XFR A;  3S0F A;  4JD9 A;  3VB1 A;  4INW A;  3B86 A;  1LS8 A;  3S0B A;  3FE6 A;  3B88 A;  3CAB A;  3NGV A;  3BFH A;  3R1P A;  1GM0 A;  1TWO A;  3BFA A;  3B6X A;  3NHT A;  3K1E A;  3FE8 A;  1C3Z A;  2WCH A;  3PJI A;  3DY9 A;  1ORG A;  3S0A A;  1T14 A;  2WCJ A;  2GTE A;  4PT1 A;  3NHI A;  3DZT A;  2QEB A;  2QEV A;  3B7A A;  5DIC A;  3D76 A;  3DYE A;  3FE9 A;  4FQT A;  1QWV A;  2FJY A;  3D75 A;  4INX A;  3S0G A;  2QEH A;  3CZ1 A;  2KPH A;  3L4L A;  2L2C A;  3CYZ A;  2JPO A;  4OZD A;  3CZ0 A;  4F7F A;  2WCL A;  3B87 A;  3D78 A;  3S0E A;  2WCK A;  2PQL A;  1TUJ A;  3DXL A;  3R1V A;  3R1O A;  1OOG A;  3S0D A;  1OOI X;  1DQE A;  3QME A;  3D73 A;  3L47 A;  3CDN A;  3L4A A;  3D74 A;  3Q8I A;  1OOF A;  1OOH A;  3R72 A;  2P70 A;  2H8V A;  3N7H A; 
#chains in the Genus database with same CATH topology
 1SCM C;  3PM8 A;  1F71 A;  2QEO A;  1CDL A;  1ZOT B;  1C3Y A;  3RZS A;  4YBH B;  2JOJ A;  3WHT B;  3D77 A;  2K0J A;  3TDI A;  2CTN A;  2QDI A;  3EVU A;  5HKW A;  4YGD B;  5EL2 A;  1J1D A;  1YRU B;  2KLE A;  1M39 A;  1G4Y R;  3GK4 X;  2PAS A;  2AAO A;  4YRU A;  1KK7 Y;  4MVF A;  1F54 A;  1SSE B;  3S0F A;  3EK8 A;  4CFQ A;  1N0Y A;  4NQG A;  1UHI A;  4CPV A;  1KFU S;  3DVM A;  4GNK B;  1RTP 1;  3S0B A;  1H4B A;  1XFY O;  3PFV A;  5PAL A;  1F70 A;  3CAB A;  3E3R A;  3NGV A;  4TNC A;  3R1P A;  1LVC D;  4QJ4 B;  1ALV A;  1QX5 B;  1SR6 B;  4YI9 A;  4GAO A;  1TTX A;  5D7F A;  1OMD A;  4DRW A;  4AQI A;  4ETO A;  3D10 A;  1XFZ O;  3BFA A;  3JTD C;  2K7D A;  1M46 A;  4PHN A;  3HCM A;  3FE8 A;  2KBM A;  3I5F C;  4JKT A;  4E68 A;  1G33 A;  1DJG A;  1MF8 B;  2HPS A;  2NCP A;  2WCH A;  5B8I B;  4HRH A;  3CR5 X;  4M2O A;  2MAZ A;  2LVJ A;  3KPX A;  4IJ7 A;  4ZCU A;  3PLF B;  1KFU L;  2LE9 B;  3O2P A;  2KLD A;  1RRO A;  3BQ3 A;  3IF7 A;  1S5G Z;  3DVJ A;  4HRE E;  1IH0 A;  1AP4 A;  1SRA A;  2BL0 B;  5HKY A;  3LK1 A;  2K61 A;  4PDZ A;  1TNX A;  2WOR A;  3ICB A;  3O4X A;  3VRP A;  2QEV A;  1G8I A;  2KFG A;  1PRW A;  2BEC A;  3AAK A;  3NSK A;  1TCF A;  4DS7 A;  4DIR A;  2HQ8 A;  2H2K A;  3DYE A;  1JBA A;  2MLF C;  3PN7 C;  2M1K B;  2BCB A;  1EG4 A;  4F0Z B;  1EJ3 A;  5D69 A;  1DJH A;  4C0K A;  4WQ2 A;  5HLV A;  1CDN A;  1GGZ A;  4ORA