1T14A

Crystal structure of lush from drosophila melanogaster: apo protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 45
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1t14A00
3B87A 1DQEA 3B7AA 2L2CA 3L47A 3N7HA 3FE9A 1OOFA 1OOIX 4F7FA 3DZTA 3CZ1A 3FE8A 1OOGA 1T14A 3D76A 2GTEA 2QEVA 3R1OA 3BJHA 3D78A 3NGVA 4FQTA 2QDIA 3R1VA 1TWOA 4PT1A 4INXA 3V2LA 1LS8A 3BFHA 3CDNA 3DY9A 3S0AA 3VB1A 5EL2A 3FE6A 3QMEA 3D75A 2JPOA 3D74A 2WCHA 2WC5A 3RZSA 3L4LA 3D77A 2PQLA 3S0GA 3K1EA 1TUJA 2QEHA 3BFAA 3B6XA 2WCLA 3B86A 1QWVA 3CYZA 3DXLA 3S0FA 4INWA 3Q8IA 3CZ0A 3D73A 1OW4A 5DICA 3S0BA 3S0EA 2WC6A 3B88A 1GM0A 2P71A 1XFRA 3L4AA 3R1PA 3DYEA 1C3YA 2QEOA 3S0DA 2WCJA 1C3ZA 3BFBA 1P28A 3PJIA 2WCMA 2WCKA 4OZDA 1ORGA 1OOHA 2FJYA 3CABA 3R72A 2H8VA 2P70A 3NHIA 4JD9A 2KPHA 2ERBA 2QEBA 3NHTA 3OGNA 3CZ2A
chains in the Genus database with same CATH superfamily
2JOJA 3B87A 4XYNA 3BXKA 1M39A 3B7AA 1B7TY 3OB2B 5CSNA 3UO9A 3O2PA 1ZACA 1Y6WA 1SL8A 2Y4QA 2CXJA 1QIVA 2KLDA 3HX4A 5G08A 3DVJA 3FE9A 2A4JA 4FTGA 3PM8A 1NCYA 3I5HB 2BKIB 2JNFA 3JTDC 3LLEA 1Q80A 1RTP1 1T14A 3VRPA 1YUTA 2BBNA 2KQYA 2K2FA 1KWOC 1QX2A 3D78A 5BPJA 3EK7A 4OR9B 2I94A 4MZJA 4NQGA 1PULA 3AKAA 2ZKMX 2M7LA 1XYDA 2JPTA 1K94A 4FQTA 2LLTA 1IQ3A 2G9BA 2QDIA 3JTDB 3H4SE 1CB1A 2BCAA 1B8RA 1Y1UA 2HETA 2H61C 1SMGA 1F8HA 1FI5A 1B8LA 2MA2A 2KHNA 5AANA 1SYMA 1HQVA 4M2PA 4M2OA 1F70A 2OS8C 2LLUA 1G8IA 2KI6D 1MF8B 2L4HA 5AXIA 1XFXO 1AJ5A 2I7AA 1QXPA 5B8IB 1CDNA 2PRUA 2SCPA 3CTNA 2M97A 2WC5A 4YRUA 3RZSA 1J55A 2KLEA 3SG3A 2ZN9A 1ALWA 3D77A 2PQLA 2LMTA 3S0GA 2ZRSA 5ER4X 3VRQA 1AVSA 3KF9A 1A75B 3BFAA 4PALA 2IS9A 3CR2A 3TDZA 2OS8B 1JC2A 1H4BA 2WCLA 3DXLA 3S0FA 1KK8B 4WQ3A 1F54A 1K8UA 4OKHA 5JJGA 1OW4A 1YTZC 1K9UA 2MLFC 3AAJA 3IF7A 1CKKA 2L50A 1AUIB 2WORA 2BCBA 4YI8A 1ZUZA 1RK9A 4YGBB 3S0EA 3I5IB 3F45A 4WQ2A 1OZSA 1WLZA 2F2PA 2KAVA 4P2YB 2WC6A 4C0LA 2EC6C 1A75A 1DMOA 2P71A 3BUNB 4GNKB 1XFRA 3L4AA 4I5LB 1V1FA 5KSZA 1HT9A 4I5JA 1YUSA 1SNLA 3R1PA 4PCWA 1F71A 3DYEA 1NWDA 1BMOA 3FS7A 3WNXB 2QACA 2E30A 1CMFA 1B8CA 1NPQA 1C3ZA 3NSLA 1LA3A 2K0JA 3AAKA 1YVHA 3BFBA 2EC6B 1F55A 1BU3A 1TNPA 2HQWA 2OTGB 3PN7C 2KAYA 2KFFA 1YRUB 4OZDA 4NDCA 1L2OC 2BE6A 2JT3A 2D8NA 1OOHA 2FJYA 2JWWA 4HREE 5HKWA 2L2EA 5IBWA 4JPZB 2L4IA 2BNXA 2M3WA 1B4CA 3BOWB 4IL1A 2CTNA 1CLBA 3C1VA 4JWQA 4NDDA 2KQ6A 4YGAA 2ERBA 2JTTA 1WRKA 2HQ8A 3NHTA 1WDCB 1Y1AA 1W7IB 3CZ2A 5HLOA 