1DMOA

Calmodulin, nmr, 30 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Calcium-induced conformational transition revealed by the solution structure of apo calmodulin.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Calcium-binding protein
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1996-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dmoA00
4F0ZB 5I8NA 2LP3A 3SG6A 1K93D 1B9AA 1TNWA 3M0WA 2OS8B 4CFRA 1J1EA 2GGZA 1LA0A 1BU3A 4D1EA 1A29A 3MSEB 1L2OC 1RROA 5AFPA 4GUKA 1J7PA 3H4SE 4P5OE 2BL0C 4E68A 2JZIA 1JBAA 1DF0A 1A4PA 1QV0A 1QX2A 4C0KA 1IH0A 1CMFA 3EVVA 2L50A 2L2EA 1BR1B 3JVTB 1SKTA 4GFTA 1S26D 1H8BA 3OB2B 4PALA 2PRUA 3TZ1A 1BJFA 3EVRA 4GGNA 3CGAA 5CSJA 1PSRA 4XYNA 2H61C 4MN0A 3C1VA 1SR6B 2AUCA 1J1DA 1K2HA 2LP2A 4GPLB 1CNPA 2LMUA 4MBEA 1FPWA 2TN4A 1BR4B 1TN4A 3I5HB 2JT8A 4M2QA 3CS1A 5TNCA 1KFXS 1F54A 3DVKA 5HKZA 1M45A 3DVJA 1JSAA 1OQPA 4ORBB 1JC2A 1KQMB 1YUTA 1F71A 2JNFA 1YVHA 1KWOC 2WCBA 3EKJA 1BODA 2GV5A 1G4YR 3I5GC 1RECA 1XFWO 2MJWB 1ZMZA 4P2YB 2KI4B 4M2PA 3OHMB 1FF1A 1NCZA 2AAOA 3NSKA 5DKRA 2LVJA 1KFXL 4YGBB 3BYAA 1IJ6A 4GNKB 2KAVA 1K8UA 3WHUB 2ZRTA 1K94A 1XO5A 1LKJA 1A75A 4GGFC 2H61A 1QJTA 4YI9A 1ALWA 5AERA 2IS9A 2PVBA 1TTXA 1KCYA 1MQ1A 3AKBA 1IQ3A 5AXIA 4MSPA 1XFXO 2DOQA 3WNXB 1GQMA 1YURA 4PHJA 4BY5A 2CXJA 4DS7A 1XA5A 3TDIA 2OPOA 2I2RE 2KFHA 3LK1A 1DJZA 3KO0A 1H4BA 3PN7C 3LK0A 2HQ8A 5K89A 2KNEA 2KYFA 1CMGA 1NYAA 2KFFA 1KSMA 1DTLA 4HRHA 4N5XA 1Y0VH 1GGWA 1J55A 1K95A 2L5XB 4PHMA 2KBIA 5AEQA 1IJ5A 3BXKA 1JF0A 1DJGA 2KOTA 3LLEA 1M63B 3TDZA 1S1EA 2MBXA 2JRFA 3TS5C 3TUYC 1N2DA 1JFJA 3NXAA 1S6CA 2CNPA 2Y4QA 4MLWA 5J3XA 4PE0A 1RWYA 1N65A 4I5NB 2L4IA 2VRGA 1WDCC 3SG5A 1UHHA 3GK2A 1C07A 4GGFA 1AHRA 1K96A 1MXEA 2KHNA 2L0PA 2E6WA 4MEWA 3HCMA 4QJ4B 1BT6A 3JTDB 1CFCA 1DGUA 3F45A 1QLSA 1SL8A 1J7RA 1KFUL 2CBLA 2JXLA 2KQYA 4PDZA 4DIRA 1QS7A 2LHIA 2I7AA 2F3ZA 4FQOA 1MR8A 3O4YA 2M0RA 1QATA 4OVNF 1XFUO 2Q4UA 1PVAA 1WRZA 3I5FB 4WQ3A 5KTYA 4QJ3B 2QACA 1B4CA 1DJXA 2M97A 4A4BA 2LVKA 2BCAA 3AKAA 2K61A 4HRGA 3CR4X 3IF7A 1OZOA 1FW4A 2NCOA 1XFVO 2E30A 1M31A 2KGBC 1BLQA 1SK6D 1LXFC 3DF0B 1SMGA 1S3PA 2KAXA 3I5IB 5HLVA 1TCOB 1J7QA 5KU1A 1U5IA 2LHLA 3A8RA 4I5LB 3BUWB 2BCXA 1NCYA 4ORAB 3WHTB 1NX2A 2H2KA 4NDDA 2CT9A 2F33A 4C0JA 2LCPA 1CLBA 2QPTA 2M29A 1EXRA 1K9UA 1JFKA 3WXAA 2LANA 1TNQA 3CTNA 3PATA 1WY9A 2JOJA 1TIZA 2WCFA 1QX5B 2NLNA 1UURA 2F3YA 4CIDA 1YTZC 1PRWA 2K0JA 1SCMB 1KK8B 2OS8C 4L9MA 2BKIB 2JXCA 4YGCB 1F4OA 1DVIA 3PFVA 1AJ4A 4OKHA 4YRUA 3O78A 4A4CA 5CSNA 4OCIA 1SL9A 2LLSA 2CCMA 3D0YA 4ZCUA 2KSPA 3CR5X 2LAPA 2M49B 1B1GA 1S36A 1S5GZ 5CPVA 1UHNA 2ZFDA 2ZNDA 3A4UB 3JVTC 4PHNA 4CPVA 1AK8A 3IQQA 1SW8A 1M46A 2F8PA 1WRLA 1DMOA 2NXQA 1MWNA 1L7ZA 3BUNB 4AQJA 1SR6C 1RTP1 3CZTX 2JPTA 1MHOA 2Y1NA 5JOLA 2MA2A 1CLMA 1ZUZA 4HSZA 3I5HC 5GQQC 4NQGA 5F6TA 2M1UA 4HREE 4R1EA 5DKQA 1AJ5A 3D10A 2LLUA 1G8IA 2FCEA 3KHEA 5HYDA 1MXLC 2D8NA 1KQMC 1OZSA 1V1FA 1VRKA 4M2OA 4U8DA 2BE6A 2I94A 2K7DA 2KI6C 3IQOA 1CDPA 2MAZA 1YX8A 2JTZA 2BCBA 2WOSA 2KI4C 1EH2A 2BECA 1AVSA 2LMVA 2BE4A 3BUXB 3BOWB 1LVCD 2FCDA 2I18A 2KAYA 1C7VA 2COLB 1KK7Z 2EC6B 1S6IA 1F8HA 2KYCA 2M8UA 2KI6D 2M3WA 1QASA 1Y6WA 1YUSA 2LNKA 1F70A 1SL7A 2ZRSA 2ZNEA 1MUXA 1RFJA 1DF0B 1S5GY 1CTRA 1BMOA 2JT3A 1QTXA 2MLEC 5FYXA 4JPZB 2RGIA 1B8RA 4MRXA 2ISDA 2OTGB 4PCWA 1GJYA 2Q91A 4ETOA 3VRQA 1EJ3A 1IQ5A 5HKWA 2P6BB 5HKYA 4I5KA 4YGDB 4DCKA 4AQIA 2HPSA 1OMVA 4XJKA 1NCXA 3TDUA 1QIWA 2NCPA 2ZN9A 1K9KA 2JU0A 2K7OA 3OX5A 1CDMA 1TNXA 4OV2A 3BUMB 3FIAA 3OB1B 4WRIA 1CM4A 1W7IB 3GK4X 4MZJA 4WQ2A 2BKHB 4ZCVA 3EK4A 1ZACA 3OP0A 1YRUB 1F55A 2A4JA 3RM1A 2NZ0A 4USLA 3VROA 3SIAA 1FI5A 2K7CA 1LA3A 1WRKA 3KPXA 3EK8A 1L2OB 1A2XA 2K7BA 1CM1A 5ER4X 1LINA 2MRDA 1UUSA 1YR5A 1QV1A 1XK4C 1KK7Y 2BL0B 4MRYA 4NDBA 2MHHA 2G9BA 2JT0A 1OE9B 4QJ5B 4MZKA 1N0YA 1EG3A 1XYDA 2JTTA 2KDHA 1YUUA 3FWCA 1K90D 3JTDC 4PE4A 4PHKA 5JJGA 1NWDA 2LVIA 1SBJA 5D69A 1BF5A 1NIWA 2ZKMX 1A75B 1HQVA 1JWDA 2KFGA 1SY9A 4N1GA 4JWQA 2MLFC 3BQ3A 2LUCA 3PALA 3I5FC 2BBNA 1OMDA 1B8LA 5CSIA 2G2BA 3KF9A 5G08A 2KGRA 1Y1AA 1TOPA 1PALA 3CWGA 1SRAA 5D7FA 5DKNA 4IL1A 1KWOB 4PE1A 5B8IB 1C7WA 2LC5A 2LUXA 3I5GB 2LLTA 1E8AA 2O5GA 1ODBA 3SG3A 3I5IC 4GBAA 1XK4A 1QVIZ 1WLZA 2JC2A 4YGEB 1UWOA 3SIBA 1XFZO 4GAOA 1M39A 2WNDA 3CLNA 2V53A 4NDCA 1Y1XA 1EG4A 2AMIA 1EL4A 1IWQA 4I5JA 4DRWA 1CDNA 1J7OA 3O2PA 1DJYA 1PSBA 2LM5A 4FTGA 5KSZA 5I2OA 3PSRA 1NUBA 3RLZA 1CFDA 5PALA 1NX1A 2FOTA 4XJKB 1CKKA 1MF8B 2HF5A 2SCPA 3KEVA 2WORA 1DT7B 1FBVA 1SCMC 1UHKA 1KK8C 1Y1UA 3NSIA 4ICBA 5I2LA 2WCEA 5HLOA 1NX3A 2PASA 1YRTB 1ALVA 2JULA 2LMTA 3E3RA 2L51A 1DJIA 3CR2A 1B47A 3PN7B 2KQ6A 1UHJA 1KSOA 2HETA 2WC8A 1R2UA 1B7TZ 1IG5A 1SPYA 1NX0A 1R6PA 3SG7A 3DF0A 1JF2A 1PULA 1OSAA 1WLMA 1A03A 4UPGA 4C0LA 2F2PA 1TNPA 3TS5B 1SCVA 5IBWA 3TUYB 2O60A 1RJVA 1TRFA 3EK7A 2M7LA 1SYMA 3VGOA 1QVIY 3SG2A 3QRXA 1CFFA 3GK1A 4ORCB 1U5IB 1NP8A 1WDCB 2K2AA 2KBMA 1PK0D 2PALA 1OMRA 3LCPC 4TNCA 3VRRA 1D1OA 4MVFA 4AOMA 1QLKA 4CFQA 1YX7A 2PMYA 4DUQA 1XFYO 1SNLA 1QIVA 1ZFSA 1X02A 1RK9A 4YGAA 2JWWA 2JNXA 4CLNA 3ICBA 3FS7A 3VRPA 2L4HA 3PLFB 1W7JB 3FWBA 2M7NA 1UHIA 2BBMA 2LVVA 2PSRA 1CDLA 4MZLA 3K21A 2Y5IA 5BPJA 4BY4A 3BUOB 1DGVA 4YBHB 5ER5A 1OOJA 1BG1A 1CFPA 2LV7A 1KFUS 3AAJA 3VRNA 1QXPA 1AUIB 2ZN8A 2JQ6A 2EC6C 2Y1MA 5AANA 3O6BA 2K8MB 1KQVA 1F4QA 1UP5A 2LE9B 1DJWA 3LL8B 1BOCA 3D0YB 1AP4A 1B7TY 1IGVA 1JUOA 1NSHA 4JQ0D 1HT9A 2EHBA 5I2QA 1YVLA 3DVEA 1FI6A 2HQWA 2SASA 2OTGC 2B1UA 3PM8A 1DJHA 3SG4A 1QX7A 1S6JA 1G33A 4PE7A 1GGZA 1NPQA 3DVMA 3SJSA 1PVBA 5CSFA 2F2OA 1Q80A 3EKHA 4N1FA 3NSLA 2FJUB 3EVUA 2GGMA 2L98A 3NSOA 2CTNA 1K9PA 2R2IA 2M1KB 3AAKA 1CB1A 1IRJA 4YI8A 1V1GA 4OR9B 3HX4A 1IKUA 1TCFA 3ZWHA 1CLLA 1XVJA 2M9GA 3OX6A 2EGDA 3ZNIA 2K2FA 4Q04A 3DD4A 3GOFA 3BOWA 1ZOTB 1B8CA
