1DMOA

Calmodulin, nmr, 30 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
publication title Calcium-induced conformational transition revealed by the solution structure of apo calmodulin.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1996-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dmoA00
1X02A 1B9AA 2JPTA 1M46A 2O60A 3BUOB 3JVTC 3CTNA 5KSZA 1DJGA 2WORA 2MLFC 1SMGA 3ICBA 3PM8A 1S3PA 3EVRA 1BT6A 1CLLA 4YGCB 1CDLA 1UHNA 1A29A 3BUNB 4NDDA 1A75B 4DUQA 3KO0A 1KWOC 1M39A 2M29A 2PALA 3FIAA 1W7JB 3LL8B 2KI6D 1SKTA 1F71A 3D0YA 3CR2A 3NXAA 2Y5IA 1CDNA 2Q4UA 1G8IA 1V1GA 2M7LA 3D0YB 1TCOB 2WCFA 4WQ2A 4CPVA 1KCYA 1C7WA 1OOJA 2K7DA 1TNPA 2M97A 4GNKB 5I2OA 1S6JA 4XJKA 1H8BA 1XFVO 2AMIA 1OQPA 3LK0A 1JFJA 3TDUA 1CKKA 3MSEB 2EC6C 2JT0A 1YX7A 1FI5A 2M1UA 5I2LA 1SL9A 2OS8B 1J7QA 4ORCB 2B1UA 2G9BA 4FTGA 1NCYA 1AJ4A 1WLMA 1XA5A 3NSLA 1JSAA 2WC8A 4C0LA 1QATA 4I5JA 2FOTA 1S5GY 3PATA 1SW8A 2LLTA 1KFUS 4PDZA 1YURA 2JRFA 2LV7A 2KYFA 2JOJA 1GJYA 5DKNA 2GGZA 1DJWA 2LANA 2JULA 3O78A 4GAOA 4JPZB 2AUCA 4YI9A 3TDIA 3NSOA 1MQ1A 1SK6D 3H4SE 2KI4B 2BCBA 1L2OC 2JTZA 2F2PA 1YTZC 1RWYA 3KPXA 3HCMA 2L0PA 1S1EA 1F54A 3A8RA 1S36A 1F4OA 1N0YA 1VRKA 2KAYA 2OS8C 1F55A 2H61C 2NCOA 1QASA 1QIVA 1XFZO 1YRTB 3A4UB 4PE1A 4D1EA 2QPTA 1LXFC 4QJ3B 3C1VA 1MXEA 1IJ5A 1SYMA 3TDZA 1CFPA 1K9UA 1NP8A 2P6BB 1NWDA 1J7PA 1S26D 1UURA 1AK8A 4NDCA 1R6PA 1IKUA 4PHJA 3LCPC 1HT9A 1PALA 4BY4A 3CLNA 2BCAA 2ZRSA 1WLZA 2F2OA 1QV0A 4OVNF 1MWNA 1KFXS 1ZOTB 2KI4C 1K8UA 5G08A 2M3WA 2Y1NA 2JNXA 4GBAA 4N1GA 1GGWA 5HKWA 3DD4A 2ZRTA 1RECA 1XK4C 2KQYA 2IS9A 3K21A 1QLSA 2O5GA 4MSPA 2JC2A 3SG5A 4I5KA 2PSRA 1RTP1 1UHKA 1JFKA 1EG4A 2VRGA 3SG3A 1K93D 1R2UA 4Q04A 2LHIA 2K0JA 1BG1A 1NX1A 3OP0A 1YUUA 3WHTB 1CLBA 4OKHA 4WQ3A 2LVJA 1KQMC 3AAJA 1PSBA 2MHHA 3PSRA 1SR6B 1V1FA 4MBEA 4MZLA 1SY9A 3I5HC 4A4CA 2EC6B 3E3RA 2L50A 1BF5A 4BY5A 3BQ3A 1TNXA 2L98A 1N2DA 2K7OA 2M0RA 1Y1UA 2NLNA 5KTYA 1IRJA 1DJZA 1K9KA 1Y1XA 2LP3A 3I5IB 1MHOA 1AJ5A 5B8IB 4MVFA 1RK9A 1A75A 2KBMA 4QJ5B 1AHRA 4PHMA 5I2QA 4PE7A 1J7RA 1AVSA 4PHKA 1QVIZ 1YX8A 3BUXB 5AEQA 1XVJA 1B47A 2FCDA 2KAXA 4HSZA 5CSFA 1Y6WA 3GK4X 1DJHA 1QXPA 2NZ0A 1J7OA 3OHMB 4I5LB 5J3XA 2AAOA 1XO5A 2PASA 1L2OB 4YI8A 1QS7A 1K2HA 1SR6C 3EVUA 4ORBB 1PVAA 4M2OA 2LVVA 2LP2A 2BBNA 5TNCA 3TS5B 2H61A 3SG6A 2I2RE 4AOMA 1CLMA 3DVKA 1OMDA 2RGIA 5KU1A 2R2IA 1E8AA 1F8HA 2LCPA 2ZN9A 3I5IC 2KFHA 1ALVA 1DGVA 1DTLA 1JF2A 2KDHA 2F33A 3HX4A 4JQ0D 4UPGA 1FPWA 3LK1A 1KFXL 3OX6A 1ODBA 1Y1AA 3CR5X 4P2YB 2KGBC 1M31A 2BL0C 4ORAB 2F8PA 1OMVA 2GGMA 1FF1A 1PULA 3BUWB 4OV2A 3QRXA 1IQ5A 4L9MA 2JU0A 3IF7A 1JC2A 1EG3A 5CSIA 1EL4A 1NCXA 1TCFA 5AXIA 1UHJA 3I5FB 2F3ZA 4GGNA 2LMUA 3BOWA 1BR4B 4ZCUA 1CM1A 1QJTA 1UP5A 3EVVA 1XK4A 2PRUA 3BOWB 1A2XA 1PSRA 4R1EA 2K2AA 2OTGC 2M7NA 1WDCC 3TS5C 1CFDA 1BLQA 3WNXB 2HQWA 2LNKA 1J1DA 2LE9B 1EH2A 3EK8A 1K95A 1IJ6A 5D7FA 2KGRA 1QV1A 1K9PA 1RFJA 3O2PA 3TZ1A 1SPYA 3SG7A 1BR1B 2I7AA 2OPOA 4QJ4B 2K7CA 1OSAA 1L7ZA 1LINA 1MF8B 2ZKMX 2M1KB 4N5XA 2I94A 1KQVA 1KQMB 1JF0A 5GQQC 1KK7Y 4CFQA 1JBAA 5AANA 3VRPA 4YRUA 3I5HB 3NSIA 1QLKA 2KNEA 2WOSA 3FS7A 3GK1A 1B8CA 1TTXA 2FCEA 4JWQA 3EKJA 3I5FC 3DVJA 1YVHA 3VRNA 1KK7Z 2TN4A 2CCMA 1B7TZ 2KFGA 2A4JA 4P5OE 2D8NA 1AP4A 2KBIA 5I8NA 1DT7B 2K7BA 2FJUB 5CSJA 1MUXA 2CXJA 1NYAA 3GK2A 1B1GA 1B4CA 4XYNA 1YR5A 4DCKA 3PFVA 1BMOA 2KI6C 1QTXA 2M8UA 1JUOA 2ISDA 1HQVA 1SL7A 1YRUB 2LUXA 2L5XB 2BKHB 4GFTA 5JOLA 1J55A 4GGFC 2COLB 2M9GA 4M2QA 1H4BA 4DS7A 2WCBA 4HREE 4CFRA 1WRKA 1D1OA 1OZSA 2ZNDA 1KFUL 2KOTA 4NDBA 3FWBA 1IH0A 5HKZA 2LHLA 3VRRA 2JT8A 1DVIA 4F0ZB 1QVIY 3PLFB 1FW4A 5JJGA 2KAVA 1OMRA 5CSNA 4MEWA 3SIBA 2L4HA 3SG4A 2SASA 3AKBA 3DVMA 1NCZA 3PN7C 1M63B 3I5GB 1ZUZA 2LUCA 1NPQA 2BE4A 2HETA 4TNCA 3SG2A 3D10A 2BL0B 2QACA 3EKHA 2NCPA 3BXKA 3KF9A 1XFWO 1K90D 1SCMC 3LLEA 1CMGA 1B8RA 2BCXA 3CR4X 4DRWA 3WHUB 2L51A 2CTNA 2LMVA 1CFCA 2ZNEA 1AUIB 3JTDC 3GOFA 5ER5A 1SRAA 3WXAA 5DKRA 5HLVA 3RLZA 1GGZA 4MRYA 1DMOA 1CFFA 2EHBA 2OTGB 2K8MB 1WDCB 3OB2B 2NXQA 1C07A 2V53A 3F45A 4PALA 1PVBA 1DGUA 4C0JA 4GPLB 1SCVA 5DKQA 1TRFA 3AKAA 1BODA 2SCPA 4YGDB 4NQGA 1UWOA 3CS1A 4HRHA 4PE0A 3M0WA 4YGBB 3DF0A 5F6TA 1NX2A 2E6WA 3I5GC 1CDMA 2MRDA 1LA3A 3CGAA 1CNPA 5IBWA 2JNFA 3DF0B 5BPJA 2LAPA 3AAKA 1DJYA 1IWQA 5AFPA 1OE9B 1TOPA 1YUTA 1IQ3A 2MJWB 4PCWA 4XJKB 1QX5B 2BE6A 2EGDA 1FI6A 2PVBA 2E30A 2MA2A 2ZN8A 2HF5A 1K96A 2LMTA 3VGOA 1RJVA 2F3YA 2KQ6A 1KSMA 4MRXA 1PRWA 1OZOA 3VRQA 1BU3A 4OR9B 4IL1A 2Y4QA 1WRLA 2CT9A 2LC5A 