3SG4A 2LVJA 1DJHA 1SL9A 1JBAA 2SASA 2M49B 3DVMA 4F0ZB 1J7RA 3N7HA 1K2HA 1EXRA 4IJ7A 4QJ5B 1LVCD 1N0YA 1OOIX 3OX5A 4PDZA 3SIBA 1SCMC 3KO0A 1SCVA 3VROA 3BOWA 2K8MB 3O6BA 4OV2A 1DJGA 1V1GA 5JOLA 2ZN8A 2BCXA 2KGRA 2EGDA 1M63B 3D76A 3D0YB 1LA0A 1TCFA 1QX7A 1K9PA 2EHBA 2QEVA 3R1OA 5HKYA 1OQPA 5D7FA 1UHNA 3I5HC 4GGFC 2L0PA 4MLWA 1GQMA 2K7DA 1EG3A 1NP8A 2PALA 1SCMB 3I5GB 2LUCA 1OE9B 5HKZA 5DKNA 1A4PA 1NX3A 1Y0VH 2LC5A 3PM2A 3R1VA 1BOCA 5DKRA 1PALA 3SJSA 4PT1A 4ORAB 1EL4A 4INXA 4MVFA 2G2BA 2LE9B 3CDNA 3DY9A 4PHMA 3IVTA 3D0YA 1QIWA 2P6BB 4GPLB 1AK8A 2JPOA 3D74A 1LXFC 2LNKA 2NCOA 2LM5A 2WCFA 3ICBA 5J3XA 2WNDA 4OVNF 1OOJA 2JC2A 4D1EA 1BLQA 4ZCUA 4DIRA 2JT8A 4DUQA 2MLEC 1DTLA 1K95A 2KYCA 2PASA 3K1EA 4FQOA 2JNXA 1PSRA 3TS5C 1GGWA 1UHHA 3CYZA 4GGNA 3EVUA 4I5NB 1WLMA 1OMRA 4GGFA 4INWA 3Q8IA 1BR4B 3D73A 2ISDA 2K60A 3CWGA 4N1GA 1A03A 2Y5IA 3CLNA 1S26D 1IIOA 2AAOA 1WRLA 2BE4A 4GAOA 3TUYB 3OBVA 1XVJA 1UHJA 3AKBA 3A8RA 1KK8C 1RJVA 1CFDA 2LP3A 2NXQA 2BBMA 3B88A 3MSEB 3TS5B 4ETOA 1GM0A 1J1EA 4C0JA 4JKTA 1CNPA 1G33A 4GUKA 1K90D 2BL0C 1NX0A 4YBHB 3I5IC 3SG7A 1MXEA 3VRNA 4ICBA 5CSJA 2K2AA 4NDBA 2I18A 2KNEA 2Y1NA 3SG5A 2PMYA 5AFPA 1QATA 2LANA 1B1GA 3TZ1A 2KFHA 1PVBA 2PYQA 2WCJA 1TRFA 2L51A 3FWBA 1Z4HA 1K96A 1P28A 5FI2A 1TUZA 3OB1B 3PLFB 3RLZA 5CSIA 3PJIA 1YURA 2BL0B 2WCMA 1H8BA 1ORGA 2AMIA 4TNCA 3VRRA 4KYNA 1SBJA 3FWCA 1QTXA 3EKJA 1PSBA 2WCBA 1CM4A 1SL7A 5D3OA 1NX2A 3IQOA 3TDUA 1J7PA 2OTGC 3EVVA 3CR5X 4MBEA 4DCKA 1KSOA 1QX5B 1RROA 2BECA 1XFVO 2JXLA 2KPHA 2LLSA 3O4YA 1NIWA 1F4QA 1BJFA 2M9GA 1EH2A 1R6PA 2LV7A 4I5KA 2M7NA 2CCMA 3NSKA 1DQEA 5FI7A 5AERA 1VRKA 5CSFA 2F2OA 4CIDA 4YGCB 4YI9A 4JQ0D 2KSPA 2GGZA 1OOFA 1B9AA 2M29A 1WDCC 2JQ6A 1A2XA 3DZTA 4GBAA 4OCIA 3D10A 1NCZA 1BG1A 1MQ1A 1PVAA 3DVEA 2BAPA 2K7OA 1BODA 1TN4A 1MXLC 3VGOA 4E68A 2CNPA 1J1DA 1CFCA 1FF1A 2GTEA 4HSZA 2CBLA 3SG2A 2FOTA 2VRGA 5FI6A 2JU0A 1TTXA 3EKHA 1KFXL 3NGVA 1UHKA 1X02A 3I5FB 2MBXA 2F3YA 1IKUA 1DJYA 1D1OA 2KDHA 1DVIA 3ZNIA 1TWOA 2KI6C 3BUWB 4HRGA 1L7ZA 1CDPA 3V2LA 1LS8A 3BFHA 1SK6D 1SSEB 1S6JA 3S0AA 3VB1A 4A4CA 3I5GC 1Y1XA 2NCPA 3PSRA 2HF5A 1S6CA 2L98A 2WCEA 1G4YR 1OMDA 2F3ZA 1IG5A 2L5YA 2O5GA 1EG4A 1JF2A 1SPYA 4M2QA 4XJKB 2LMVA 1FBVA 3LK1A 2LAPA 4MEWA 1CMGA 3EG5B 2QEHA 1S6IA 5AEQA 1M46A 3B86A 1S3PA 1B47A 1IWQA 5K89A 1RWYA 1C7WA 1TIZA 5I8NA 5I2LA 1BT6A 2QPTA 1K93D 2KBIA 2ZRTA 1W7JB 5DICA 3S0BA 2LCPA 2FCDA 4XJKA 