chains in the Genus database with same CATH superfamily
4F0ZB 5I8NA 2LP3A 3SG6A 1K93D 1B9AA 1TNWA 3M0WA 2OS8B 2H8VA 1J1EA 2GGZA 4CFRA 1DQEA 1LA0A 1BU3A 4D1EA 1A29A 3MSEB 1L2OC 1RROA 5AFPA 4GUKA 1J7PA 1Z4HA 3H4SE 4P5OE 2BL0C 4E68A 2JZIA 1JBAA 1GM0A 1DF0A 1A4PA 1QV0A 1QX2A 4C0KA 1IH0A 1CMFA 3EVVA 2L50A 2L2EA 1BR1B 3JVTB 3L4LA 1SKTA 4GFTA 1S26D 4INXA 2QEOA 1H8BA 3OB2B 4PALA 3B7AA 2PRUA 3R1OA 3TZ1A 1BJFA 3EVRA 3D77A 4GGNA 3CGAA 5CSJA 1PSRA 4XYNA 2H61C 4MN0A 3C1VA 1SR6B 2AUCA 1J1DA 1K2HA 2LP2A 3DY9A 4GPLB 1CNPA 2LMUA 4OZDA 4MBEA 1FPWA 2TN4A 1BR4B 4F7FA 1TN4A 3I5HB 2JT8A 4M2QA 3CS1A 5TNCA 1KFXS 1F54A 3DVKA 5HKZA 1M45A 3DVJA 1JSAA 1OQPA 3SS3A 4ORBB 1JC2A 1KQMB 1C3ZA 1YUTA 1F71A 2JNFA 1YVHA 1KWOC 2WCBA 3EKJA 2YGUA 1BODA 2GV5A 1G4YR 3I5GC 1RECA 1XFWO 2MJWB 1ZMZA 3S0FA 3BFBA 4P2YB 2KI4B 4M2PA 3OHMB 1FF1A 1NCZA 2AAOA 3NSKA 5DKRA 2LVJA 1KFXL 4YGBB 3B88A 3BYAA 1IJ6A 4GNKB 4INWA 2KAVA 1K8UA 3WHUB 2ZRTA 1K94A 1XO5A 1LKJA 1OOFA 1A75A 4GGFC 2H61A 1QJTA 4YI9A 1ALWA 5AERA 2IS9A 2PVBA 1TTXA 1KCYA 1MQ1A 3AKBA 1IQ3A 5AXIA 4MSPA 1XFXO 2DOQA 3L47A 1GQMA 3WNXB 1YURA 3S0GA 4PHJA 4BY5A 2CXJA 1P28A 1XA5A 4DS7A 3TDIA 2OPOA 2I2RE 2KFHA 3LK1A 1DJZA 2WCJA 3KO0A 3PN7C 1H4BA 3LK0A 2HQ8A 5I94A 5K89A 2KNEA 2L5YA 2KYFA 1CMGA 1NYAA 2KFFA 1KSMA 1DTLA 4HRHA 4N5XA 1Y0VH 1GGWA 1J55A 1K95A 2L5XB 1OW4A 3S0DA 4PHMA 5BPJA 2KBIA 5AEQA 1IJ5A 3BXKA 1JF0A 3CZ1A 1DJGA 2KOTA 3LLEA 1M63B 3TDZA 1S1EA 2MBXA 2JRFA 3TS5C 3TUYC 1N2DA 1JFJA 3NXAA 1S6CA 2CNPA 2Y4QA 4MLWA 5J3XA 4PE0A 1RWYA 1N65A 4I5NB 2L4IA 2VRGA 1WDCC 3SG5A 1UHHA 3GK2A 1QWVA 1C07A 4GGFA 1AHRA 1K96A 1MXEA 2KHNA 2L0PA 2E6WA 4MEWA 3HCMA 4QJ4B 1BT6A 3JTDB 1CFCA 3D76A 5FI6A 1DGUA 3F45A 1QLSA 1SL8A 1J7RA 1KFUL 2CBLA 2JXLA 2KQYA 4PDZA 4DIRA 1QS7A 2LHIA 2I7AA 2F3ZA 4FQOA 1MR8A 3O4YA 3R1VA 2M0RA 1QATA 4OVNF 3QMEA 3D74A 1XFUO 2Q4UA 1PVAA 1WRZA 3I5FB 4WQ3A 5KTYA 4QJ3B 2QACA 1B4CA 1DJXA 3CDNA 2M97A 4A4BA 2LVKA 2BCAA 3AKAA 2K61A 3DYEA 4HRGA 3CR4X 3IF7A 1OZOA 1FW4A 2NCOA 1XFVO 2E30A 1M31A 2ERBA 2KGBC 3UO9A 3B87A 1BLQA 1SK6D 1LXFC 3DF0B 5EL2A 1SMGA 1S3PA 2KAXA 3I5IB 5HLVA 1TCOB 1J7QA 5KU1A 1U5IA 2LHLA 3A8RA 3D75A 4I5LB 3NHIA 3Q8IA 3BUWB 2BCXA 1NCYA 4ORAB 3WHTB 3L4AA 1NX2A 2H2KA 4NDDA 2CT9A 2F33A 4C0JA 2LCPA 1CLBA 2QPTA 4KYNA 1OOHA 2M29A 1EXRA 5FI7A 1K9UA 1JFKA 3K1EA 3WXAA 2LANA 5I2LA 3SS4A 1TNQA 3CTNA 3PATA 1WY9A 1OOGA 1TIZA 2JOJA 3VB1A 2WCFA 1QX5B 2NLNA 1UURA 2F3YA 4CIDA 1YTZC 1PRWA 2K0JA 1SCMB 1KK8B 2OS8C 4L9MA 2BKIB 2JXCA 4YGCB 1F4OA 3OGNA 3S0AA 1DVIA 3PFVA 1AJ4A 4OKHA 3EG5B 4YRUA 3O78A 4A4CA 5CSNA 4OCIA 1SL9A 2QEHA 2LLSA 2CCMA 3D0YA 3B6XA 4ZCUA 5DICA 2KSPA 3CR5X 2LAPA 2M49B 1B1GA 1S36A 1S5GZ 5CPVA 3RZSA 1UHNA 2ZFDA 2ZNDA 3A4UB 3JVTC 4PHNA 4CPVA 1AK8A 3IQQA 1SW8A 1M46A 2F8PA 1WRLA 1DMOA 3CYZA 2NXQA 1MWNA 1L7ZA 3BUNB 4AQJA 1SR6C 1RTP1 3CZTX 2JPTA 1MHOA 2Y1NA 3DZTA 2MA2A 1CLMA 5JOLA 1ZUZA 4HSZA 3I5HC 5GQQC 4NQGA 5F6TA 2M1UA 4HREE 4R1EA 5DKQA 1AJ5A 3D10A 2LLUA 1G8IA 2FCEA 2P71A 3KHEA 5HYDA 1MXLC 2WC6A 2D8NA 1KQMC 1OZSA 1V1FA 1VRKA 1W9ZA 4M2OA 2BE6A 4U8DA 2I94A 2K7DA 2KI6C 3IQOA 1CDPA 2MAZA 2PYQA 1YX8A 2JTZA 2BCBA 2WOSA 2KI4C 1EH2A 2BECA 1AVSA 2LMVA 2BE4A 3BUXB 3BOWB 1LVCD 2FCDA 2I18A 2KAYA 1C7VA 3R1PA 5D3OA 2COLB 3D78A 1KK7Z 2EC6B 1S6IA 1F8HA 2KYCA 2M8UA 2KI6D 4NDCA 2M3WA 1QASA 1Y6WA 1YUSA 2LNKA 1F70A 1SL7A 2ZRSA 2ZNEA 1MUXA 1RFJA 2KPHA 1DF0B 1S5GY 1CTRA 1BMOA 2JT3A 1QTXA 2MLEC 3IVTA 5FYXA 4JPZB 2RGIA 1B8RA 4MRXA 2ISDA 2OTGB 4PCWA 1GJYA 2Q91A 4ETOA 3VRQA 1EJ3A 1IQ5A 5HKWA 2P6BB 5HKYA 2GTEA 4I5KA 2WCKA 4YGDB 4DCKA 4AQIA 2HPSA 1OMVA 4XJKA 1NCXA 3TDUA 1QIWA 2NCPA 2WCLA 2BAPA 1K9KA 2ZN9A 2JU0A 2K7OA 3OX5A 3BFAA 1CDMA 1TNXA 4OV2A 3FE9A 3BUMB 3FIAA 3OB1B 4WRIA 1CM4A 1W7IB 3GK4X 4MZJA 2K60A 4WQ2A 2BKHB 4ZCVA 3EK4A 1ZACA 3OP0A 1YRUB 1F55A 2A4JA 3RM1A 2NZ0A 4USLA 3VROA 3SIAA 1FI5A 3DXLA 2WCHA 2K7CA 1LA3A 2JPOA 1WRKA 3KPXA 3EK8A 1L2OB 1A2XA 2K7BA 1CM1A 5ER4X 1LINA 2MRDA 1UUSA 1YR5A 1QV1A 1XK4C 1KK7Y 2BL0B 4MRYA 4NDBA 2MHHA 3UNWA 2G9BA 2JT0A 1OE9B 4QJ5B 4MZKA 1N0YA 1EG3A 1XYDA 2JTTA 2KDHA 1YUUA 3FWCA 1K90D 3JTDC 4PE4A 4PHKA 5JJGA 1NWDA 2LVIA 1SBJA 3CZ2A 5D69A 1BF5A 1NIWA 5FI2A 2ZKMX 1A75B 1HQVA 1JWDA 2KFGA 1SY9A 4N1GA 4JWQA 2MLFC 3BQ3A 2LUCA 4FQTA 3PALA 3I5FC 2BBNA 1OMDA 1B8LA 5CSIA 2G2BA 3KF9A 5G08A 2KGRA 1Y1AA 5HL1A 1TOPA 1PALA 3CWGA 1SRAA 5D7FA 5DKNA 4IL1A 1KWOB 4PE1A 5B8IB 1C7WA 2LC5A 2LUXA 3I5GB 2LLTA 1E8AA 2QDIA 2O5GA 1ODBA 3SG3A 3I5IC 4GBAA 3D73A 1XK4A 1QVIZ 1WLZA 2JC2A 3NHTA 1UWOA 4YGEB 3SIBA 1XFZO 4GAOA 1M39A 2WNDA 3CLNA 1DELA 2V53A 1Y1XA 1EG4A 1EL4A 1IWQA 2AMIA 4I5JA 3SS5A 1CDNA 1J7OA 3O2PA 4JKTA 1DJYA 1PSBA 2LM5A 4FTGA 5KSZA 5I2OA 3PSRA 1NUBA 3RLZA 1CFDA 1TWOA 5PALA 1NX1A 2FOTA 4XJKB 1CKKA 1MF8B 2HF5A 2SCPA 3KEVA 1ORGA 2WORA 1DT7B 1FBVA 1SCMC 1UHKA 1KK8C 1Y1UA 3NSIA 3R72A 4ICBA 2WCEA 5HLOA 1NX3A 2PASA 1YRTB 1ALVA 2JULA 2QEBA 2LMTA 3E3RA 2L51A 1DJIA 3CR2A 1B47A 3PN7B 2FJYA 2KQ6A 1UHJA 1SSEB 1IIOA 1KSOA 2HETA 2WC8A 1R2UA 4DRWA 1B7TZ 1IG5A 1SPYA 1T14A 1NX0A 1R6PA 3SG7A 3BFHA 3DF0A 1JF2A 4PT1A 