1DMOA

Calmodulin, nmr, 30 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-induced conformational transition revealed by the solution structure of apo calmodulin.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1996-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dmoA00
1CM1A 1TCOB 2BKIB 1IG5A 1MXLC 3PATA 1YURA 2KI6D 1AJ5A 1WDCC 3FWBA 2LMUA 4JWQA 3BUWB 1MUXA 4MSPA 1WDCB 5PALA 4ORAB 4YBHB 2BCXA 3WXAA 1RK9A 2JRFA 3SIAA 1NCXA 2PRUA 3CS1A 1GQMA 4I5JA 1J7RA 4NDCA 4QJ3B 3SJSA 1B9AA 2LC5A 3WNXB 3DD4A 5DKQA 2KNEA 4CPVA 4PALA 3I5IB 1YUTA 1YTZC 1ZFSA 4MLWA 4MZLA 4YGDB 1YUUA 1K9UA 1G33A 4I5LB 1AHRA 1A4PA 1QS7A 3K21A 1CLLA 2JXLA 3VROA 3EVUA 1NP8A 2B1UA 4PHNA 4PHJA 4FTGA 2L4HA 3EVRA 1AJ4A 1ZOTB 1CFPA 1KFXS 4QJ4B 1X02A 2LMVA 5D69A 2M49B 1ALWA 1W7IB 2MRDA 5F6TA 4DUQA 1XVJA 1SCVA 1BG1A 2KQ6A 2FOTA 1K9KA 4GBAA 1NIWA 4GAOA 3RLZA 1PALA 1TNWA 5I2OA 2WOSA 1EH2A 4NQGA 2EC6C 1XFZO 3PM8A 2HF5A 2M29A 1XK4C 1G8IA 2JT0A 1AVSA 3JVTB 1QLKA 1M45A 5JOLA 2PMYA 2KI4C 1NCYA 4YRUA 1OQPA 3HCMA 1J7QA 3AAKA 3I5FC 3DVMA 3MSEB 2K2FA 1M31A 3O78A 2NZ0A 2ZFDA 3I5GC 1LVCD 3BOWB 3EVVA 1OMVA 1QTXA 2KAVA 2KFGA 3SG6A 4GGFA 2FCDA 1UWOA 5GQQC 4ZCVA 1NUBA 1QIWA 3ICBA 4N1FA 2PVBA 2JTTA 1JUOA 4MEWA 1FI6A 2HQWA 4DCKA 1UUSA 1IKUA 1PVAA 1CNPA 1FF1A 1FW4A 3TS5C 1KK7Y 2GGMA 4OV2A 1DJWA 1DJXA 1TIZA 2KBMA 1YRTB 1CMGA 2VRGA 2JT8A 1J7PA 2LUXA 4CLNA 1E8AA 1EG4A 4NDBA 3SG7A 5JJGA 2BECA 1Y1UA 4HRGA 5HKWA 1JSAA 2KI6C 2G2BA 1SL7A 2BBNA 2LV7A 1CKKA 1FPWA 2KI4B 1CLBA 3SG4A 4USLA 2WCFA 1F8HA 1DGVA 1NPQA 1U5IB 2CXJA 1SNLA 4YGAA 3NSLA 2HETA 1KQVA 5ER4X 4PE1A 2GGZA 1L2OB 2LP2A 2HPSA 1DTLA 1OSAA 2PASA 2Y5IA 2DOQA 1MR8A 1QV0A 2LLSA 3A8RA 3I5IC 4GUKA 1C7VA 2R2IA 3NSIA 2ZNDA 1B8CA 1SL8A 2JTZA 2KFHA 2M9GA 3BOWA 1UHJA 1A29A 1XFUO 1UHIA 1UHKA 3BXKA 1SKTA 4MVFA 1NX0A 2F3ZA 1MXEA 2ZNEA 2L5XB 3SG2A 5BPJA 1SPYA 1D1OA 4ETOA 1RJVA 4NDDA 1K9PA 4ICBA 2LMTA 1K94A 2I7AA 1AK8A 2M3WA 4WQ3A 2PSRA 2LUCA 4HREE 1FI5A 1S26D 5G08A 1JFKA 1M39A 2Q4UA 2I2RE 4D1EA 1G4YR 2LVKA 1B47A 1SL9A 5AEQA 1XO5A 5J3XA 3KHEA 1QX2A 1DF0A 2BCBA 1JBAA 3WHUB 5HKYA 1CFCA 3AKAA 1IRJA 3EK4A 5I2LA 3CR4X 1K90D 1XK4A 1SR6B 1NSHA 2O5GA 3BUXB 1IH0A 1QATA 3GOFA 1JWDA 1WRKA 3JTDB 2KSPA 2LLUA 2JOJA 2L4IA 4E68A 1C7WA 4A4CA 2LANA 2H61A 1NYAA 1HT9A 1YVHA 2JPTA 2LVJA 1M46A 4F0ZB 2K7CA 2M8UA 3LL8B 4CFQA 1BLQA 1BU3A 2CTNA 4HRHA 3DVKA 1YX8A 1XFYO 3D0YB 1B8LA 3KF9A 1AP4A 2K7DA 3NXAA 4MRYA 3TS5B 2JT3A 2OTGB 4OKHA 1FBVA 1F4QA 1EL4A 2MJWB 1DJYA 1A03A 1IQ3A 1BR1B 4P5OE 4XJKA 5CPVA 1S36A 1IJ6A 1XA5A 1A2XA 4IL1A 1F70A 1AUIB 2AUCA 2WCEA 2LLTA 4GPLB 4PCWA 1QASA 2IS9A 4AQIA 2P6BB 4JQ0D 3VRQA 1XFVO 4A4BA 2MBXA 3LLEA 4BY5A 1RWYA 1EXRA 1QIVA 4Q04A 3KPXA 4N5XA 4DIRA 2SASA 2MLEC 1CDNA 5B8IB 3PFVA 3IF7A 4OCIA 4ORCB 1KWOC 4QJ5B 3C1VA 4MN0A 2A4JA 1SRAA 1ALVA 2O60A 5D7FA 1LKJA 2MAZA 1DMOA 1QVIZ 1S1EA 3PALA 1L7ZA 3PN7B 3EKJA 3CWGA 2OTGC 4BY4A 4C0KA 2JU0A 2FJUB 1SW8A 3PLFB 2LCPA 2LHLA 1TNPA 1K93D 5FYXA 1DVIA 4MZKA 2KYFA 2KGRA 3SG3A 5I8NA 1U5IA 4CIDA 2LNKA 3CR2A 1K95A 2K7BA 1TCFA 4UPGA 5IBWA 1J1EA 3E3RA 1V1FA 4PE4A 1KWOB 2BE4A 3EKHA 1DJIA 3D10A 3DF0A 3QRXA 2COLB 4U8DA 2D8NA 2LP3A 5CSFA 1C07A 1F71A 1XYDA 2V53A 2M1KB 4XJKB 2EC6B 1SR6C 1DGUA 2QACA 4XYNA 1MHOA 3VRNA 1BJFA 1YVLA 4AQJA 1WLMA 4OR9B 2CCMA 1BR4B 4OVNF 1DT7B 4GFTA 4PHMA 1S5GY 2MA2A 3IQQA 1KSOA 1A75B 1KK8B 2BKHB 2BE6A 1TTXA 1S3PA 1PULA 3OP0A 1DJHA 5CSJA 2M7NA 1HQVA 2GV5A 3BQ3A 3I5HC 5DKNA 3PSRA 1CMFA 5ER5A 1Y1AA 1Y1XA 4MBEA 4YGEB 3ZWHA 2NXQA 3VRRA 5CSIA 3DVJA 1LA3A 1CDMA 3EK7A 3GK1A 1TNQA 2K0JA 2Y1NA 3CR5X 2PALA 4TNCA 4DS7A 2JNXA 1ZACA 1F4OA 2BBMA 2K2AA 2K61A 1J1DA 2M0RA 3GK2A 4AOMA 3O6BA 2ISDA 4MRXA 2H61C 1CM4A 2M97A 4HSZA 1WRZA 5CSNA 3SG5A 2HQ8A 1ZUZA 2H2KA 3O2PA 1B8RA 2JXCA 2F2PA 2L0PA 1UP5A 1CTRA 2F33A 3A4UB 1QV1A 1WY9A 5AERA 1SYMA 1DF0B 3OHMB 5HYDA 1EG3A 1B1GA 2TN4A 4L9MA 1RROA 1KQMC 1PVBA 1QLSA 3RM1A 1MF8B 1NWDA 3BUMB 2WORA 1M63B 4GNKB 3KO0A 2EGDA 1L2OC 1YUSA 3D0YA 1OZSA 3ZNIA 3I5FB 2G9BA 2Y4QA 2L2EA 2ZN8A 3NSOA 2LE9B 3LK0A 1UHNA 1K8UA 1R2UA 1TRFA 2L51A 3OX5A 3JVTC 1SCMB 1RECA 2ZRSA 1EJ3A 5K89A 2E6WA 1PSRA 2CBLA 1J7OA 3LCPC 4JPZB 1N0YA 1J55A 1BF5A 1A75A 4YI9A 1JF0A 4YGBB 1XFXO 2JZIA 2LVVA 1KK8C 2NCPA 1KFUL 1CFDA 2K8MB 1JF2A 1PRWA 1Y6WA 1R6PA 2ZRTA 4PHKA 1LA0A 1MWNA 4M2QA 5KU1A 1MQ1A 2KYCA 2F8PA 3IQOA 1JFJA 5AXIA 1SBJA 2MLFC 3WHTB 1B4CA 1B7TY 5HLVA 2EHBA 2QPTA 1QXPA 1IQ5A 2JC2A 3AAJA 2M7LA 2ZKMX 2BCAA 1UHHA 1QVIY 1YRUB 2BL0B 2LAPA 3OX6A 5DKRA 1BOCA 1W7JB 2KBIA 3F45A 1OZOA 1WLZA 1Y0VH 2CT9A 4I5KA 3TDUA 2WNDA 1ZMZA 1NX2A 3BYAA 1GGZA 1S6IA 3CZTX 2OPOA 1VRKA 1KFUS 3O4YA 4PE0A 4M2OA 2MHHA 4ZCUA 3M0WA 2NCOA 3LK1A 3TDIA 1K2HA 1OMRA 4R1EA 1H8BA 1F54A 3KEVA 2SCPA 3OB2B 2RGIA 4YGCB 2OS8C 3H4SE 1DJGA 2LVIA 4N1GA 3VGOA 3PN7C 2KHNA 1KCYA 1NX3A 1KK7Z 1NCZA 2LM5A 1OMDA 3JTDC 1QX5B 2WC8A 4C0LA 1IJ5A 1CDLA 1XFWO 1KFXL 1PK0D 2WCBA 2OS8B 1ODBA 5AANA 4FQOA 1SMGA 2KGBC 4C0JA 2I94A 1BODA 4MZJA 3HX4A 2ZN9A 1GGWA 1CB1A 1TNXA 3I5HB 2KQYA 4DRWA 3EK8A 3SIBA 1KQMB 3FS7A 2KDHA 4P2YB 4YI8A 4WRIA 2CNPA 2KFFA 4CFRA 1OE9B 3TUYB 1GJYA 3FWCA 1JC2A 1LINA 2L98A 5HLOA 1UURA 1Q80A 2L50A 4PDZA 2BL0C 1LXFC 2JNFA 1NX1A 3GK4X 3TZ1A 3DF0B 1TN4A 1YX7A 1N2DA 2M1UA 1SY9A 2LHIA 1PSBA 3VRPA 5AFPA 1BT6A 3I5GB 4I5NB 2Y1MA 1YR5A 1SCMC 4PE7A 1RTP1 1K96A 1V1GA 1RFJA 2AAOA 1OOJA 1TOPA 1IWQA 2JQ6A 1CDPA 5TNCA 2Q91A 2KOTA 2NLNA 3BUNB 4GGFC 3AKBA 5HKZA 3TDZA 1CLMA 2I18A 4WQ2A 4M2PA 1WRLA 2E30A 3TUYC 3CTNA 1N65A 3CGAA 3OB1B 1KSMA 4ORBB 1QJTA 1DJZA 5KTYA 1IGVA 1CFFA 1SK6D 2AMIA 2FCEA 2KAYA 3BUOB 1H4BA 1B7TZ 5KSZA 1F55A 2K7OA 1S5GZ 2JWWA 3NSKA 1BMOA 3FIAA 4GGNA 2F2OA 2JULA 1S6CA 1S6JA 3DVEA 5I2QA 3CLNA 1QX7A 2F3YA 2KAXA