3BQ3A 2MJWB 4U8DA 4ORBB 1UP5A 3BUXB 1DJIA 3EK8A 3O4XA 2JULA 2LVKA 5KU1A 3KEVA 1MUXA 1XK4A 5HYDA 2ZNDA 4MN0A 1JSAA 1SR6C 2LHLA 3WHUB 1DT7B 1LINA 1CDLA 2JTZA 3WXAA 2F33A 3TUYC 1IQ5A 1N2DA 1KQMB 3DF0B 1CFFA 2OPOA 3SS3A 1YVLA 1U5IB 3OHMB 2F8PA 1KFXS 2BKHB 3QRXA 3K21A 2LVIA 1NCXA 1QLKA 1QS7A 4MSPA 3GK4X 1C7VA 4QJ4B 1XFWO 1W9ZA 2KOTA 2M1UA 1K9KA 2QEOA 1BF5A 1S1EA 3S0DA 4YGEB 1CTRA 1XFYO 4N5XA 3CS1A 2TN4A 5I2QA 2NLNA 3M0WA 1SR6B 2H2KA 4CFRA 1EJ3A 3LK0A 4WRIA 1XA5A 2WOSA 1UURA 1KK7Y 1KQVA 2WCKA 1QV0A 1FW4A 1KFUL 1ODBA 3DF0A 3NSOA 1TNQA 1DGVA 1U5IA 2K7BA 2LVVA 1ZMZA 3CGAA 4ZCVA 4Q04A 1QASA 2LP2A 2Q91A 4L9MA 4ORCB 4GFTA 4PE0A 2MRDA 5KTYA 3OGNA 4PE4A 1F4OA 3KPXA 1J7OA 2FJUB 3E3RA 4AQIA 4PE1A 4BY5A 1OZOA 2KI4C 2K7CA 4MZLA 1M45A 2L2CA 1ZFSA 2NZ0A 5D69A 5I2OA 2RGIA 3L47A 3A4UB 1XFZO 4MRYA 4N1FA 4P5OE 3GK1A 4F7FA 1WRZA 1KWOB 3SIAA 1AP4A 3CZ1A 3FE8A 5F6TA 2Y1MA 1QJTA 1OOGA 4CLNA 4PHKA 2DOQA 2E6WA 3GK2A 3NXAA 1DC1A 3CZTX 4YGDB 2I2RE 2KI4B 3JVTC 3NSIA 3BJHA 4A4BA 1E8AA 1SW8A 1DGUA 3O78A 2B1UA 3PALA 1FI6A 1CFPA 1KSMA 1PRWA 1XO5A 5DKQA 4DRWA 1R2UA 1N65A 1NUBA 2KGBC 3BUOB 1JFJA 5PALA 1DJXA 4CPVA 1IRJA 4AOMA 2L5XB 3GOFA 3WHTB 1RFJA 2JXCA 1YX7A 1PK0D 1DF0B 3I5FC 2ZFDA 1OSAA 2V53A 1MHOA 1JF0A 1TNXA 3JVTB 3TDIA 2H61A 5HL1A 1NX1A 5EL2A 2M1KB 2JRFA 2O60A 3FE6A 3QMEA 1C07A 1SKTA 3D75A 4PHJA 3BUMB 1KFUS 1RECA 3BYAA 4PE7A 2WCHA 1YX8A 1MWNA 2KFGA 3L4LA 1S5GZ 4HRHA 5FYXA 3LL8B 1QVIZ 1QV1A 2PSRA 3PATA 2FCEA 2PVBA 4AQJA 1TUJA 1DF0A 2KBMA 3EK4A 2GV5A 3B6XA 2AUCA 3DD4A 1QWVA 2MAZA 2MHHA 1XFUO 4UPGA 2ZNEA 1DELA 2M8UA 3CZ0A 2KYFA 3OP0A 1ZOTB 1JWDA 3LCPC 1DJWA 1CLLA 1XK4C 1NYAA 1MR8A 3FIAA 3ZWHA 1YR5A 1FPWA 1SRAA 1CM1A 5HLVA 4USLA 1KCYA 1JFKA 3DVKA 1BR1B 5ER5A 3SS5A 4CFQA 2YGUA 1YRTB 3SG6A 4MRXA 1QLSA 1DJZA 5CPVA 3IQQA 4BY4A 1UWOA 1B7TZ 3PN7B 2LUXA 1S5GY 1TCOB 1C3YA 2K61A 1OMVA 3SS4A 4MZKA 1QVIY 4C0KA 1J7QA 2WC8A 1L2OB 2CT9A 3OX6A 1NSHA 2GGMA 2JT0A 2KAXA 3RM1A 1KQMC 3HCMA 4R1EA 3UNWA 4DS7A 1DEKA 1GGZA 1KK7Z 1IJ5A 1CDMA 1IH0A 1IJ6A 1UHIA 2JZIA 1AJ4A 1WY9A 1CLMA 1TOPA 1AHRA 5I94A 1YUUA 1ALVA 1IGVA 2LMUA 4PHNA 1A29A 5GQQC 3CABA 1S36A 2Q4UA 3R72A 1Z2CB 2LHIA 3PFVA 2R2IA 3EVRA 2H8VA 2P70A 3CR4X 5TNCA 1M31A 3NHIA 4JD9A 1GJYA 1UUSA 1TNWA 2COLB 2M0RA 1SY9A 2QEBA 3KHEA 4QJ3B 1JUOA 1LKJA 2HPSA
chains in the Genus database with same CATH topology