B;  1TNQ A;  5DKQ A;  1KFX S;  5K89 A;  1LKJ A;  2PYQ A;  2KQ6 A;  3S0G A;  1OE9 B;  2QEH A;  2BCX A;  1KWO B;  1SK6 D;  1YVH A;  2KPH A;  1WDC C;  5HYD A;  1CFF A;  3O78 A;  2LP2 A;  1AVS A;  1UHH A;  3DF0 A;  4OZD A;  2EC6 C;  1B9A A;  1QV0 A;  3BUN B;  1YVL A;  3I5F B;  4AOM A;  2L4I A;  2BKI B;  2O60 A;  2WCL A;  1BU3 A;  3B87 A;  4GBA A;  1J55 A;  2KI4 C;  1LIN A;  2H61 C;  1OOJ A;  2JC2 A;  2LUX A;  4YGB B;  5I94 A;  1UHN A;  3I5I B;  1QTX A;  1VRK A;  3I5G C;  2OS8 B;  1SMG A;  5DKN A;  3IVT A;  1FI5 A;  1DQE A;  4C0J A;  1OZS A;  5BPJ A;  3TUY C;  1KFX L;  3QME A;  1B4C A;  1SBJ A;  1AJ5 A;  1N65 A;  3O6B A;  3OB1 B;  1BJF A;  3JVT C;  1K9K A;  1DC1 A;  4N1F A;  3TDU A;  1IRJ A;  2ZKM X;  1K9P A;  2JNX A;  2LLS A;  3WHU B;  1Y1U A;  2LHI A;  2ZRS A;  2P70 A;  1S36 A;  1CFD A;  2H8V A;  1KQM B;  3HX4 A;  1BLQ A;  1K8U A;  2BKH B;  2L98 A;  2M49 B;  2MJW B;  2WCM A;  1EG3 A;  4I5K A;  1PSB A;  4JPZ B;  4XJK B;  1AUI B;  1PAL A;  2ERB A;  2KNE A;  1OSA A;  2WC6 A;  5ER4 X;  5FI7 A;  1Y6W A;  1IJ5 A;  2KI6 D;  3V2L A;  1OW4 A;  3OGN A;  2FCE A;  2P71 A;  3OP0 A;  2WC5 A;  4GGF A;  2DOQ A;  3F45 A;  3DD4 A;  1XFX O;  3D0Y B;  4I5J A;  4M2Q A;  3TS5 B;  1WDC B;  2G2B A;  1P28 A;  1XFR A;  5CSI A;  4JD9 A;  3TZ1 A;  3VB1 A;  1B7T Z;  2JZI A;  2L4H A;  2HET A;  1S1E A;  3CR4 X;  1JFJ A;  1A2X A;  3CGA A;  2K7C A;  2M8U A;  1DVI A;  3B86 A;  2FJU B;  2ZN9 A;  1WLM A;  3LL8 B;  4U8D A;  3RLZ A;  1LS8 A;  4M2P A;  1BF5 A;  1JSA A;  2JT8 A;  3NXA A;  1SL8 A;  2LLT A;  3B88 A;  5HL1 A;  1KK8 C;  1H8B A;  2KI4 B;  1QV1 A;  2LHL A;  3LCP C;  4PE0 A;  2FCD A;  2M7N A;  4MRY A;  1GM0 A;  1KSO A;  1K90 D;  3LK0 A;  4MZL A;  3VRR A;  1DMO A;  3SS3 A;  1B1G A;  3NHT A;  4YI8 A;  2JTT A;  2JT0 A;  2LP3 A;  1CMF A;  3PJI A;  1ZUZ A;  3C1V A;  1LA3 A;  4OV2 A;  4PE4 A;  2JUL A;  2Q91 A;  1T14 A;  2ZFD A;  1V1F A;  3SIB A;  3PSR A;  2MLE C;  2WCJ A;  5JOL A;  3UNW A;  1NX3 A;  5GQQ C;  3NHI A;  2WCB A;  1YUS A;  1DF0 B;  1TIZ A;  2E30 A;  3KO0 A;  1K93 D;  3KHE A;  1TOP A;  1QS7 A;  1Y1X A;  2QEB A;  3EK7 A;  1C7V A;  1A29 A;  3B7A A;  1QJT A;  3AKA A;  3VGO A;  5J3X A;  5TNC A;  1YTZ C;  3D76 A;  3I5H C;  1XK4 A;  