1PULA 1OSAA 1WLMA 3S0BA 2WCMA 4UPGA 1DC1A 4C0LA 2F2PA 1A03A 1TNPA 3TS5B 1SCVA 5IBWA 3TUYB 2O60A 1Z2CB 1XFRA 1RJVA 1TRFA 1DEKA 3EK7A 3NGVA 1C3YA 2M7LA 1SYMA 3VGOA 2QEVA 1OOIX 2WC5A 1QVIY 3SG2A 3QRXA 1CFFA 3GK1A 4ORCB 1U5IB 1NP8A 1WDCB 2K2AA 2KBMA 1PK0D 2PALA 1OMRA 3LCPC 3PJIA 4TNCA 3VRRA 1D1OA 4MVFA 4AOMA 1QLKA 4CFQA 1YX7A 2PMYA 2PQLA 4DUQA 1XFYO 1SNLA 1QIVA 1ZFSA 1X02A 3O4XA 3N7HA 1RK9A 4YGAA 2JWWA 2JNXA 4CLNA 3ICBA 3FS7A 3VRPA 2L4HA 3PLFB 1W7JB 3FWBA 2M7NA 1UHIA 2BBMA 2LVVA 2PSRA 1CDLA 4MZLA 3K21A 2Y5IA 3BJHA 2L2CA 3V2LA 3BUOB 4BY4A 1DGVA 1TUJA 4YBHB 1OOJA 3CZ0A 3OBVA 5ER5A 3S0EA 2LV7A 1KFUS 3AAJA 3VRNA 1BG1A 1CFPA 1QXPA 1AUIB 2BNXA 2ZN8A 2JQ6A 2EC6C 2Y1MA 5AANA 3O6BA 1TUZA 2K8MB 1KQVA 1F4QA 1UP5A 2LE9B 3FE6A 1DJWA 3LL8B 1BOCA 3D0YB 1AP4A 1B7TY 1IGVA 1JUOA 1NSHA 4JQ0D 1HT9A 2EHBA 5I2QA 1YVLA 3DVEA 1FI6A 2HQWA 3CABA 2SASA 3FE8A 2OTGC 2B1UA 3PM8A 1DJHA 4IJ7A 1QX7A 1S6JA 3SG4A 1G33A 2KLEA 2P70A 4JD9A 4PE7A 1GGZA 1NPQA 3DVMA 3SJSA 1PVBA 5CSFA 2F2OA 3B86A 1Q80A 3EKHA 4N1FA 3NSLA 2FJUB 3EVUA 2GGMA 2L98A 3NSOA 2CTNA 1K9PA 2R2IA 2M1KB 3AAKA 1CB1A 1IRJA 4YI8A 1V1GA 4OR9B 3HX4A 1IKUA 1TCFA 1LS8A 1CLLA 2KLDA 1XVJA 2M9GA 3ZWHA 3OX6A 2EGDA 3ZNIA 2K2FA 4Q04A 3PM2A 3DD4A 3GOFA 3BOWA 1ZOTB 1B8CA
chains in the Genus database with same CATH topology
4F0ZB 5I8NA 2LP3A 3SG6A 1K93D 1B9AA 1TNWA 3M0WA 2OS8B 4CFRA 1J1EA 2GGZA 1LA0A 1BU3A 4D1EA 1A29A 3MSEB 1L2OC 1RROA 5AFPA 4GUKA 1J7PA 3H4SE 4P5OE 2BL0C 4E68A 2JZIA 1JBAA 1DF0A 1A4PA 1QV0A 1QX2A 4C0KA 1IH0A 1CMFA 3EVVA 2L50A 2L2EA 1BR1B 3JVTB 1SKTA 4GFTA 1S26D 1H8BA 3OB2B 4PALA 2PRUA 3TZ1A 1BJFA 3EVRA 4GGNA 3CGAA 5CSJA 1PSRA 4XYNA 2H61C 4MN0A 3C1VA 1SR6B 2AUCA 1J1DA 1K2HA 2LP2A 4GPLB 1CNPA 2LMUA 4MBEA 1FPWA 2TN4A 1BR4B 1TN4A 3I5HB 2JT8A 4M2QA 3CS1A 5TNCA 1KFXS 1F54A 3DVKA 5HKZA 1M45A 3DVJA 1JSAA 1OQPA 4ORBB 1JC2A 1KQMB 1YUTA 1F71A 2JNFA 1YVHA 1KWOC 2WCBA 3EKJA 1BODA 2GV5A 1G4YR 3I5GC 1RECA 1XFWO 2MJWB 1ZMZA 4P2YB 2KI4B 4M2PA 3OHMB 1FF1A 1NCZA 2AAOA 3NSKA 5DKRA 2LVJA 1KFXL 4YGBB 3BYAA 1IJ6A 4GNKB 2KAVA 1K8UA 3WHUB 2ZRTA 1K94A 1XO5A 1LKJA 1A75A 4GGFC 2H61A 1QJTA 4YI9A 1ALWA 5AERA 2IS9A 2PVBA 1TTXA 1KCYA 1MQ1A 3AKBA 1IQ3A 5AXIA 4MSPA 1XFXO 2DOQA 3WNXB 1GQMA 1YURA 4PHJA 4BY5A 2CXJA 4DS7A 1XA5A 3TDIA 2OPOA 2I2RE 2KFHA 3LK1A 1DJZA 3KO0A 1H4BA 3PN7C 3LK0A 2HQ8A 5K89A 2KNEA 2KYFA 1CMGA 1NYAA 2KFFA 1KSMA 1DTLA 4HRHA 4N5XA 1Y0VH 1GGWA 1J55A 1K95A 2L5XB 4PHMA 2KBIA 5AEQA 1IJ5A 3BXKA 1JF0A 1DJGA 2KOTA 3LLEA 1M63B 3TDZA 1S1EA 2MBXA 2JRFA 3TS5C 3TUYC 1N2DA 1JFJA 3NXAA 1S6CA 2CNPA 2Y4QA 4MLWA 5J3XA 4PE0A 1RWYA 1N65A 4I5NB 2L4IA 2VRGA 1WDCC 3SG5A 1UHHA 3GK2A 1C07A 4GGFA 1AHRA 1K96A 1MXEA 2KHNA 2L0PA 2E6WA 4MEWA 3HCMA 4QJ4B 1BT6A 3JTDB 1CFCA 1DGUA 3F45A 1QLSA 1SL8A 1J7RA 1KFUL 2CBLA 2JXLA 2KQYA 4PDZA 4DIRA 1QS7A 2LHIA 2I7AA 2F3ZA 4FQOA 1MR8A 3O4YA 2M0RA 1QATA 4OVNF 1XFUO 2Q4UA 1PVAA 1WRZA 3I5FB 4WQ3A 5KTYA 4QJ3B 2QACA 1B4CA 1DJXA 2M97A 4A4BA 2LVKA 2BCAA 3AKAA 2K61A 4HRGA 3CR4X 3IF7A 1OZOA 1FW4A 2NCOA 1XFVO 2E30A 1M31A 2KGBC 1BLQA 1SK6D 1LXFC 3DF0B 1SMGA 1S3PA 2KAXA 3I5IB 5HLVA 1TCOB 1J7QA 5KU1A 1U5IA 2LHLA 3A8RA 4I5LB 3BUWB 2BCXA 1NCYA 4ORAB 3WHTB 1NX2A 2H2KA 4NDDA 2CT9A 2F33A 4C0JA 2LCPA 1CLBA 2QPTA 2M29A 1EXRA 1K9UA 1JFKA 3WXAA 2LANA 1TNQA 3CTNA 3PATA 1WY9A 2JOJA 1TIZA 2WCFA 1QX5B 2NLNA 1UURA 2F3YA 4CIDA 1YTZC 1PRWA 2K0JA 1SCMB 1KK8B 2OS8C 4L9MA 2BKIB 2JXCA 4YGCB 1F4OA 1DVIA 3PFVA 1AJ4A 4OKHA 4YRUA 3O78A 4A4CA 5CSNA 4OCIA 1SL9A 2LLSA 2CCMA 3D0YA 4ZCUA 2KSPA 3CR5X 2LAPA 2M49B 1B1GA 1S36A 1S5GZ 5CPVA 1UHNA 2ZFDA 2ZNDA 3A4UB 3JVTC 4PHNA 4CPVA 1AK8A 3IQQA 1SW8A 1M46A 2F8PA 1WRLA 1DMOA 2NXQA 1MWNA 1L7ZA 3BUNB 4AQJA 1SR6C 1RTP1 3CZTX 2JPTA 1MHOA 2Y1NA 5JOLA 2MA2A 1CLMA 1ZUZA 4HSZA 3I5HC 5GQQC 4NQGA 5F6TA 2M1UA 4HREE 4R1EA 5DKQA 1AJ5A 3D10A 2LLUA 1G8IA 2FCEA 3KHEA 5HYDA 1MXLC 2D8NA 1KQMC 1OZSA 1V1FA 1VRKA 4M2OA 4U8DA 2BE6A 2I94A 2K7DA 2KI6C 3IQOA 1CDPA 2MAZA 1YX8A 2JTZA 2BCBA 2WOSA 2KI4C 1EH2A 2BECA 1AVSA 2LMVA 2BE4A 3BUXB 3BOWB 1LVCD 2FCDA 2I18A 2KAYA 1C7VA 2COLB 1KK7Z 2EC6B 1S6IA 1F8HA 2KYCA 2M8UA 2KI6D 2M3WA 1QASA 1Y6WA 1YUSA 2LNKA 1F70A 1SL7A 2ZRSA 2ZNEA 1MUXA 1RFJA 1DF0B 1S5GY 1CTRA 1BMOA 2JT3A 1QTXA 2MLEC 5FYXA 4JPZB 2RGIA 1B8RA 4MRXA 2ISDA 2OTGB 4PCWA 1GJYA 2Q91A 4ETOA 3VRQA 1EJ3A 1IQ5A 5HKWA 2P6BB 5HKYA 4I5KA 4YGDB 4DCKA 4AQIA 2HPSA 1OMVA 4XJKA 1NCXA 3TDUA 1QIWA 2NCPA 2ZN9A 1K9KA 2JU0A 2K7OA 3OX5A 1CDMA 1TNXA 4OV2A 3BUMB 3FIAA 3OB1B 4WRIA 1CM4A 1W7IB 3GK4X 4MZJA 4WQ2A 2BKHB 4ZCVA 3EK4A 1ZACA 3OP0A 1YRUB 1F55A 2A4JA 3RM1A 2NZ0A 4USLA 3VROA 3SIAA 1FI5A 2K7CA 1LA3A 1WRKA 3KPXA 3EK8A 1L2OB 1A2XA 2K7BA 1CM1A 5ER4X 1LINA 2MRDA 1UUSA 1YR5A 1QV1A 1XK4C 1KK7Y 2BL0B 4MRYA 4NDBA 2MHHA 2G9BA 2JT0A 1OE9B 4QJ5B 4MZKA 1N0YA 1EG3A 1XYDA 2JTTA 2KDHA 1YUUA 3FWCA 1K90D 3JTDC 4PE4A 4PHKA 5JJGA 1NWDA 2LVIA 1SBJA 5D69A 1BF5A 1NIWA 2ZKMX 1A75B 1HQVA 1JWDA 2KFGA 1SY9A 4N1GA 4JWQA 2MLFC 3BQ3A 2LUCA 3PALA 3I5FC 2BBNA 1OMDA 1B8LA 5CSIA 2G2BA 3KF9A 5G08A 2KGRA 1Y1AA 1TOPA 1PALA 3CWGA 1SRAA 5D7FA 5DKNA 4IL1A 1KWOB 4PE1A 5B8IB 1C7WA 2LC5A 2LUXA 3I5GB 2LLTA 1E8AA 2O5GA 1ODBA 3SG3A 3I5IC 4GBAA 1XK4A 1QVIZ 1WLZA 2JC2A 4YGEB 1UWOA 3SIBA 1XFZO 4GAOA 1M39A 2WNDA 3CLNA 2V53A 4NDCA 1Y1XA 1EG4A 2AMIA 1EL4A 1IWQA 4I5JA 4DRWA 1CDNA 1J7OA 3O2PA 1DJYA 1PSBA 2LM5A 4FTGA 5KSZA 5I2OA 3PSRA 1NUBA 3RLZA 1CFDA 5PALA 1NX1A 2FOTA 4XJKB 1CKKA 1MF8B 2HF5A 2SCPA 