chains in the Genus database with same CATH superfamily
1CM1A 3D73A 1TCOB 2BKIB 1IG5A 1DEKA 1MXLC 1YURA 3PATA 2KI6D 1AJ5A 1WDCC 3FWBA 2LMUA 4JWQA 3BUWB 1MUXA 4MSPA 1WDCB 5PALA 4ORAB 4YBHB 2BCXA 3WXAA 1TWOA 1RK9A 2JRFA 3UNWA 3SIAA 1NCXA 4INWA 5EL2A 2PRUA 3CS1A 1GQMA 4I5JA 2GTEA 1J7RA 4NDCA 4QJ3B 3SJSA 1DC1A 1B9AA 2LC5A 3IVTA 3WNXB 3DD4A 5DKQA 2KNEA 4CPVA 4PALA 3DXLA 3I5IB 1YUTA 1YTZC 1SSEB 3B6XA 1ZFSA 3D78A 4MLWA 4MZLA 4YGDB 1YUUA 1K9UA 1G33A 4I5LB 1AHRA 2FJYA 1A4PA 1QS7A 3K21A 1CLLA 2JXLA 3D77A 3R1VA 3EVUA 3VROA 1NP8A 2B1UA 4PHNA 4PHJA 4FTGA 2L4HA 3EVRA 1AJ4A 1ZOTB 4OZDA 1CFPA 1KFXS 2QEHA 1X02A 4QJ4B 2LMVA 5D69A 2M49B 1ALWA 1W7IB 2MRDA 5F6TA 4DUQA 1XVJA 1SCVA 1BG1A 2KQ6A 2FOTA 1K9KA 4GBAA 1NIWA 4GAOA 3RLZA 1PALA 1TNWA 5I2OA 2WOSA 1EH2A 4NQGA 2EC6C 1XFZO 3PM8A 2HF5A 2M29A 1XK4C 1G8IA 2JT0A 1AVSA 3JVTB 1QLKA 1M45A 5JOLA 2PMYA 3FE8A 2KI4C 3K1EA 4F7FA 1NCYA 4YRUA 2BAPA 1OQPA 3HCMA 1J7QA 3AAKA 3I5FC 2YGUA 3DVMA 3MSEB 2K2FA 1M31A 3O78A 2NZ0A 2ZFDA 3I5GC 1LVCD 3BOWB 3EVVA 1OMVA 1QTXA 2KAVA 2KFGA 3SG6A 1IIOA 4GGFA 2FCDA 1UWOA 5GQQC 4ZCVA 1NUBA 1QIWA 3ICBA 4N1FA 2PVBA 2JTTA 1JUOA 4MEWA 1FI6A 2HQWA 4DCKA 1UUSA 1IKUA 1PVAA 1CNPA 3V2LA 3L47A 1FF1A 1FW4A 1DQEA 3TS5C 1KK7Y 2GGMA 3O4XA 4OV2A 1DJWA 1DJXA 1TIZA 2KBMA 1YRTB 1CMGA 2VRGA 2JT8A 1J7PA 2LUXA 4CLNA 1E8AA 1EG4A 2H8VA 1OOHA 3UO9A 4NDBA 3SG7A 5JJGA 2BECA 1Y1UA 4HRGA 5HKWA 1P28A 2KI6C 1JSAA 2G2BA 1SL7A 2BBNA 2LV7A 1CKKA 1FPWA 2KI4B 1CLBA 3B86A 3SG4A 4USLA 2WCFA 1F8HA 1GM0A 1DGVA 1NPQA 1U5IB 2CXJA 1SNLA 4YGAA 3NSLA 2HETA 1KQVA 5ER4X 4PE1A 2GGZA 1L2OB 2LP2A 2HPSA 1DTLA 1OSAA 2PASA 2Y5IA 2DOQA 1MR8A 1QV0A 2LLSA 3A8RA 3DZTA 3I5IC 4GUKA 3QMEA 2R2IA 3NSIA 2WC5A 2ZNDA 1B8CA 1SL8A 2JTZA 2KFHA 2M9GA 3BOWA 1UHJA 1A29A 1XFUO 1UHIA 1UHKA 3BXKA 1SKTA 3D74A 4MVFA 1NX0A 2F3ZA 1MXEA 2ZNEA 2L5XB 3BFHA 5FI2A 3SG2A 5BPJA 1SPYA 1D1OA 4ETOA 1RJVA 4JKTA 4NDDA 3S0DA 1K9PA 2WCLA 4ICBA 1TUZA 2BNXA 2LMTA 1K94A 2I7AA 1AK8A 2M3WA 2WC6A 3CZ2A 4WQ3A 2PSRA 2LUCA 4HREE 3CABA 1FI5A 1S26D 5G08A 1JFKA 1M39A 2QEVA 2Q4UA 2I2RE 4D1EA 1G4YR 2LVKA 1B47A 1OOFA 1SL9A 3FE6A 5AEQA 1XO5A 3NHIA 5J3XA 3KHEA 1QX2A 2WCKA 1DF0A 2BCBA 1JBAA 3DY9A 4PT1A 3WHUB 5HKYA 1CFCA 3AKAA 1IRJA 3EK4A 3PJIA 5I2LA 3CR4X 1K90D 1XK4A 1SR6B 1NSHA 2O5GA 2QEBA 3BUXB 1IH0A 3FE9A 1QATA 3GOFA 1JWDA 5FI6A 2WCJA 1WRKA 3JTDB 1Z2CB 2KSPA 2LLUA 2JOJA 2L4IA 4E68A 1C7WA 4A4CA 2LANA 5HL1A 2H61A 1NYAA 1HT9A 1YVHA 2JPTA 2LVJA 3DYEA 1M46A 3OBVA 3SS3A 4F0ZB 2K7CA 2M8UA 3LL8B 4CFQA 1BLQA 1BU3A 2CTNA 4HRHA 3DVKA 1YX8A 1XFYO 3D0YB 1B8LA 3KF9A 1AP4A 2K7DA 3NXAA 4MRYA 3D76A 3TS5B 2JT3A 2OTGB 4OKHA 1FBVA 1F4QA 1EL4A 2JPOA 1W9ZA 2MJWB 1DJYA 1A03A 1C3YA 1IQ3A 1BR1B 4P5OE 4XJKA 5CPVA 1S36A 1IJ6A 1XA5A 1A2XA 4IL1A 1F70A 1AUIB 2AUCA 4JD9A 2WCEA 2LLTA 4GPLB 4PCWA 1QASA 2IS9A 4AQIA 2P6BB 4JQ0D 3VRQA 1XFVO 4A4BA 2MBXA 3LLEA 4BY5A 1RWYA 1EXRA 1QIVA 4Q04A 3KPXA 4N5XA 4DIRA 2SASA 2MLEC 3RZSA 3D75A 5B8IB 3PFVA 1CDNA 3IF7A 4OCIA 4ORCB 1KWOC 3S0EA 3C1VA 4MN0A 2A4JA 1SRAA 1ALVA 2O60A 3L4AA 5D7FA 1LKJA 2MAZA 1DMOA 1QVIZ 1S1EA 3PALA 1L7ZA 3PN7B 3EKJA 3CWGA 2OTGC 4BY4A 4C0KA 2JU0A 2FJUB 2PYQA 1SW8A 3PLFB 2LCPA 2LHLA 1TNPA 1K93D 5FYXA 1DVIA 4MZKA 2KYFA 2KGRA 3SG3A 5I8NA 1U5IA 4CIDA 2LNKA 3CR2A 1K95A 2K7BA 1TCFA 4KYNA 4UPGA 5IBWA 3SS4A 1J1EA 3E3RA 1V1FA 4PE4A 1KWOB 2BE4A 3EKHA 1DJIA 3D10A 3DF0A 3QRXA 2COLB 4U8DA 2D8NA 2LP3A 5CSFA 1C07A 1F71A 3S0GA 1XYDA 2V53A 2M1KB 4XJKB 2EC6B 1SR6C 1DGUA 2QACA 4XYNA 5I94A 1MHOA 3CYZA 2L5YA 1XFRA 3VRNA 1BJFA 1YVLA 4AQJA 1WLMA 4OR9B 2CCMA 1BR4B 4OVNF 1DT7B 4GFTA 4PHMA 1S5GY 2MA2A 3IQQA 4INXA 1KSOA 1A75B 1KK8B 2BKHB 2BE6A 1TTXA 2ERBA 1S3PA 1PULA 3OP0A 1DJHA 5CSJA 2M7NA 3L4LA 1HQVA 2GV5A 3BQ3A 3I5HC 5DKNA 3PSRA 1CMFA 5ER5A 1Y1AA 1Y1XA 4MBEA 4YGEB 3ZWHA 2NXQA 5FI7A 3VRRA 2KLDA 5CSIA 3DVJA 1LA3A 1CDMA 3B88A 3EK7A 1TNQA 2K0JA 2Y1NA 3CR5X 2PALA 3GK1A 4TNCA 2JNXA 1ZACA 1F4OA 2BBMA 2K2AA 2K61A 1J1DA 2M0RA 3GK2A 4FQTA 1T14A 4AOMA 3O6BA 2ISDA 4MRXA 2H61C 1CM4A 4QJ5B 4IJ7A 2M97A 4HSZA 1WRZA 5CSNA 5DICA 2HQ8A 3SG5A 1ZUZA 2H2KA 3O2PA 1B8RA 2JXCA 2F2PA 2L0PA 2WCHA 1UP5A 3BJHA 1CTRA 2F33A 3A4UB 1QV1A 1WY9A 5AERA 1SYMA 1DF0B 3OHMB 5HYDA 1EG3A 1B1GA 2TN4A 4L9MA 1RROA 3R72A 5D3OA 1KQMC 1PVBA 1QLSA 3RM1A 1MF8B 1NWDA 3BUMB 2WORA 3NGVA 1M63B 3B7AA 4GNKB 3KO0A 2EGDA 1L2OC 1YUSA 3D0YA 4DS7A 1OZSA 2K60A 3ZNIA 3I5FB 2G9BA 2QEOA 2Y4QA 2KPHA 2L2EA 2ZN8A 3NSOA 2LE9B 3LK0A 1UHNA 1K8UA 1R2UA 1TRFA 2L51A 3CZ1A 3OX5A 3JVTC 1SCMB 1RECA 2ZRSA 1EJ3A 3VB1A 5K89A 2E6WA 1PSRA 2CBLA 1C7VA 1J7OA 3LCPC 4JPZB 1N0YA 1J55A 1BF5A 1A75A 4YI9A 1JF0A 3CDNA 4YGBB 1XFXO 2JZIA 2LVVA 1KK8C 2NCPA 1KFUL 1ORGA 1CFDA 1LS8A 2K8MB 1JF2A 1PRWA 1Y6WA 1R6PA 2ZRTA 4PHKA 1LA0A 1MWNA 4M2QA 5KU1A 1MQ1A 2KYCA 2F8PA 3IQOA 1JFJA 5AXIA 1SBJA 2MLFC 3WHTB 1B4CA 3B87A 1B7TY 2PQLA 5HLVA 2EHBA 2QPTA 1QXPA 1IQ5A 2JC2A 3AAJA 2M7LA 2ZKMX 2BCAA 1UHHA 1QVIY 1YRUB 2BL0B 2LAPA 3OX6A 5DKRA 3S0BA 1BOCA 1W7JB 2KBIA 1TUJA 3F45A 1OZOA 1WLZA 1Y0VH 2CT9A 4I5KA 3TDUA 2WNDA 1ZMZA 1NX2A 3BYAA 1GGZA 1S6IA 3CZTX 2OPOA 1VRKA 1KFUS 3O4YA 4PE0A 4M2OA 3Q8IA 2MHHA 4ZCUA 3M0WA 2NCOA 