3O4YA 1NX0A 4N1FA 3KHEA 2HQ8A 3CZTX 5CPVA 1FBVA 1KSOA 1UUSA 1G33A 2LVKA 1CB1A 1B8LA 2LM5A 1CTRA 1QX2A 3OB1B 4ETOA 2BECA 3ZWHA 4HRGA 1C7VA 1XYDA 1LA0A 1S5GZ 2JZIA 2KYCA 1KK8B 2JXLA 1IGVA 1U5IA 2LVIA 4MZJA 2Q91A 3OX5A 2JQ6A 4OCIA 4GGFA 2MLEC 1U5IB 1QX7A 3FWCA 1DJXA 1G4YR 2HPSA 1S6IA 1SNLA 4MN0A 3ZNIA 1B7TY 1NUBA 2DOQA 4MLWA 4ZCVA 1LKJA 4YGEB 1F70A 2BKIB 2K2FA 2L4IA 3IQQA 1QIWA 5HLOA 5D69A 1A03A 1K94A 1CMFA 4GUKA 3EK4A 3DVEA 1XFXO 5PALA 2KSPA 2MAZA 3NSKA 2CNPA 1M45A 2WCEA 3BUMB 1W7IB 1ZMZA 1MR8A 5ER4X 4YGAA 1TIZA 4A4BA 1CDPA 3KEVA 3PN7B 4CLNA 2H2KA 3TUYB 1TNQA 4MZKA 5AERA 2LLSA 3SIAA 1N65A 3O6BA 1WY9A 1S6CA 4DIRA 1Q80A 4CIDA 1SCMB 3IQOA 2I18A 1UHHA 4M2PA 2JWWA 1DJIA 1KK8C 5FYXA 3BYAA 4PHNA 1BOCA 4PE4A 3JTDB 1NSHA 2KFFA 3JVTB 4FQOA 1A4PA 3RM1A 1RROA 3CWGA 1YUSA 1F4QA 1ALWA 2M49B 1DF0A 2PMYA 1LVCD 2JTTA 2L2EA 3VROA 5HYDA 1EXRA 4YBHB 5K89A 4E68A 1DF0B 1MXLC 1TNWA 4AQJA 1BJFA 1NIWA 1XFUO 1KWOB 3EK7A 3SJSA 1SL8A 1ZACA 2MBXA 1CM4A 1ZFSA 4C0KA 2LLUA 2K61A 5HKYA 1UHIA 1SBJA 2GV5A 1JWDA 4ICBA 1Y0VH 1WRZA 1PK0D 2BBMA 2CBLA 2Y1MA 3TUYC 1GQMA 2JXCA 1IG5A 1NX3A 1TN4A 1XFYO 2ZFDA 4I5NB 1EJ3A 2WNDA 2KHNA 4USLA 4WRIA 4U8DA 1J1EA 3PALA 4AQIA 1YVLA 2G2BA 2JT3A
chains in the Genus database with same CATH superfamily
1X02A 1B9AA 2JPTA 1M46A 2O60A 3BUOB 3JVTC 3S0EA 3CTNA 5KSZA 1DJGA 2WORA 2MLFC 1OOIX 1SMGA 3ICBA 3PM8A 1S3PA 3EVRA 1BT6A 1CLLA 1QWVA 4INXA 4YGCB 1CDLA 1UHNA 1A29A 3BUNB 4NDDA 1A75B 4DUQA 2QDIA 3KO0A 1KWOC 1M39A 2M29A 2PALA 3FIAA 1W7JB 3LL8B 2KI6D 3R1VA 1SKTA 1DEKA 1F71A 3D0YA 3CR2A 3NXAA 2Y5IA 1CDNA 2Q4UA 1G8IA 1V1GA 2M7LA 3D0YB 3S0DA 1TCOB 2WCFA 4WQ2A 4CPVA 1KCYA 1C7WA 1OOJA 2K7DA 4JKTA 1TNPA 2M97A 4GNKB 5I2OA 1S6JA 4XJKA 1H8BA 1XFVO 2AMIA 1OQPA 2KLDA 3LK0A 3TDUA 1JFJA 1CKKA 3IVTA 3MSEB 3V2LA 2EC6C 2JT0A 2QEHA 1YX7A 1FI5A 2M1UA 5I2LA 1SL9A 2OS8B 3B7AA 1J7QA 4ORCB 2B1UA 2G9BA 4FTGA 1NCYA 1AJ4A 1WLMA 1XA5A 3NSLA 1JSAA 2WC8A 4C0LA 1QATA 4I5JA 2FOTA 1S5GY 2PYQA 3PATA 1SW8A 2LLTA 1KFUS 2PQLA 1YURA 4PDZA 2JRFA 2LV7A 2KYFA 2JOJA 1GJYA 5DKNA 2GGZA 1DJWA 2LANA 2JULA 3O78A 4GAOA 4JPZB 2AUCA 2WCLA 4YI9A 3TDIA 3NSOA 1MQ1A 1SK6D 3H4SE 4FQTA 2KI4B 2BCBA 1L2OC 2JTZA 2F2PA 1YTZC 1RWYA 3KPXA 3HCMA 2L0PA 1S1EA 3BFBA 1F54A 3A8RA 1S36A 3DXLA 1F4OA 1N0YA 1VRKA 3FE6A 2KAYA 2OS8C 1F55A 2H61C 2NCOA 1QASA 1QIVA 1XFZO 1YRTB 3A4UB 4PE1A 3D77A 4D1EA 4PT1A 4OZDA 2QPTA 1LXFC 4QJ3B 3C1VA 1MXEA 3CABA 1IJ5A 1SYMA 3TDZA 1CFPA 1K9UA 1NP8A 2P6BB 1NWDA 1J7PA 3NHTA 1S26D 1UURA 1AK8A 1DQEA 3D75A 1R6PA 3BFAA 4NDCA 1IKUA 4PHJA 1LS8A 3LCPC 1HT9A 1PALA 3CDNA 4BY4A 3CLNA 2BCAA 2ZRSA 1WLZA 2F2OA 1QV0A 3FE9A 4OVNF 1MWNA 1KFXS 1ZOTB 2KI4C 1K8UA 5G08A 2M3WA 2Y1NA 2JNXA 4GBAA 4N1GA 1GGWA 5HKWA 3DD4A 2ZRTA 1RECA 1XK4C 2KQYA 2IS9A 3K21A 1QLSA 2O5GA 4MSPA 2JC2A 2GTEA 1W9ZA 3SG5A 4I5KA 5FI6A 2PSRA 1RTP1 1UHKA 1JFKA 1EG4A 2VRGA 2H8VA 5F6TA 3SG3A 1K93D 1R2UA 4Q04A 2LHIA 2K0JA 1BG1A 1NX1A 3OP0A 1YUUA 3WHTB 1CLBA 4OKHA 4WQ3A 2LVJA 1KQMC 3AAJA 1PSBA 2MHHA 3PSRA 1SR6B 1V1FA 2YGUA 1GM0A 3NHIA 4MBEA 4MZLA 1SY9A 3I5HC 4A4CA 2EC6B 3E3RA 2L50A 1BF5A 1OOHA 4BY5A 3BQ3A 1TNXA 2L98A 3B86A 1N2DA 2K7OA 4IJ7A 2M0RA 1Y1UA 2NLNA 5KTYA 1IRJA 1DJZA 1K9KA 1Y1XA 1OOFA 2LP3A 3I5IB 1MHOA 3S0BA 1AJ5A 5B8IB 4MVFA 1RK9A 1A75A 1TUJA 2KBMA 2JPOA 1AHRA 4QJ5B 4PHMA 5I2QA 4PE7A 1J7RA 1AVSA 4PHKA 1QVIZ 1YX8A 3BUXB 5AEQA 1XVJA 1B47A 2FCDA 2KAXA 2L5YA 4HSZA 5CSFA 1Y6WA 3GK4X 1DJHA 1QXPA 2NZ0A 3CYZA 1J7OA 3OHMB 4I5LB 5J3XA 2AAOA 1XO5A 2PASA 1L2OB 4YI8A 1QS7A 3R1OA 1K2HA 1SR6C 3EVUA 2WCMA 4ORBB 1PVAA 5I94A 4M2OA 2LVVA 2LP2A 2BBNA 5TNCA 3CZ0A 2H61A 3SG6A 2I2RE 3TS5B 4AOMA 1CLMA 3DVKA 1OMDA 3SS4A 2RGIA 3N7HA 2R2IA 5KU1A 1E8AA 1F8HA 2LCPA 2ZN9A 3I5IC 2KFHA 1ALVA 1DGVA 1DTLA 1JF2A 2KDHA 2F33A 3HX4A 4JQ0D 4UPGA 1FPWA 3LK1A 1KFXL 3OX6A 3K1EA 1ODBA 1Y1AA 3CR5X 4P2YB 2KGBC 1M31A 2BL0C 4ORAB 2F8PA 1OMVA 2GGMA 1FF1A 1PULA 3BUWB 4OV2A 3QRXA 1IQ5A 4L9MA 2JU0A 3IF7A 1JC2A 1EG3A 5CSIA 1EL4A 1NCXA 1TWOA 3R72A 1TCFA 5AXIA 1UHJA 3I5FB 2F3ZA 4GGNA 2LMUA 3BOWA 1BR4B 4ZCUA 1CM1A 1QJTA 1UP5A 3EVVA 1XK4A 2PRUA 3BOWB 1IIOA 1A2XA 1PSRA 1DELA 1Z4HA 2K2AA 2OTGC 2M7NA 1WDCC 4R1EA 3SS5A 3TS5C 1CFDA 1BLQA 3WNXB 2HQWA 2LNKA 3DZTA 3D76A 1J1DA 3L4LA 2LE9B 3UO9A 1EH2A 3EK8A 1K95A 1IJ6A 5D7FA 2KGRA 1QV1A 1K9PA 1RFJA 3O2PA 3EG5B 3TZ1A 1SPYA 3SG7A 1BR1B 2I7AA 2OPOA 3PJIA 4QJ4B 2K7CA 5FI2A 1OSAA 1L7ZA 1LINA 3CZ1A 1MF8B 5FI7A 2ZKMX 2M1KB 3D74A 4N5XA 2I94A 1KQVA 1KQMB 4KYNA 1JF0A 5GQQC 1KK7Y 4CFQA 1JBAA 2QEVA 