3KEVA 2WORA 1DT7B 1FBVA 1SCMC 1UHKA 1KK8C 1Y1UA 3NSIA 4ICBA 5I2LA 2WCEA 5HLOA 1NX3A 2PASA 1YRTB 1ALVA 2JULA 2LMTA 3E3RA 2L51A 1DJIA 3CR2A 1B47A 3PN7B 2KQ6A 1UHJA 1KSOA 2HETA 2WC8A 1R2UA 1B7TZ 1IG5A 1SPYA 1NX0A 1R6PA 3SG7A 3DF0A 1JF2A 1PULA 1OSAA 1WLMA 1A03A 4UPGA 4C0LA 2F2PA 1TNPA 3TS5B 1SCVA 5IBWA 3TUYB 2O60A 1RJVA 1TRFA 3EK7A 2M7LA 1SYMA 3VGOA 1QVIY 3SG2A 3QRXA 1CFFA 3GK1A 4ORCB 1U5IB 1NP8A 1WDCB 2K2AA 2KBMA 1PK0D 2PALA 1OMRA 3LCPC 4TNCA 3VRRA 1D1OA 4MVFA 4AOMA 1QLKA 4CFQA 1YX7A 2PMYA 4DUQA 1XFYO 1SNLA 1QIVA 1ZFSA 1X02A 1RK9A 4YGAA 2JWWA 2JNXA 4CLNA 3ICBA 3FS7A 3VRPA 2L4HA 3PLFB 1W7JB 3FWBA 2M7NA 1UHIA 2BBMA 2LVVA 2PSRA 1CDLA 4MZLA 3K21A 2Y5IA 5BPJA 4BY4A 3BUOB 1DGVA 4YBHB 5ER5A 1OOJA 1BG1A 1CFPA 2LV7A 1KFUS 3AAJA 3VRNA 1QXPA 1AUIB 2ZN8A 2JQ6A 2EC6C 2Y1MA 5AANA 3O6BA 2K8MB 1KQVA 1F4QA 1UP5A 2LE9B 1DJWA 3LL8B 1BOCA 3D0YB 1AP4A 1B7TY 1IGVA 1JUOA 1NSHA 4JQ0D 1HT9A 2EHBA 5I2QA 1YVLA 3DVEA 1FI6A 2HQWA 2SASA 2OTGC 2B1UA 3PM8A 1DJHA 3SG4A 1QX7A 1S6JA 1G33A 4PE7A 1GGZA 1NPQA 3DVMA 3SJSA 1PVBA 5CSFA 2F2OA 1Q80A 3EKHA 4N1FA 3NSLA 2FJUB 3EVUA 2GGMA 2L98A 3NSOA 2CTNA 1K9PA 2R2IA 2M1KB 3AAKA 1CB1A 1IRJA 4YI8A 1V1GA 4OR9B 3HX4A 1IKUA 1TCFA 3ZWHA 1CLLA 1XVJA 2M9GA 3OX6A 2EGDA 3ZNIA 2K2FA 4Q04A 3DD4A 3GOFA 3BOWA 1ZOTB 1B8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Z B;  5I8N A;  2LP3 A;  3SG6 A;  1K93 D;  1B9A A;  1TNW A;  3M0W A;  2OS8 B;  4CFR A;  1J1E A;  2GGZ A;  1LA0 A;  1BU3 A;  4D1E A;  1A29 A;  3MSE B;  1L2O C;  1RRO A;  5AFP A;  4GUK A;  1J7P A;  3H4S E;  4P5O E;  2BL0 C;  4E68 A;  2JZI A;  1JBA A;  1DF0 A;  1A4P A;  1QV0 A;  1QX2 A;  4C0K A;  1IH0 A;  1CMF A;  3EVV A;  2L50 A;  2L2E A;  1BR1 B;  3JVT B;  1SKT A;  4GFT A;  1S26 D;  1H8B A;  3OB2 B;  4PAL A;  2PRU A;  3TZ1 A;  1BJF A;  3EVR A;  4GGN A;  3CGA A;  5CSJ A;  1PSR A;  4XYN A;  2H61 C;  4MN0 A;  3C1V A;  1SR6 B;  2AUC A;  1J1D A;  1K2H A;  2LP2 A;  4GPL B;  1CNP A;  2LMU A;  4MBE A;  1FPW A;  2TN4 A;  1BR4 B;  1TN4 A;  3I5H B;  2JT8 A;  4M2Q A;  3CS1 A;  5TNC A;  1KFX S;  1F54 A;  3DVK A;  5HKZ A;  1M45 A;  3DVJ A;  1JSA A;  1OQP A;  4ORB B;  1JC2 A;  1KQM B;  1YUT A;  1F71 A;  2JNF A;  1YVH A;  1KWO C;  2WCB A;  3EKJ A;  1BOD A;  2GV5 A;  1G4Y R;  3I5G C;  1REC A;  1XFW O;  2MJW B;  1ZMZ A;  4P2Y B;  2KI4 B;  4M2P A;  3OHM B;  1FF1 A;  1NCZ A;  2AAO A;  3NSK A;  5DKR A;  2LVJ A;  1KFX L;  4YGB B;  3BYA A;  1IJ6 A;  4GNK B;  2KAV A;  1K8U A;  3WHU B;  2ZRT A;  1K94 A;  1XO5 A;  1LKJ A;  1A75 A;  4GGF C;  2H61 A;  1QJT A;  4YI9 A;  1ALW A;  5AER A;  2IS9 A;  2PVB A;  1TTX A;  1KCY A;  1MQ1 A;  3AKB A;  1IQ3 A;  5AXI A;  4MSP A;  1XFX O;  2DOQ A;  3WNX B;  1GQM A;  1YUR A;  4PHJ A;  4BY5 A;  2CXJ A;  4DS7 A;  1XA5 A;  3TDI A;  2OPO A;  2I2R E;  2KFH A;  3LK1 A;  1DJZ A;  3KO0 A;  1H4B A;  3PN7 C;  3LK0 A;  2HQ8 A;  5K89 A;  2KNE A;  2KYF A;  1CMG A;  1NYA A;  2KFF A;  1KSM A;  1DTL A;  4HRH A;  4N5X A;  1Y0V H;  1GGW A;  1J55 A;  1K95 A;  2L5X B;  4PHM A;  2KBI A;  5AEQ A;  1IJ5 A;  3BXK A;  1JF0 A;  1DJG A;  2KOT A;  3LLE A;  1M63 B;  3TDZ A;  1S1E A;  2MBX A;  2JRF A;  3TS5 C;  3TUY C;  1N2D A;  1JFJ A;  3NXA A;  1S6C A;  2CNP A;  2Y4Q A;  4MLW A;  5J3X A;  4PE0 A;  1RWY A;  1N65 A;  4I5N B;  2L4I A;  2VRG A;  1WDC C;  3SG5 A;  1UHH A;  3GK2 A;  1C07 A;  4GGF A;  1AHR A;  1K96 A;  1MXE A;  2KHN A;  2L0P A;  2E6W A;  4MEW A;  3HCM A;  4QJ4 B;  1BT6 A;  3JTD B;  1CFC A;  1DGU A;  3F45 A;  1QLS A;  1SL8 A;  1J7R A;  1KFU L;  2CBL A;  2JXL A;  2KQY A;  4PDZ A;  4DIR A;  1QS7 A;  2LHI A;  2I7A A;  2F3Z A;  4FQO A;  1MR8 A;  3O4Y A;  2M0R A;  1QAT A;  4OVN F;  1XFU O;  2Q4U A;  1PVA A;  1WRZ A;  3I5F B;  4WQ3 A;  5KTY A;  4QJ3 B;  2QAC A;  1B4C A;  1DJX A;  2M97 A;  4A4B A;  2LVK A;  2BCA A;  3AKA A;  2K61 A;  4HRG A;  3CR4 X;  3IF7 A;  1OZO A;  1FW4 A;  2NCO A;  1XFV O;  2E30 A;  1M31 A;  2KGB C;  1BLQ A;  1SK6 D;  1LXF C;  3DF0 B;  1SMG A;  1S3P A;  2KAX A;  3I5I B;  5HLV A;  1TCO B;  1J7Q A;  5KU1 A;  1U5I A;  2LHL A;  3A8R A;  4I5L B;  3BUW B;  2BCX A;  1NCY A;  4ORA B;  3WHT B;  1NX2 A;  2H2K A;  4NDD A;  2CT9 A;  2F33 A;  4C0J A;  2LCP A;  1CLB A;  2QPT A;  2M29 A;  1EXR A;  1K9U A;  1JFK A;  3WXA A;  2LAN A;  1TNQ A;  3CTN A;  3PAT A;  1WY9 A;  2JOJ A;  1TIZ A;  2WCF A;  1QX5 B;  2NLN A;  1UUR A;  2F3Y A;  4CID A;  1YTZ C;  1PRW A;  2K0J A;  1SCM B;  1KK8 B;  2OS8 C;  4L9M A;  2BKI B;  2JXC A;  4YGC B;  1F4O A;  1DVI A;  3PFV A;  1AJ4 A;  4OKH A;  4YRU A;  3O78 A;  4A4C A;  5CSN A;  4OCI A;  1SL9 A;  2LLS A;  2CCM A;  3D0Y A;  4ZCU A;  2KSP A;  3CR5 X;  2LAP A;  2M49 B;  1B1G A;  1S36 A;  1S5G Z;  5CPV A;  1UHN A;  2ZFD A;  2ZND A;  3A4U B;  3JVT C;  4PHN A;  4CPV A;  1AK8 A;  3IQQ A;  1SW8 A;  1M46 A;  2F8P A;  1WRL A;  1DMO A;  2NXQ A;  1MWN A;  1L7Z A;  3BUN B;  4AQJ A;  1SR6 C;  1RTP 1;  3CZT X;  2JPT A;  1MHO A;  2Y1N A;  5JOL A;  2MA2 A;  1CLM A;  1ZUZ A;  4HSZ A;  3I5H C;  5GQQ C;  4NQG A;  5F6T A;  2M1U A;  4HRE E;  4R1E A;  5DKQ A;  1AJ5 A;  3D10 A;  2LLU A;  1G8I A;  2FCE A;  3KHE A;  5HYD A;  1MXL C;  2D8N A;  1KQM C;  1OZS A;  1V1F A;  1VRK A;  4M2O A;  4U8D A;  2BE6 A;  2I94 A;  2K7D A;  2KI6 C;  3IQO A;  1CDP A;  2MAZ A;  1YX8 A;  2JTZ A;  2BCB A;  2WOS A;  2KI4 C;  1EH2 A;  2BEC A;  1AVS A;  2LMV A;  2BE4 A;  3BUX B;  3BOW B;  1LVC D;  2FCD A;  