3B87A 1DQEA 3B7AA 2L2CA 3L47A 3N7HA 3FE9A 1OOFA 1OOIX 4F7FA 3DZTA 3CZ1A 3FE8A 1OOGA 1T14A 3D76A 2GTEA 2QEVA 3R1OA 3BJHA 3D78A 3NGVA 4FQTA 2QDIA 3R1VA 1TWOA 4PT1A 4INXA 3V2LA 1LS8A 3BFHA 3CDNA 3DY9A 3S0AA 3VB1A 5EL2A 3FE6A 3QMEA 3D75A 2JPOA 3D74A 2WCHA 2WC5A 3RZSA 3L4LA 3D77A 2PQLA 3S0GA 3K1EA 1TUJA 2QEHA 3BFAA 3B6XA 2WCLA 3B86A 1QWVA 3CYZA 3DXLA 3S0FA 4INWA 3Q8IA 3CZ0A 3D73A 1OW4A 5DICA 3S0BA 3S0EA 2WC6A 3B88A 1GM0A 2P71A 1XFRA 3L4AA 3R1PA 3DYEA 1C3YA 2QEOA 3S0DA 2WCJA 1C3ZA 3BFBA 1P28A 3PJIA 2WCMA 2WCKA 4OZDA 1ORGA 1OOHA 2FJYA 3CABA 3R72A 2H8VA 2P70A 3NHIA 4JD9A 2KPHA 2ERBA 2QEBA 3NHTA 3OGNA 3CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B87 A;  1DQE A;  3B7A A;  2L2C A;  3L47 A;  3N7H A;  3FE9 A;  1OOF A;  1OOI X;  4F7F A;  3DZT A;  3CZ1 A;  3FE8 A;  1OOG A;  1T14 A;  3D76 A;  2GTE A;  2QEV A;  3R1O A;  3BJH A;  3D78 A;  3NGV A;  4FQT A;  2QDI A;  3R1V A;  1TWO A;  4PT1 A;  4INX A;  3V2L A;  1LS8 A;  3BFH A;  3CDN A;  3DY9 A;  3S0A A;  3VB1 A;  5EL2 A;  3FE6 A;  3QME A;  3D75 A;  2JPO A;  3D74 A;  2WCH A;  2WC5 A;  3RZS A;  3L4L A;  3D77 A;  2PQL A;  3S0G A;  3K1E A;  1TUJ A;  2QEH A;  3BFA A;  3B6X A;  2WCL A;  3B86 A;  1QWV A;  3CYZ A;  3DXL A;  3S0F A;  4INW A;  3Q8I A;  3CZ0 A;  3D73 A;  1OW4 A;  5DIC A;  3S0B A;  3S0E A;  2WC6 A;  3B88 A;  1GM0 A;  2P71 A;  1XFR A;  3L4A A;  3R1P A;  3DYE A;  1C3Y A;  2QEO A;  3S0D A;  2WCJ A;  1C3Z A;  3BFB A;  1P28 A;  3PJI A;  2WCM A;  2WCK A;  4OZD A;  1ORG A;  1OOH A;  2FJY A;  3CAB A;  3R72 A;  2H8V A;  2P70 A;  3NHI A;  4JD9 A;  2KPH A;  2ERB A;  2QEB A;  3NHT A;  3OGN A;  3CZ2 A; 
#chains in the Genus database with same CATH topology
 2JOJ A;  3B87 A;  4XYN A;  3BXK A;  1M39 A;  3B7A A;  1B7T Y;  3OB2 B;  5CSN A;  3UO9 A;  3O2P A;  1ZAC A;  1Y6W A;  1SL8 A;  2Y4Q A;  2CXJ A;  1QIV A;  2KLD A;  3HX4 A;  5G08 A;  3DVJ A;  3FE9 A;  2A4J A;  4FTG A;  3PM8 A;  1NCY A;  3I5H B;  2BKI B;  2JNF A;  3JTD C;  3LLE A;  1Q80 A;  1RTP 1;  1T14 A;  3VRP A;  1YUT A;  2BBN A;  2KQY A;  2K2F A;  1KWO C;  1QX2 A;  3D78 A;  5BPJ A;  3EK7 A;  4OR9 B;  2I94 A;  4MZJ A;  4NQG A;  1PUL A;  3AKA A;  2ZKM X;  2M7L A;  1XYD A;  2JPT A;  1K94 A;  4FQT A;  2LLT A;  1IQ3 A;  2G9B A;  2QDI A;  3JTD B;  3H4S E;  1CB1 A;  2BCA A;  1B8R A;  1Y1U A;  2HET A;  2H61 C;  1SMG A;  1F8H A;  1FI5 A;  1B8L A;  2MA2 A;  2KHN A;  5AAN A;  1SYM A;  1HQV A;  4M2P A;  4M2O A;  1F70 A;  2OS8 