4BY4 A;  1QAS A;  1B47 A;  4WQ3 A;  4FQT A;  2FJY A;  2KI6 C;  2LVK A;  3D75 A;  5FYX A;  3A8R A;  2M9G A;  1YX8 A;  5HLO A;  4MN0 A;  3FIA A;  1CM4 A;  2JQ6 A;  4PCW A;  1QLS A;  1M31 A;  2AMI A;  1KK8 B;  4DUQ A;  1ODB A;  1MXL C;  2PVB A;  3K21 A;  1IQ3 A;  1JF0 A;  3CZ1 A;  1Z2C B;  5I2L A;  3L4L A;  5AEQ A;  4BY5 A;  1SCM B;  3VRQ A;  4YGA A;  2OTG C;  1SYM A;  2F3Z A;  2LMV A;  2COL B;  2JPO A;  3CTN A;  3CYZ A;  1E8A A;  3BUX B;  4USL A;  2V53 A;  4NDC A;  2F2P A;  3CZ0 A;  1F4O A;  2AUC A;  3OX6 A;  4YGC B;  1NYA A;  4OCI A;  1SKT A;  2K8M B;  2WCK A;  3S0E A;  2PQL A;  1TUJ A;  3DXL A;  4FQO A;  2K7B A;  4KYN A;  1RFJ A;  2JPT A;  3GK2 A;  4HRG A;  1NWD A;  2Q4U A;  1S5G Y;  3R1O A;  5AXI A;  4A4C A;  1OOG A;  2F33 A;  4CLN A;  1BOD A;  1ZMZ A;  2LLU A;  2SCP A;  3OBV A;  2L50 A;  2NLN A;  1L2O C;  3CDN A;  3L4A A;  1K9U A;  5HKZ A;  2M7L A;  3DVK A;  2D8N A;  4QJ3 B;  1S6J A;  1MWN A;  4MLW A;  3EK4 A;  1J7O A;  1IGV A;  2LMT A;  1CFP A;  1DGU A;  2Y4Q A;  3R72 A;  1CM1 A;  1RJV A;  1YUT A;  1F55 A;  1FF1 A;  1SNL A;  1W7J B;  1AJ4 A;  4GPL B;  3JTD B;  3N7H A;  4N1G A;  2L5Y A;  1NPQ A;  2P6B B;  2PRU A;  1SY9 A;  5CSN A;  1S6C A;  3CWG A;  4NDB A;  1B8R A;  1OZO A;  1ZFS A;  1EL4 A;  2BCA A;  3AKB A;  1CFC A;  3OX5 A;  2OPO A;  1IWQ A;  2M3W A;  1Y0V H;  2BBN A;  1BR4 B;  1K96 A;  1XFV O;  5FI6 A;  1NCX A;  1UUS A;  1KSM A;  2M29 A;  2NZ0 A;  1JWD A;  3SG5 A;  2OTG B;  1NUB A;  2LVV A;  1M45 A;  3NSI A;  1A03 A;  1X02 A;  1NCZ A;  1BMO A;  2I18 A;  5JJG A;  1B8C A;  2FOT A;  4ICB A;  1Z4H A;  2JRF A;  3FE6 A;  1XVJ A;  3SS4 A;  2ZNE A;  3BFH A;  4QJ5 B;  1DT7 B;  1FPW A;  4MEW A;  1R6P A;  2WCE A;  3PN7 B;  4DCK A;  4A4B A;  1CKK A;  4XJK A;  3EKJ A;  1TWO A;  3B6X A;  1N2D A;  1OMV A;  3K1E A;  4PAL A;  1DJI A;  1L2O B;  2CBL A;  4AQJ A;  5ER5 A;  1J1E A;  4I5L B;  3AAJ A;  2JT3 A;  1AHR A;  3D0Y A;  1F4Q A;  1ORG A;  1MQ1 A;  1RK9 A;  1UHJ A;  2BE4 A;  2LAP A;  1TCO B;  2CCM A;  4P5O E;  2M97 A;  2KFH A;  4XYN A;  1CMG A;  1TUZ A;  2GTE A;  2KQY A;  4D1E A;  1IKU A;  4PT1 A;  2G9B A;  3CR2 A;  1BT6 A;  2PAL A;  2B1U A;  2EC6 B;  2KSP A;  3SIA A;  2H61 A;  2MBX A;  1TN4 A;  2ZRT A;  1K95 