1T14A

Crystal structure of lush from drosophila melanogaster: apo protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 45
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1t14A00
3DXLA 2FJYA 2ERBA 5EL2A 3OGNA 3S0BA 2PQLA 3VB1A 3Q8IA 3BFBA 3L4AA 3QMEA 3DY9A 2H8VA 3FE9A 3S0AA 3B7AA 3L4LA 2P70A 3DZTA 1OOFA 2L2CA 3FE8A 3V2LA 3D74A 2GTEA 2WCLA 3CABA 1P28A 4JD9A 4FQTA 4INXA 1GM0A 3D76A 3PJIA 1C3ZA 3B86A 3B6XA 3R1OA 1OOHA 2QEVA 4F7FA 2WCHA 3S0EA 2P71A 3R72A 3BJHA 3D78A 1OOIX 3K1EA 3CZ0A 2WC5A 3CYZA 3NGVA 1LS8A 1ORGA 2WCKA 2KPHA 3S0FA 1OOGA 4PT1A 2QDIA 3CDNA 2QEOA 3D75A 3R1VA 5DICA 3R1PA 3DYEA 2QEBA 3D77A 1T14A 3RZSA 3B88A 3BFHA 4OZDA 3NHIA 1QWVA 1XFRA 2WCJA 2WCMA 3L47A 4INWA 3S0GA 1OW4A 3S0DA 3NHTA 2WC6A 1TWOA 3B87A 3CZ2A 3CZ1A 3BFAA 1C3YA 1TUJA 1DQEA 2JPOA 3FE6A 2QEHA 3N7HA 3D73A
chains in the Genus database with same CATH superfamily
1QX5B 2A4JA 2EC6C 4ORBB 1BLQA 2ERBA 2ZN9A 1K9KA 1KFXL 1KSMA 2JRFA 1PK0D 2LLUA 1IG5A 4PDZA 2R2IA 3HX4A 2ZFDA 1Y0VH 1UHKA 5CSJA 5FI2A 2WC8A 3L4LA 2NZ0A 2F3ZA 3OHMB 4NDBA 4ZCUA 1N2DA 1NPQA 2L2CA 4DRWA 4GGFC 3FE8A 2K2FA 2L98A 2KBIA 3EG5B 5I2OA 2L5YA 3C1VA 3NSIA 4JKTA 5I2QA 1K9UA 2LMTA 1M63B 1JBAA 2WCFA 1A2XA 2BCBA 1OQPA 1C07A 2KGRA 2LC5A 1J1EA 3IVTA 2LCPA 5HL1A 2KSPA 1MF8B 4FQTA 3LCPC 3SS3A 3PJIA 2FCDA 2JTTA 1M39A 3R1OA 1YUSA 1NCZA 2K61A 3WHUB 1SL7A 1EL4A 2PYQA 2P71A 1UHNA 1QXPA 2GGMA 4PE1A 1NX1A 2QPTA 5FI7A 2LAPA 1AVSA 3DVMA 3UO9A 1SK6D 2WOSA 1KSOA 1YX8A 3O4YA 4R1EA 2BKIB 1ZFSA 3EVVA 2F3YA 2E30A 2KI6C 2I18A 2KQ6A 1OZSA 5JJGA 3IQOA 2ZRTA 1XFWO 3EVUA 2KPHA 1C7WA 2E6WA 4WQ3A 1ZMZA 3S0FA 1FBVA 1KQVA 2JWWA 1OOGA 4HREE 4MBEA 5CSNA 1JWDA 1U5IA 1KK8B 1EXRA 3R1VA 2P6BB 2Y4QA 1NUBA 2K7CA 2LVVA 3I5FB 5HLOA 1YUTA 1DGUA 3KHEA 3TS5B 2F2PA 1LXFC 3BUOB 5I8NA 2JNFA 1WRZA 1D1OA 3BOWA 2L2EA 1SCVA 2PSRA 1IKUA 2ZNDA 1CFCA 1YURA 2QEBA 3WNXB 4P2YB 1DMOA 2MRDA 1N0YA 4GGNA 2G2BA 3I5GB 1J1DA 1Q80A 1DELA 1TIZA 4GGFA 3B88A 2LM5A 3BFHA 1RFJA 1SSEB 1OMVA 2KLDA 3FIAA 4PE0A 2LV7A 1B47A 1XFRA 2F8PA 3DVJA 1B8RA 1RECA 1TUZA 1KWOB 5AANA 2CTNA 3TUYC 3S0GA 3BUWB 1BU3A 3M0WA 1L2OC 1WDCC 4A4BA 4QJ4B 3NHTA 2TN4A 2WC6A 2M97A 1K8UA 1NX0A 4PALA 3CZ2A 1SR6C 3SJSA 2Q91A 1PULA 3CZTX 3K21A 1B7TY 1F4QA 3FWBA 2SCPA 1XK4A 3NSLA 2JPOA 4YBHB 1F54A 1CDMA 4PHNA 1DTLA 2M0RA 2QEHA 1IIOA 3N7HA 2BCXA 3DXLA 1BODA 3EVRA 2FJYA 2MA2A 3NSOA 4DS7A 3S0BA 3OGNA 1IJ5A 5FYXA 2KAVA 4JWQA 