C;  2LLU A;  1G8I A;  2KI6 D;  1MF8 B;  2L4H A;  5AXI A;  1XFX O;  1AJ5 A;  2I7A A;  1QXP A;  5B8I B;  1CDN A;  2PRU A;  2SCP A;  3CTN A;  2M97 A;  2WC5 A;  4YRU A;  3RZS A;  1J55 A;  2KLE A;  3SG3 A;  2ZN9 A;  1ALW A;  3D77 A;  2PQL A;  2LMT A;  3S0G A;  2ZRS A;  5ER4 X;  3VRQ A;  1AVS A;  3KF9 A;  1A75 B;  3BFA A;  4PAL A;  2IS9 A;  3CR2 A;  3TDZ A;  2OS8 B;  1JC2 A;  1H4B A;  2WCL A;  3DXL A;  3S0F A;  1KK8 B;  4WQ3 A;  1F54 A;  1K8U A;  4OKH A;  5JJG A;  1OW4 A;  1YTZ C;  1K9U A;  2MLF C;  3AAJ A;  3IF7 A;  1CKK A;  2L50 A;  1AUI B;  2WOR A;  2BCB A;  4YI8 A;  1ZUZ A;  1RK9 A;  4YGB B;  3S0E A;  3I5I B;  3F45 A;  4WQ2 A;  1OZS A;  1WLZ A;  2F2P A;  2KAV A;  4P2Y B;  2WC6 A;  4C0L A;  2EC6 C;  1A75 A;  1DMO A;  2P71 A;  3BUN B;  4GNK B;  1XFR A;  3L4A A;  4I5L B;  1V1F A;  5KSZ A;  1HT9 A;  4I5J A;  1YUS A;  1SNL A;  3R1P A;  4PCW A;  1F71 A;  3DYE A;  1NWD A;  1BMO A;  3FS7 A;  3WNX B;  2QAC A;  2E30 A;  1CMF A;  1B8C A;  1NPQ A;  1C3Z A;  3NSL A;  1LA3 A;  2K0J A;  3AAK A;  1YVH A;  3BFB A;  2EC6 B;  1F55 A;  1BU3 A;  1TNP A;  2HQW A;  2OTG B;  3PN7 C;  2KAY A;  2KFF A;  1YRU B;  4OZD A;  4NDC A;  1L2O C;  2BE6 A;  2JT3 A;  2D8N A;  1OOH A;  2FJY A;  2JWW A;  4HRE E;  5HKW A;  2L2E A;  5IBW A;  4JPZ B;  2L4I A;  2BNX A;  2M3W A;  1B4C A;  3BOW B;  4IL1 A;  2CTN A;  1CLB A;  3C1V A;  4JWQ A;  4NDD A;  2KQ6 A;  4YGA A;  2ERB A;  2JTT A;  1WRK A;  2HQ8 A;  3NHT A;  1WDC B;  1Y1A A;  1W7I B;  3CZ2 A;  5HLO A;  3SG4 A;  2LVJ A;  1DJH A;  1SL9 A;  1JBA A;  2SAS A;  2M49 B;  3DVM A;  4F0Z B;  1J7R A;  3N7H A;  1K2H A;  1EXR A;  4IJ7 A;  4QJ5 B;  1LVC D;  1N0Y A;  1OOI X;  3OX5 A;  4PDZ A;  3SIB A;  1SCM C;  3KO0 A;  1SCV A;  3VRO A;  3BOW A;  2K8M B;  3O6B A;  4OV2 A;  1DJG A;  1V1G A;  5JOL A;  2ZN8 A;  2BCX A;  2KGR A;  2EGD A;  1M63 B;  3D76 A;  3D0Y B;  1LA0 A;  1TCF A;  1QX7 A;  1K9P A;  2EHB A;  2QEV A;  3R1O A;  5HKY A;  1OQP A;  5D7F A;  1UHN A;  3I5H C;  4GGF C;  2L0P A;  4MLW A;  1GQM A;  2K7D A;  1EG3 A;  1NP8 A;  2PAL A;  1SCM B;  3I5G B;  2LUC A;  1OE9 B;  5HKZ A;  5DKN A;  1A4P A;  1NX3 A;  1Y0V H;  2LC5 A;  3PM2 A;  3R1V A;  1BOC A;  5DKR A;  1PAL A;  3SJS A;  4PT1 A;  4ORA B;  1EL4 A;  4INX A;  4MVF A;  2G2B A;  2LE9 B;  3CDN A;  3DY9 A;  4PHM A;  3IVT A;  3D0Y A;  1QIW A;  2P6B B;  4GPL B;  1AK8 A;  2JPO A;  3D74 A;  1LXF C;  2LNK A;  