3LK1A 3TDIA 1K2HA 1OMRA 1OOIX 3N7HA 4R1EA 1H8BA 1F54A 3KEVA 2QDIA 2SCPA 3OB2B 2RGIA 3PM2A 4YGCB 2OS8C 1C3ZA 1QWVA 3H4SE 1DJGA 2LVIA 3SS5A 4N1GA 3VGOA 3PN7C 2KHNA 1KCYA 1NX3A 1KK7Z 2KLEA 1NCZA 2LM5A 1OMDA 2P71A 3JTDC 1QX5B 2WC8A 4C0LA 1IJ5A 1CDLA 1XFWO 1KFXL 1PK0D 2WCBA 2OS8B 3NHTA 1ODBA 5AANA 4FQOA 1SMGA 2KGBC 4C0JA 2I94A 1BODA 4MZJA 3HX4A 2ZN9A 1GGWA 1CB1A 3BFBA 1TNXA 3I5HB 2KQYA 4DRWA 3EK8A 3SIBA 1KQMB 3FS7A 2KDHA 4P2YB 2L2CA 4YI8A 1Z4HA 4WRIA 2CNPA 2KFFA 4CFRA 1OE9B 2P70A 3TUYB 1GJYA 3FWCA 1JC2A 1LINA 2L98A 5HLOA 1UURA 1Q80A 1OW4A 2L50A 4PDZA 2BL0C 2WCMA 1DELA 1LXFC 1NX1A 2JNFA 3GK4X 3TZ1A 3DF0B 1OOGA 1TN4A 1YX7A 1N2DA 2M1UA 1SY9A 2LHIA 1PSBA 3VRPA 5AFPA 1BT6A 3I5GB 4I5NB 2Y1MA 1YR5A 1SCMC 4PE7A 1RTP1 1K96A 1V1GA 1RFJA 2AAOA 1OOJA 1TOPA 1IWQA 3EG5B 3S0FA 2JQ6A 1CDPA 5TNCA 2Q91A 2KOTA 2NLNA 3BUNB 4GGFC 3CZ0A 3AKBA 5HKZA 3TDZA 1CLMA 3R1OA 2I18A 4WQ2A 4M2PA 1WRLA 2E30A 3TUYC 3CTNA 1N65A 3CGAA 3OB1B 1KSMA 4ORBB 1QJTA 1DJZA 5KTYA 1IGVA 1CFFA 1SK6D 2AMIA 2FCEA 3BFAA 2KAYA 3BUOB 1H4BA 1B7TZ 5KSZA 1F55A 3R1PA 2K7OA 1S5GZ 2JWWA 3S0AA 3NSKA 1BMOA 3OGNA 3FIAA 4GGNA 2F2OA 2JULA 1S6CA 1S6JA 3DVEA 5I2QA 3CLNA 1QX7A 2F3YA 2KAXA
chains in the Genus database with same CATH topology
1CM1A 1TCOB 2BKIB 1IG5A 1MXLC 3PATA 1YURA 2KI6D 1AJ5A 1WDCC 3FWBA 2LMUA 4JWQA 3BUWB 1MUXA 4MSPA 1WDCB 5PALA 4ORAB 4YBHB 2BCXA 3WXAA 1RK9A 2JRFA 3SIAA 1NCXA 2PRUA 3CS1A 1GQMA 4I5JA 1J7RA 4NDCA 4QJ3B 3SJSA 1B9AA 2LC5A 3WNXB 3DD4A 5DKQA 2KNEA 4CPVA 4PALA 3I5IB 1YUTA 1YTZC 1ZFSA 4MLWA 4MZLA 4YGDB 1YUUA 1K9UA 1G33A 4I5LB 1AHRA 1A4PA 1QS7A 3K21A 1CLLA 2JXLA 3VROA 3EVUA 1NP8A 2B1UA 4PHNA 4PHJA 4FTGA 2L4HA 3EVRA 1AJ4A 1ZOTB 1CFPA 1KFXS 4QJ4B 1X02A 2LMVA 5D69A 2M49B 1ALWA 1W7IB 2MRDA 5F6TA 4DUQA 1XVJA 1SCVA 1BG1A 2KQ6A 2FOTA 1K9KA 4GBAA 1NIWA 4GAOA 3RLZA 1PALA 1TNWA 5I2OA 2WOSA 1EH2A 4NQGA 2EC6C 1XFZO 3PM8A 2HF5A 2M29A 1XK4C 1G8IA 2JT0A 1AVSA 3JVTB 1QLKA 1M45A 5JOLA 2PMYA 2KI4C 1NCYA 4YRUA 1OQPA 3HCMA 1J7QA 3AAKA 3I5FC 3DVMA 3MSEB 2K2FA 1M31A 3O78A 2NZ0A 2ZFDA 3I5GC 1LVCD 3BOWB 3EVVA 1OMVA 1QTXA 2KAVA 2KFGA 3SG6A 4GGFA 2FCDA 1UWOA 5GQQC 4ZCVA 1NUBA 1QIWA 3ICBA 4N1FA 2PVBA 2JTTA 1JUOA 4MEWA 1FI6A 2HQWA 4DCKA 1UUSA 1IKUA 1PVAA 1CNPA 1FF1A 1FW4A 3TS5C 1KK7Y 2GGMA 4OV2A 1DJWA 1DJXA 1TIZA 2KBMA 1YRTB 1CMGA 2VRGA 2JT8A 1J7PA 2LUXA 4CLNA 1E8AA 1EG4A 4NDBA 3SG7A 5JJGA 2BECA 1Y1UA 4HRGA 5HKWA 1JSAA 2KI6C 2G2BA 1SL7A 2BBNA 2LV7A 1CKKA 1FPWA 2KI4B 1CLBA 3SG4A 4USLA 2WCFA 1F8HA 1DGVA 1NPQA 1U5IB 2CXJA 1SNLA 4YGAA 3NSLA 2HETA 1KQVA 5ER4X 4PE1A 2GGZA 1L2OB 2LP2A 2HPSA 1DTLA 1OSAA 2PASA 2Y5IA 2DOQA 1MR8A 1QV0A 2LLSA 3A8RA 3I5IC 4GUKA 1C7VA 2R2IA 3NSIA 2ZNDA 1B8CA 1SL8A 2JTZA 2KFHA 2M9GA 3BOWA 1UHJA 1A29A 1XFUO 1UHIA 1UHKA 3BXKA 1SKTA 4MVFA 1NX0A 2F3ZA 1MXEA 2ZNEA 2L5XB 3SG2A 5BPJA 1SPYA 1D1OA 4ETOA 1RJVA 4NDDA 1K9PA 4ICBA 2LMTA 1K94A 2I7AA 1AK8A 2M3WA 4WQ3A 2PSRA 2LUCA 4HREE 1FI5A 1S26D 5G08A 1JFKA 1M39A 2Q4UA 2I2RE 4D1EA 1G4YR 2LVKA 1B47A 1SL9A 5AEQA 1XO5A 5J3XA 3KHEA 1QX2A 1DF0A 2BCBA 1JBAA 3WHUB 5HKYA 1CFCA 3AKAA 1IRJA 3EK4A 5I2LA 3CR4X 1K90D 1XK4A 1SR6B 1NSHA 2O5GA 3BUXB 1IH0A 1QATA 3GOFA 1JWDA 1WRKA 3JTDB 2KSPA 2LLUA 2JOJA 2L4IA 4E68A 1C7WA 4A4CA 2LANA 2H61A 1NYAA 1HT9A 1YVHA 2JPTA 2LVJA 1M46A 4F0ZB 2K7CA 2M8UA 3LL8B 4CFQA 1BLQA 1BU3A 2CTNA 4HRHA 3DVKA 1YX8A 1XFYO 3D0YB 1B8LA 3KF9A 1AP4A 2K7DA 3NXAA 4MRYA 3TS5B 2JT3A 2OTGB 4OKHA 1FBVA 1F4QA 1EL4A 2MJWB 1DJYA 1A03A 1IQ3A 1BR1B 4P5OE 4XJKA 5CPVA 1S36A 1IJ6A 1XA5A 1A2XA 4IL1A 1F70A 1AUIB 2AUCA 2WCEA 2LLTA 4GPLB 4PCWA 1QASA 2IS9A 4AQIA 2P6BB 4JQ0D 3VRQA 1XFVO 4A4BA 2MBXA 3LLEA 4BY5A 1RWYA 1EXRA 1QIVA 4Q04A 3KPXA 4N5XA 4DIRA 2SASA 2MLEC 1CDNA 5B8IB 3PFVA 3IF7A 4OCIA 4ORCB 1KWOC 4QJ5B 3C1VA 4MN0A 2A4JA 1SRAA 1ALVA 2O60A 5D7FA 1LKJA 2MAZA 1DMOA 1QVIZ 1S1EA 3PALA 1L7ZA 3PN7B 3EKJA 3CWGA 2OTGC 4BY4A 4C0KA 2JU0A 2FJUB 1SW8A 3PLFB 2LCPA 2LHLA 1TNPA 1K93D 5FYXA 1DVIA 4MZKA 2KYFA 2KGRA 3SG3A 5I8NA 1U5IA 4CIDA 2LNKA 3CR2A 1K95A 2K7BA 1TCFA 4UPGA 5IBWA 1J1EA 3E3RA 1V1FA 4PE4A 1KWOB 2BE4A 3EKHA 1DJIA 3D10A 3DF0A 3QRXA 2COLB 4U8DA 2D8NA 2LP3A 5CSFA 1C07A 1F71A 1XYDA 2V53A 2M1KB 4XJKB 2EC6B 1SR6C 1DGUA 2QACA 4XYNA 1MHOA 3VRNA 1BJFA 1YVLA 4AQJA 1WLMA 4OR9B 2CCMA 1BR4B 4OVNF 1DT7B 4GFTA 4PHMA 1S5GY 2MA2A 3IQQA 1KSOA 1A75B 1KK8B 2BKHB 2BE6A 1TTXA 1S3PA 1PULA 3OP0A 1DJHA 5CSJA 2M7NA 1HQVA 2GV5A 3BQ3A 3I5HC 5DKNA 3PSRA 1CMFA 5ER5A 1Y1AA 1Y1XA 4MBEA 4YGEB 3ZWHA 2NXQA 3VRRA 5CSIA 3DVJA 1LA3A 1CDMA 3EK7A 3GK1A 1TNQA 2K0JA 2Y1NA 3CR5X 2PALA 4TNCA 4DS7A 2JNXA 1ZACA 1F4OA 2BBMA 2K2AA 2K61A 1J1DA 2M0RA 3GK2A 4AOMA 3O6BA 2ISDA 4MRXA 2H61C 1CM4A 2M97A 4HSZA 1WRZA 5CSNA 3SG5A 2HQ8A 1ZUZA 2H2KA 3O2PA 1B8RA 2JXCA 2F2PA 2L0PA 1UP5A 1CTRA 2F33A 3A4UB 1QV1A 1WY9A 5AERA 1SYMA 1DF0B 3OHMB 5HYDA 1EG3A 1B1GA 2TN4A 4L9MA 1RROA 1KQMC 1PVBA 1QLSA 3RM1A 1MF8B 1NWDA 3BUMB 2WORA 1M63B 4GNKB 3KO0A 2EGDA 1L2OC 1YUSA 3D0YA 1OZSA 3ZNIA 3I5FB 2G9BA 2Y4QA 2L2EA 2ZN8A 3NSOA 2LE9B 3LK0A 1UHNA 1K8UA 1R2UA 1TRFA 2L51A 3OX5A 3JVTC 1SCMB 1RECA 2ZRSA 1EJ3A 5K89A 2E6WA 1PSRA 2CBLA 1J7OA 3LCPC 4JPZB 1N0YA 1J55A 1BF5A 1A75A 4YI9A 1JF0A 4YGBB 1XFXO 2JZIA 2LVVA 1KK8C 2NCPA 1KFUL 1CFDA 2K8MB 1JF2A 1PRWA 1Y6WA 1R6PA 2ZRTA 4PHKA 1LA0A 1MWNA 4M2QA 5KU1A 1MQ1A 2KYCA 2F8PA 3IQOA 1JFJA 5AXIA 1SBJA 2MLFC 3WHTB 1B4CA 1B7TY 5HLVA 2EHBA 2QPTA 1QXPA 1IQ5A 2JC2A 3AAJA 2M7LA 2ZKMX 2BCAA 1UHHA 