5ER5A 1S26D 1Y1UA 3DVEA 4DUQA 2JNXA 1QIWA 5D3OA 3H4SE 1DJIA 2L0PA 2VRGA 4CIDA 1U5IB 3L4AA 2JOJA 2M9GA 3QMEA 1CFDA 3S0AA 2K2AA 3B7AA 2EC6B 1BG1A 1JUOA 2KI6D 3D0YA 4I5KA 1QATA 1XO5A 2P70A 3BUXB 3GOFA 4ORCB 1DJXA 1QX7A 5TNCA 4QJ5B 1GGWA 3VRPA 2JXCA 1MHOA 1AHRA 4WRIA 2K8MB 3OBVA 4CFRA 3ICBA 1LKJA 2YGUA 2V53A 3IQQA 5KU1A 3DF0A 2MAZA 1OOJA 3BUMB 1WY9A 1SRAA 2JPTA 2O60A 3LL8B 3OB2B 1JF0A 4HSZA 4A4CA 4MEWA 2NXQA 1RK9A 2CBLA 2ISDA 2WCLA 1W9ZA 2KFFA 4GUKA 2LP2A 2QACA 1P28A 4JD9A 4N1FA 1GM0A 2SASA 3D76A 4E68A 1C3ZA 4GBAA 1SKTA 1PVAA 1F70A 1SL9A 4M2PA 4F7FA 2BL0C 2OTGC 2JU0A 2WCHA 5HKZA 1KQMC 3R72A 1W7JB 1J55A 1Y6WA 1XA5A 2B1UA 2JULA 3AAKA 1GQMA 3F45A 1PRWA 2KYFA 4PCWA 2M49B 2PMYA 1S3PA 1NP8A 1MXLC 1K96A 2G9BA 2BECA 3CZ0A 2GV5A 5ER4X 2Q4UA 3SG3A 1R2UA 1UP5A 2JT3A 2PALA 1BJFA 2LVIA 1TNPA 3CYZA 2WORA 1LS8A 4MRYA 5DKNA 1XFUO 5I94A 2L4IA 2WCKA 2K7OA 2MBXA 3CTNA 2BBMA 3FS7A 2L50A 1TTXA 1IRJA 3PATA 2LLTA 1DJWA 3I5IC 5AEQA 1XFZO 2KOTA 2H61C 2KAYA 2BKHB 1EJ3A 1PSRA 2QDIA 3PSRA 2JT0A 1CLBA 1A75A 5DICA 3R1PA 3E3RA 2LE9B 2CNPA 1B9AA 1NX2A 1IQ5A 2WNDA 1TN4A 3SG4A 2AAOA 1WLZA 1Z4HA 1XK4C 2I94A 2MLEC 4MSPA 2HQWA 4JPZB 3UNWA 2LANA 5AERA 1CMFA 1XFYO 4XJKB 4YGCB 3RZSA 3VROA 2JXLA 5DKRA 3AKBA 1OMDA 2KLEA 4GFTA 1CFFA 3NHIA 1J7QA 1S6IA 4ICBA 2LHLA 4OCIA 1GJYA 1YX7A 1DF0B 4M2OA 5AXIA 5I2LA 3KEVA 1DVIA 3SG5A 2WCMA 4INWA 1OW4A 1NCXA 3CS1A 4HRHA 3WHTB 1SPYA 1LINA 1SL8A 5HYDA 1QVIY 2K60A 1K2HA 1KFUS 2JT8A 1EG4A 1W7IB 1CM4A 1ZOTB 2OS8C 3BUNB 3TUYB 4AQJA 4CPVA 1L2OB 1G4YR 1UWOA 1WDCB 1WLMA 2D8NA 3FWCA 4MLWA 1S6JA 1CMGA 3FE6A 5FI6A 2L4HA 4GAOA 3D73A 1FPWA 3SG6A 4QJ3B 1FI6A 1RROA 1SR6B 3LK1A 5EL2A 4FTGA 1LA3A 2PQLA 4CLNA 1IH0A 1KFXS 3Q8IA 3JTDC 1A03A 1G33A 1OMRA 1EH2A 1S5GZ 2CXJA 1S6CA 1R6PA 1CKKA 1Y1AA 2H61A 1B8CA 3CWGA 3RLZA 3CR2A 4OR9B 3I5HC 3PN7C 1DJZA 4ORAB 1TNQA 1WRKA 5CSFA 1IJ6A 1ZACA 2M29A 1F8HA 1A29A 1XFXO 1KK8C 3LLEA 2JZIA 3SIAA 3PLFB 2MHHA 1FF1A 2LVJA 3NSKA 4KYNA 2GTEA 5PALA 1FW4A 3CABA 1XVJA 1YRTB 2FCEA 4INXA 2BE4A 3EKJA 3SS5A 1A4PA 3EKHA 1V1GA 2KHNA 3B86A 3B6XA 1OOHA 2PASA 2ZN8A 4N1GA 2FOTA 4I5JA 1DJYA 1TNWA 1F4OA 1JSAA 3KO0A 4GPLB 2M8UA 1CNPA 2NCOA 1SCMC 5HKYA 1EG3A 1M31A 1M45A 1ALVA 4N5XA 1QV1A 4FQOA 1GGZA 2BL0B 3IF7A 4C0KA 3DD4A 3GK1A 3BOWB 1F55A 3VRNA 2CT9A 3A8RA 1ZUZA 3NGVA 3TDIA 5B8IB 3ZWHA 1LVCD 3CGAA 1UURA 3RM1A 2EGDA 5K89A 1PALA 1DC1A 1J7OA 3JVTC 3NXAA 4PT1A 1ALWA 