2NCO A;  2LM5 A;  2WCF A;  3ICB A;  5J3X A;  2WND A;  4OVN F;  1OOJ A;  2JC2 A;  4D1E A;  1BLQ A;  4ZCU A;  4DIR A;  2JT8 A;  4DUQ A;  2MLE C;  1DTL A;  1K95 A;  2KYC A;  2PAS A;  3K1E A;  4FQO A;  2JNX A;  1PSR A;  3TS5 C;  1GGW A;  1UHH A;  3CYZ A;  4GGN A;  3EVU A;  4I5N B;  1WLM A;  1OMR A;  4GGF A;  4INW A;  3Q8I A;  1BR4 B;  3D73 A;  2ISD A;  2K60 A;  3CWG A;  4N1G A;  1A03 A;  2Y5I A;  3CLN A;  1S26 D;  1IIO A;  2AAO A;  1WRL A;  2BE4 A;  4GAO A;  3TUY B;  3OBV A;  1XVJ A;  1UHJ A;  3AKB A;  3A8R A;  1KK8 C;  1RJV A;  1CFD A;  2LP3 A;  2NXQ A;  2BBM A;  3B88 A;  3MSE B;  3TS5 B;  4ETO A;  1GM0 A;  1J1E A;  4C0J A;  4JKT A;  1CNP A;  1G33 A;  4GUK A;  1K90 D;  2BL0 C;  1NX0 A;  4YBH B;  3I5I C;  3SG7 A;  1MXE A;  3VRN A;  4ICB A;  5CSJ A;  2K2A A;  4NDB A;  2I18 A;  2KNE A;  2Y1N A;  3SG5 A;  2PMY A;  5AFP A;  1QAT A;  2LAN A;  1B1G A;  3TZ1 A;  2KFH A;  1PVB A;  2PYQ A;  2WCJ A;  1TRF A;  2L51 A;  3FWB A;  1Z4H A;  1K96 A;  1P28 A;  5FI2 A;  1TUZ A;  3OB1 B;  3PLF B;  3RLZ A;  5CSI A;  3PJI A;  1YUR A;  2BL0 B;  2WCM A;  1H8B A;  1ORG A;  2AMI A;  4TNC A;  3VRR A;  4KYN A;  1SBJ A;  3FWC A;  1QTX A;  3EKJ A;  1PSB A;  2WCB A;  1CM4 A;  1SL7 A;  5D3O A;  1NX2 A;  3IQO A;  3TDU A;  1J7P A;  2OTG C;  3EVV A;  3CR5 X;  4MBE A;  4DCK A;  1KSO A;  1QX5 B;  1RRO A;  2BEC A;  1XFV O;  2JXL A;  2KPH A;  2LLS A;  3O4Y A;  1NIW A;  1F4Q A;  1BJF A;  2M9G A;  1EH2 A;  1R6P A;  2LV7 A;  4I5K A;  2M7N A;  2CCM A;  3NSK A;  1DQE A;  5FI7 A;  5AER A;  1VRK A;  5CSF A;  2F2O A;  4CID A;  4YGC B;  4YI9 A;  4JQ0 D;  2KSP A;  2GGZ A;  1OOF A;  1B9A A;  2M29 A;  1WDC C;  2JQ6 A;  1A2X A;  3DZT A;  4GBA A;  4OCI A;  3D10 A;  1NCZ A;  1BG1 A;  1MQ1 A;  1PVA A;  3DVE A;  2BAP A;  2K7O A;  1BOD A;  1TN4 A;  1MXL C;  3VGO A;  4E68 A;  2CNP A;  1J1D A;  1CFC A;  1FF1 A;  2GTE A;  4HSZ A;  2CBL A;  3SG2 A;  2FOT A;  2VRG A;  5FI6 A;  2JU0 A;  1TTX A;  3EKH A;  1KFX L;  3NGV A;  1UHK A;  1X02 A;  3I5F B;  2MBX A;  2F3Y A;  1IKU A;  1DJY A;  1D1O A;  2KDH A;  1DVI A;  3ZNI A;  1TWO A;  2KI6 C;  3BUW B;  4HRG A;  1L7Z A;  1CDP A;  3V2L A;  1LS8 A;  3BFH A;  1SK6 D;  1SSE B;  1S6J A;  3S0A A;  3VB1 A;  4A4C A;  3I5G C;  1Y1X A;  2NCP A;  3PSR A;  2HF5 A;  1S6C A;  2L98 A;  2WCE A;  1G4Y R;  1OMD A;  2F3Z A;  1IG5 A;  2L5Y A;  2O5G A;  1EG4 A;  1JF2 A;  1SPY A;  4M2Q A;  4XJK