1QVIY 1YRUB 2BL0B 2LAPA 3OX6A 5DKRA 1BOCA 1W7JB 2KBIA 3F45A 1OZOA 1WLZA 1Y0VH 2CT9A 4I5KA 3TDUA 2WNDA 1ZMZA 1NX2A 3BYAA 1GGZA 1S6IA 3CZTX 2OPOA 1VRKA 1KFUS 3O4YA 4PE0A 4M2OA 2MHHA 4ZCUA 3M0WA 2NCOA 3LK1A 3TDIA 1K2HA 1OMRA 4R1EA 1H8BA 1F54A 3KEVA 2SCPA 3OB2B 2RGIA 4YGCB 2OS8C 3H4SE 1DJGA 2LVIA 4N1GA 3VGOA 3PN7C 2KHNA 1KCYA 1NX3A 1KK7Z 1NCZA 2LM5A 1OMDA 3JTDC 1QX5B 2WC8A 4C0LA 1IJ5A 1CDLA 1XFWO 1KFXL 1PK0D 2WCBA 2OS8B 1ODBA 5AANA 4FQOA 1SMGA 2KGBC 4C0JA 2I94A 1BODA 4MZJA 3HX4A 2ZN9A 1GGWA 1CB1A 1TNXA 3I5HB 2KQYA 4DRWA 3EK8A 3SIBA 1KQMB 3FS7A 2KDHA 4P2YB 4YI8A 4WRIA 2CNPA 2KFFA 4CFRA 1OE9B 3TUYB 1GJYA 3FWCA 1JC2A 1LINA 2L98A 5HLOA 1UURA 1Q80A 2L50A 4PDZA 2BL0C 1LXFC 2JNFA 1NX1A 3GK4X 3TZ1A 3DF0B 1TN4A 1YX7A 1N2DA 2M1UA 1SY9A 2LHIA 1PSBA 3VRPA 5AFPA 1BT6A 3I5GB 4I5NB 2Y1MA 1YR5A 1SCMC 4PE7A 1RTP1 1K96A 1V1GA 1RFJA 2AAOA 1OOJA 1TOPA 1IWQA 2JQ6A 1CDPA 5TNCA 2Q91A 2KOTA 2NLNA 3BUNB 4GGFC 3AKBA 5HKZA 3TDZA 1CLMA 2I18A 4WQ2A 4M2PA 1WRLA 2E30A 3TUYC 3CTNA 1N65A 3CGAA 3OB1B 1KSMA 4ORBB 1QJTA 1DJZA 5KTYA 1IGVA 1CFFA 1SK6D 2AMIA 2FCEA 2KAYA 3BUOB 1H4BA 1B7TZ 5KSZA 1F55A 2K7OA 1S5GZ 2JWWA 3NSKA 1BMOA 3FIAA 4GGNA 2F2OA 2JULA 1S6CA 1S6JA 3DVEA 5I2QA 3CLNA 1QX7A 2F3YA 2KAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM1 A;  1TCO B;  2BKI B;  1IG5 A;  1MXL C;  3PAT A;  1YUR A;  2KI6 D;  1AJ5 A;  1WDC C;  3FWB A;  2LMU A;  4JWQ A;  3BUW B;  1MUX A;  4MSP A;  1WDC B;  5PAL A;  4ORA B;  4YBH B;  2BCX A;  3WXA A;  1RK9 A;  2JRF A;  3SIA A;  1NCX A;  2PRU A;  3CS1 A;  1GQM A;  4I5J A;  1J7R A;  4NDC A;  4QJ3 B;  3SJS A;  1B9A A;  2LC5 A;  3WNX B;  3DD4 A;  5DKQ A;  2KNE A;  4CPV A;  4PAL A;  3I5I B;  1YUT A;  1YTZ C;  1ZFS A;  4MLW A;  4MZL A;  4YGD B;  1YUU A;  1K9U A;  1G33 A;  4I5L B;  1AHR A;  1A4P A;  1QS7 A;  3K21 A;  1CLL A;  2JXL A;  3VRO A;  3EVU A;  1NP8 A;  2B1U A;  4PHN A;  4PHJ A;  4FTG A;  2L4H A;  3EVR A;  1AJ4 A;  1ZOT B;  1CFP A;  1KFX S;  4QJ4 B;  1X02 A;  2LMV A;  5D69 A;  2M49 B;  1ALW A;  1W7I B;  2MRD A;  5F6T A;  4DUQ A;  1XVJ A;  1SCV A;  1BG1 A;  2KQ6 A;  2FOT A;  1K9K A;  4GBA A;  1NIW A;  4GAO A;  3RLZ A;  1PAL A;  1TNW A;  5I2O A;  2WOS A;  1EH2 A;  4NQG A;  2EC6 C;  1XFZ O;  3PM8 A;  2HF5 A;  2M29 A;  1XK4 C;  1G8I A;  2JT0 A;  1AVS A;  3JVT B;  1QLK A;  1M45 A;  5JOL A;  2PMY A;  2KI4 C;  1NCY A;  4YRU A;  1OQP A;  3HCM A;  1J7Q A;  3AAK A;  3I5F C;  3DVM A;  3MSE B;  2K2F A;  1M31 A;  3O78 A;  2NZ0 A;  2ZFD A;  3I5G C;  1LVC D;  3BOW B;  3EVV A;  1OMV A;  1QTX A;  2KAV A;  2KFG A;  3SG6 A;  4GGF A;  2FCD A;  1UWO A;  5GQQ C;  4ZCV A;  1NUB A;  1QIW A;  3ICB A;  4N1F A;  2PVB A;  2JTT A;  1JUO A;  4MEW A;  1FI6 A;  2HQW A;  4DCK A;  1UUS A;  1IKU A;  1PVA A;  1CNP A;  1FF1 A;  1FW4 A;  3TS5 C;  1KK7 Y;  2GGM A;  4OV2 A;  1DJW A;  1DJX A;  1TIZ A;  2KBM A;  1YRT B;  1CMG A;  2VRG A;  2JT8 A;  1J7P A;  2LUX A;  4CLN A;  1E8A A;  1EG4 A;  4NDB A;  3SG7 A;  5JJG A;  2BEC A;  1Y1U A;  4HRG A;  5HKW A;  1JSA A;  2KI6 C;  2G2B A;  1SL7 A;  2BBN A;  2LV7 A;  1CKK A;  1FPW A;  2KI4 B;  1CLB A;  3SG4 A;  4USL A;  2WCF A;  1F8H A;  1DGV A;  1NPQ A;  1U5I B;  2CXJ A;  1SNL A;  4YGA A;  3NSL A;  2HET A;  1KQV A;  5ER4 X;  4PE1 A;  2GGZ A;  1L2O B;  2LP2 A;  2HPS A;  1DTL A;  1OSA A;  2PAS A;  2Y5I A;  2DOQ A;  1MR8 A;  1QV0 A;  2LLS A;  3A8R A;  3I5I C;  4GUK A;  1C7V A;  2R2I A;  3NSI A;  2ZND A;  1B8C A;  1SL8 A;  2JTZ A;  2KFH A;  2M9G A;  3BOW A;  1UHJ A;  1A29 A;  1XFU O;  1UHI A;  1UHK A;  3BXK A;  1SKT A;  4MVF A;  1NX0 A;  2F3Z A;  1MXE A;  2ZNE A;  2L5X B;  3SG2 A;  5BPJ A;  1SPY A;  1D1O A;  4ETO A;  1RJV A;  4NDD A;  1K9P A;  4ICB A;  2LMT A;  1K94 A;  2I7A A;  1AK8 A;  2M3W A;  4WQ3 A;  2PSR A;  2LUC A;  4HRE E;  1FI5 A;  1S26 D;  5G08 A;  1JFK A;  1M39 A;  2Q4U A;  2I2R E;  4D1E A;  1G4Y R;  2LVK A;  1B47 A;  1SL9 A;  5AEQ A;  1XO5 A;  5J3X A;  3KHE A;  1QX2 A;  1DF0 A;  2BCB A;  1JBA A;  3WHU B;  5HKY A;  1CFC A;  3AKA A;  1IRJ A;  3EK4 A;  5I2L A;  3CR4 X;  1K90 D;  1XK4 A;  1SR6 B;  1NSH A;  2O5G A;  3BUX B;  1IH0 A;  1QAT A;  3GOF A;  1JWD A;  1WRK A;  3JTD B;  2KSP A;  2LLU A;  2JOJ A;  2L4I A;  4E68 A;  1C7W A;  4A4C A;  2LAN A;  2H61 A;  1NYA A;  1HT9 A;  1YVH A;  2JPT A;  2LVJ A;  1M46 A;  4F0Z B;  2K7C A;  2M8U A;  3LL8 B;  4CFQ A;  1BLQ A;  1BU3 A;  2CTN A;  4HRH A;  3DVK A;  1YX8 A;  1XFY O;  3D0Y B;  1B8L A;  3KF9 A;  1AP4 A;  2K7D A;  3NXA A;  4MRY A;  3TS5 B;  2JT3 A;  2OTG B;  4OKH A;  1FBV A;  1F4Q A;  1EL4 A;  2MJW B;  1DJY A;  1A03 A;  1IQ3 A;  1BR1 B;  4P5O E;  4XJK A;  5CPV A;  1S36 A;  1IJ6 A;  1XA5 A;  1A2X A;  4IL1 A;  1F70 A;  1AUI B;  2AUC A;  2WCE A;  2LLT A;  4GPL B;  4PCW A;  1QAS A;  2IS9 A;  4AQI A;  2P6B B;  4JQ0 D;  3VRQ A;  1XFV O;  4A4B A;  2MBX A;  3LLE A;  4BY5 A;  1RWY A;  1EXR A;  1QIV A;  4Q04 A;  3KPX A;  4N5X A;  4DIR A;  2SAS A;  2MLE C;  1CDN A;  5B8I B;  3PFV A;  3IF7 A;  4OCI A;  4ORC B;  1KWO C;  4QJ5 B;  3C1V A;  4MN0 A;  2A4J A;  1SRA A;  1ALV A;  2O60 A;  5D7F A;  1LKJ A;  2MAZ A;  1DMO A;  1QVI Z;  1S1E A;  3PAL A;  1L7Z A;  3PN7 B;  3EKJ A;  3CWG A;  2OTG C;  4BY4 A;  4C0K A;  2JU0 A;  2FJU B;  1SW8 A;  3PLF B;  2LCP A;  2LHL A;  1TNP A;  1K93 D;  5FYX A;  1DVI A;  4MZK A;  2KYF A;  2KGR A;  3SG3 A;  5I8N A;  1U5I A;  4CID A;  2LNK A;  3CR2 A;  1K95 