1YTZC 1BR4B 2FJUB 1JF2A 5J3XA 2RGIA 1DGVA 1XYDA 1XFVO 2HF5A 3DYEA 1N65A 3I5IB 4PHJA 1S36A 3VGOA 1CTRA 1LA0A 2WCBA 1KCYA 4PHMA 3D77A 5CPVA 1QX2A 2KI4C 1K9PA 3SG7A 1TCOB 1T14A 4P5OE 1AK8A 1AJ5A 2KFHA 2M3WA 5HKWA 2IS9A 4OZDA 2H2KA 1IWQA 1NX3A 4MZLA 4XYNA 3SG2A 2MJWB 3SIBA 3PALA 5KSZA 2LUXA 2ZNEA 2LVKA 3GK2A 1SY9A 1UHIA 4MZJA 1CDNA 1MUXA 2BBNA 3S0DA 1YR5A 2HETA 4MRXA 4U8DA 5DKQA 2LUCA 2WCEA 1B7TZ 1UHHA 2F33A 1M46A 3PM8A 4C0LA 1WRLA 1S5GY 4NQGA 3EK7A 5KTYA 2LP3A 3D0YB 1BMOA 3SS4A 1TRFA 3BFAA 4L9MA 1CB1A 3PM2A 1NCYA 1C3YA 1AUIB 1TOPA 1K90D 2M1KB 4WQ2A 1MQ1A 5HLVA 4F0ZB 1CFPA 2JQ6A 1UHJA 1UUSA 2O5GA 2L51A 3AKAA 2M7LA 5AFPA 2LMUA 3DF0B 4UPGA 5F6TA 2OS8B 2Y5IA 3MSEB 4HRGA 2Y1NA 3VB1A 1SW8A 3ZNIA 2NLNA 1C7VA 2L5XB 3PFVA 4OKHA 1G8IA 1ODBA 2KDHA 1NYAA 2BCAA 2BAPA 3BFBA 4YRUA 1PVBA 2H8VA 3DY9A 3FE9A 3OX6A 1QLSA 1HQVA 4NDCA 2KGBC 3DZTA 1NWDA 1OOFA 1MR8A 1YUUA 1QS7A 2HPSA 3BQ3A 1SMGA 4YGAA 2NCPA 1X02A 1KK7Z 3JTDB 4AQIA 1YVLA 4PE4A 1IQ3A 1BF5A 4NDDA 3V2LA 3D74A 3TZ1A 1B1GA 2Y1MA 3I5HB 3PN7B 4YI9A 4AOMA 2KAXA 1BR1B 5D69A 4IL1A 3VRRA 4YGBB 1YVHA 2DOQA 3O6BA 1BT6A 1CLMA 1SYMA 4C0JA 2COLB 1CDPA 2HQ8A 4MVFA 3KPXA 4YGDB 5JOLA 2QEVA 1L7ZA 4YI8A 1DJGA 3S0EA 1B8LA 3BJHA 1K93D 2PVBA 1A75B 1RWYA 2JC2A 3D78A 1OOIX 5G08A 1CDLA 2K0JA 3K1EA 2BE6A 1HT9A 1TCFA 3DVKA 4Q04A 4IJ7A 4ZCVA 1H8BA 4PHKA 3BXKA 2GGZA 3EK8A 2WC5A 1JFJA 4DIRA 1MXEA 1QV0A 2F2OA 4JQ0D 1J7RA 1MWNA 1ORGA 2PRUA 2MLFC 3O2PA 3OP0A 4BY4A 5IBWA 1RJVA 1DJHA 3I5FC 1OZOA 1V1FA 1SCMB 2KYCA 1BOCA 2M1UA 3TDUA 1PSBA 4D1EA 1QTXA 3TS5C 4BY5A 1SBJA 3CR4X 2LLSA 1F71A 1VRKA 2QEOA 3CDNA 3CLNA 3D75A 4I5NB 2JTZA 5BPJA 3HCMA 1OSAA 2OPOA 3LK0A 1NSHA 4TNCA 4ETOA 3I5GC 5CSIA 1DT7B 4I5LB 3WXAA 3QRXA 2BNXA 1Y1XA 3OB1B 1E8AA 2KFGA 3JVTB 2EHBA 3O78A 4OV2A 2ZKMX 1B4CA 2OTGB 4USLA 3KF9A 1KWOC 1CM1A 1KQMB 1S1EA 4MZKA 3CR5X 1NIWA 1YRUB 1IGVA 1Z2CB 1K95A 1TNXA 1JC2A 2AUCA 4OVNF 2M7NA 1QWVA 2K7BA 3O4XA 2I2RE 1K94A 2WCJA 1QLKA 2KI4B 1QASA 1QVIZ 2KBMA 2K7DA 1DEKA 4YGEB 5D7FA 3VRQA 4PE7A 1QJTA 3BYAA 1AJ4A 3L47A 4MN0A 2CCMA 2ZRSA 1RTP1 1KFUL 3EK4A 1SNLA 3AAJA 5GQQC 2I7AA 1TWOA 3B87A 1J7PA 3TDZA 3GK4X 3CZ1A 4GNKB 1AP4A 4XJKA 3D10A 4DCKA 1H4BA 2AMIA 1CLLA 1TUJA 2LMVA 2KQYA 3A4UB 4M2QA 1DQEA 1JFKA 1QIVA 2LNKA 3OX5A 4CFQA 2KNEA 1FI5A 1KK7Y 1OE9B 2LHIA 1DF0A
chains in the Genus database with same CATH topology