5AANA 3SS3A 3VRPA 4YRUA 3I5HB 3NSIA 1QLKA 2KNEA 2WOSA 3FS7A 3GK1A 1B8CA 1TTXA 2FCEA 4JWQA 3EKJA 3I5FC 3DVJA 1YVHA 3VRNA 1KK7Z 2TN4A 2CCMA 1B7TZ 2KFGA 3B88A 2A4JA 4P5OE 2D8NA 1AP4A 2KBIA 5I8NA 1DT7B 2K7BA 2FJUB 5CSJA 1MUXA 5HL1A 2CXJA 1NYAA 3GK2A 4INWA 1B1GA 3S0AA 1B4CA 4XYNA 1P28A 1YR5A 3PFVA 4DCKA 3NGVA 1BMOA 2KI6C 1QTXA 2M8UA 1JUOA 2ISDA 1HQVA 1SL7A 1YRUB 1XFRA 2LUXA 1OOGA 5EL2A 2L5XB 2BKHB 2L2CA 4GFTA 5JOLA 1J55A 1DC1A 4GGFC 2COLB 2M9GA 4M2QA 1H4BA 4DS7A 2WCBA 4HREE 4CFRA 1WRKA 1D1OA 2P70A 1OZSA 3RZSA 2ZNDA 1KFUL 2KOTA 4NDBA 3FWBA 1IH0A 2WC6A 5HKZA 2LHLA 2QEBA 3VRRA 2JT8A 1DVIA 4F0ZB 3Q8IA 1QVIY 3PLFB 1FW4A 5JJGA 2KAVA 1OMRA 5CSNA 4MEWA 3SIBA 2L4HA 2WCKA 2SASA 3AKBA 3DVMA 3SG4A 1NCZA 3B6XA 3PN7C 1M63B 3I5GB 1ZUZA 2LUCA 1NPQA 2BE4A 2HETA 3BFHA 4TNCA 3SG2A 1ORGA 3D10A 2BL0B 2QACA 3EKHA 2NCPA 3BXKA 3KF9A 1XFWO 1K90D 1SCMC 3LLEA 1CMGA 1B8RA 2BCXA 3CR4X 4DRWA 3WHUB 2L51A 2CTNA 2LMVA 1CFCA 2ZNEA 1AUIB 3JTDC 3PM2A 3GOFA 5ER5A 4JD9A 1SRAA 3WXAA 5DKRA 5HLVA 3RLZA 1GGZA 4MRYA 1DMOA 1CFFA 2EHBA 2OTGB 2K8MB 1WDCB 3OB2B 2NXQA 3L47A 1C07A 2V53A 3S0FA 3F45A 4PALA 1PVBA 1DGUA 4C0JA 4GPLB 1SCVA 3L4AA 5DKQA 1TRFA 3AKAA 1BODA 2SCPA 3DYEA 4NQGA 1UWOA 3CS1A 4HRHA 4PE0A 3M0WA 4YGDB 3DF0A 4YGBB 1NX2A 2E6WA 3I5GC 1CDMA 2MRDA 1LA3A 3CGAA 1CNPA 5IBWA 2JNFA 3DF0B 3FE8A 5BPJA 2LAPA 3AAKA 1DJYA 1IWQA 5AFPA 1OE9B 1TOPA 1YUTA 1IQ3A 1TUZA 2MJWB 4PCWA 4XJKB 1QX5B 1C3YA 5D3OA 2BE6A 2EGDA 1FI6A 2PVBA 2E30A 2MA2A 2ZN8A 2HF5A 1K96A 2BNXA 2LMTA 3D78A 3VGOA 1RJVA 2F3YA 2KQ6A 1KSMA 1SSEB 4MRXA 1PRWA 1OZOA 3VRQA 1BU3A 4OR9B 4IL1A 2Y4QA 1WRLA 2CT9A 2LC5A 3O4YA 1NX0A 1Z2CB 4N1FA 3KHEA 4F7FA 2HQ8A 3CZTX 3D73A 5CPVA 1FBVA 1KSOA 1UUSA 1G33A 2LVKA 1CB1A 1B8LA 3OBVA 2LM5A 1CTRA 3CZ2A 1QX2A 3OB1B 4ETOA 2K60A 2BECA 3ZWHA 4HRGA 1C7VA 1XYDA 1LA0A 1S5GZ 2JZIA 2KYCA 1KK8B 2JXLA 2KPHA 1IGVA 1U5IA 2LVIA 4MZJA 2Q91A 3OX5A 2JQ6A 2P71A 2FJYA 1T14A 2ERBA 4OCIA 4GGFA 2MLEC 1U5IB 1QX7A 3DY9A 1DJXA 1G4YR 3FWCA 2HPSA 1S6IA 1SNLA 2WCJA 4MN0A 3ZNIA 1B7TY 1NUBA 2DOQA 4MLWA 4ZCVA 1LKJA 4YGEB 1F70A 2BKIB 2K2FA 2L4IA 3IQQA 1QIWA 5HLOA 5D69A 5DICA 1A03A 1K94A 1CMFA 4GUKA 3EK4A 3DVEA 1XFXO 2QEOA 5PALA 2KSPA 3BJHA 2MAZA 3NSKA 2CNPA 1M45A 2WCEA 3BUMB 1W7IB 3QMEA 1ZMZA 1MR8A 5ER4X 4YGAA 1TIZA 4A4BA 1CDPA 3KEVA 3PN7B 3R1PA 4CLNA 3UNWA 1OW4A 2H2KA 3TUYB 3VB1A 1TNQA 4MZKA 5AERA 2LLSA 3SIAA 1N65A 3O6BA 1WY9A 1S6CA 4DIRA 1Q80A 4CIDA 1SCMB 3IQOA 2I18A 1UHHA 4M2PA 2JWWA 1DJIA 1KK8C 5FYXA 3BYAA 4PHNA 1BOCA 4PE4A 3JTDB 1NSHA 2KFFA 3JVTB 4FQOA 1A4PA 1C3ZA 3O4XA 3B87A 3RM1A 1RROA 3CWGA 1YUSA 1F4QA 1ALWA 2M49B 1DF0A 2PMYA 1LVCD 2JTTA 2L2EA 3VROA 5HYDA 1EXRA 2BAPA 4YBHB 5K89A 1DF0B 1MXLC 1TNWA 4E68A 4AQJA 1BJFA 1NIWA 1XFUO 1KWOB 3EK7A 3SJSA 1SL8A 2KLEA 1ZACA 2MBXA 1CM4A 1ZFSA 4C0KA 2LLUA 2K61A 5HKYA 1UHIA 1SBJA 2GV5A 1JWDA 4ICBA 2WC5A 1Y0VH 1WRZA 1PK0D 2BBMA 2CBLA 2Y1MA 3TUYC 1GQMA 2JXCA 3S0GA 1IG5A 2WCHA 1NX3A 1TN4A 1XFYO 2ZFDA 4I5NB 1EJ3A 2WNDA 2KHNA 3OGNA 4USLA 4WRIA 4U8DA 1J1EA 3PALA 4AQIA 1YVLA 2G2BA 2JT3A
chains in the Genus database with same CATH topology
1X02A 1B9AA 2JPTA 1M46A 2O60A 3BUOB 3JVTC 3CTNA 5KSZA 1DJGA 2WORA 2MLFC 1SMGA 3ICBA 3PM8A 1S3PA 3EVRA 1BT6A 1CLLA 4YGCB 1CDLA 1UHNA 1A29A 3BUNB 4NDDA 1A75B 4DUQA 3KO0A 1KWOC 1M39A 2M29A 2PALA 3FIAA 1W7JB 3LL8B 2KI6D 1SKTA 1F71A 3D0YA 3CR2A 3NXAA 2Y5IA 1CDNA 2Q4UA 1G8IA 1V1GA 2M7LA 3D0YB 1TCOB 2WCFA 4WQ2A 4CPVA 1KCYA 1C7WA 1OOJA 2K7DA 1TNPA 2M97A 4GNKB 5I2OA 1S6JA 4XJKA 1H8BA 1XFVO 2AMIA 1OQPA 3LK0A 1JFJA 3TDUA 1CKKA 3MSEB 2EC6C 2JT0A 1YX7A 1FI5A 2M1UA 5I2LA 1SL9A 2OS8B 1J7QA 4ORCB 2B1UA 2G9BA 4FTGA 1NCYA 1AJ4A 1WLMA 1XA5A 3NSLA 1JSAA 2WC8A 4C0LA 1QATA 4I5JA 2FOTA 1S5GY 3PATA 1SW8A 2LLTA 1KFUS 4PDZA 1YURA 2JRFA 2LV7A 2KYFA 2JOJA 1GJYA 5DKNA 2GGZA 1DJWA 2LANA 2JULA 3O78A 4GAOA 4JPZB 2AUCA 4YI9A 3TDIA 3NSOA 1MQ1A 1SK6D 3H4SE 2KI4B 2BCBA 1L2OC 2JTZA 2F2PA 1YTZC 1RWYA 3KPXA 3HCMA 2L0PA 1S1EA 1F54A 3A8RA 1S36A 1F4OA 1N0YA 1VRKA 2KAYA 2OS8C 1F55A 2H61C 2NCOA 1QASA 1QIVA 1XFZO 1YRTB 3A4UB 4PE1A 4D1EA 2QPTA 1LXFC 4QJ3B 3C1VA 1MXEA 1IJ5A 1SYMA 3TDZA 1CFPA 1K9UA 1NP8A 2P6BB 1NWDA 1J7PA 1S26D 1UURA 1AK8A 4NDCA 1R6PA 1IKUA 4PHJA 3LCPC 1HT9A 1PALA 4BY4A 3CLNA 2BCAA 2ZRSA 1WLZA 2F2OA 1QV0A 4OVNF 1MWNA 1KFXS 1ZOTB 2KI4C 1K8UA 5G08A 2M3WA 2Y1NA 2JNXA 4GBAA 4N1GA 1GGWA 5HKWA 3DD4A 2ZRTA 1RECA 1XK4C 2KQYA 2IS9A 3K21A 1QLSA 2O5GA 4MSPA 2JC2A 3SG5A 4I5KA 2PSRA 1RTP1 1UHKA 1JFKA 1EG4A 2VRGA 3SG3A 1K93D 1R2UA 4Q04A 2LHIA 