A;  2K7B A;  1TCF A;  4UPG A;  5IBW A;  1J1E A;  3E3R A;  1V1F A;  4PE4 A;  1KWO B;  2BE4 A;  3EKH A;  1DJI A;  3D10 A;  3DF0 A;  3QRX A;  2COL B;  4U8D A;  2D8N A;  2LP3 A;  5CSF A;  1C07 A;  1F71 A;  1XYD A;  2V53 A;  2M1K B;  4XJK B;  2EC6 B;  1SR6 C;  1DGU A;  2QAC A;  4XYN A;  1MHO A;  3VRN A;  1BJF A;  1YVL A;  4AQJ A;  1WLM A;  4OR9 B;  2CCM A;  1BR4 B;  4OVN F;  1DT7 B;  4GFT A;  4PHM A;  1S5G Y;  2MA2 A;  3IQQ A;  1KSO A;  1A75 B;  1KK8 B;  2BKH B;  2BE6 A;  1TTX A;  1S3P A;  1PUL A;  3OP0 A;  1DJH A;  5CSJ A;  2M7N A;  1HQV A;  2GV5 A;  3BQ3 A;  3I5H C;  5DKN A;  3PSR A;  1CMF A;  5ER5 A;  1Y1A A;  1Y1X A;  4MBE A;  4YGE B;  3ZWH A;  2NXQ A;  3VRR A;  5CSI A;  3DVJ A;  1LA3 A;  1CDM A;  3EK7 A;  3GK1 A;  1TNQ A;  2K0J A;  2Y1N A;  3CR5 X;  2PAL A;  4TNC A;  4DS7 A;  2JNX A;  1ZAC A;  1F4O A;  2BBM A;  2K2A A;  2K61 A;  1J1D A;  2M0R A;  3GK2 A;  4AOM A;  3O6B A;  2ISD A;  4MRX A;  2H61 C;  1CM4 A;  2M97 A;  4HSZ A;  1WRZ A;  5CSN A;  3SG5 A;  2HQ8 A;  1ZUZ A;  2H2K A;  3O2P A;  1B8R A;  2JXC A;  2F2P A;  2L0P A;  1UP5 A;  1CTR A;  2F33 A;  3A4U B;  1QV1 A;  1WY9 A;  5AER A;  1SYM A;  1DF0 B;  3OHM B;  5HYD A;  1EG3 A;  1B1G A;  2TN4 A;  4L9M A;  1RRO A;  1KQM C;  1PVB A;  1QLS A;  3RM1 A;  1MF8 B;  1NWD A;  3BUM B;  2WOR A;  1M63 B;  4GNK B;  3KO0 A;  2EGD A;  1L2O C;  1YUS A;  3D0Y A;  1OZS A;  3ZNI A;  3I5F B;  2G9B A;  2Y4Q A;  2L2E A;  2ZN8 A;  3NSO A;  2LE9 B;  3LK0 A;  1UHN A;  1K8U A;  1R2U A;  1TRF A;  2L51 A;  3OX5 A;  3JVT C;  1SCM B;  1REC A;  2ZRS A;  1EJ3 A;  5K89 A;  2E6W A;  1PSR A;  2CBL A;  1J7O A;  3LCP C;  4JPZ B;  1N0Y A;  1J55 A;  1BF5 A;  1A75 A;  4YI9 A;  1JF0 A;  4YGB B;  1XFX O;  2JZI A;  2LVV A;  1KK8 C;  2NCP A;  1KFU L;  1CFD A;  2K8M B;  1JF2 A;  1PRW A;  1Y6W A;  1R6P A;  2ZRT A;  4PHK A;  1LA0 A;  1MWN A;  4M2Q A;  5KU1 A;  1MQ1 A;  2KYC A;  2F8P A;  3IQO A;  1JFJ A;  5AXI A;  1SBJ A;  2MLF C;  3WHT B;  1B4C A;  1B7T Y;  5HLV A;  2EHB A;  2QPT A;  1QXP A;  1IQ5 A;  2JC2 A;  3AAJ A;  2M7L A;  2ZKM X;  2BCA A;  1UHH A;  1QVI Y;  1YRU B;  2BL0 B;  2LAP A;  3OX6 A;  5DKR A;  1BOC A;  1W7J B;  2KBI A;  3F45 A;  1OZO A;  1WLZ A;  1Y0V H;  2CT9 A;  4I5K A;  3TDU A;  2WND A;  1ZMZ A;  1NX2 A;  3BYA A;  1GGZ A;  1S6I A;  3CZT X;  2OPO A;  1VRK A;  1KFU S;  3O4Y A;  4PE0 A;  4M2O A;  2MHH A;  4ZCU A;  3M0W A;  2NCO A;  3LK1 A;  3TDI A;  1K2H A;  1OMR A;  4R1E A;  1H8B A;  1F54 A;  3KEV A;  2SCP A;  3OB2 B;  2RGI A;  4YGC B;  2OS8 C;  3H4S E;  1DJG A;  2LVI A;  4N1G A;  3VGO A;  3PN7 C;  2KHN A;  1KCY A;  1NX3 A;  1KK7 Z;  1NCZ A;  2LM5 A;  1OMD A;  3JTD C;  1QX5 B;  2WC8 A;  4C0L A;  1IJ5 A;  1CDL A;  1XFW O;  1KFX L;  1PK0 D;  2WCB A;  2OS8 B;  1ODB A;  5AAN A;  4FQO A;  1SMG A;  2KGB C;  4C0J A;  2I94 A;  1BOD A;  4MZJ A;  3HX4 A;  2ZN9 A;  1GGW A;  1CB1 A;  1TNX A;  3I5H B;  2KQY A;  4DRW A;  3EK8 A;  3SIB A;  1KQM B;  3FS7 A;  2KDH A;  4P2Y B;  4YI8 A;  4WRI A;  2CNP A;  2KFF A;  4CFR A;  1OE9 B;  3TUY B;  1GJY A;  3FWC A;  1JC2 A;  1LIN A;  2L98 A;  5HLO A;  1UUR A;  1Q80 A;  2L50 A;  4PDZ A;  2BL0 C;  1LXF C;  2JNF A;  1NX1 A;  3GK4 X;  3TZ1 A;  3DF0 B;  1TN4 A;  1YX7 A;  1N2D A;  2M1U A;  1SY9 A;  2LHI A;  1PSB A;  3VRP A;  5AFP A;  1BT6 A;  3I5G B;  4I5N B;  2Y1M A;  1YR5 A;  1SCM C;  4PE7 A;  1RTP 1;  1K96 A;  1V1G A;  1RFJ A;  2AAO A;  1OOJ A;  1TOP A;  1IWQ A;  2JQ6 A;  1CDP A;  5TNC A;  2Q91 A;  2KOT A;  2NLN A;  3BUN B;  4GGF C;  3AKB A;  5HKZ A;  3TDZ A;  1CLM A;  2I18 A;  4WQ2 A;  4M2P A;  1WRL A;  2E30 A;  3TUY C;  3CTN A;  1N65 A;  3CGA A;  3OB1 B;  1KSM A;  4ORB B;  1QJT A;  1DJZ A;  5KTY A;  1IGV A;  1CFF A;  1SK6 D;  2AMI A;  2FCE A;  2KAY A;  3BUO B;  1H4B A;  1B7T Z;  5KSZ A;  1F55 A;  2K7O A;  1S5G Z;  2JWW A;  3NSK A;  1BMO A;  3FIA A;  4GGN A;  2F2O A;  2JUL A;  1S6C A;  1S6J A;  3DVE A;  5I2Q A;  3CLN A;  1QX7 A;  2F3Y A;  2KAX A; 
#chains in the Genus database with same CATH topology
 1CM1 A;  3D73 A;  1TCO B;  2BKI B;  1IG5 A;  1DEK A;  1MXL C;  1YUR A;  3PAT A;  2KI6 D;  1AJ5 A;  1WDC C;  3FWB A;  2LMU A;  4JWQ A;  3BUW B;  1MUX A;  4MSP A;  1WDC B;  5PAL A;  4ORA B;  4YBH B;  2BCX A;  3WXA A;  1TWO A;  1RK9 A;  2JRF A;  3UNW A;  3SIA A;  1NCX A;  4INW A;  5EL2 A;  2PRU A;  3CS1 A;  1GQM A;  4I5J A;  2GTE A;  1J7R A;  4NDC A;  4QJ3 B;  3SJS A;  1DC1 A;  1B9A A;  2LC5 A;  3IVT A;  3WNX B;  3DD4 A;  5DKQ A;  2KNE A;  4CPV A;  4PAL A;  3DXL A;  3I5I B;  1YUT A;  1YTZ C;  1SSE B;  3B6X A;  1ZFS A;  3D78 A;  4MLW A;  4MZL A;  4YGD B;  1YUU A;  1K9U A;  1G33 A;  4I5L B;  1AHR A;  2FJY A;  1A4P A;  1QS7 A;  3K21 A;  1CLL A;  2JXL A;  3D77 A;  3R1V A;  3EVU A;  3VRO A;  1NP8 A;  2B1U A;  4PHN A;  4PHJ A;  4FTG A;  2L4H A;  3EVR A;  1AJ4 A;  1ZOT B;  4OZD A;  1CFP A;  1KFX S;  2QEH A;  1X02 A;  4QJ4 B;  2LMV A;  5D69 A;  2M49 B;  1ALW A;  1W7I B;  2MRD A;  5F6T A;  4DUQ A;  1XVJ A;  1SCV A;  1BG1 A;  2KQ6 A;  2FOT A;  1K9K A;  4GBA A;  1NIW A;  4GAO A;  3RLZ A;  1PAL A;  1TNW A;  5I2O A;  2WOS A;  1EH2 A;  4NQG A;  2EC6 C;  1XFZ O;  3PM8 A;  2HF5 A;  2M29 A;  1XK4 C;  1G8I A;  2JT0 A;  1AVS A;  3JVT B;  1QLK A;  1M45 A;  5JOL A;  2PMY A;  3FE8 A;  2KI4 C;  3K1E A;  4F7F A;  1NCY A;  4YRU A;  2BAP A;  1OQP A;  3HCM A;  1J7Q A;  3AAK A;  3I5F C;  2YGU A;  3DVM A;  