3DXLA 2FJYA 2ERBA 5EL2A 3OGNA 3S0BA 2PQLA 3VB1A 3Q8IA 3BFBA 3L4AA 3QMEA 3DY9A 2H8VA 3FE9A 3S0AA 3B7AA 3L4LA 2P70A 3DZTA 1OOFA 2L2CA 3FE8A 3V2LA 3D74A 2GTEA 2WCLA 3CABA 1P28A 4JD9A 4FQTA 4INXA 1GM0A 3D76A 3PJIA 1C3ZA 3B86A 3B6XA 3R1OA 1OOHA 2QEVA 4F7FA 2WCHA 3S0EA 2P71A 3R72A 3BJHA 3D78A 1OOIX 3K1EA 3CZ0A 2WC5A 3CYZA 3NGVA 1LS8A 1ORGA 2WCKA 2KPHA 3S0FA 1OOGA 4PT1A 2QDIA 3CDNA 2QEOA 3D75A 3R1VA 5DICA 3R1PA 3DYEA 2QEBA 3D77A 1T14A 3RZSA 3B88A 3BFHA 4OZDA 3NHIA 1QWVA 1XFRA 2WCJA 2WCMA 3L47A 4INWA 3S0GA 1OW4A 3S0DA 3NHTA 2WC6A 1TWOA 3B87A 3CZ2A 3CZ1A 3BFAA 1C3YA 1TUJA 1DQEA 2JPOA 3FE6A 2QEHA 3N7HA 3D73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXL A;  2FJY A;  2ERB A;  5EL2 A;  3OGN A;  3S0B A;  2PQL A;  3VB1 A;  3Q8I A;  3BFB A;  3L4A A;  3QME A;  3DY9 A;  2H8V A;  3FE9 A;  3S0A A;  3B7A A;  3L4L A;  2P70 A;  3DZT A;  1OOF A;  2L2C A;  3FE8 A;  3V2L A;  3D74 A;  2GTE A;  2WCL A;  3CAB A;  1P28 A;  4JD9 A;  4FQT A;  4INX A;  1GM0 A;  3D76 A;  3PJI A;  1C3Z A;  3B86 A;  3B6X A;  3R1O A;  1OOH A;  2QEV A;  4F7F A;  2WCH A;  3S0E A;  2P71 A;  3R72 A;  3BJH A;  3D78 A;  1OOI X;  3K1E A;  3CZ0 A;  2WC5 A;  3CYZ A;  3NGV A;  1LS8 A;  1ORG A;  2WCK A;  2KPH A;  3S0F A;  1OOG A;  4PT1 A;  2QDI A;  3CDN A;  2QEO A;  3D75 A;  3R1V A;  5DIC A;  3R1P A;  3DYE A;  2QEB A;  3D77 A;  1T14 A;  3RZS A;  3B88 A;  3BFH A;  4OZD A;  3NHI A;  1QWV A;  1XFR A;  2WCJ A;  2WCM A;  3L47 A;  4INW A;  3S0G A;  1OW4 A;  3S0D A;  3NHT A;  2WC6 A;  1TWO A;  3B87 A;  3CZ2 A;  3CZ1 A;  3BFA A;  1C3Y A;  1TUJ A;  1DQE A;  2JPO A;  3FE6 A;  2QEH A;  3N7H A;  3D73 A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  2A4J A;  2EC6 C;  4ORB B;  1BLQ A;  2ERB A;  2ZN9 A;  1K9K A;  1KFX L;  1KSM A;  2JRF A;  1PK0 D;  2LLU A;  1IG5 A;  4PDZ A;  2R2I A;  3HX4 A;  2ZFD A;  1Y0V H;  1UHK A;  5CSJ A;  5FI2 A;  2WC8 A;  3L4L A;  2NZ0 A;  2F3Z A;  3OHM B;  4NDB A;  4ZCU A;  1N2D A;  1NPQ A;  2L2C A;  4DRW A;  4GGF C;  3FE8 A;  2K2F A;  2L98 A;  2KBI A;  3EG5 B;  5I2O A;  2L5Y A;  3C1V A;  3NSI A;  4JKT A;  5I2Q A;  1K9U A;  2LMT A;  1M63 B;  1JBA A;  2WCF A;  1A2X A;  2BCB A;  1OQP A;  1C07 A;  2KGR A;  2LC5 A;  1J1E A;  3IVT A;  2LCP A;  5HL1 A;  2KSP A;  1MF8 B;  4FQT A;  3LCP C;  3SS3 A;  3PJI A;  2FCD A;  2JTT A;  1M39 A;  3R1O A;  1YUS A;  1NCZ A;  2K61 A;  3WHU B;  1SL7 A;  1EL4 A;  2PYQ A;  2P71 A;  1UHN A;  1QXP A;  2GGM A;  