2K0JA 1BG1A 1NX1A 3OP0A 1YUUA 3WHTB 1CLBA 4OKHA 4WQ3A 2LVJA 1KQMC 3AAJA 1PSBA 2MHHA 3PSRA 1SR6B 1V1FA 4MBEA 4MZLA 1SY9A 3I5HC 4A4CA 2EC6B 3E3RA 2L50A 1BF5A 4BY5A 3BQ3A 1TNXA 2L98A 1N2DA 2K7OA 2M0RA 1Y1UA 2NLNA 5KTYA 1IRJA 1DJZA 1K9KA 1Y1XA 2LP3A 3I5IB 1MHOA 1AJ5A 5B8IB 4MVFA 1RK9A 1A75A 2KBMA 4QJ5B 1AHRA 4PHMA 5I2QA 4PE7A 1J7RA 1AVSA 4PHKA 1QVIZ 1YX8A 3BUXB 5AEQA 1XVJA 1B47A 2FCDA 2KAXA 4HSZA 5CSFA 1Y6WA 3GK4X 1DJHA 1QXPA 2NZ0A 1J7OA 3OHMB 4I5LB 5J3XA 2AAOA 1XO5A 2PASA 1L2OB 4YI8A 1QS7A 1K2HA 1SR6C 3EVUA 4ORBB 1PVAA 4M2OA 2LVVA 2LP2A 2BBNA 5TNCA 3TS5B 2H61A 3SG6A 2I2RE 4AOMA 1CLMA 3DVKA 1OMDA 2RGIA 5KU1A 2R2IA 1E8AA 1F8HA 2LCPA 2ZN9A 3I5IC 2KFHA 1ALVA 1DGVA 1DTLA 1JF2A 2KDHA 2F33A 3HX4A 4JQ0D 4UPGA 1FPWA 3LK1A 1KFXL 3OX6A 1ODBA 1Y1AA 3CR5X 4P2YB 2KGBC 1M31A 2BL0C 4ORAB 2F8PA 1OMVA 2GGMA 1FF1A 1PULA 3BUWB 4OV2A 3QRXA 1IQ5A 4L9MA 2JU0A 3IF7A 1JC2A 1EG3A 5CSIA 1EL4A 1NCXA 1TCFA 5AXIA 1UHJA 3I5FB 2F3ZA 4GGNA 2LMUA 3BOWA 1BR4B 4ZCUA 1CM1A 1QJTA 1UP5A 3EVVA 1XK4A 2PRUA 3BOWB 1A2XA 1PSRA 4R1EA 2K2AA 2OTGC 2M7NA 1WDCC 3TS5C 1CFDA 1BLQA 3WNXB 2HQWA 2LNKA 1J1DA 2LE9B 1EH2A 3EK8A 1K95A 1IJ6A 5D7FA 2KGRA 1QV1A 1K9PA 1RFJA 3O2PA 3TZ1A 1SPYA 3SG7A 1BR1B 2I7AA 2OPOA 4QJ4B 2K7CA 1OSAA 1L7ZA 1LINA 1MF8B 2ZKMX 2M1KB 4N5XA 2I94A 1KQVA 1KQMB 1JF0A 5GQQC 1KK7Y 4CFQA 1JBAA 5AANA 3VRPA 4YRUA 3I5HB 3NSIA 1QLKA 2KNEA 2WOSA 3FS7A 3GK1A 1B8CA 1TTXA 2FCEA 4JWQA 3EKJA 3I5FC 3DVJA 1YVHA 3VRNA 1KK7Z 2TN4A 2CCMA 1B7TZ 2KFGA 2A4JA 4P5OE 2D8NA 1AP4A 2KBIA 5I8NA 1DT7B 2K7BA 2FJUB 5CSJA 1MUXA 2CXJA 1NYAA 3GK2A 1B1GA 1B4CA 4XYNA 1YR5A 4DCKA 3PFVA 1BMOA 2KI6C 1QTXA 2M8UA 1JUOA 2ISDA 1HQVA 1SL7A 1YRUB 2LUXA 2L5XB 2BKHB 4GFTA 5JOLA 1J55A 4GGFC 2COLB 2M9GA 4M2QA 1H4BA 4DS7A 2WCBA 4HREE 4CFRA 1WRKA 1D1OA 1OZSA 2ZNDA 1KFUL 2KOTA 4NDBA 3FWBA 1IH0A 5HKZA 2LHLA 3VRRA 2JT8A 1DVIA 4F0ZB 1QVIY 3PLFB 1FW4A 5JJGA 2KAVA 1OMRA 5CSNA 4MEWA 3SIBA 2L4HA 3SG4A 2SASA 3AKBA 3DVMA 1NCZA 3PN7C 1M63B 3I5GB 1ZUZA 2LUCA 1NPQA 2BE4A 2HETA 4TNCA 3SG2A 3D10A 2BL0B 2QACA 3EKHA 2NCPA 3BXKA 3KF9A 1XFWO 1K90D 1SCMC 3LLEA 1CMGA 1B8RA 2BCXA 3CR4X 4DRWA 3WHUB 2L51A 2CTNA 2LMVA 1CFCA 2ZNEA 1AUIB 3JTDC 3GOFA 5ER5A 1SRAA 3WXAA 5DKRA 5HLVA 3RLZA 1GGZA 4MRYA 1DMOA 1CFFA 2EHBA 2OTGB 2K8MB 1WDCB 3OB2B 2NXQA 1C07A 2V53A 3F45A 4PALA 1PVBA 1DGUA 4C0JA 4GPLB 1SCVA 5DKQA 1TRFA 3AKAA 1BODA 2SCPA 4YGDB 4NQGA 1UWOA 3CS1A 4HRHA 4PE0A 3M0WA 4YGBB 3DF0A 5F6TA 1NX2A 2E6WA 3I5GC 1CDMA 2MRDA 1LA3A 3CGAA 1CNPA 5IBWA 2JNFA 3DF0B 5BPJA 2LAPA 3AAKA 1DJYA 1IWQA 5AFPA 1OE9B 1TOPA 1YUTA 1IQ3A 2MJWB 4PCWA 4XJKB 1QX5B 2BE6A 2EGDA 1FI6A 2PVBA 2E30A 2MA2A 2ZN8A 2HF5A 1K96A 2LMTA 3VGOA 1RJVA 2F3YA 2KQ6A 1KSMA 4MRXA 1PRWA 1OZOA 3VRQA 1BU3A 4OR9B 4IL1A 2Y4QA 1WRLA 2CT9A 2LC5A 3O4YA 1NX0A 4N1FA 3KHEA 2HQ8A 3CZTX 5CPVA 1FBVA 1KSOA 1UUSA 1G33A 2LVKA 1CB1A 1B8LA 2LM5A 1CTRA 1QX2A 3OB1B 4ETOA 2BECA 3ZWHA 4HRGA 1C7VA 1XYDA 1LA0A 1S5GZ 2JZIA 2KYCA 1KK8B 2JXLA 1IGVA 1U5IA 2LVIA 4MZJA 2Q91A 3OX5A 2JQ6A 4OCIA 4GGFA 2MLEC 1U5IB 1QX7A 3FWCA 1DJXA 1G4YR 2HPSA 1S6IA 1SNLA 4MN0A 3ZNIA 1B7TY 1NUBA 2DOQA 4MLWA 4ZCVA 1LKJA 4YGEB 1F70A 2BKIB 2K2FA 2L4IA 3IQQA 1QIWA 5HLOA 5D69A 1A03A 1K94A 1CMFA 4GUKA 3EK4A 3DVEA 1XFXO 5PALA 2KSPA 2MAZA 3NSKA 2CNPA 1M45A 2WCEA 3BUMB 1W7IB 1ZMZA 1MR8A 5ER4X 4YGAA 1TIZA 4A4BA 1CDPA 3KEVA 3PN7B 4CLNA 2H2KA 3TUYB 1TNQA 4MZKA 5AERA 2LLSA 3SIAA 1N65A 3O6BA 1WY9A 1S6CA 4DIRA 1Q80A 4CIDA 1SCMB 3IQOA 2I18A 1UHHA 4M2PA 2JWWA 1DJIA 1KK8C 5FYXA 3BYAA 4PHNA 1BOCA 4PE4A 3JTDB 1NSHA 2KFFA 3JVTB 4FQOA 1A4PA 3RM1A 1RROA 3CWGA 1YUSA 1F4QA 1ALWA 2M49B 1DF0A 2PMYA 1LVCD 2JTTA 2L2EA 3VROA 5HYDA 1EXRA 4YBHB 5K89A 4E68A 1DF0B 1MXLC 1TNWA 4AQJA 1BJFA 1NIWA 1XFUO 1KWOB 3EK7A 3SJSA 1SL8A 1ZACA 2MBXA 1CM4A 1ZFSA 4C0KA 2LLUA 2K61A 5HKYA 1UHIA 1SBJA 2GV5A 1JWDA 4ICBA 1Y0VH 1WRZA 1PK0D 2BBMA 2CBLA 2Y1MA 3TUYC 1GQMA 2JXCA 1IG5A 1NX3A 1TN4A 1XFYO 2ZFDA 4I5NB 1EJ3A 2WNDA 2KHNA 4USLA 4WRIA 4U8DA 1J1EA 3PALA 4AQIA 1YVLA 2G2BA 2JT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X02 A;  1B9A A;  2JPT A;  1M46 A;  2O60 A;  3BUO B;  3JVT C;  3CTN A;  5KSZ A;  1DJG A;  2WOR A;  2MLF C;  1SMG A;  3ICB A;  3PM8 A;  1S3P A;  3EVR A;  1BT6 A;  1CLL A;  4YGC B;  1CDL A;  1UHN A;  1A29 A;  3BUN B;  4NDD A;  1A75 B;  4DUQ A;  3KO0 A;  1KWO C;  1M39 A;  2M29 A;  2PAL A;  3FIA A;  1W7J B;  3LL8 B;  2KI6 D;  1SKT A;  1F71 A;  3D0Y A;  3CR2 A;  3NXA A;  2Y5I A;  1CDN A;  2Q4U A;  1G8I A;  1V1G A;  2M7L A;  