B;  2LMV A;  1FBV A;  3LK1 A;  2LAP A;  4MEW A;  1CMG A;  3EG5 B;  2QEH A;  1S6I A;  5AEQ A;  1M46 A;  3B86 A;  1S3P A;  1B47 A;  1IWQ A;  5K89 A;  1RWY A;  1C7W A;  1TIZ A;  5I8N A;  5I2L A;  1BT6 A;  2QPT A;  1K93 D;  2KBI A;  2ZRT A;  1W7J B;  5DIC A;  3S0B A;  2LCP A;  2FCD A;  4XJK A;  3BQ3 A;  2MJW B;  4U8D A;  4ORB B;  1UP5 A;  3BUX B;  1DJI A;  3EK8 A;  3O4X A;  2JUL A;  2LVK A;  5KU1 A;  3KEV A;  1MUX A;  1XK4 A;  5HYD A;  2ZND A;  4MN0 A;  1JSA A;  1SR6 C;  2LHL A;  3WHU B;  1DT7 B;  1LIN A;  1CDL A;  2JTZ A;  3WXA A;  2F33 A;  3TUY C;  1IQ5 A;  1N2D A;  1KQM B;  3DF0 B;  1CFF A;  2OPO A;  3SS3 A;  1YVL A;  1U5I B;  3OHM B;  2F8P A;  1KFX S;  2BKH B;  3QRX A;  3K21 A;  2LVI A;  1NCX A;  1QLK A;  1QS7 A;  4MSP A;  3GK4 X;  1C7V A;  4QJ4 B;  1XFW O;  1W9Z A;  2KOT A;  2M1U A;  1K9K A;  2QEO A;  1BF5 A;  1S1E A;  3S0D A;  4YGE B;  1CTR A;  1XFY O;  4N5X A;  3CS1 A;  2TN4 A;  5I2Q A;  2NLN A;  3M0W A;  1SR6 B;  2H2K A;  4CFR A;  1EJ3 A;  3LK0 A;  4WRI A;  1XA5 A;  2WOS A;  1UUR A;  1KK7 Y;  1KQV A;  2WCK A;  1QV0 A;  1FW4 A;  1KFU L;  1ODB A;  3DF0 A;  3NSO A;  1TNQ A;  1DGV A;  1U5I A;  2K7B A;  2LVV A;  1ZMZ A;  3CGA A;  4ZCV A;  4Q04 A;  1QAS A;  2LP2 A;  2Q91 A;  4L9M A;  4ORC B;  4GFT A;  4PE0 A;  2MRD A;  5KTY A;  3OGN A;  4PE4 A;  1F4O A;  3KPX A;  1J7O A;  2FJU B;  3E3R A;  4AQI A;  4PE1 A;  4BY5 A;  1OZO A;  2KI4 C;  2K7C A;  4MZL A;  1M45 A;  2L2C A;  1ZFS A;  2NZ0 A;  5D69 A;  5I2O A;  2RGI A;  3L47 A;  3A4U B;  1XFZ O;  4MRY A;  4N1F A;  4P5O E;  3GK1 A;  4F7F A;  1WRZ A;  1KWO B;  3SIA A;  1AP4 A;  3CZ1 A;  3FE8 A;  5F6T A;  2Y1M A;  1QJT A;  1OOG A;  4CLN A;  4PHK A;  2DOQ A;  2E6W A;  3GK2 A;  3NXA A;  1DC1 A;  3CZT X;  4YGD B;  2I2R E;  2KI4 B;  3JVT C;  3NSI A;  3BJH A;  4A4B A;  1E8A A;  1SW8 A;  1DGU A;  3O78 A;  2B1U A;  3PAL A;  1FI6 A;  1CFP A;  1KSM A;  1PRW A;  1XO5 A;  5DKQ A;  4DRW A;  1R2U A;  1N65 A;  1NUB A;  2KGB C;  3BUO B;  1JFJ A;  5PAL A;  1DJX A;  4CPV A;  1IRJ A;  4AOM A;  2L5X B;  3GOF A;  3WHT B;  1RFJ A;  2JXC A;  1YX7 A;  1PK0 D;  1DF0 B;  3I5F C;  2ZFD A;  1OSA A;  2V53 A;  1MHO A;  1JF0 A;  1TNX A;  3JVT B;  3TDI A;  2H61 A;  5HL1 A;  1NX1 A;  5EL2 A;  2M1K B;  2JRF A;  2O60 A;  3FE6 A;  3QME A;  1C07 A;  1SKT A;  3D75 A;  4PHJ A;  3BUM B;  1KFU S;  1REC A;  3BYA A;  4PE7 A;  2WCH A;  1YX8 A;  1MWN A;  