4PE1 A;  1NX1 A;  2QPT A;  5FI7 A;  2LAP A;  1AVS A;  3DVM A;  3UO9 A;  1SK6 D;  2WOS A;  1KSO A;  1YX8 A;  3O4Y A;  4R1E A;  2BKI B;  1ZFS A;  3EVV A;  2F3Y A;  2E30 A;  2KI6 C;  2I18 A;  2KQ6 A;  1OZS A;  5JJG A;  3IQO A;  2ZRT A;  1XFW O;  3EVU A;  2KPH A;  1C7W A;  2E6W A;  4WQ3 A;  1ZMZ A;  3S0F A;  1FBV A;  1KQV A;  2JWW A;  1OOG A;  4HRE E;  4MBE A;  5CSN A;  1JWD A;  1U5I A;  1KK8 B;  1EXR A;  3R1V A;  2P6B B;  2Y4Q A;  1NUB A;  2K7C A;  2LVV A;  3I5F B;  5HLO A;  1YUT A;  1DGU A;  3KHE A;  3TS5 B;  2F2P A;  1LXF C;  3BUO B;  5I8N A;  2JNF A;  1WRZ A;  1D1O A;  3BOW A;  2L2E A;  1SCV A;  2PSR A;  1IKU A;  2ZND A;  1CFC A;  1YUR A;  2QEB A;  3WNX B;  4P2Y B;  1DMO A;  2MRD A;  1N0Y A;  4GGN A;  2G2B A;  3I5G B;  1J1D A;  1Q80 A;  1DEL A;  1TIZ A;  4GGF A;  3B88 A;  2LM5 A;  3BFH A;  1RFJ A;  1SSE B;  1OMV A;  2KLD A;  3FIA A;  4PE0 A;  2LV7 A;  1B47 A;  1XFR A;  2F8P A;  3DVJ A;  1B8R A;  1REC A;  1TUZ A;  1KWO B;  5AAN A;  2CTN A;  3TUY C;  3S0G A;  3BUW B;  1BU3 A;  3M0W A;  1L2O C;  1WDC C;  4A4B A;  4QJ4 B;  3NHT A;  2TN4 A;  2WC6 A;  2M97 A;  1K8U A;  1NX0 A;  4PAL A;  3CZ2 A;  1SR6 C;  3SJS A;  2Q91 A;  1PUL A;  3CZT X;  3K21 A;  1B7T Y;  1F4Q A;  3FWB A;  2SCP A;  1XK4 A;  3NSL A;  2JPO A;  4YBH B;  1F54 A;  1CDM A;  4PHN A;  1DTL A;  2M0R A;  2QEH A;  1IIO A;  3N7H A;  2BCX A;  3DXL A;  1BOD A;  3EVR A;  2FJY A;  2MA2 A;  3NSO A;  4DS7 A;  3S0B A;  3OGN A;  1IJ5 A;  5FYX A;  2KAV A;  4JWQ A;  5ER5 A;  1S26 D;  1Y1U A;  3DVE A;  4DUQ A;  2JNX A;  1QIW A;  5D3O A;  3H4S E;  1DJI A;  2L0P A;  2VRG A;  4CID A;  1U5I B;  3L4A A;  2JOJ A;  2M9G A;  3QME A;  1CFD A;  3S0A A;  2K2A A;  3B7A A;  2EC6 B;  1BG1 A;  1JUO A;  2KI6 D;  3D0Y A;  4I5K A;  1QAT A;  1XO5 A;  2P70 A;  3BUX B;  3GOF A;  4ORC B;  1DJX A;  1QX7 A;  5TNC A;  4QJ5 B;  1GGW A;  3VRP A;  2JXC A;  1MHO A;  1AHR A;  4WRI A;  2K8M B;  3OBV A;  4CFR A;  3ICB A;  1LKJ A;  2YGU A;  2V53 A;  3IQQ A;  5KU1 A;  3DF0 A;  2MAZ A;  1OOJ A;  3BUM B;  1WY9 A;  1SRA A;  2JPT A;  2O60 A;  3LL8 B;  3OB2 B;  1JF0 A;  4HSZ A;  4A4C A;  4MEW A;  2NXQ A;  1RK9 A;  2CBL A;  2ISD A;  2WCL A;  1W9Z A;  2KFF A;  4GUK A;  2LP2 A;  2QAC A;  1P28 A;  4JD9 A;  4N1F A;  1GM0 A;  2SAS A;  3D76 A;  4E68 A;  1C3Z A;  4GBA A;  1SKT A;  1PVA A;  1F70 A;  1SL9 A;  4M2P A;  4F7F A;  2BL0 C;  2OTG C;  2JU0 A;  2WCH