3D0Y B;  1TCO B;  2WCF A;  4WQ2 A;  4CPV A;  1KCY A;  1C7W A;  1OOJ A;  2K7D A;  1TNP A;  2M97 A;  4GNK B;  5I2O A;  1S6J A;  4XJK A;  1H8B A;  1XFV O;  2AMI A;  1OQP A;  3LK0 A;  1JFJ A;  3TDU A;  1CKK A;  3MSE B;  2EC6 C;  2JT0 A;  1YX7 A;  1FI5 A;  2M1U A;  5I2L A;  1SL9 A;  2OS8 B;  1J7Q A;  4ORC B;  2B1U A;  2G9B A;  4FTG A;  1NCY A;  1AJ4 A;  1WLM A;  1XA5 A;  3NSL A;  1JSA A;  2WC8 A;  4C0L A;  1QAT A;  4I5J A;  2FOT A;  1S5G Y;  3PAT A;  1SW8 A;  2LLT A;  1KFU S;  4PDZ A;  1YUR A;  2JRF A;  2LV7 A;  2KYF A;  2JOJ A;  1GJY A;  5DKN A;  2GGZ A;  1DJW A;  2LAN A;  2JUL A;  3O78 A;  4GAO A;  4JPZ B;  2AUC A;  4YI9 A;  3TDI A;  3NSO A;  1MQ1 A;  1SK6 D;  3H4S E;  2KI4 B;  2BCB A;  1L2O C;  2JTZ A;  2F2P A;  1YTZ C;  1RWY A;  3KPX A;  3HCM A;  2L0P A;  1S1E A;  1F54 A;  3A8R A;  1S36 A;  1F4O A;  1N0Y A;  1VRK A;  2KAY A;  2OS8 C;  1F55 A;  2H61 C;  2NCO A;  1QAS A;  1QIV A;  1XFZ O;  1YRT B;  3A4U B;  4PE1 A;  4D1E A;  2QPT A;  1LXF C;  4QJ3 B;  3C1V A;  1MXE A;  1IJ5 A;  1SYM A;  3TDZ A;  1CFP A;  1K9U A;  1NP8 A;  2P6B B;  1NWD A;  1J7P A;  1S26 D;  1UUR A;  1AK8 A;  4NDC A;  1R6P A;  1IKU A;  4PHJ A;  3LCP C;  1HT9 A;  1PAL A;  4BY4 A;  3CLN A;  2BCA A;  2ZRS A;  1WLZ A;  2F2O A;  1QV0 A;  4OVN F;  1MWN A;  1KFX S;  1ZOT B;  2KI4 C;  1K8U A;  5G08 A;  2M3W A;  2Y1N A;  2JNX A;  4GBA A;  4N1G A;  1GGW A;  5HKW A;  3DD4 A;  2ZRT A;  1REC A;  1XK4 C;  2KQY A;  2IS9 A;  3K21 A;  1QLS A;  2O5G A;  4MSP A;  2JC2 A;  3SG5 A;  4I5K A;  2PSR A;  1RTP 1;  1UHK A;  1JFK A;  1EG4 A;  2VRG A;  3SG3 A;  1K93 D;  1R2U A;  4Q04 A;  2LHI A;  2K0J A;  1BG1 A;  1NX1 A;  3OP0 A;  1YUU A;  3WHT B;  1CLB A;  4OKH A;  4WQ3 A;  2LVJ A;  1KQM C;  3AAJ A;  1PSB A;  2MHH A;  3PSR A;  1SR6 B;  1V1F A;  4MBE A;  4MZL A;  1SY9 A;  3I5H C;  4A4C A;  2EC6 B;  3E3R A;  2L50 A;  1BF5 A;  4BY5 A;  3BQ3 A;  1TNX A;  2L98 A;  1N2D A;  2K7O A;  2M0R A;  1Y1U A;  2NLN A;  5KTY A;  1IRJ A;  1DJZ A;  1K9K A;  1Y1X A;  2LP3 A;  3I5I B;  1MHO A;  1AJ5 A;  5B8I B;  4MVF A;  1RK9 A;  1A75 A;  2KBM A;  4QJ5 B;  1AHR A;  4PHM A;  5I2Q A;  4PE7 A;  1J7R A;  1AVS A;  4PHK A;  1QVI Z;  1YX8 A;  3BUX B;  5AEQ A;  1XVJ A;  1B47 A;  2FCD A;  2KAX A;  4HSZ A;  5CSF A;  1Y6W A;  3GK4 X;  1DJH A;  1QXP A;  2NZ0 A;  1J7O A;  3OHM B;  4I5L B;  5J3X A;  2AAO A;  1XO5 A;  2PAS A;  1L2O B;  4YI8 A;  1QS7 A;  1K2H A;  1SR6 C;  3EVU A;  4ORB B;  1PVA A;  4M2O A;  2LVV A;  2LP2 A;  2BBN A;  5TNC A;  3TS5 B;  2H61 A;  3SG6 A;  2I2R E;  4AOM A;  1CLM A;  3DVK A;  1OMD A;  2RGI A;  5KU1 A;  2R2I A;  1E8A A;  1F8H A;  2LCP A;  2ZN9 A;  3I5I C;  2KFH A;  1ALV A;  1DGV A;  1DTL A;  1JF2 A;  2KDH A;  2F33 A;  3HX4 A;  4JQ0 D;  4UPG A;  1FPW A;  3LK1 A;  1KFX L;  3OX6 A;  1ODB A;  1Y1A A;  3CR5 X;  4P2Y B;  2KGB C;  1M31 A;  2BL0 C;  4ORA B;  2F8P A;  1OMV A;  2GGM A;  1FF1 A;  1PUL A;  3BUW B;  4OV2 A;  3QRX A;  1IQ5 A;  4L9M A;  2JU0 A;  3IF7 A;  1JC2 A;  1EG3 A;  5CSI A;  1EL4 A;  1NCX A;  1TCF A;  5AXI A;  1UHJ A;  3I5F B;  2F3Z A;  4GGN A;  2LMU A;  3BOW A;  1BR4 B;  4ZCU A;  1CM1 A;  1QJT A;  1UP5 A;  3EVV A;  1XK4 A;  2PRU A;  3BOW B;  1A2X A;  1PSR A;  4R1E A;  2K2A A;  2OTG C;  2M7N A;  1WDC C;  3TS5 C;  1CFD A;  1BLQ A;  3WNX B;  2HQW A;  2LNK A;  1J1D A;  2LE9 B;  1EH2 A;  3EK8 A;  1K95 A;  1IJ6 A;  5D7F A;  2KGR A;  1QV1 A;  1K9P A;  1RFJ A;  3O2P A;  3TZ1 A;  1SPY A;  3SG7 A;  1BR1 B;  2I7A A;  2OPO A;  4QJ4 B;  2K7C A;  1OSA A;  1L7Z A;  1LIN A;  1MF8 B;  2ZKM X;  2M1K B;  4N5X A;  2I94 A;  1KQV A;  1KQM B;  1JF0 A;  5GQQ C;  1KK7 Y;  4CFQ A;  1JBA A;  5AAN A;  3VRP A;  4YRU A;  3I5H B;  3NSI A;  1QLK A;  2KNE A;  2WOS A;  3FS7 A;  3GK1 A;  1B8C A;  1TTX A;  2FCE A;  4JWQ A;  3EKJ A;  3I5F C;  3DVJ A;  1YVH A;  3VRN A;  1KK7 Z;  2TN4 A;  2CCM A;  1B7T Z;  2KFG A;  2A4J A;  4P5O E;  2D8N A;  1AP4 A;  2KBI A;  5I8N A;  1DT7 B;  2K7B A;  2FJU B;  5CSJ A;  1MUX A;  2CXJ A;  1NYA A;  3GK2 A;  1B1G A;  1B4C A;  4XYN A;  1YR5 A;  4DCK A;  3PFV A;  1BMO A;  2KI6 C;  1QTX A;  2M8U A;  1JUO A;  2ISD A;  1HQV A;  1SL7 A;  1YRU B;  2LUX A;  2L5X B;  2BKH B;  4GFT A;  5JOL A;  1J55 A;  4GGF C;  2COL B;  2M9G A;  4M2Q A;  1H4B A;  4DS7 A;  2WCB A;  4HRE E;  4CFR A;  1WRK A;  1D1O A;  1OZS A;  2ZND A;  1KFU L;  2KOT A;  4NDB A;  3FWB A;  1IH0 A;  5HKZ A;  2LHL A;  3VRR A;  2JT8 A;  1DVI A;  4F0Z B;  1QVI Y;  3PLF B;  1FW4 A;  5JJG A;  