2I18 A;  2KAY A;  1C7V A;  2COL B;  1KK7 Z;  2EC6 B;  1S6I A;  1F8H A;  2KYC A;  2M8U A;  2KI6 D;  2M3W A;  1QAS A;  1Y6W A;  1YUS A;  2LNK A;  1F70 A;  1SL7 A;  2ZRS A;  2ZNE A;  1MUX A;  1RFJ A;  1DF0 B;  1S5G Y;  1CTR A;  1BMO A;  2JT3 A;  1QTX A;  2MLE C;  5FYX A;  4JPZ B;  2RGI A;  1B8R A;  4MRX A;  2ISD A;  2OTG B;  4PCW A;  1GJY A;  2Q91 A;  4ETO A;  3VRQ A;  1EJ3 A;  1IQ5 A;  5HKW A;  2P6B B;  5HKY A;  4I5K A;  4YGD B;  4DCK A;  4AQI A;  2HPS A;  1OMV A;  4XJK A;  1NCX A;  3TDU A;  1QIW A;  2NCP A;  2ZN9 A;  1K9K A;  2JU0 A;  2K7O A;  3OX5 A;  1CDM A;  1TNX A;  4OV2 A;  3BUM B;  3FIA A;  3OB1 B;  4WRI A;  1CM4 A;  1W7I B;  3GK4 X;  4MZJ A;  4WQ2 A;  2BKH B;  4ZCV A;  3EK4 A;  1ZAC A;  3OP0 A;  1YRU B;  1F55 A;  2A4J A;  3RM1 A;  2NZ0 A;  4USL A;  3VRO A;  3SIA A;  1FI5 A;  2K7C A;  1LA3 A;  1WRK A;  3KPX A;  3EK8 A;  1L2O B;  1A2X A;  2K7B A;  1CM1 A;  5ER4 X;  1LIN A;  2MRD A;  1UUS A;  1YR5 A;  1QV1 A;  1XK4 C;  1KK7 Y;  2BL0 B;  4MRY A;  4NDB A;  2MHH A;  2G9B A;  2JT0 A;  1OE9 B;  4QJ5 B;  4MZK A;  1N0Y A;  1EG3 A;  1XYD A;  2JTT A;  2KDH A;  1YUU A;  3FWC A;  1K90 D;  3JTD C;  4PE4 A;  4PHK A;  5JJG A;  1NWD A;  2LVI A;  1SBJ A;  5D69 A;  1BF5 A;  1NIW A;  2ZKM X;  1A75 B;  1HQV A;  1JWD A;  2KFG A;  1SY9 A;  4N1G A;  4JWQ A;  2MLF C;  3BQ3 A;  2LUC A;  3PAL A;  3I5F C;  2BBN A;  1OMD A;  1B8L A;  5CSI A;  2G2B A;  3KF9 A;  5G08 A;  2KGR A;  1Y1A A;  1TOP A;  1PAL A;  3CWG A;  1SRA A;  5D7F A;  5DKN A;  4IL1 A;  1KWO B;  4PE1 A;  5B8I B;  1C7W A;  2LC5 A;  2LUX A;  3I5G B;  2LLT A;  1E8A A;  2O5G A;  1ODB A;  3SG3 A;  3I5I C;  4GBA A;  1XK4 A;  1QVI Z;  1WLZ A;  2JC2 A;  4YGE B;  1UWO A;  3SIB A;  1XFZ O;  4GAO A;  1M39 A;  2WND A;  3CLN A;  2V53 A;  4NDC A;  1Y1X A;  1EG4 A;  2AMI A;  1EL4 A;  1IWQ A;  4I5J A;  4DRW A;  1CDN A;  1J7O A;  3O2P A;  1DJY A;  1PSB A;  2LM5 A;  4FTG A;  5KSZ A;  5I2O A;  3PSR A;  1NUB A;  3RLZ A;  1CFD A;  5PAL A;  1NX1 A;  2FOT A;  4XJK B;  1CKK A;  1MF8 B;  2HF5 A;  2SCP A;  3KEV A;  2WOR A;  1DT7 B;  1FBV A;  1SCM C;  1UHK A;  1KK8 C;  1Y1U A;  3NSI A;  4ICB A;  5I2L A;  2WCE A;  5HLO A;  1NX3 A;  2PAS A;  1YRT B;  1ALV A;  2JUL A;  2LMT A;  3E3R A;  2L51 A;  1DJI A;  3CR2 A;  1B47 A;  3PN7 B;  2KQ6 A;  1UHJ A;  1KSO A;  2HET A;  2WC8 A;  1R2U A;  1B7T Z;  1IG5 A;  1SPY A;  1NX0 A;  1R6P A;  3SG7 A;  3DF0 A;  1JF2 A;  1PUL A;  1OSA A;  1WLM A;  1A03 A;  4UPG A;  4C0L A;  2F2P A;  1TNP A;  3TS5 B;  1SCV A;  5IBW A;  3TUY B;  2O60 A;  1RJV A;  1TRF A;  3EK7 A;  2M7L A;  1SYM A;  3VGO A;  1QVI Y;  3SG2 A;  3QRX A;  1CFF A;  3GK1 A;  4ORC B;  1U5I B;  1NP8 A;  1WDC B;  2K2A A;  2KBM A;  1PK0 D;  2PAL A;  1OMR A;  3LCP C;  4TNC A;  3VRR A;  1D1O A;  4MVF A;  4AOM A;  1QLK A;  4CFQ A;  1YX7 A;  2PMY A;  4DUQ A;  1XFY O;  1SNL A;  1QIV A;  1ZFS A;  1X02 A;  1RK9 A;  4YGA A;  2JWW A;  2JNX A;  4CLN A;  3ICB A;  3FS7 A;  3VRP A;  2L4H A;  3PLF B;  1W7J B;  3FWB A;  2M7N A;  1UHI A;  2BBM A;  2LVV A;  2PSR A;  1CDL A;  4MZL A;  3K21 A;  2Y5I A;  5BPJ A;  4BY4 A;  3BUO B;  1DGV A;  4YBH B;  5ER5 A;  1OOJ A;  1BG1 A;  1CFP A;  2LV7 A;  1KFU S;  3AAJ A;  3VRN A;  1QXP A;  1AUI B;  2ZN8 A;  2JQ6 A;  2EC6 C;  2Y1M A;  5AAN A;  3O6B A;  2K8M B;  1KQV A;  1F4Q A;  1UP5 A;  2LE9 B;  1DJW A;  3LL8 B;  1BOC A;  3D0Y B;  1AP4 A;  1B7T Y;  1IGV A;  1JUO A;  1NSH A;  4JQ0 D;  1HT9 A;  2EHB A;  5I2Q A;  1YVL A;  3DVE A;  1FI6 A;  2HQW A;  2SAS A;  2OTG C;  2B1U A;  3PM8 A;  1DJH A;  3SG4 A;  1QX7 A;  1S6J A;  1G33 A;  4PE7 A;  1GGZ A;  1NPQ A;  3DVM A;  3SJS A;  1PVB A;  5CSF A;  2F2O A;  1Q80 A;  3EKH A;  4N1F A;  3NSL A;  2FJU B;  3EVU A;  2GGM A;  2L98 A;  3NSO A;  2CTN A;  1K9P A;  2R2I A;  2M1K B;  3AAK A;  1CB1 A;  1IRJ A;  4YI8 A;  1V1G A;  4OR9 B;  3HX4 A;  1IKU A;  1TCF A;  3ZWH A;  1CLL A;  1XVJ A;  2M9G A;  3OX6 A;  2EGD A;  3ZNI A;  2K2F A;  4Q04 A;  3DD4 A;  3GOF A;  3BOW A;  1ZOT B;  1B8C A; 
#chains in the Genus database with same CATH topology
 4F0Z B;  5I8N A;  2LP3 A;  3SG6 A;  1K93 D;  1B9A A;  1TNW A;  3M0W A;  2OS8 B;  2H8V A;  1J1E A;  2GGZ A;  4CFR A;  1DQE A;  1LA0 A;  1BU3 A;  4D1E A;  1A29 A;  3MSE B;  1L2O C;  1RRO A;  5AFP A;  4GUK A;  1J7P A;  1Z4H A;  3H4S E;  4P5O E;  2BL0 C;  4E68 A;  2JZI A;  1JBA A;  1GM0 A;  1DF0 A;  1A4P A;  1QV0 A;  1QX2 A;  4C0K A;  1IH0 A;  1CMF A;  3EVV A;  2L50 A;  2L2E A;  1BR1 B;  3JVT B;  3L4L A;  1SKT A;  4GFT A;  1S26 D;  4INX A;  2QEO A;  1H8B A;  3OB2 B;  4PAL A;  3B7A A;  2PRU A;  3R1O A;  3TZ1 A;  1BJF A;  3EVR A;  3D77 A;  4GGN A;  3CGA A;  5CSJ A;  1PSR A;  4XYN A;  2H61 C;  4MN0 A;  3C1V A;  1SR6 B;  2AUC A;  1J1D A;  1K2H A;  2LP2 A;  3DY9 A;  4GPL B;  1CNP A;  2LMU A;  4OZD A;  4MBE A;  1FPW A;  2TN4 A;  1BR4 B;  4F7F A;  1TN4 A;  3I5H B;  2JT8 A;  4M2Q A;  3CS1 A;  5TNC A;  1KFX S;  1F54 A;  3DVK A;  5HKZ A;  1M45 A;  3DVJ A;  1JSA A;  1OQP A;  3SS3 A;  4ORB B;  1JC2 A;  1KQM B;  1C3Z A;  1YUT A;  1F71 A;  2JNF A;  1YVH A;  1KWO C;  2WCB A;  3EKJ A;  2YGU A;  1BOD A;  2GV5 A;  1G4Y R;  3I5G C;  1REC A;  1XFW O;  2MJW B;  1ZMZ A;  3S0F A;  3BFB A;  4P2Y B;  2KI4 B;  4M2P A;  3OHM B;  1FF1 A;  1NCZ A;  2AAO A;  3NSK A;  5DKR A;  2LVJ A;  1KFX L;  4YGB B;  3B88 A;  3BYA A;  1IJ6 A;  4GNK B;  4INW A;  2KAV A;  1K8U A;  3WHU B;  2ZRT