A;  5HKZ A;  1KQM C;  3R72 A;  1W7J B;  1J55 A;  1Y6W A;  1XA5 A;  2B1U A;  2JUL A;  3AAK A;  1GQM A;  3F45 A;  1PRW A;  2KYF A;  4PCW A;  2M49 B;  2PMY A;  1S3P A;  1NP8 A;  1MXL C;  1K96 A;  2G9B A;  2BEC A;  3CZ0 A;  2GV5 A;  5ER4 X;  2Q4U A;  3SG3 A;  1R2U A;  1UP5 A;  2JT3 A;  2PAL A;  1BJF A;  2LVI A;  1TNP A;  3CYZ A;  2WOR A;  1LS8 A;  4MRY A;  5DKN A;  1XFU O;  5I94 A;  2L4I A;  2WCK A;  2K7O A;  2MBX A;  3CTN A;  2BBM A;  3FS7 A;  2L50 A;  1TTX A;  1IRJ A;  3PAT A;  2LLT A;  1DJW A;  3I5I C;  5AEQ A;  1XFZ O;  2KOT A;  2H61 C;  2KAY A;  2BKH B;  1EJ3 A;  1PSR A;  2QDI A;  3PSR A;  2JT0 A;  1CLB A;  1A75 A;  5DIC A;  3R1P A;  3E3R A;  2LE9 B;  2CNP A;  1B9A A;  1NX2 A;  1IQ5 A;  2WND A;  1TN4 A;  3SG4 A;  2AAO A;  1WLZ A;  1Z4H A;  1XK4 C;  2I94 A;  2MLE C;  4MSP A;  2HQW A;  4JPZ B;  3UNW A;  2LAN A;  5AER A;  1CMF A;  1XFY O;  4XJK B;  4YGC B;  3RZS A;  3VRO A;  2JXL A;  5DKR A;  3AKB A;  1OMD A;  2KLE A;  4GFT A;  1CFF A;  3NHI A;  1J7Q A;  1S6I A;  4ICB A;  2LHL A;  4OCI A;  1GJY A;  1YX7 A;  1DF0 B;  4M2O A;  5AXI A;  5I2L A;  3KEV A;  1DVI A;  3SG5 A;  2WCM A;  4INW A;  1OW4 A;  1NCX A;  3CS1 A;  4HRH A;  3WHT B;  1SPY A;  1LIN A;  1SL8 A;  5HYD A;  1QVI Y;  2K60 A;  1K2H A;  1KFU S;  2JT8 A;  1EG4 A;  1W7I B;  1CM4 A;  1ZOT B;  2OS8 C;  3BUN B;  3TUY B;  4AQJ A;  4CPV A;  1L2O B;  1G4Y R;  1UWO A;  1WDC B;  1WLM A;  2D8N A;  3FWC A;  4MLW A;  1S6J A;  1CMG A;  3FE6 A;  5FI6 A;  2L4H A;  4GAO A;  3D73 A;  1FPW A;  3SG6 A;  4QJ3 B;  1FI6 A;  1RRO A;  1SR6 B;  3LK1 A;  5EL2 A;  4FTG A;  1LA3 A;  2PQL A;  4CLN A;  1IH0 A;  1KFX S;  3Q8I A;  3JTD C;  1A03 A;  1G33 A;  1OMR A;  1EH2 A;  1S5G Z;  2CXJ A;  1S6C A;  1R6P A;  1CKK A;  1Y1A A;  2H61 A;  1B8C A;  3CWG A;  3RLZ A;  3CR2 A;  4OR9 B;  3I5H C;  3PN7 C;  1DJZ A;  4ORA B;  1TNQ A;  1WRK A;  5CSF A;  1IJ6 A;  1ZAC A;  2M29 A;  1F8H A;  1A29 A;  1XFX O;  1KK8 C;  3LLE A;  2JZI A;  3SIA A;  3PLF B;  2MHH A;  1FF1 A;  2LVJ A;  3NSK A;  4KYN A;  2GTE A;  5PAL A;  1FW4 A;  3CAB A;  1XVJ A;  1YRT B;  2FCE A;  4INX A;  2BE4 A;  3EKJ A;  3SS5 A;  1A4P A;  3EKH A;  1V1G A;  2KHN A;  3B86 A;  3B6X A;  1OOH A;  2PAS A;  2ZN8 A;  4N1G A;  2FOT A;  4I5J A;  1DJY A;  1TNW A;  1F4O A;  1JSA A;  3KO0 A;  4GPL B;  2M8U A;  1CNP A;  2NCO A;  1SCM C;  5HKY A;  1EG3 A;  1M31 A;  1M45 A;  1ALV A;  4N5X A;  