2KAV A;  1OMR A;  5CSN A;  4MEW A;  3SIB A;  2L4H A;  3SG4 A;  2SAS A;  3AKB A;  3DVM A;  1NCZ A;  3PN7 C;  1M63 B;  3I5G B;  1ZUZ A;  2LUC A;  1NPQ A;  2BE4 A;  2HET A;  4TNC A;  3SG2 A;  3D10 A;  2BL0 B;  2QAC A;  3EKH A;  2NCP A;  3BXK A;  3KF9 A;  1XFW O;  1K90 D;  1SCM C;  3LLE A;  1CMG A;  1B8R A;  2BCX A;  3CR4 X;  4DRW A;  3WHU B;  2L51 A;  2CTN A;  2LMV A;  1CFC A;  2ZNE A;  1AUI B;  3JTD C;  3GOF A;  5ER5 A;  1SRA A;  3WXA A;  5DKR A;  5HLV A;  3RLZ A;  1GGZ A;  4MRY A;  1DMO A;  1CFF A;  2EHB A;  2OTG B;  2K8M B;  1WDC B;  3OB2 B;  2NXQ A;  1C07 A;  2V53 A;  3F45 A;  4PAL A;  1PVB A;  1DGU A;  4C0J A;  4GPL B;  1SCV A;  5DKQ A;  1TRF A;  3AKA A;  1BOD A;  2SCP A;  4YGD B;  4NQG A;  1UWO A;  3CS1 A;  4HRH A;  4PE0 A;  3M0W A;  4YGB B;  3DF0 A;  5F6T A;  1NX2 A;  2E6W A;  3I5G C;  1CDM A;  2MRD A;  1LA3 A;  3CGA A;  1CNP A;  5IBW A;  2JNF A;  3DF0 B;  5BPJ A;  2LAP A;  3AAK A;  1DJY A;  1IWQ A;  5AFP A;  1OE9 B;  1TOP A;  1YUT A;  1IQ3 A;  2MJW B;  4PCW A;  4XJK B;  1QX5 B;  2BE6 A;  2EGD A;  1FI6 A;  2PVB A;  2E30 A;  2MA2 A;  2ZN8 A;  2HF5 A;  1K96 A;  2LMT A;  3VGO A;  1RJV A;  2F3Y A;  2KQ6 A;  1KSM A;  4MRX A;  1PRW A;  1OZO A;  3VRQ A;  1BU3 A;  4OR9 B;  4IL1 A;  2Y4Q A;  1WRL A;  2CT9 A;  2LC5 A;  3O4Y A;  1NX0 A;  4N1F A;  3KHE A;  2HQ8 A;  3CZT X;  5CPV A;  1FBV A;  1KSO A;  1UUS A;  1G33 A;  2LVK A;  1CB1 A;  1B8L A;  2LM5 A;  1CTR A;  1QX2 A;  3OB1 B;  4ETO A;  2BEC A;  3ZWH A;  4HRG A;  1C7V A;  1XYD A;  1LA0 A;  1S5G Z;  2JZI A;  2KYC A;  1KK8 B;  2JXL A;  1IGV A;  1U5I A;  2LVI A;  4MZJ A;  2Q91 A;  3OX5 A;  2JQ6 A;  4OCI A;  4GGF A;  2MLE C;  1U5I B;  1QX7 A;  3FWC A;  1DJX A;  1G4Y R;  2HPS A;  1S6I A;  1SNL A;  4MN0 A;  3ZNI A;  1B7T Y;  1NUB A;  2DOQ A;  4MLW A;  4ZCV A;  1LKJ A;  4YGE B;  1F70 A;  2BKI B;  2K2F A;  2L4I A;  3IQQ A;  1QIW A;  5HLO A;  5D69 A;  1A03 A;  1K94 A;  1CMF A;  4GUK A;  3EK4 A;  3DVE A;  1XFX O;  5PAL A;  2KSP A;  2MAZ A;  3NSK A;  2CNP A;  1M45 A;  2WCE A;  3BUM B;  1W7I B;  1ZMZ A;  1MR8 A;  5ER4 X;  4YGA A;  1TIZ A;  4A4B A;  1CDP A;  3KEV A;  3PN7 B;  4CLN A;  2H2K A;  3TUY B;  1TNQ A;  4MZK A;  5AER A;  2LLS A;  3SIA A;  1N65 A;  3O6B A;  1WY9 A;  1S6C A;  4DIR A;  1Q80 A;  4CID A;  1SCM B;  3IQO A;  2I18 A;  1UHH A;  4M2P A;  2JWW A;  1DJI A;  1KK8 C;  5FYX A;  3BYA A;  4PHN A;  1BOC A;  4PE4 A;  3JTD B;  1NSH A;  2KFF A;  3JVT B;  4FQO A;  1A4P A;  3RM1 A;  1RRO A;  3CWG A;  1YUS A;  1F4Q A;  1ALW A;  2M49 B;  1DF0 A;  2PMY A;  1LVC D;  2JTT A;  2L2E A;  3VRO A;  5HYD A;  1EXR A;  4YBH B;  5K89 A;  4E68 A;  1DF0 B;  1MXL C;  1TNW A;  4AQJ A;  1BJF A;  1NIW A;  1XFU O;  1KWO B;  3EK7 A;  3SJS A;  1SL8 A;  1ZAC A;  2MBX A;  1CM4 A;  1ZFS A;  4C0K A;  2LLU A;  2K61 A;  5HKY A;  1UHI A;  1SBJ A;  2GV5 A;  1JWD A;  4ICB A;  1Y0V H;  1WRZ A;  1PK0 D;  2BBM A;  2CBL A;  2Y1M A;  3TUY C;  1GQM A;  2JXC A;  1IG5 A;  1NX3 A;  1TN4 A;  1XFY O;  2ZFD A;  4I5N B;  1EJ3 A;  2WND A;  2KHN A;  4USL A;  4WRI A;  4U8D A;  1J1E A;  3PAL A;  4AQI A;  1YVL A;  2G2B A;  2JT3 A; 
#chains in the Genus database with same CATH topology
 1X02 A;  1B9A A;  2JPT A;  1M46 A;  2O60 A;  3BUO B;  3JVT C;  3S0E A;  3CTN A;  5KSZ A;  1DJG A;  2WOR A;  2MLF C;  1OOI X;  1SMG A;  3ICB A;  3PM8 A;  1S3P A;  3EVR A;  1BT6 A;  1CLL A;  1QWV A;  4INX A;  4YGC B;  1CDL A;  1UHN A;  1A29 A;  3BUN B;  4NDD A;  1A75 B;  4DUQ A;  2QDI A;  3KO0 A;  1KWO C;  1M39 A;  2M29 A;  2PAL A;  3FIA A;  1W7J B;  3LL8 B;  2KI6 D;  3R1V A;  1SKT A;  1DEK A;  1F71 A;  3D0Y A;  3CR2 A;  3NXA A;  2Y5I A;  1CDN A;  2Q4U A;  1G8I A;  1V1G A;  2M7L A;  3D0Y B;  3S0D A;  1TCO B;  2WCF A;  4WQ2 A;  4CPV A;  1KCY A;  1C7W A;  1OOJ A;  2K7D A;  4JKT A;  1TNP A;  2M97 A;  4GNK B;  5I2O A;  1S6J A;  4XJK A;  1H8B A;  1XFV O;  2AMI A;  1OQP A;  2KLD A;  3LK0 A;  3TDU A;  1JFJ A;  1CKK A;  3IVT A;  3MSE B;  3V2L A;  2EC6 C;  2JT0 A;  2QEH A;  1YX7 A;  1FI5 A;  2M1U A;  5I2L A;  1SL9 A;  2OS8 B;  3B7A A;  1J7Q A;  4ORC B;  2B1U A;  2G9B A;  4FTG A;  1NCY A;  1AJ4 A;  1WLM A;  1XA5 A;  3NSL A;  1JSA A;  2WC8 A;  4C0L A;  1QAT A;  4I5J A;  2FOT A;  1S5G Y;  2PYQ A;  3PAT A;  1SW8 A;  2LLT A;  1KFU S;  2PQL A;  1YUR A;  4PDZ A;  2JRF A;  2LV7 A;  2KYF A;  2JOJ A;  1GJY A;  5DKN A;  2GGZ A;  1DJW A;  2LAN A;  2JUL A;  3O78 A;  4GAO A;  4JPZ B;  2AUC A;  2WCL A;  4YI9 A;  3TDI A;  3NSO A;  