A;  1WRL A;  3BOW A;  5DIC A;  4P2Y B;  3BOW B;  2NXQ A;  2LC5 A;  3RM1 A;  1KQV A;  3I5G B;  2KAV A;  1B7T Y;  3TUY B;  1QLK A;  3FE9 A;  4MZK A;  2HF5 A;  1F8H A;  1MR8 A;  4INX A;  2KAY A;  1C7W A;  2L0P A;  3JVT B;  2I7A A;  2WND A;  1JF2 A;  1CTR A;  5CSF A;  3EVR A;  1EXR A;  1YUU A;  2KBI A;  1GGW A;  2KYC A;  1QVI Y;  1NSH A;  2GV5 A;  4L9M A;  1DF0 A;  4PHM A;  3ZNI A;  1CLL A;  2L5X B;  5AER A;  1QX7 A;  2KYF A;  2L2C A;  2LMU A;  2RGI A;  2LVI A;  1D1O A;  2MRD A;  4NDD A;  1CB1 A;  5KSZ A;  1KK7 Z;  1SL9 A;  2ZN8 A;  1OMR A;  2IS9 A;  1FI6 A;  1A75 B;  4I5N B;  1QIV A;  4ORB B;  4WRI A;  4YGE B;  2K2F A;  2E6W A;  3D78 A;  2I94 A;  4Q04 A;  1LA0 A;  3SG7 A;  3UO9 A;  3VRO A;  1YR5 A;  1DJW A;  2JXC A;  3R1V A;  1TRF A;  3SS5 A;  1CNP A;  1SPY A;  3PAL A;  1J7Q A;  2HQW A;  1WRZ A;  3D73 A;  1W7I B;  2ZND A;  1S26 D;  1V1G A;  2YGU A;  1CLB A;  1HQV A;  1UP5 A;  1JUO A;  1YX7 A;  1NX1 A;  1OQP A;  4PE7 A;  4CFR A;  3Q8I A;  3CLN A;  3BYA A;  1OOF A;  1OOH A;  2F2O A;  1XYD A;  2Y1N A;  3CZT X;  2CT9 A;  2JTZ A;  1QX2 A;  3CS1 A;  5I8N A;  2M0R A;  1KWO C;  1S6I A;  4PE1 A;  5F6T A;  2L51 A;  4R1E A;  3IQQ A;  2KHN A;  3PAT A;  2JWW A;  1SW8 A;  1QXP A;  2LCP A;  4HSZ A;  1YUR A;  3BFB A;  3CZ2 A;  1AK8 A;  1DEK A;  3VRN A;  1TNW A;  4IL1 A;  4OKH A;  2MA2 A;  2L2E A;  1L7Z A;  3BUO B;  2M1U A;  5G08 A;  5CSJ A;  1U5I A;  3KEV A;  1CDP A;  2KGB C;  1R2U A;  3I5I C;  5CPV A;  2KDH A;  3BJH A;  1U5I B;  2F8P A;  2OS8 C;  2LV7 A;  1MXE A;  3BUW B;  2KFF A;  5DKR A;  5AAN A;  1IG5 A;  1NX2 A;  5IBW A;  4INW A;  1XFU O;  2LAN A;  1IIO A;  5D3O A;  2QPT A;  2A4J A;  3SG3 A;  1DJZ A;  2ISD A;  2Y5I A;  1J7R A;  3I5H B;  3FWB A;  3ZWH A;  1NCY A;  2JU0 A;  4CID A;  4UPG A;  2PMY A;  2LM5 A;  3BUM B;  2LUC A;  4GUK A;  1WLZ A;  4PHK A;  1ALW A;  1ZAC A;  1BR1 B;  1KQM C;  4GGN A;  3SJS A;  1C3Z A;  3EG5 B;  3SG2 A;  2K2A A;  4MZJ A;  4OVN F;  1IQ5 A;  1C07 A;  2QAC A;  3DY9 A;  3KF9 A;  1FBV A;  5FI2 A;  3S0A A;  1PUL A;  1SCV A;  2BAP A;  4OR9 B;  1S3P A;  2O5G A;  3WNX B;  2PSR A;  1FW4 A;  1TNP A;  5KU1 A;  3TS5 C;  4JQ0 D;  3GOF A;  2K7O A;  1MHO A;  4GGF C;  1IJ6 A;  1J7P A;  1PVB A;  1JFK A;  