A;  1K94 A;  1XO5 A;  1LKJ A;  1OOF A;  1A75 A;  4GGF C;  2H61 A;  1QJT A;  4YI9 A;  1ALW A;  5AER A;  2IS9 A;  2PVB A;  1TTX A;  1KCY A;  1MQ1 A;  3AKB A;  1IQ3 A;  5AXI A;  4MSP A;  1XFX O;  2DOQ A;  3L47 A;  1GQM A;  3WNX B;  1YUR A;  3S0G A;  4PHJ A;  4BY5 A;  2CXJ A;  1P28 A;  1XA5 A;  4DS7 A;  3TDI A;  2OPO A;  2I2R E;  2KFH A;  3LK1 A;  1DJZ A;  2WCJ A;  3KO0 A;  3PN7 C;  1H4B A;  3LK0 A;  2HQ8 A;  5I94 A;  5K89 A;  2KNE A;  2L5Y A;  2KYF A;  1CMG A;  1NYA A;  2KFF A;  1KSM A;  1DTL A;  4HRH A;  4N5X A;  1Y0V H;  1GGW A;  1J55 A;  1K95 A;  2L5X B;  1OW4 A;  3S0D A;  4PHM A;  5BPJ A;  2KBI A;  5AEQ A;  1IJ5 A;  3BXK A;  1JF0 A;  3CZ1 A;  1DJG A;  2KOT A;  3LLE A;  1M63 B;  3TDZ A;  1S1E A;  2MBX A;  2JRF A;  3TS5 C;  3TUY C;  1N2D A;  1JFJ A;  3NXA A;  1S6C A;  2CNP A;  2Y4Q A;  4MLW A;  5J3X A;  4PE0 A;  1RWY A;  1N65 A;  4I5N B;  2L4I A;  2VRG A;  1WDC C;  3SG5 A;  1UHH A;  3GK2 A;  1QWV A;  1C07 A;  4GGF A;  1AHR A;  1K96 A;  1MXE A;  2KHN A;  2L0P A;  2E6W A;  4MEW A;  3HCM A;  4QJ4 B;  1BT6 A;  3JTD B;  1CFC A;  3D76 A;  5FI6 A;  1DGU A;  3F45 A;  1QLS A;  1SL8 A;  1J7R A;  1KFU L;  2CBL A;  2JXL A;  2KQY A;  4PDZ A;  4DIR A;  1QS7 A;  2LHI A;  2I7A A;  2F3Z A;  4FQO A;  1MR8 A;  3O4Y A;  3R1V A;  2M0R A;  1QAT A;  4OVN F;  3QME A;  3D74 A;  1XFU O;  2Q4U A;  1PVA A;  1WRZ A;  3I5F B;  4WQ3 A;  5KTY A;  4QJ3 B;  2QAC A;  1B4C A;  1DJX A;  3CDN A;  2M97 A;  4A4B A;  2LVK A;  2BCA A;  3AKA A;  2K61 A;  3DYE A;  4HRG A;  3CR4 X;  3IF7 A;  1OZO A;  1FW4 A;  2NCO A;  1XFV O;  2E30 A;  1M31 A;  2ERB A;  2KGB C;  3UO9 A;  3B87 A;  1BLQ A;  1SK6 D;  1LXF C;  3DF0 B;  5EL2 A;  1SMG A;  1S3P A;  2KAX A;  3I5I B;  5HLV A;  1TCO B;  1J7Q A;  5KU1 A;  1U5I A;  2LHL A;  3A8R A;  3D75 A;  4I5L B;  3NHI A;  3Q8I A;  3BUW B;  2BCX A;  1NCY A;  4ORA B;  3WHT B;  3L4A A;  1NX2 A;  2H2K A;  4NDD A;  2CT9 A;  2F33 A;  4C0J A;  2LCP A;  1CLB A;  2QPT A;  4KYN A;  1OOH A;  2M29 A;  1EXR A;  5FI7 A;  1K9U A;  1JFK A;  3K1E A;  3WXA A;  2LAN A;  5I2L A;  3SS4 A;  1TNQ A;  3CTN A;  3PAT A;  1WY9 A;  1OOG A;  1TIZ A;  2JOJ A;  3VB1 A;  2WCF A;  1QX5 B;  2NLN A;  1UUR A;  2F3Y A;  4CID A;  1YTZ C;  1PRW A;  2K0J A;  1SCM B;  1KK8 B;  2OS8 C;  4L9M A;  2BKI B;  2JXC A;  4YGC B;  1F4O A;  3OGN A;  3S0A A;  1DVI A;  3PFV A;  1AJ4 A;  4OKH A;  3EG5 B;  4YRU A;  3O78 A;  4A4C A;  5CSN A;  4OCI A;  1SL9 A;  2QEH A;  2LLS A;  2CCM A;  3D0Y A;  3B6X A;  4ZCU A;  5DIC A;  2KSP A;  3CR5 X;  2LAP A;  2M49 B;  1B1G A;  1S36 A;  1S5G Z;  5CPV A;  3RZS A;  1UHN A;  2ZFD A;  2ZND A;  3A4U B;  3JVT C;  4PHN A;  4CPV A;  1AK8 A;  3IQQ A;  1SW8 A;  1M46 A;  2F8P A;  1WRL A;  1DMO A;  3CYZ A;  2NXQ A;  1MWN A;  1L7Z A;  3BUN B;  4AQJ A;  1SR6 C;  1RTP 1;  3CZT X;  2JPT A;  1MHO A;  2Y1N A;  3DZT A;  2MA2 A;  1CLM A;  5JOL A;  1ZUZ A;  4HSZ A;  3I5H C;  5GQQ C;  4NQG A;  5F6T A;  2M1U A;  4HRE E;  4R1E A;  5DKQ A;  1AJ5 A;  3D10 A;  2LLU A;  1G8I A;  2FCE A;  2P71 A;  3KHE A;  5HYD A;  1MXL C;  2WC6 A;  2D8N A;  1KQM C;  1OZS A;  1V1F A;  1VRK A;  1W9Z A;  4M2O A;  2BE6 A;  4U8D A;  2I94 A;  2K7D A;  2KI6 C;  3IQO A;  1CDP A;  2MAZ A;  2PYQ A;  1YX8 A;  2JTZ A;  2BCB A;  2WOS A;  2KI4 C;  1EH2 A;  2BEC A;  1AVS A;  2LMV A;  2BE4 A;  3BUX B;  3BOW B;  1LVC D;  2FCD A;  2I18 A;  2KAY A;  1C7V A;  3R1P A;  5D3O A;  2COL B;  3D78 A;  1KK7 Z;  2EC6 B;  1S6I A;  1F8H A;  2KYC A;  2M8U A;  2KI6 D;  4NDC A;  2M3W A;  1QAS A;  1Y6W A;  1YUS A;  2LNK A;  1F70 A;  1SL7 A;  2ZRS A;  2ZNE A;  1MUX A;  1RFJ A;  2KPH A;  1DF0 B;  1S5G Y;  1CTR A;  1BMO A;  2JT3 A;  1QTX A;  2MLE C;  3IVT A;  5FYX A;  4JPZ B;  2RGI A;  1B8R A;  4MRX A;  2ISD A;  2OTG B;  4PCW A;  1GJY A;  2Q91 A;  4ETO A;  3VRQ A;  1EJ3 A;  1IQ5 A;  5HKW A;  2P6B B;  5HKY A;  2GTE A;  4I5K A;  2WCK A;  4YGD B;  4DCK A;  4AQI A;  2HPS A;  1OMV A;  4XJK A;  1NCX A;  3TDU A;  1QIW A;  2NCP A;  2WCL A;  2BAP A;  1K9K A;  2ZN9 A;  2JU0 A;  2K7O A;  3OX5 A;  3BFA A;  1CDM A;  1TNX A;  4OV2 A;  3FE9 A;  3BUM B;  3FIA A;  3OB1 B;  4WRI A;  1CM4 A;  1W7I B;  3GK4 X;  4MZJ A;  2K60 A;  4WQ2 A;  2BKH B;  4ZCV A;  3EK4 A;  1ZAC A;  3OP0 A;  1YRU B;  1F55 A;  2A4J A;  3RM1 A;  2NZ0 A;  4USL A;  3VRO A;  3SIA A;  1FI5 A;  3DXL A;  2WCH A;  2K7C A;  1LA3 A;  2JPO A;  1WRK A;  3KPX A;  3EK8 A;  1L2O B;  1A2X A;  2K7B A;  1CM1 A;  5ER4 X;  1LIN A;  2MRD A;  1UUS A;  1YR5 A;  1QV1 A;  1XK4 C;  1KK7 Y;  2BL0 B;  4MRY A;  4NDB A;  2MHH A;  3UNW A;  2G9B A;  2JT0 A;  1OE9 B;  4QJ5 B;  4MZK A;  1N0Y A;  1EG3 A;  1XYD A;  2JTT A;  2KDH A;  1YUU A;  3FWC A;  1K90 D;  3JTD C;  4PE4 A;  4PHK A;  5JJG A;  1NWD A;  2LVI A;  1SBJ A;  3CZ2 A;  5D69 A;  1BF5 A;  1NIW A;  5FI2 A;  2ZKM X;  1A75 B;  1HQV A;  1JWD A;  2KFG A;  1SY9 A;  4N1G A;  4JWQ A;  2MLF C;  3BQ3 A;  2LUC A;  4FQT A;  3PAL A;  3I5F C;  2BBN A;  1OMD A;  1B8L A;  5CSI A;  2G2B A;  3KF9 A;  5G08 A;  2KGR A;  1Y1A A;  5HL1 A;  1TOP A;  1PAL A;  3CWG A;  1SRA A;  5D7F A;  5DKN A;  4IL1 A;  1KWO B;  4PE1 A;  5B8I B;  1C7W A;  2LC5 A;  2LUX A;  3I5G B;  2LLT A;  1E8A A;  2QDI A;  2O5G A;  1ODB A;  3SG3 A;  3I5I C;  4GBA A;  3D73 A;  1XK4 A;  1QVI Z;  1WLZ A;  2JC2 A;  3NHT A;  1UWO A;  4YGE B;  3SIB A;  1XFZ O;  4GAO A;  1M39 A;  2WND A;  3CLN A;  1DEL A;  2V53 A;  1Y1X A;  