1MQ1 A;  1SK6 D;  3H4S E;  4FQT A;  2KI4 B;  2BCB A;  1L2O C;  2JTZ A;  2F2P A;  1YTZ C;  1RWY A;  3KPX A;  3HCM A;  2L0P A;  1S1E A;  3BFB A;  1F54 A;  3A8R A;  1S36 A;  3DXL A;  1F4O A;  1N0Y A;  1VRK A;  3FE6 A;  2KAY A;  2OS8 C;  1F55 A;  2H61 C;  2NCO A;  1QAS A;  1QIV A;  1XFZ O;  1YRT B;  3A4U B;  4PE1 A;  3D77 A;  4D1E A;  4PT1 A;  4OZD A;  2QPT A;  1LXF C;  4QJ3 B;  3C1V A;  1MXE A;  3CAB A;  1IJ5 A;  1SYM A;  3TDZ A;  1CFP A;  1K9U A;  1NP8 A;  2P6B B;  1NWD A;  1J7P A;  3NHT A;  1S26 D;  1UUR A;  1AK8 A;  1DQE A;  3D75 A;  1R6P A;  3BFA A;  4NDC A;  1IKU A;  4PHJ A;  1LS8 A;  3LCP C;  1HT9 A;  1PAL A;  3CDN A;  4BY4 A;  3CLN A;  2BCA A;  2ZRS A;  1WLZ A;  2F2O A;  1QV0 A;  3FE9 A;  4OVN F;  1MWN A;  1KFX S;  1ZOT B;  2KI4 C;  1K8U A;  5G08 A;  2M3W A;  2Y1N A;  2JNX A;  4GBA A;  4N1G A;  1GGW A;  5HKW A;  3DD4 A;  2ZRT A;  1REC A;  1XK4 C;  2KQY A;  2IS9 A;  3K21 A;  1QLS A;  2O5G A;  4MSP A;  2JC2 A;  2GTE A;  1W9Z A;  3SG5 A;  4I5K A;  5FI6 A;  2PSR A;  1RTP 1;  1UHK A;  1JFK A;  1EG4 A;  2VRG A;  2H8V A;  5F6T A;  3SG3 A;  1K93 D;  1R2U A;  4Q04 A;  2LHI A;  2K0J A;  1BG1 A;  1NX1 A;  3OP0 A;  1YUU A;  3WHT B;  1CLB A;  4OKH A;  4WQ3 A;  2LVJ A;  1KQM C;  3AAJ A;  1PSB A;  2MHH A;  3PSR A;  1SR6 B;  1V1F A;  2YGU A;  1GM0 A;  3NHI A;  4MBE A;  4MZL A;  1SY9 A;  3I5H C;  4A4C A;  2EC6 B;  3E3R A;  2L50 A;  1BF5 A;  1OOH A;  4BY5 A;  3BQ3 A;  1TNX A;  2L98 A;  3B86 A;  1N2D A;  2K7O A;  4IJ7 A;  2M0R A;  1Y1U A;  2NLN A;  5KTY A;  1IRJ A;  1DJZ A;  1K9K A;  1Y1X A;  1OOF A;  2LP3 A;  3I5I B;  1MHO A;  3S0B A;  1AJ5 A;  5B8I B;  4MVF A;  1RK9 A;  1A75 A;  1TUJ A;  2KBM A;  2JPO A;  1AHR A;  4QJ5 B;  4PHM A;  5I2Q A;  4PE7 A;  1J7R A;  1AVS A;  4PHK A;  1QVI Z;  1YX8 A;  3BUX B;  5AEQ A;  1XVJ A;  1B47 A;  2FCD A;  2KAX A;  2L5Y A;  4HSZ A;  5CSF A;  1Y6W A;  3GK4 X;  1DJH A;  1QXP A;  2NZ0 A;  3CYZ A;  1J7O A;  3OHM B;  4I5L B;  5J3X A;  2AAO A;  1XO5 A;  2PAS A;  1L2O B;  4YI8 A;  1QS7 A;  3R1O A;  1K2H A;  1SR6 C;  3EVU A;  2WCM A;  4ORB B;  1PVA A;  5I94 A;  4M2O A;  2LVV A;  2LP2 A;  2BBN A;  5TNC A;  3CZ0 A;  2H61 A;  3SG6 A;  2I2R E;  3TS5 B;  4AOM A;  1CLM A;  3DVK A;  1OMD A;  3SS4 A;  2RGI A;  3N7H A;  2R2I A;  5KU1 A;  1E8A A;  1F8H A;  2LCP A;  2ZN9 A;  3I5I C;  2KFH A;  1ALV A;  1DGV A;  1DTL A;  1JF2 A;  2KDH A;  2F33 A;  3HX4 A;  4JQ0 D;  4UPG A;  1FPW A;  3LK1 A;  1KFX L;  3OX6 A;  3K1E A;  1ODB A;  1Y1A A;  3CR5 X;  4P2Y B;  2KGB C;  1M31 A;  2BL0 C;  4ORA B;  2F8P A;  1OMV A;  2GGM A;  1FF1 A;  1PUL A;  3BUW B;  4OV2 A;  3QRX A;  1IQ5 A;  4L9M A;  2JU0 A;  3IF7 A;  1JC2 A;  1EG3 A;  5CSI A;  1EL4 A;  1NCX A;  1TWO A;  3R72 A;  1TCF A;  5AXI A;  1UHJ A;  3I5F B;  2F3Z A;  4GGN A;  2LMU A;  3BOW A;  1BR4 B;  4ZCU A;  1CM1 A;  1QJT A;  1UP5 A;  3EVV A;  1XK4 A;  2PRU A;  3BOW B;  1IIO A;  1A2X A;  1PSR A;  1DEL A;  1Z4H A;  2K2A A;  2OTG C;  2M7N A;  1WDC C;  4R1E A;  3SS5 A;  3TS5 C;  1CFD A;  1BLQ A;  3WNX B;  2HQW A;  2LNK A;  3DZT A;  3D76 A;  1J1D A;  3L4L A;  2LE9 B;  3UO9 A;  1EH2 A;  3EK8 A;  1K95 A;  1IJ6 A;  5D7F A;  2KGR A;  1QV1 A;  1K9P A;  1RFJ A;  3O2P A;  3EG5 B;  3TZ1 A;  1SPY A;  3SG7 A;  1BR1 B;  2I7A A;  2OPO A;  3PJI A;  4QJ4 B;  2K7C A;  5FI2 A;  1OSA A;  1L7Z A;  1LIN A;  3CZ1 A;  1MF8 B;  5FI7 A;  2ZKM X;  2M1K B;  3D74 A;  4N5X A;  2I94 A;  1KQV A;  1KQM B;  4KYN A;  1JF0 A;  5GQQ C;  1KK7 Y;  4CFQ A;  1JBA A;  2QEV A;  5AAN A;  3SS3 A;  3VRP A;  4YRU A;  3I5H B;  3NSI A;  1QLK A;  2KNE A;  2WOS A;  3FS7 A;  3GK1 A;  1B8C A;  1TTX A;  2FCE A;  4JWQ A;  3EKJ A;  3I5F C;  3DVJ A;  1YVH A;  3VRN A;  1KK7 Z;  2TN4 A;  2CCM A;  1B7T Z;  2KFG A;  3B88 A;  2A4J A;  4P5O E;  2D8N A;  1AP4 A;  2KBI A;  5I8N A;  1DT7 B;  2K7B A;  2FJU B;  5CSJ A;  1MUX A;  5HL1 A;  2CXJ A;  1NYA A;  3GK2 A;  4INW A;  1B1G A;  3S0A A;  1B4C A;  4XYN A;  1P28 A;  1YR5 A;  3PFV A;  4DCK A;  3NGV A;  1BMO A;  2KI6 C;  1QTX A;  2M8U A;  1JUO A;  2ISD A;  1HQV A;  1SL7 A;  1YRU B;  1XFR A;  2LUX A;  1OOG A;  5EL2 A;  2L5X B;  2BKH B;  2L2C A;  4GFT A;  5JOL A;  1J55 A;  1DC1 A;  4GGF C;  2COL B;  2M9G A;  4M2Q A;  1H4B A;  4DS7 A;  2WCB A;  4HRE E;  4CFR A;  1WRK A;  1D1O A;  2P70 A;  1OZS A;  3RZS A;  2ZND A;  1KFU L;  2KOT A;  4NDB A;  3FWB A;  1IH0 A;  2WC6 A;  5HKZ A;  2LHL A;  2QEB A;  3VRR A;  2JT8 A;  1DVI A;  4F0Z B;  3Q8I A;  1QVI Y;  3PLF B;  1FW4 