2GGM A;  3H4S E;  1PK0 D;  2F3Y A;  3BXK A;  3DZT A;  2I2R E;  2K60 A;  3NSL A;  3DF0 B;  1KCY A;  1MUX A;  1GJY A;  1SL7 A;  3MSE B;  1JC2 A;  2KGR A;  1CLM A;  1QIW A;  4MSP A;  3OHM B;  1QAT A;  3LLE A;  2KOT A;  2KAX A;  1A4P A;  1WRK A;  4JWQ A;  3SG4 A;  3EKH A;  1QWV A;  2R2I A;  2EHB A;  2TN4 A;  2SAS A;  1DGV A;  1DEL A;  1GQM A;  1REC A;  1NP8 A;  4ZCV A;  3GK1 A;  1Q80 A;  3NSO A;  3SG6 A;  1CDM A;  2CNP A;  2GGZ A;  1K94 A;  2LNK A;  3TDZ A;  1UWO A;  1BG1 A;  1NX0 A;  2EGD A;  3PM2 A;  1DJX A;  3FS7 A;  1LXF C;  2MHH A;  5I2Q A;  4F7F A;  2VRG A;  3QRX A;  1DJY A;  1YRT B;  2NCO A;  1EH2 A;  1K2H A;  2WCF A;  3FWC A;  3WXA A;  2BE6 A;  2CXJ A;  1XFW O;  5KTY A;  1HT9 A;  1M63 B;  1SR6 C;  1W9Z A;  3A4U B;  3O4Y A;  3S0D A;  5I2O A;  1OOI X;  4MRX A;  1BOC A;  4C0L A;  4N5X A;  2WC8 A;  1XK4 C;  3IQO A;  1RWY A;  3L47 A;  4MBE A;  1DTL A;  1PSR A;  1XA5 A;  2BNX A;  2WOS A;  2Y1M A;  3D74 A;  3EVV A;  5AFP A;  1NIW A;  1B8L A;  3M0W A;  1Y1A A;  4PHJ A;  2JNF A;  4FTG A;  3OB2 B;  1UUR A;  1PVA A;  3DVE A;  4GFT A;  4ORC B;  1XO5 A;  2BBM A;  1UHK A;  1A75 A;  1QVI Z;  1WY9 A;  2JXL A;  2BL0 C; 
#chains in the Genus database with same CATH homology
 2WCM A;  2QEO A;  3CZ2 A;  3BFB A;  2ERB A;  3RZS A;  1C3Y A;  2WC6 A;  3D77 A;  2QDI A;  3V2L A;  1OW4 A;  5EL2 A;  3OGN A;  2P71 A;  2WC5 A;  3BJH A;  1P28 A;  1XFR A;  3S0F A;  4JD9 A;  3VB1 A;  4INW A;  3B86 A;  1LS8 A;  3S0B A;  3FE6 A;  3B88 A;  3CAB A;  3NGV A;  3BFH A;  3R1P A;  1GM0 A;  1TWO A;  3BFA A;  3B6X A;  3NHT A;  3K1E A;  3FE8 A;  1C3Z A;  2WCH A;  3PJI A;  3DY9 A;  1ORG A;  3S0A A;  1T14 A;  2WCJ A;  2GTE A;  4PT1 A;  3NHI A;  3DZT A;  2QEB A;  2QEV A;  3B7A A;  5DIC A;  3D76 A;  3DYE A;  3FE9 A;  4FQT A;  1QWV A;  2FJY A;  3D75 A;  4INX A;  3S0G A;  2QEH A;  3CZ1 A;  2KPH A;  3L4L A;  2L2C A;  3CYZ A;  2JPO A;  4OZD A;  3CZ0 A;  4F7F A;  2WCL A;  3B87 A;  3D78 A;  3S0E A;  2WCK A;  2PQL A;  1TUJ A;  3DXL A;  3R1V A;  3R1O A;  1OOG A;  3S0D A;  1OOI X;  1DQE A;  3QME A;  3D73 A;  3L47 A;  3CDN A;  3L4A A;  3D74 A;  3Q8I A;  1OOF A;  1OOH A;  3R72 A;  2P70 A;  2H8V A;  3N7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...