1EG4 A;  1EL4 A;  1IWQ A;  2AMI A;  4I5J A;  3SS5 A;  1CDN A;  1J7O A;  3O2P A;  4JKT A;  1DJY A;  1PSB A;  2LM5 A;  4FTG A;  5KSZ A;  5I2O A;  3PSR A;  1NUB A;  3RLZ A;  1CFD A;  1TWO A;  5PAL A;  1NX1 A;  2FOT A;  4XJK B;  1CKK A;  1MF8 B;  2HF5 A;  2SCP A;  3KEV A;  1ORG A;  2WOR A;  1DT7 B;  1FBV A;  1SCM C;  1UHK A;  1KK8 C;  1Y1U A;  3NSI A;  3R72 A;  4ICB A;  2WCE A;  5HLO A;  1NX3 A;  2PAS A;  1YRT B;  1ALV A;  2JUL A;  2QEB A;  2LMT A;  3E3R A;  2L51 A;  1DJI A;  3CR2 A;  1B47 A;  3PN7 B;  2FJY A;  2KQ6 A;  1UHJ A;  1SSE B;  1IIO A;  1KSO A;  2HET A;  2WC8 A;  1R2U A;  4DRW A;  1B7T Z;  1IG5 A;  1SPY A;  1T14 A;  1NX0 A;  1R6P A;  3SG7 A;  3BFH A;  3DF0 A;  1JF2 A;  4PT1 A;  1PUL A;  1OSA A;  1WLM A;  3S0B A;  2WCM A;  4UPG A;  1DC1 A;  4C0L A;  2F2P A;  1A03 A;  1TNP A;  3TS5 B;  1SCV A;  5IBW A;  3TUY B;  2O60 A;  1Z2C B;  1XFR A;  1RJV A;  1TRF A;  1DEK A;  3EK7 A;  3NGV A;  1C3Y A;  2M7L A;  1SYM A;  3VGO A;  2QEV A;  1OOI X;  2WC5 A;  1QVI Y;  3SG2 A;  3QRX A;  1CFF A;  3GK1 A;  4ORC B;  1U5I B;  1NP8 A;  1WDC B;  2K2A A;  2KBM A;  1PK0 D;  2PAL A;  1OMR A;  3LCP C;  3PJI A;  4TNC A;  3VRR A;  1D1O A;  4MVF A;  4AOM A;  1QLK A;  4CFQ A;  1YX7 A;  2PMY A;  2PQL A;  4DUQ A;  1XFY O;  1SNL A;  1QIV A;  1ZFS A;  1X02 A;  3O4X A;  3N7H A;  1RK9 A;  4YGA A;  2JWW A;  2JNX A;  4CLN A;  3ICB A;  3FS7 A;  3VRP A;  2L4H A;  3PLF B;  1W7J B;  3FWB A;  2M7N A;  1UHI A;  2BBM A;  2LVV A;  2PSR A;  1CDL A;  4MZL A;  3K21 A;  2Y5I A;  3BJH A;  2L2C A;  3V2L A;  3BUO B;  4BY4 A;  1DGV A;  1TUJ A;  4YBH B;  1OOJ A;  3CZ0 A;  3OBV A;  5ER5 A;  3S0E A;  2LV7 A;  1KFU S;  3AAJ A;  3VRN A;  1BG1 A;  1CFP A;  1QXP A;  1AUI B;  2BNX A;  2ZN8 A;  2JQ6 A;  2EC6 C;  2Y1M A;  5AAN A;  3O6B A;  1TUZ A;  2K8M B;  1KQV A;  1F4Q A;  1UP5 A;  2LE9 B;  3FE6 A;  1DJW A;  3LL8 B;  1BOC A;  3D0Y B;  1AP4 A;  1B7T Y;  1IGV A;  1JUO A;  1NSH A;  4JQ0 D;  1HT9 A;  2EHB A;  5I2Q A;  1YVL A;  3DVE A;  1FI6 A;  2HQW A;  3CAB A;  2SAS A;  3FE8 A;  2OTG C;  2B1U A;  3PM8 A;  1DJH A;  4IJ7 A;  1QX7 A;  1S6J A;  3SG4 A;  1G33 A;  2KLE A;  2P70 A;  4JD9 A;  4PE7 A;  1GGZ A;  1NPQ A;  3DVM A;  3SJS A;  1PVB A;  5CSF A;  2F2O A;  3B86 A;  1Q80 A;  3EKH A;  4N1F A;  3NSL A;  2FJU B;  3EVU A;  2GGM A;  2L98 A;  3NSO A;  2CTN A;  1K9P A;  2R2I A;  2M1K B;  3AAK A;  1CB1 A;  1IRJ A;  4YI8 A;  1V1G A;  4OR9 B;  3HX4 A;  1IKU A;  1TCF A;  1LS8 A;  1CLL A;  2KLD A;  1XVJ A;  2M9G A;  3ZWH A;  3OX6 A;  2EGD A;  3ZNI A;  2K2F A;  4Q04 A;  3PM2 A;  3DD4 A;  3GOF A;  3BOW A;  1ZOT B;  1B8C A; 
#chains in the Genus database with same CATH homology
 4F0Z B;  5I8N A;  2LP3 A;  3SG6 A;  1K93 D;  1B9A A;  1TNW A;  3M0W A;  2OS8 B;  4CFR A;  1J1E A;  2GGZ A;  1LA0 A;  1BU3 A;  4D1E A;  1A29 A;  3MSE B;  1L2O C;  1RRO A;  5AFP A;  4GUK A;  1J7P A;  3H4S E;  4P5O E;  2BL0 C;  4E68 A;  2JZI A;  1JBA A;  1DF0 A;  1A4P A;  1QV0 A;  1QX2 A;  4C0K A;  1IH0 A;  1CMF A;  3EVV A;  2L50 A;  2L2E A;  1BR1 B;  3JVT B;  1SKT A;  4GFT A;  1S26 D;  1H8B A;  3OB2 B;  4PAL A;  2PRU A;  3TZ1 A;  1BJF A;  3EVR A;  4GGN A;  3CGA A;  5CSJ A;  1PSR A;  4XYN A;  2H61 C;  4MN0 A;  3C1V A;  1SR6 B;  2AUC A;  1J1D A;  1K2H A;  2LP2 A;  4GPL B;  1CNP A;  2LMU A;  4MBE A;  1FPW A;  2TN4 A;  1BR4 B;  1TN4 A;  3I5H B;  2JT8 A;  4M2Q A;  3CS1 A;  5TNC A;  1KFX S;  1F54 A;  3DVK A;  5HKZ A;  1M45 A;  3DVJ A;  1JSA A;  1OQP A;  4ORB B;  1JC2 A;  1KQM B;  1YUT A;  1F71 A;  2JNF A;  1YVH A;  1KWO C;  2WCB A;  3EKJ A;  1BOD A;  2GV5 A;  1G4Y R;  3I5G C;  1REC A;  1XFW O;  2MJW B;  1ZMZ A;  4P2Y B;  2KI4 B;  4M2P A;  3OHM B;  1FF1 A;  1NCZ A;  2AAO A;  3NSK A;  5DKR A;  2LVJ A;  1KFX L;  4YGB B;  3BYA A;  1IJ6 A;  4GNK B;  2KAV A;  1K8U A;  3WHU B;  2ZRT A;  1K94 A;  1XO5 A;  1LKJ A;  1A75 A;  4GGF C;  2H61 A;  1QJT A;  4YI9 A;  1ALW A;  5AER A;  2IS9 A;  2PVB A;  1TTX A;  1KCY A;  1MQ1 A;  3AKB A;  1IQ3 A;  5AXI A;  4MSP A;  1XFX O;  2DOQ A;  3WNX B;  1GQM A;  1YUR A;  4PHJ A;  4BY5 A;  2CXJ A;  4DS7 A;  1XA5 A;  3TDI A;  2OPO A;  2I2R E;  2KFH A;  3LK1 A;  1DJZ A;  3KO0 A;  1H4B A;  3PN7 C;  3LK0 A;  2HQ8 A;  5K89 A;  2KNE A;  2KYF A;  1CMG A;  1NYA A;  2KFF A;  1KSM A;  1DTL A;  4HRH A;  4N5X A;  1Y0V H;  1GGW A;  1J55 A;  1K95 A;  2L5X B;  4PHM A;  2KBI A;  5AEQ A;  1IJ5 A;  3BXK A;  1JF0 A;  1DJG A;  2KOT A;  3LLE A;  1M63 B;  3TDZ A;  1S1E A;  2MBX A;  2JRF A;  3TS5 C;  3TUY C;  1N2D A;  1JFJ A;  3NXA A;  1S6C A;  2CNP A;  2Y4Q A;  4MLW A;  5J3X A;  4PE0 A;  1RWY A;  1N65 A;  4I5N B;  2L4I A;  2VRG A;  1WDC C;  3SG5 A;  1UHH A;  3GK2 A;  1C07 A;  4GGF A;  1AHR A;  1K96 A;  1MXE A;  2KHN A;  2L0P A;  2E6W A;  4MEW A;  3HCM A;  4QJ4 B;  1BT6 A;  3JTD B;  1CFC A;  1DGU A;  3F45 A;  1QLS A;  1SL8 A;  1J7R A;  1KFU L;  2CBL A;  2JXL A;  2KQY A;  4PDZ A;  4DIR A;  1QS7 A;  2LHI A;  2I7A A;  2F3Z A;  4FQO A;  1MR8 A;  3O4Y A;  2M0R A;  1QAT A;  4OVN F;  1XFU O;  2Q4U A;  1PVA A;  1WRZ A;  3I5F B;  4WQ3 A;  5KTY A;  4QJ3 B;  2QAC A;  1B4C A;  1DJX A;  2M97 A;  4A4B A;  2LVK A;  2BCA A;  3AKA A;  2K61 A;  4HRG A;  3CR4 X;  3IF7 A;  1OZO A;  1FW4 A;  2NCO A;  1XFV O;  2E30 A;  1M31 A;  2KGB C;  1BLQ A;  1SK6 D;  1LXF C;  3DF0 B;  1SMG A;  1S3P A;  2KAX A;  3I5I B;  5HLV A;  1TCO B;  1J7Q A;  5KU1 A;  1U5I A;  2LHL A;  