3MSE B;  2K2F A;  1M31 A;  3O78 A;  2NZ0 A;  2ZFD A;  3I5G C;  1LVC D;  3BOW B;  3EVV A;  1OMV A;  1QTX A;  2KAV A;  2KFG A;  3SG6 A;  1IIO A;  4GGF A;  2FCD A;  1UWO A;  5GQQ C;  4ZCV A;  1NUB A;  1QIW A;  3ICB A;  4N1F A;  2PVB A;  2JTT A;  1JUO A;  4MEW A;  1FI6 A;  2HQW A;  4DCK A;  1UUS A;  1IKU A;  1PVA A;  1CNP A;  3V2L A;  3L47 A;  1FF1 A;  1FW4 A;  1DQE A;  3TS5 C;  1KK7 Y;  2GGM A;  3O4X A;  4OV2 A;  1DJW A;  1DJX A;  1TIZ A;  2KBM A;  1YRT B;  1CMG A;  2VRG A;  2JT8 A;  1J7P A;  2LUX A;  4CLN A;  1E8A A;  1EG4 A;  2H8V A;  1OOH A;  3UO9 A;  4NDB A;  3SG7 A;  5JJG A;  2BEC A;  1Y1U A;  4HRG A;  5HKW A;  1P28 A;  2KI6 C;  1JSA A;  2G2B A;  1SL7 A;  2BBN A;  2LV7 A;  1CKK A;  1FPW A;  2KI4 B;  1CLB A;  3B86 A;  3SG4 A;  4USL A;  2WCF A;  1F8H A;  1GM0 A;  1DGV A;  1NPQ A;  1U5I B;  2CXJ A;  1SNL A;  4YGA A;  3NSL A;  2HET A;  1KQV A;  5ER4 X;  4PE1 A;  2GGZ A;  1L2O B;  2LP2 A;  2HPS A;  1DTL A;  1OSA A;  2PAS A;  2Y5I A;  2DOQ A;  1MR8 A;  1QV0 A;  2LLS A;  3A8R A;  3DZT A;  3I5I C;  4GUK A;  3QME A;  2R2I A;  3NSI A;  2WC5 A;  2ZND A;  1B8C A;  1SL8 A;  2JTZ A;  2KFH A;  2M9G A;  3BOW A;  1UHJ A;  1A29 A;  1XFU O;  1UHI A;  1UHK A;  3BXK A;  1SKT A;  3D74 A;  4MVF A;  1NX0 A;  2F3Z A;  1MXE A;  2ZNE A;  2L5X B;  3BFH A;  5FI2 A;  3SG2 A;  5BPJ A;  1SPY A;  1D1O A;  4ETO A;  1RJV A;  4JKT A;  4NDD A;  3S0D A;  1K9P A;  2WCL A;  4ICB A;  1TUZ A;  2BNX A;  2LMT A;  1K94 A;  2I7A A;  1AK8 A;  2M3W A;  2WC6 A;  3CZ2 A;  4WQ3 A;  2PSR A;  2LUC A;  4HRE E;  3CAB A;  1FI5 A;  1S26 D;  5G08 A;  1JFK A;  1M39 A;  2QEV A;  2Q4U A;  2I2R E;  4D1E A;  1G4Y R;  2LVK A;  1B47 A;  1OOF A;  1SL9 A;  3FE6 A;  5AEQ A;  1XO5 A;  3NHI A;  5J3X A;  3KHE A;  1QX2 A;  2WCK A;  1DF0 A;  2BCB A;  1JBA A;  3DY9 A;  4PT1 A;  3WHU B;  5HKY A;  1CFC A;  3AKA A;  1IRJ A;  3EK4 A;  3PJI A;  5I2L A;  3CR4 X;  1K90 D;  1XK4 A;  1SR6 B;  1NSH A;  2O5G A;  2QEB A;  3BUX B;  1IH0 A;  3FE9 A;  1QAT A;  3GOF A;  1JWD A;  5FI6 A;  2WCJ A;  1WRK A;  3JTD B;  1Z2C B;  2KSP A;  2LLU A;  2JOJ A;  2L4I A;  4E68 A;  1C7W A;  4A4C A;  2LAN A;  5HL1 A;  2H61 A;  1NYA A;  1HT9 A;  1YVH A;  2JPT A;  2LVJ A;  3DYE A;  1M46 A;  3OBV A;  3SS3 A;  4F0Z B;  2K7C A;  2M8U A;  3LL8 B;  4CFQ A;  1BLQ A;  1BU3 A;  2CTN A;  4HRH A;  3DVK A;  1YX8 A;  1XFY O;  3D0Y B;  1B8L A;  3KF9 A;  1AP4 A;  2K7D A;  3NXA A;  4MRY A;  3D76 A;  3TS5 B;  2JT3 A;  2OTG B;  4OKH A;  1FBV A;  1F4Q A;  1EL4 A;  2JPO A;  1W9Z A;  2MJW B;  1DJY A;  1A03 A;  1C3Y A;  1IQ3 A;  1BR1 B;  4P5O E;  4XJK A;  5CPV A;  1S36 A;  1IJ6 A;  1XA5 A;  1A2X A;  4IL1 A;  1F70 A;  1AUI B;  2AUC A;  4JD9 A;  2WCE A;  2LLT A;  4GPL B;  4PCW A;  1QAS A;  2IS9 A;  4AQI A;  2P6B B;  4JQ0 D;  3VRQ A;  1XFV O;  4A4B A;  2MBX A;  3LLE A;  4BY5 A;  1RWY A;  1EXR A;  1QIV A;  4Q04 A;  3KPX A;  4N5X A;  4DIR A;  2SAS A;  2MLE C;  3RZS A;  3D75 A;  5B8I B;  3PFV A;  1CDN A;  3IF7 A;  4OCI A;  4ORC B;  1KWO C;  3S0E A;  3C1V A;  4MN0 A;  2A4J A;  1SRA A;  1ALV A;  2O60 A;  3L4A A;  5D7F A;  1LKJ A;  2MAZ A;  1DMO A;  1QVI Z;  1S1E A;  3PAL A;  1L7Z A;  3PN7 B;  3EKJ A;  3CWG A;  2OTG C;  4BY4 A;  4C0K A;  2JU0 A;  2FJU B;  2PYQ A;  1SW8 A;  3PLF B;  2LCP A;  2LHL A;  1TNP A;  1K93 D;  5FYX A;  1DVI A;  4MZK A;  2KYF A;  2KGR A;  3SG3 A;  5I8N A;  1U5I A;  4CID A;  2LNK A;  3CR2 A;  1K95 A;  2K7B A;  1TCF A;  4KYN A;  4UPG A;  5IBW A;  3SS4 A;  1J1E A;  3E3R A;  1V1F A;  4PE4 A;  1KWO B;  2BE4 A;  3EKH A;  1DJI A;  3D10 A;  3DF0 A;  3QRX A;  2COL B;  4U8D A;  2D8N A;  2LP3 A;  5CSF A;  1C07 A;  1F71 A;  3S0G A;  1XYD A;  2V53 A;  2M1K B;  4XJK B;  2EC6 B;  1SR6 C;  1DGU A;  2QAC A;  4XYN A;  5I94 A;  1MHO A;  3CYZ A;  2L5Y A;  1XFR A;  3VRN A;  1BJF A;  1YVL A;  4AQJ A;  1WLM A;  4OR9 B;  2CCM A;  1BR4 B;  4OVN F;  1DT7 B;  4GFT A;  4PHM A;  1S5G Y;  2MA2 A;  3IQQ A;  4INX A;  1KSO A;  1A75 B;  1KK8 B;  2BKH B;  2BE6 A;  1TTX A;  2ERB A;  1S3P A;  1PUL A;  3OP0 A;  1DJH A;  5CSJ A;  2M7N A;  3L4L A;  1HQV A;  2GV5 A;  3BQ3 A;  3I5H C;  5DKN A;  3PSR A;  1CMF A;  5ER5 A;  1Y1A A;  1Y1X A;  4MBE A;  4YGE B;  3ZWH A;  2NXQ A;  5FI7 A;  3VRR A;  2KLD A;  5CSI A;  3DVJ A;  1LA3 A;  1CDM A;  3B88 A;  3EK7 A;  1TNQ A;  2K0J A;  2Y1N A;  3CR5 X;  2PAL A;  3GK1 A;  4TNC A;  2JNX A;  1ZAC A;  1F4O A;  2BBM A;  2K2A A;  2K61 A;  1J1D A;  2M0R A;  3GK2 A;  4FQT A;  1T14 A;  4AOM A;  3O6B A;  2ISD A;  4MRX A;  2H61 C;  1CM4 A;  4QJ5 B;  4IJ7 A;  2M97 A;  4HSZ A;  1WRZ A;  5CSN A;  5DIC A;  2HQ8 A;  3SG5 A;  1ZUZ A;  2H2K A;  3O2P A;  1B8R A;  2JXC A;  2F2P A;  2L0P A;  2WCH A;  1UP5 A;  3BJH A;  1CTR A;  2F33 A;  3A4U B;  1QV1 A;  1WY9 A;  5AER A;  1SYM A;  1DF0 B;  3OHM B;  5HYD A;  1EG3 A;  1B1G A;  2TN4 A;  4L9M A;  1RRO A;  3R72 A;  5D3O A;  1KQM C;  1PVB A;  1QLS A;  3RM1 A;  1MF8 B;  1NWD A;  3BUM B;  2WOR A;  3NGV A;  1M63 B;  3B7A A;  4GNK B;  3KO0 A;  2EGD A;  1L2O C;  1YUS A;  3D0Y A;  4DS7 A;  1OZS A;  2K60 A;  3ZNI A;  3I5F B;  2G9B A;  2QEO A;  2Y4Q A;  2KPH A;  2L2E A;  2ZN8 A;  3NSO A;  2LE9 B;  3LK0 A;  1UHN A;  1K8U A;  1R2U A;  1TRF A;  2L51 A;  3CZ1 A;  3OX5 A;  3JVT C;  1SCM B;  1REC A;  2ZRS A;  1EJ3 A;  3VB1 A;  5K89 A;  2E6W A;  1PSR A;  2CBL A;  1C7V A;  1J7O A;  3LCP C;  4JPZ B;  1N0Y A;  1J55 A;  1BF5 