2KFG A;  3L4L A;  1S5G Z;  4HRH A;  5FYX A;  3LL8 B;  1QVI Z;  1QV1 A;  2PSR A;  3PAT A;  2FCE A;  2PVB A;  4AQJ A;  1TUJ A;  1DF0 A;  2KBM A;  3EK4 A;  2GV5 A;  3B6X A;  2AUC A;  3DD4 A;  1QWV A;  2MAZ A;  2MHH A;  1XFU O;  4UPG A;  2ZNE A;  1DEL A;  2M8U A;  3CZ0 A;  2KYF A;  3OP0 A;  1ZOT B;  1JWD A;  3LCP C;  1DJW A;  1CLL A;  1XK4 C;  1NYA A;  1MR8 A;  3FIA A;  3ZWH A;  1YR5 A;  1FPW A;  1SRA A;  1CM1 A;  5HLV A;  4USL A;  1KCY A;  1JFK A;  3DVK A;  1BR1 B;  5ER5 A;  3SS5 A;  4CFQ A;  2YGU A;  1YRT B;  3SG6 A;  4MRX A;  1QLS A;  1DJZ A;  5CPV A;  3IQQ A;  4BY4 A;  1UWO A;  1B7T Z;  3PN7 B;  2LUX A;  1S5G Y;  1TCO B;  1C3Y A;  2K61 A;  1OMV A;  3SS4 A;  4MZK A;  1QVI Y;  4C0K A;  1J7Q A;  2WC8 A;  1L2O B;  2CT9 A;  3OX6 A;  1NSH A;  2GGM A;  2JT0 A;  2KAX A;  3RM1 A;  1KQM C;  3HCM A;  4R1E A;  3UNW A;  4DS7 A;  1DEK A;  1GGZ A;  1KK7 Z;  1IJ5 A;  1CDM A;  1IH0 A;  1IJ6 A;  1UHI A;  2JZI A;  1AJ4 A;  1WY9 A;  1CLM A;  1TOP A;  1AHR A;  5I94 A;  1YUU A;  1ALV A;  1IGV A;  2LMU A;  4PHN A;  1A29 A;  5GQQ C;  3CAB A;  1S36 A;  2Q4U A;  3R72 A;  1Z2C B;  2LHI A;  3PFV A;  2R2I A;  3EVR A;  2H8V A;  2P70 A;  3CR4 X;  5TNC A;  1M31 A;  3NHI A;  4JD9 A;  1GJY A;  1UUS A;  1TNW A;  2COL B;  2M0R A;  1SY9 A;  2QEB A;  3KHE A;  4QJ3 B;  1JUO A;  1LKJ A;  2HPS A; 
#chains in the Genus database with same CATH homology
 3B87 A;  1DQE A;  3B7A A;  2L2C A;  3L47 A;  3N7H A;  3FE9 A;  1OOF A;  1OOI X;  4F7F A;  3DZT A;  3CZ1 A;  3FE8 A;  1OOG A;  1T14 A;  3D76 A;  2GTE A;  2QEV A;  3R1O A;  3BJH A;  3D78 A;  3NGV A;  4FQT A;  2QDI A;  3R1V A;  1TWO A;  4PT1 A;  4INX A;  3V2L A;  1LS8 A;  3BFH A;  3CDN A;  3DY9 A;  3S0A A;  3VB1 A;  5EL2 A;  3FE6 A;  3QME A;  3D75 A;  2JPO A;  3D74 A;  2WCH A;  2WC5 A;  3RZS A;  3L4L A;  3D77 A;  2PQL A;  3S0G A;  3K1E A;  1TUJ A;  2QEH A;  3BFA A;  3B6X A;  2WCL A;  3B86 A;  1QWV A;  3CYZ A;  3DXL A;  3S0F A;  4INW A;  3Q8I A;  3CZ0 A;  3D73 A;  1OW4 A;  5DIC A;  3S0B A;  3S0E A;  2WC6 A;  3B88 A;  1GM0 A;  2P71 A;  1XFR A;  3L4A A;  3R1P A;  3DYE A;  1C3Y A;  2QEO A;  3S0D A;  2WCJ A;  1C3Z A;  3BFB A;  1P28 A;  3PJI A;  2WCM A;  2WCK A;  4OZD A;  1ORG A;  1OOH A;  2FJY A;  3CAB A;  3R72 A;  2H8V A;  2P70 A;  3NHI A;  4JD9 A;  2KPH A;  2ERB A;  2QEB A;  3NHT A;  3OGN A;  3CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...