3A8R A;  4I5L B;  3BUW B;  2BCX A;  1NCY A;  4ORA B;  3WHT B;  1NX2 A;  2H2K A;  4NDD A;  2CT9 A;  2F33 A;  4C0J A;  2LCP A;  1CLB A;  2QPT A;  2M29 A;  1EXR A;  1K9U A;  1JFK A;  3WXA A;  2LAN A;  1TNQ A;  3CTN A;  3PAT A;  1WY9 A;  2JOJ A;  1TIZ A;  2WCF A;  1QX5 B;  2NLN A;  1UUR A;  2F3Y A;  4CID A;  1YTZ C;  1PRW A;  2K0J A;  1SCM B;  1KK8 B;  2OS8 C;  4L9M A;  2BKI B;  2JXC A;  4YGC B;  1F4O A;  1DVI A;  3PFV A;  1AJ4 A;  4OKH A;  4YRU A;  3O78 A;  4A4C A;  5CSN A;  4OCI A;  1SL9 A;  2LLS A;  2CCM A;  3D0Y A;  4ZCU A;  2KSP A;  3CR5 X;  2LAP A;  2M49 B;  1B1G A;  1S36 A;  1S5G Z;  5CPV A;  1UHN A;  2ZFD A;  2ZND A;  3A4U B;  3JVT C;  4PHN A;  4CPV A;  1AK8 A;  3IQQ A;  1SW8 A;  1M46 A;  2F8P A;  1WRL A;  1DMO A;  2NXQ A;  1MWN A;  1L7Z A;  3BUN B;  4AQJ A;  1SR6 C;  1RTP 1;  3CZT X;  2JPT A;  1MHO A;  2Y1N A;  5JOL A;  2MA2 A;  1CLM A;  1ZUZ A;  4HSZ A;  3I5H C;  5GQQ C;  4NQG A;  5F6T A;  2M1U A;  4HRE E;  4R1E A;  5DKQ A;  1AJ5 A;  3D10 A;  2LLU A;  1G8I A;  2FCE A;  3KHE A;  5HYD A;  1MXL C;  2D8N A;  1KQM C;  1OZS A;  1V1F A;  1VRK A;  4M2O A;  4U8D A;  2BE6 A;  2I94 A;  2K7D A;  2KI6 C;  3IQO A;  1CDP A;  2MAZ A;  1YX8 A;  2JTZ A;  2BCB A;  2WOS A;  2KI4 C;  1EH2 A;  2BEC A;  1AVS A;  2LMV A;  2BE4 A;  3BUX B;  3BOW B;  1LVC D;  2FCD A;  2I18 A;  2KAY A;  1C7V A;  2COL B;  1KK7 Z;  2EC6 B;  1S6I A;  1F8H A;  2KYC A;  2M8U A;  2KI6 D;  2M3W A;  1QAS A;  1Y6W A;  1YUS A;  2LNK A;  1F70 A;  1SL7 A;  2ZRS A;  2ZNE A;  1MUX A;  1RFJ A;  1DF0 B;  1S5G Y;  1CTR A;  1BMO A;  2JT3 A;  1QTX A;  2MLE C;  5FYX A;  4JPZ B;  2RGI A;  1B8R A;  4MRX A;  2ISD A;  2OTG B;  4PCW A;  1GJY A;  2Q91 A;  4ETO A;  3VRQ A;  1EJ3 A;  1IQ5 A;  5HKW A;  2P6B B;  5HKY A;  4I5K A;  4YGD B;  4DCK A;  4AQI A;  2HPS A;  1OMV A;  4XJK A;  1NCX A;  3TDU A;  1QIW A;  2NCP A;  2ZN9 A;  1K9K A;  2JU0 A;  2K7O A;  3OX5 A;  1CDM A;  1TNX A;  4OV2 A;  3BUM B;  3FIA A;  3OB1 B;  4WRI A;  1CM4 A;  1W7I B;  3GK4 X;  4MZJ A;  4WQ2 A;  2BKH B;  4ZCV A;  3EK4 A;  1ZAC A;  3OP0 A;  1YRU B;  1F55 A;  2A4J A;  3RM1 A;  2NZ0 A;  4USL A;  3VRO A;  3SIA A;  1FI5 A;  2K7C A;  1LA3 A;  1WRK A;  3KPX A;  3EK8 A;  1L2O B;  1A2X A;  2K7B A;  1CM1 A;  5ER4 X;  1LIN A;  2MRD A;  1UUS A;  1YR5 A;  1QV1 A;  1XK4 C;  1KK7 Y;  2BL0 B;  4MRY A;  4NDB A;  2MHH A;  2G9B A;  2JT0 A;  1OE9 B;  4QJ5 B;  4MZK A;  1N0Y A;  1EG3 A;  1XYD A;  2JTT A;  2KDH A;  1YUU A;  3FWC A;  1K90 D;  3JTD C;  4PE4 A;  4PHK A;  5JJG A;  1NWD A;  2LVI A;  1SBJ A;  5D69 A;  1BF5 A;  1NIW A;  2ZKM X;  1A75 B;  1HQV A;  1JWD A;  2KFG A;  1SY9 A;  4N1G A;  4JWQ A;  2MLF C;  3BQ3 A;  2LUC A;  3PAL A;  3I5F C;  2BBN A;  1OMD A;  1B8L A;  5CSI A;  2G2B A;  3KF9 A;  5G08 A;  2KGR A;  1Y1A A;  1TOP A;  1PAL A;  3CWG A;  1SRA A;  5D7F A;  5DKN A;  4IL1 A;  1KWO B;  4PE1 A;  5B8I B;  1C7W A;  2LC5 A;  2LUX A;  3I5G B;  2LLT A;  1E8A A;  2O5G A;  1ODB A;  3SG3 A;  3I5I C;  4GBA A;  1XK4 A;  1QVI Z;  1WLZ A;  2JC2 A;  4YGE B;  1UWO A;  3SIB A;  1XFZ O;  4GAO A;  1M39 A;  2WND A;  3CLN A;  2V53 A;  4NDC A;  1Y1X A;  1EG4 A;  2AMI A;  1EL4 A;  1IWQ A;  4I5J A;  4DRW A;  1CDN A;  1J7O A;  3O2P A;  1DJY A;  1PSB A;  2LM5 A;  4FTG A;  5KSZ A;  5I2O A;  3PSR A;  1NUB A;  3RLZ A;  1CFD A;  5PAL A;  1NX1 A;  2FOT A;  4XJK B;  1CKK A;  1MF8 B;  2HF5 A;  2SCP A;  3KEV A;  2WOR A;  1DT7 B;  1FBV A;  1SCM C;  1UHK A;  1KK8 C;  1Y1U A;  3NSI A;  4ICB A;  5I2L A;  2WCE A;  5HLO A;  1NX3 A;  2PAS A;  1YRT B;  1ALV A;  2JUL A;  2LMT A;  3E3R A;  2L51 A;  1DJI A;  3CR2 A;  1B47 A;  3PN7 B;  2KQ6 A;  1UHJ A;  1KSO A;  2HET A;  2WC8 A;  1R2U A;  1B7T Z;  1IG5 A;  1SPY A;  1NX0 A;  1R6P A;  3SG7 A;  3DF0 A;  1JF2 A;  1PUL A;  1OSA A;  1WLM A;  1A03 A;  4UPG A;  4C0L A;  2F2P A;  1TNP A;  3TS5 B;  1SCV A;  5IBW A;  3TUY B;  2O60 A;  1RJV A;  1TRF A;  3EK7 A;  2M7L A;  1SYM A;  3VGO A;  1QVI Y;  3SG2 A;  3QRX A;  1CFF A;  3GK1 A;  4ORC B;  1U5I B;  1NP8 A;  1WDC B;  2K2A A;  2KBM A;  1PK0 D;  2PAL A;  1OMR A;  3LCP C;  4TNC A;  3VRR A;  1D1O A;  4MVF A;  4AOM A;  1QLK A;  4CFQ A;  1YX7 A;  2PMY A;  4DUQ A;  1XFY O;  1SNL A;  1QIV A;  1ZFS A;  1X02 A;  1RK9 A;  4YGA A;  2JWW A;  2JNX A;  4CLN A;  3ICB A;  3FS7 A;  3VRP A;  2L4H A;  3PLF B;  1W7J B;  3FWB A;  2M7N A;  1UHI A;  2BBM A;  2LVV A;  2PSR A;  1CDL A;  4MZL A;  3K21 A;  2Y5I A;  5BPJ A;  4BY4 A;  3BUO B;  1DGV A;  4YBH B;  5ER5 A;  1OOJ A;  1BG1 A;  1CFP A;  2LV7 A;  1KFU S;  3AAJ A;  3VRN A;  1QXP A;  1AUI B;  2ZN8 A;  2JQ6 A;  2EC6 C;  2Y1M A;  5AAN A;  3O6B A;  2K8M B;  1KQV A;  1F4Q A;  1UP5 A;  2LE9 B;  1DJW A;  3LL8 B;  1BOC A;  3D0Y B;  1AP4 A;  1B7T Y;  1IGV A;  1JUO A;  1NSH A;  4JQ0 D;  1HT9 A;  2EHB A;  5I2Q A;  1YVL A;  3DVE A;  1FI6 A;  2HQW A;  2SAS A;  2OTG C;  2B1U A;  3PM8 A;  1DJH A;  3SG4 A;  1QX7 A;  1S6J A;  1G33 A;  4PE7 A;  1GGZ A;  1NPQ A;  3DVM A;  3SJS A;  1PVB A;  5CSF A;  2F2O A;  1Q80 A;  3EKH A;  4N1F A;  3NSL A;  2FJU B;  3EVU A;  2GGM A;  2L98 A;  3NSO A;  2CTN A;  1K9P A;  2R2I A;  2M1K B;  3AAK A;  1CB1 A;  1IRJ A;  4YI8 A;  1V1G A;  4OR9 B;  3HX4 A;  1IKU A;  1TCF A;  3ZWH A;  1CLL A;  1XVJ A;  2M9G A;  3OX6 A;  2EGD A;  3ZNI A;  2K2F A;  4Q04 A;  3DD4 A;  3GOF A;  3BOW A;  1ZOT B;  1B8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...