A;  1A75 A;  4YI9 A;  1JF0 A;  3CDN A;  4YGB B;  1XFX O;  2JZI A;  2LVV A;  1KK8 C;  2NCP A;  1KFU L;  1ORG A;  1CFD A;  1LS8 A;  2K8M B;  1JF2 A;  1PRW A;  1Y6W A;  1R6P A;  2ZRT A;  4PHK A;  1LA0 A;  1MWN A;  4M2Q A;  5KU1 A;  1MQ1 A;  2KYC A;  2F8P A;  3IQO A;  1JFJ A;  5AXI A;  1SBJ A;  2MLF C;  3WHT B;  1B4C A;  3B87 A;  1B7T Y;  2PQL A;  5HLV A;  2EHB A;  2QPT A;  1QXP A;  1IQ5 A;  2JC2 A;  3AAJ A;  2M7L A;  2ZKM X;  2BCA A;  1UHH A;  1QVI Y;  1YRU B;  2BL0 B;  2LAP A;  3OX6 A;  5DKR A;  3S0B A;  1BOC A;  1W7J B;  2KBI A;  1TUJ A;  3F45 A;  1OZO A;  1WLZ A;  1Y0V H;  2CT9 A;  4I5K A;  3TDU A;  2WND A;  1ZMZ A;  1NX2 A;  3BYA A;  1GGZ A;  1S6I A;  3CZT X;  2OPO A;  1VRK A;  1KFU S;  3O4Y A;  4PE0 A;  4M2O A;  3Q8I A;  2MHH A;  4ZCU A;  3M0W A;  2NCO A;  3LK1 A;  3TDI A;  1K2H A;  1OMR A;  1OOI X;  3N7H A;  4R1E A;  1H8B A;  1F54 A;  3KEV A;  2QDI A;  2SCP A;  3OB2 B;  2RGI A;  3PM2 A;  4YGC B;  2OS8 C;  1C3Z A;  1QWV A;  3H4S E;  1DJG A;  2LVI A;  3SS5 A;  4N1G A;  3VGO A;  3PN7 C;  2KHN A;  1KCY A;  1NX3 A;  1KK7 Z;  2KLE A;  1NCZ A;  2LM5 A;  1OMD A;  2P71 A;  3JTD C;  1QX5 B;  2WC8 A;  4C0L A;  1IJ5 A;  1CDL A;  1XFW O;  1KFX L;  1PK0 D;  2WCB A;  2OS8 B;  3NHT A;  1ODB A;  5AAN A;  4FQO A;  1SMG A;  2KGB C;  4C0J A;  2I94 A;  1BOD A;  4MZJ A;  3HX4 A;  2ZN9 A;  1GGW A;  1CB1 A;  3BFB A;  1TNX A;  3I5H B;  2KQY A;  4DRW A;  3EK8 A;  3SIB A;  1KQM B;  3FS7 A;  2KDH A;  4P2Y B;  2L2C A;  4YI8 A;  1Z4H A;  4WRI A;  2CNP A;  2KFF A;  4CFR A;  1OE9 B;  2P70 A;  3TUY B;  1GJY A;  3FWC A;  1JC2 A;  1LIN A;  2L98 A;  5HLO A;  1UUR A;  1Q80 A;  1OW4 A;  2L50 A;  4PDZ A;  2BL0 C;  2WCM A;  1DEL A;  1LXF C;  1NX1 A;  2JNF A;  3GK4 X;  3TZ1 A;  3DF0 B;  1OOG A;  1TN4 A;  1YX7 A;  1N2D A;  2M1U A;  1SY9 A;  2LHI A;  1PSB A;  3VRP A;  5AFP A;  1BT6 A;  3I5G B;  4I5N B;  2Y1M A;  1YR5 A;  1SCM C;  4PE7 A;  1RTP 1;  1K96 A;  1V1G A;  1RFJ A;  2AAO A;  1OOJ A;  1TOP A;  1IWQ A;  3EG5 B;  3S0F A;  2JQ6 A;  1CDP A;  5TNC A;  2Q91 A;  2KOT A;  2NLN A;  3BUN B;  4GGF C;  3CZ0 A;  3AKB A;  5HKZ A;  3TDZ A;  1CLM A;  3R1O A;  2I18 A;  4WQ2 A;  4M2P A;  1WRL A;  2E30 A;  3TUY C;  3CTN A;  1N65 A;  3CGA A;  3OB1 B;  1KSM A;  4ORB B;  1QJT A;  1DJZ A;  5KTY A;  1IGV A;  1CFF A;  1SK6 D;  2AMI A;  2FCE A;  3BFA A;  2KAY A;  3BUO B;  1H4B A;  1B7T Z;  5KSZ A;  1F55 A;  3R1P A;  2K7O A;  1S5G Z;  2JWW A;  3S0A A;  3NSK A;  1BMO A;  3OGN A;  3FIA A;  4GGN A;  2F2O A;  2JUL A;  1S6C A;  1S6J A;  3DVE A;  5I2Q A;  3CLN A;  1QX7 A;  2F3Y A;  2KAX A; 
#chains in the Genus database with same CATH homology
 1CM1 A;  1TCO B;  2BKI B;  1IG5 A;  1MXL C;  3PAT A;  1YUR A;  2KI6 D;  1AJ5 A;  1WDC C;  3FWB A;  2LMU A;  4JWQ A;  3BUW B;  1MUX A;  4MSP A;  1WDC B;  5PAL A;  4ORA B;  4YBH B;  2BCX A;  3WXA A;  1RK9 A;  2JRF A;  3SIA A;  1NCX A;  2PRU A;  3CS1 A;  1GQM A;  4I5J A;  1J7R A;  4NDC A;  4QJ3 B;  3SJS A;  1B9A A;  2LC5 A;  3WNX B;  3DD4 A;  5DKQ A;  2KNE A;  4CPV A;  4PAL A;  3I5I B;  1YUT A;  1YTZ C;  1ZFS A;  4MLW A;  4MZL A;  4YGD B;  1YUU A;  1K9U A;  1G33 A;  4I5L B;  1AHR A;  1A4P A;  1QS7 A;  3K21 A;  1CLL A;  2JXL A;  3VRO A;  3EVU A;  1NP8 A;  2B1U A;  4PHN A;  4PHJ A;  4FTG A;  2L4H A;  3EVR A;  1AJ4 A;  1ZOT B;  1CFP A;  1KFX S;  4QJ4 B;  1X02 A;  2LMV A;  5D69 A;  2M49 B;  1ALW A;  1W7I B;  2MRD A;  5F6T A;  4DUQ A;  1XVJ A;  1SCV A;  1BG1 A;  2KQ6 A;  2FOT A;  1K9K A;  4GBA A;  1NIW A;  4GAO A;  3RLZ A;  1PAL A;  1TNW A;  5I2O A;  2WOS A;  1EH2 A;  4NQG A;  2EC6 C;  1XFZ O;  3PM8 A;  2HF5 A;  2M29 A;  1XK4 C;  1G8I A;  2JT0 A;  1AVS A;  3JVT B;  1QLK A;  1M45 A;  5JOL A;  2PMY A;  2KI4 C;  1NCY A;  4YRU A;  1OQP A;  3HCM A;  1J7Q A;  3AAK A;  3I5F C;  3DVM A;  3MSE B;  2K2F A;  1M31 A;  3O78 A;  2NZ0 A;  2ZFD A;  3I5G C;  1LVC D;  3BOW B;  3EVV A;  1OMV A;  1QTX A;  2KAV A;  2KFG A;  3SG6 A;  4GGF A;  2FCD A;  1UWO A;  5GQQ C;  4ZCV A;  1NUB A;  1QIW A;  3ICB A;  4N1F A;  2PVB A;  2JTT A;  1JUO A;  4MEW A;  1FI6 A;  2HQW A;  4DCK A;  1UUS A;  1IKU A;  1PVA A;  1CNP A;  1FF1 A;  1FW4 A;  3TS5 C;  1KK7 Y;  2GGM A;  4OV2 A;  1DJW A;  1DJX A;  1TIZ A;  2KBM A;  1YRT B;  1CMG A;  2VRG A;  2JT8 A;  1J7P A;  2LUX A;  4CLN A;  1E8A A;  1EG4 A;  4NDB A;  3SG7 A;  5JJG A;  2BEC A;  1Y1U A;  4HRG A;  5HKW A;  1JSA A;  2KI6 C;  2G2B A;  1SL7 A;  2BBN A;  2LV7 A;  1CKK A;  1FPW A;  2KI4 B;  1CLB A;  3SG4 A;  4USL A;  2WCF A;  1F8H A;  1DGV A;  1NPQ A;  1U5I B;  2CXJ A;  1SNL A;  4YGA A;  3NSL A;  2HET A;  1KQV A;  5ER4 X;  4PE1 A;  2GGZ A;  1L2O B;  2LP2 A;  2HPS A;  1DTL A;  1OSA A;  2PAS A;  2Y5I A;  2DOQ A;  1MR8 A;  1QV0 A;  2LLS A;  3A8R A;  3I5I C;  4GUK A;  1C7V A;  2R2I A;  3NSI A;  2ZND A;  1B8C A;  1SL8 A;  2JTZ A;  2KFH A;  2M9G A;  3BOW A;  1UHJ A;  1A29 A;  1XFU O;  1UHI A;  1UHK A;  3BXK A;  1SKT A;  4MVF A;  1NX0 A;  2F3Z A;  1MXE A;  2ZNE A;  2L5X B;  3SG2 A;  5BPJ A;  1SPY A;  1D1O A;  4ETO A;  1RJV A;  4NDD A;  1K9P A;  4ICB A;  2LMT A;  1K94 A;  2I7A A;  1AK8 A;  2M3W A;  4WQ3 A;  2PSR A;  2LUC A;  4HRE E;  1FI5 A;  1S26 D;  5G08 A;  1JFK A;  1M39 A;  2Q4U A;  2I2R E;  4D1E A;  1G4Y R;  2LVK A;  1B47 A;  1SL9 A;  5AEQ A;  1XO5 A;  5J3X A;  3KHE A;  1QX2 A;  1DF0 A;  2BCB A;  1JBA A;  3WHU B;  5HKY A;  1CFC A;  3AKA A;  