1QV1 A;  4FQO A;  1GGZ A;  2BL0 B;  3IF7 A;  4C0K A;  3DD4 A;  3GK1 A;  3BOW B;  1F55 A;  3VRN A;  2CT9 A;  3A8R A;  1ZUZ A;  3NGV A;  3TDI A;  5B8I B;  3ZWH A;  1LVC D;  3CGA A;  1UUR A;  3RM1 A;  2EGD A;  5K89 A;  1PAL A;  1DC1 A;  1J7O A;  3JVT C;  3NXA A;  4PT1 A;  1ALW A;  1YTZ C;  1BR4 B;  2FJU B;  1JF2 A;  5J3X A;  2RGI A;  1DGV A;  1XYD A;  1XFV O;  2HF5 A;  3DYE A;  1N65 A;  3I5I B;  4PHJ A;  1S36 A;  3VGO A;  1CTR A;  1LA0 A;  2WCB A;  1KCY A;  4PHM A;  3D77 A;  5CPV A;  1QX2 A;  2KI4 C;  1K9P A;  3SG7 A;  1TCO B;  1T14 A;  4P5O E;  1AK8 A;  1AJ5 A;  2KFH A;  2M3W A;  5HKW A;  2IS9 A;  4OZD A;  2H2K A;  1IWQ A;  1NX3 A;  4MZL A;  4XYN A;  3SG2 A;  2MJW B;  3SIB A;  3PAL A;  5KSZ A;  2LUX A;  2ZNE A;  2LVK A;  3GK2 A;  1SY9 A;  1UHI A;  4MZJ A;  1CDN A;  1MUX A;  2BBN A;  3S0D A;  1YR5 A;  2HET A;  4MRX A;  4U8D A;  5DKQ A;  2LUC A;  2WCE A;  1B7T Z;  1UHH A;  2F33 A;  1M46 A;  3PM8 A;  4C0L A;  1WRL A;  1S5G Y;  4NQG A;  3EK7 A;  5KTY A;  2LP3 A;  3D0Y B;  1BMO A;  3SS4 A;  1TRF A;  3BFA A;  4L9M A;  1CB1 A;  3PM2 A;  1NCY A;  1C3Y A;  1AUI B;  1TOP A;  1K90 D;  2M1K B;  4WQ2 A;  1MQ1 A;  5HLV A;  4F0Z B;  1CFP A;  2JQ6 A;  1UHJ A;  1UUS A;  2O5G A;  2L51 A;  3AKA A;  2M7L A;  5AFP A;  2LMU A;  3DF0 B;  4UPG A;  5F6T A;  2OS8 B;  2Y5I A;  3MSE B;  4HRG A;  2Y1N A;  3VB1 A;  1SW8 A;  3ZNI A;  2NLN A;  1C7V A;  2L5X B;  3PFV A;  4OKH A;  1G8I A;  1ODB A;  2KDH A;  1NYA A;  2BCA A;  2BAP A;  3BFB A;  4YRU A;  1PVB A;  2H8V A;  3DY9 A;  3FE9 A;  3OX6 A;  1QLS A;  1HQV A;  4NDC A;  2KGB C;  3DZT A;  1NWD A;  1OOF A;  1MR8 A;  1YUU A;  1QS7 A;  2HPS A;  3BQ3 A;  1SMG A;  4YGA A;  2NCP A;  1X02 A;  1KK7 Z;  3JTD B;  4AQI A;  1YVL A;  4PE4 A;  1IQ3 A;  1BF5 A;  4NDD A;  3V2L A;  3D74 A;  3TZ1 A;  1B1G A;  2Y1M A;  3I5H B;  3PN7 B;  4YI9 A;  4AOM A;  2KAX A;  1BR1 B;  5D69 A;  4IL1 A;  3VRR A;  4YGB B;  1YVH A;  2DOQ A;  3O6B A;  1BT6 A;  1CLM A;  1SYM A;  4C0J A;  2COL B;  1CDP A;  2HQ8 A;  4MVF A;  3KPX A;  4YGD B;  5JOL A;  2QEV A;  1L7Z A;  4YI8 A;  1DJG A;  3S0E A;  1B8L A;  3BJH A;  1K93 D;  2PVB A;  1A75 B;  1RWY A;  2JC2 A;  3D78 A;  1OOI X;  5G08 A;  1CDL A;  2K0J A;  3K1E A;  2BE6 A;  1HT9 A;  1TCF A;  3DVK A;  4Q04 A;  4IJ7 A;  4ZCV A;  1H8B A;  4PHK A;  3BXK A;  2GGZ A;  3EK8 A;  2WC5 A;  1JFJ A;  4DIR A;  1MXE A;  1QV0 A;  2F2O A;  4JQ0 