1IRJ A;  3EK4 A;  5I2L A;  3CR4 X;  1K90 D;  1XK4 A;  1SR6 B;  1NSH A;  2O5G A;  3BUX B;  1IH0 A;  1QAT A;  3GOF A;  1JWD A;  1WRK A;  3JTD B;  2KSP A;  2LLU A;  2JOJ A;  2L4I A;  4E68 A;  1C7W A;  4A4C A;  2LAN A;  2H61 A;  1NYA A;  1HT9 A;  1YVH A;  2JPT A;  2LVJ A;  1M46 A;  4F0Z B;  2K7C A;  2M8U A;  3LL8 B;  4CFQ A;  1BLQ A;  1BU3 A;  2CTN A;  4HRH A;  3DVK A;  1YX8 A;  1XFY O;  3D0Y B;  1B8L A;  3KF9 A;  1AP4 A;  2K7D A;  3NXA A;  4MRY A;  3TS5 B;  2JT3 A;  2OTG B;  4OKH A;  1FBV A;  1F4Q A;  1EL4 A;  2MJW B;  1DJY A;  1A03 A;  1IQ3 A;  1BR1 B;  4P5O E;  4XJK A;  5CPV A;  1S36 A;  1IJ6 A;  1XA5 A;  1A2X A;  4IL1 A;  1F70 A;  1AUI B;  2AUC A;  2WCE A;  2LLT A;  4GPL B;  4PCW A;  1QAS A;  2IS9 A;  4AQI A;  2P6B B;  4JQ0 D;  3VRQ A;  1XFV O;  4A4B A;  2MBX A;  3LLE A;  4BY5 A;  1RWY A;  1EXR A;  1QIV A;  4Q04 A;  3KPX A;  4N5X A;  4DIR A;  2SAS A;  2MLE C;  1CDN A;  5B8I B;  3PFV A;  3IF7 A;  4OCI A;  4ORC B;  1KWO C;  4QJ5 B;  3C1V A;  4MN0 A;  2A4J A;  1SRA A;  1ALV A;  2O60 A;  5D7F A;  1LKJ A;  2MAZ A;  1DMO A;  1QVI Z;  1S1E A;  3PAL A;  1L7Z A;  3PN7 B;  3EKJ A;  3CWG A;  2OTG C;  4BY4 A;  4C0K A;  2JU0 A;  2FJU B;  1SW8 A;  3PLF B;  2LCP A;  2LHL A;  1TNP A;  1K93 D;  5FYX A;  1DVI A;  4MZK A;  2KYF A;  2KGR A;  3SG3 A;  5I8N A;  1U5I A;  4CID A;  2LNK A;  3CR2 A;  1K95 A;  2K7B A;  1TCF A;  4UPG A;  5IBW A;  1J1E A;  3E3R A;  1V1F A;  4PE4 A;  1KWO B;  2BE4 A;  3EKH A;  1DJI A;  3D10 A;  3DF0 A;  3QRX A;  2COL B;  4U8D A;  2D8N A;  2LP3 A;  5CSF A;  1C07 A;  1F71 A;  1XYD A;  2V53 A;  2M1K B;  4XJK B;  2EC6 B;  1SR6 C;  1DGU A;  2QAC A;  4XYN A;  1MHO A;  3VRN A;  1BJF A;  1YVL A;  4AQJ A;  1WLM A;  4OR9 B;  2CCM A;  1BR4 B;  4OVN F;  1DT7 B;  4GFT A;  4PHM A;  1S5G Y;  2MA2 A;  3IQQ A;  1KSO A;  1A75 B;  1KK8 B;  2BKH B;  2BE6 A;  1TTX A;  1S3P A;  1PUL A;  3OP0 A;  1DJH A;  5CSJ A;  2M7N A;  1HQV A;  2GV5 A;  3BQ3 A;  3I5H C;  5DKN A;  3PSR A;  1CMF A;  5ER5 A;  1Y1A A;  1Y1X A;  4MBE A;  4YGE B;  3ZWH A;  2NXQ A;  3VRR A;  5CSI A;  3DVJ A;  1LA3 A;  1CDM A;  3EK7 A;  3GK1 A;  1TNQ A;  2K0J A;  2Y1N A;  3CR5 X;  2PAL A;  4TNC A;  4DS7 A;  2JNX A;  1ZAC A;  1F4O A;  2BBM A;  2K2A A;  2K61 A;  1J1D A;  2M0R A;  3GK2 A;  4AOM A;  3O6B A;  2ISD A;  4MRX A;  2H61 C;  1CM4 A;  2M97 A;  4HSZ A;  1WRZ A;  5CSN A;  3SG5 A;  2HQ8 A;  1ZUZ A;  2H2K A;  3O2P A;  1B8R A;  2JXC A;  2F2P A;  2L0P A;  1UP5 A;  1CTR A;  2F33 A;  3A4U B;  1QV1 A;  1WY9 A;  5AER A;  1SYM A;  1DF0 B;  3OHM B;  5HYD A;  1EG3 A;  1B1G A;  2TN4 A;  4L9M A;  1RRO A;  1KQM C;  1PVB A;  1QLS A;  3RM1 A;  1MF8 B;  1NWD A;  3BUM B;  2WOR A;  1M63 B;  4GNK B;  3KO0 A;  2EGD A;  1L2O C;  1YUS A;  3D0Y A;  1OZS A;  3ZNI A;  3I5F B;  2G9B A;  2Y4Q A;  2L2E A;  2ZN8 A;  3NSO A;  2LE9 B;  3LK0 A;  1UHN A;  1K8U A;  1R2U A;  1TRF A;  2L51 A;  3OX5 A;  3JVT C;  1SCM B;  1REC A;  2ZRS A;  1EJ3 A;  5K89 A;  2E6W A;  1PSR A;  2CBL A;  1J7O A;  3LCP C;  4JPZ B;  1N0Y A;  1J55 A;  1BF5 A;  1A75 A;  4YI9 A;  1JF0 A;  4YGB B;  1XFX O;  2JZI A;  2LVV A;  1KK8 C;  2NCP A;  1KFU L;  1CFD A;  2K8M B;  1JF2 A;  1PRW A;  1Y6W A;  1R6P A;  2ZRT A;  4PHK A;  1LA0 A;  1MWN A;  4M2Q A;  5KU1 A;  1MQ1 A;  2KYC A;  2F8P A;  3IQO A;  1JFJ A;  5AXI A;  1SBJ A;  2MLF C;  3WHT B;  1B4C A;  1B7T Y;  5HLV A;  2EHB A;  2QPT A;  1QXP A;  1IQ5 A;  2JC2 A;  3AAJ A;  2M7L A;  2ZKM X;  2BCA A;  1UHH A;  1QVI Y;  1YRU B;  2BL0 B;  2LAP A;  3OX6 A;  5DKR A;  1BOC A;  1W7J B;  2KBI A;  3F45 A;  1OZO A;  1WLZ A;  1Y0V H;  2CT9 A;  4I5K A;  3TDU A;  2WND A;  1ZMZ A;  1NX2 A;  3BYA A;  1GGZ A;  1S6I A;  3CZT X;  2OPO A;  1VRK A;  1KFU S;  3O4Y A;  4PE0 A;  4M2O A;  2MHH A;  4ZCU A;  3M0W A;  2NCO A;  3LK1 A;  3TDI A;  1K2H A;  1OMR A;  4R1E A;  1H8B A;  1F54 A;  3KEV A;  2SCP A;  3OB2 B;  2RGI A;  4YGC B;  2OS8 C;  3H4S E;  1DJG A;  2LVI A;  4N1G A;  3VGO A;  3PN7 C;  2KHN A;  1KCY A;  1NX3 A;  1KK7 Z;  1NCZ A;  2LM5 A;  1OMD A;  3JTD C;  1QX5 B;  2WC8 A;  4C0L A;  1IJ5 A;  1CDL A;  1XFW O;  1KFX L;  1PK0 D;  2WCB A;  2OS8 B;  1ODB A;  5AAN A;  4FQO A;  1SMG A;  2KGB C;  4C0J A;  2I94 A;  1BOD A;  4MZJ A;  3HX4 A;  2ZN9 A;  1GGW A;  1CB1 A;  1TNX A;  3I5H B;  2KQY A;  4DRW A;  3EK8 A;  3SIB A;  1KQM B;  3FS7 A;  2KDH A;  4P2Y B;  4YI8 A;  4WRI A;  2CNP A;  2KFF A;  4CFR A;  1OE9 B;  3TUY B;  1GJY A;  3FWC A;  1JC2 A;  1LIN A;  2L98 A;  5HLO A;  1UUR A;  1Q80 A;  2L50 A;  4PDZ A;  2BL0 C;  1LXF C;  2JNF A;  1NX1 A;  3GK4 X;  3TZ1 A;  3DF0 B;  1TN4 A;  1YX7 A;  1N2D A;  2M1U A;  1SY9 A;  2LHI A;  1PSB A;  3VRP A;  5AFP A;  1BT6 A;  3I5G B;  4I5N B;  2Y1M A;  1YR5 A;  1SCM C;  4PE7 A;  1RTP 1;  1K96 A;  1V1G A;  1RFJ A;  2AAO A;  1OOJ A;  1TOP A;  1IWQ A;  2JQ6 A;  1CDP A;  5TNC A;  2Q91 A;  2KOT A;  2NLN A;  3BUN B;  4GGF C;  3AKB A;  5HKZ A;  3TDZ A;  1CLM A;  2I18 A;  4WQ2 A;  4M2P A;  1WRL A;  2E30 A;  3TUY C;  3CTN A;  1N65 A;  3CGA A;  3OB1 B;  1KSM A;  4ORB B;  1QJT A;  1DJZ A;  5KTY A;  1IGV A;  1CFF A;  1SK6 D;  2AMI A;  2FCE A;  2KAY A;  3BUO B;  1H4B A;  1B7T Z;  5KSZ A;  1F55 A;  2K7O A;  1S5G Z;  2JWW A;  3NSK A;  1BMO A;  3FIA A;  4GGN A;  2F2O A;  2JUL A;  1S6C A;  1S6J A;  3DVE A;  5I2Q A;  3CLN A;  1QX7 A;  2F3Y A;  2KAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...