D;  1J7R A;  1MWN A;  1ORG A;  2PRU A;  2MLF C;  3O2P A;  3OP0 A;  4BY4 A;  5IBW A;  1RJV A;  1DJH A;  3I5F C;  1OZO A;  1V1F A;  1SCM B;  2KYC A;  1BOC A;  2M1U A;  3TDU A;  1PSB A;  4D1E A;  1QTX A;  3TS5 C;  4BY5 A;  1SBJ A;  3CR4 X;  2LLS A;  1F71 A;  1VRK A;  2QEO A;  3CDN A;  3CLN A;  3D75 A;  4I5N B;  2JTZ A;  5BPJ A;  3HCM A;  1OSA A;  2OPO A;  3LK0 A;  1NSH A;  4TNC A;  4ETO A;  3I5G C;  5CSI A;  1DT7 B;  4I5L B;  3WXA A;  3QRX A;  2BNX A;  1Y1X A;  3OB1 B;  1E8A A;  2KFG A;  3JVT B;  2EHB A;  3O78 A;  4OV2 A;  2ZKM X;  1B4C A;  2OTG B;  4USL A;  3KF9 A;  1KWO C;  1CM1 A;  1KQM B;  1S1E A;  4MZK A;  3CR5 X;  1NIW A;  1YRU B;  1IGV A;  1Z2C B;  1K95 A;  1TNX A;  1JC2 A;  2AUC A;  4OVN F;  2M7N A;  1QWV A;  2K7B A;  3O4X A;  2I2R E;  1K94 A;  2WCJ A;  1QLK A;  2KI4 B;  1QAS A;  1QVI Z;  2KBM A;  2K7D A;  1DEK A;  4YGE B;  5D7F A;  3VRQ A;  4PE7 A;  1QJT A;  3BYA A;  1AJ4 A;  3L47 A;  4MN0 A;  2CCM A;  2ZRS A;  1RTP 1;  1KFU L;  3EK4 A;  1SNL A;  3AAJ A;  5GQQ C;  2I7A A;  1TWO A;  3B87 A;  1J7P A;  3TDZ A;  3GK4 X;  3CZ1 A;  4GNK B;  1AP4 A;  4XJK A;  3D10 A;  4DCK A;  1H4B A;  2AMI A;  1CLL A;  1TUJ A;  2LMV A;  2KQY A;  3A4U B;  4M2Q A;  1DQE A;  1JFK A;  1QIV A;  2LNK A;  3OX5 A;  4CFQ A;  2KNE A;  1FI5 A;  1KK7 Y;  1OE9 B;  2LHI A;  1DF0 A; 
#chains in the Genus database with same CATH homology
 3DXL A;  2FJY A;  2ERB A;  5EL2 A;  3OGN A;  3S0B A;  2PQL A;  3VB1 A;  3Q8I A;  3BFB A;  3L4A A;  3QME A;  3DY9 A;  2H8V A;  3FE9 A;  3S0A A;  3B7A A;  3L4L A;  2P70 A;  3DZT A;  1OOF A;  2L2C A;  3FE8 A;  3V2L A;  3D74 A;  2GTE A;  2WCL A;  3CAB A;  1P28 A;  4JD9 A;  4FQT A;  4INX A;  1GM0 A;  3D76 A;  3PJI A;  1C3Z A;  3B86 A;  3B6X A;  3R1O A;  1OOH A;  2QEV A;  4F7F A;  2WCH A;  3S0E A;  2P71 A;  3R72 A;  3BJH A;  3D78 A;  1OOI X;  3K1E A;  3CZ0 A;  2WC5 A;  3CYZ A;  3NGV A;  1LS8 A;  1ORG A;  2WCK A;  2KPH A;  3S0F A;  1OOG A;  4PT1 A;  2QDI A;  3CDN A;  2QEO A;  3D75 A;  3R1V A;  5DIC A;  3R1P A;  3DYE A;  2QEB A;  3D77 A;  1T14 A;  3RZS A;  3B88 A;  3BFH A;  4OZD A;  3NHI A;  1QWV A;  1XFR A;  2WCJ A;  2WCM A;  3L47 A;  4INW A;  3S0G A;  1OW4 A;  3S0D A;  3NHT A;  2WC6 A;  1TWO A;  3B87 A;  3CZ2 A;  3CZ1 A;  3BFA A;  1C3Y A;  1TUJ A;  1DQE A;  2JPO A;  3FE6 A;  2QEH A;  3N7H A;  3D73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...