A;  5JJG A;  2KAV A;  1OMR A;  5CSN A;  4MEW A;  3SIB A;  2L4H A;  2WCK A;  2SAS A;  3AKB A;  3DVM A;  3SG4 A;  1NCZ A;  3B6X A;  3PN7 C;  1M63 B;  3I5G B;  1ZUZ A;  2LUC A;  1NPQ A;  2BE4 A;  2HET A;  3BFH A;  4TNC A;  3SG2 A;  1ORG A;  3D10 A;  2BL0 B;  2QAC A;  3EKH A;  2NCP A;  3BXK A;  3KF9 A;  1XFW O;  1K90 D;  1SCM C;  3LLE A;  1CMG A;  1B8R A;  2BCX A;  3CR4 X;  4DRW A;  3WHU B;  2L51 A;  2CTN A;  2LMV A;  1CFC A;  2ZNE A;  1AUI B;  3JTD C;  3PM2 A;  3GOF A;  5ER5 A;  4JD9 A;  1SRA A;  3WXA A;  5DKR A;  5HLV A;  3RLZ A;  1GGZ A;  4MRY A;  1DMO A;  1CFF A;  2EHB A;  2OTG B;  2K8M B;  1WDC B;  3OB2 B;  2NXQ A;  3L47 A;  1C07 A;  2V53 A;  3S0F A;  3F45 A;  4PAL A;  1PVB A;  1DGU A;  4C0J A;  4GPL B;  1SCV A;  3L4A A;  5DKQ A;  1TRF A;  3AKA A;  1BOD A;  2SCP A;  3DYE A;  4NQG A;  1UWO A;  3CS1 A;  4HRH A;  4PE0 A;  3M0W A;  4YGD B;  3DF0 A;  4YGB B;  1NX2 A;  2E6W A;  3I5G C;  1CDM A;  2MRD A;  1LA3 A;  3CGA A;  1CNP A;  5IBW A;  2JNF A;  3DF0 B;  3FE8 A;  5BPJ A;  2LAP A;  3AAK A;  1DJY A;  1IWQ A;  5AFP A;  1OE9 B;  1TOP A;  1YUT A;  1IQ3 A;  1TUZ A;  2MJW B;  4PCW A;  4XJK B;  1QX5 B;  1C3Y A;  5D3O A;  2BE6 A;  2EGD A;  1FI6 A;  2PVB A;  2E30 A;  2MA2 A;  2ZN8 A;  2HF5 A;  1K96 A;  2BNX A;  2LMT A;  3D78 A;  3VGO A;  1RJV A;  2F3Y A;  2KQ6 A;  1KSM A;  1SSE B;  4MRX A;  1PRW A;  1OZO A;  3VRQ A;  1BU3 A;  4OR9 B;  4IL1 A;  2Y4Q A;  1WRL A;  2CT9 A;  2LC5 A;  3O4Y A;  1NX0 A;  1Z2C B;  4N1F A;  3KHE A;  4F7F A;  2HQ8 A;  3CZT X;  3D73 A;  5CPV A;  1FBV A;  1KSO A;  1UUS A;  1G33 A;  2LVK A;  1CB1 A;  1B8L A;  3OBV A;  2LM5 A;  1CTR A;  3CZ2 A;  1QX2 A;  3OB1 B;  4ETO A;  2K60 A;  2BEC A;  3ZWH A;  4HRG A;  1C7V A;  1XYD A;  1LA0 A;  1S5G Z;  2JZI A;  2KYC A;  1KK8 B;  2JXL A;  2KPH A;  1IGV A;  1U5I A;  2LVI A;  4MZJ A;  2Q91 A;  3OX5 A;  2JQ6 A;  2P71 A;  2FJY A;  1T14 A;  2ERB A;  4OCI A;  4GGF A;  2MLE C;  1U5I B;  1QX7 A;  3DY9 A;  1DJX A;  1G4Y R;  3FWC A;  2HPS A;  1S6I A;  1SNL A;  2WCJ A;  4MN0 A;  3ZNI A;  1B7T Y;  1NUB A;  2DOQ A;  4MLW A;  4ZCV A;  1LKJ A;  4YGE B;  1F70 A;  2BKI B;  2K2F A;  2L4I A;  3IQQ A;  1QIW A;  5HLO A;  5D69 A;  5DIC A;  1A03 A;  1K94 A;  1CMF A;  4GUK A;  3EK4 A;  3DVE A;  1XFX O;  2QEO A;  5PAL A;  2KSP A;  3BJH A;  2MAZ A;  3NSK A;  2CNP A;  1M45 A;  2WCE A;  3BUM B;  1W7I B;  3QME A;  1ZMZ A;  1MR8 A;  5ER4 X;  4YGA A;  1TIZ A;  4A4B A;  1CDP A;  3KEV A;  3PN7 B;  3R1P A;  4CLN A;  3UNW A;  1OW4 A;  2H2K A;  3TUY B;  3VB1 A;  1TNQ A;  4MZK A;  5AER A;  2LLS A;  3SIA A;  1N65 A;  3O6B A;  1WY9 A;  1S6C A;  4DIR A;  1Q80 A;  4CID A;  1SCM B;  3IQO A;  2I18 A;  1UHH A;  4M2P A;  2JWW A;  1DJI A;  1KK8 C;  5FYX A;  3BYA A;  4PHN A;  1BOC A;  4PE4 A;  3JTD B;  1NSH A;  2KFF A;  3JVT B;  4FQO A;  1A4P A;  1C3Z A;  3O4X A;  3B87 A;  3RM1 A;  1RRO A;  3CWG A;  1YUS A;  1F4Q A;  1ALW A;  2M49 B;  1DF0 A;  2PMY A;  1LVC D;  2JTT A;  2L2E A;  3VRO A;  5HYD A;  1EXR A;  2BAP A;  4YBH B;  5K89 A;  1DF0 B;  1MXL C;  1TNW A;  4E68 A;  4AQJ A;  1BJF A;  1NIW A;  1XFU O;  1KWO B;  3EK7 A;  3SJS A;  1SL8 A;  2KLE A;  1ZAC A;  2MBX A;  1CM4 A;  1ZFS A;  4C0K A;  2LLU A;  2K61 A;  5HKY A;  1UHI A;  1SBJ A;  2GV5 A;  1JWD A;  4ICB A;  2WC5 A;  1Y0V H;  1WRZ A;  1PK0 D;  2BBM A;  2CBL A;  2Y1M A;  3TUY C;  1GQM A;  2JXC A;  3S0G A;  1IG5 A;  2WCH A;  1NX3 A;  1TN4 A;  1XFY O;  2ZFD A;  4I5N B;  1EJ3 A;  2WND A;  2KHN A;  3OGN A;  4USL A;  4WRI A;  4U8D A;  1J1E A;  3PAL A;  4AQI A;  1YVL A;  2G2B A;  2JT3 A; 
#chains in the Genus database with same CATH homology
 1X02 A;  1B9A A;  2JPT A;  1M46 A;  2O60 A;  3BUO B;  3JVT C;  3CTN A;  5KSZ A;  1DJG A;  2WOR A;  2MLF C;  1SMG A;  3ICB A;  3PM8 A;  1S3P A;  3EVR A;  1BT6 A;  1CLL A;  4YGC B;  1CDL A;  1UHN A;  1A29 A;  3BUN B;  4NDD A;  1A75 B;  4DUQ A;  3KO0 A;  1KWO C;  1M39 A;  2M29 A;  2PAL A;  3FIA A;  1W7J B;  3LL8 B;  2KI6 D;  1SKT A;  1F71 A;  3D0Y A;  3CR2 A;  3NXA A;  2Y5I A;  1CDN A;  2Q4U A;  1G8I A;  1V1G A;  2M7L A;  3D0Y B;  1TCO B;  2WCF A;  4WQ2 A;  4CPV A;  1KCY A;  1C7W A;  1OOJ A;  2K7D A;  1TNP A;  2M97 A;  4GNK B;  5I2O A;  1S6J A;  4XJK A;  1H8B A;  1XFV O;  2AMI A;  1OQP A;  3LK0 A;  1JFJ A;  3TDU A;  1CKK A;  3MSE B;  2EC6 C;  2JT0 A;  1YX7 A;  1FI5 A;  2M1U A;  5I2L A;  1SL9 A;  2OS8 B;  1J7Q A;  4ORC B;  2B1U A;  2G9B A;  4FTG A;  1NCY A;  1AJ4 A;  1WLM A;  1XA5 A;  3NSL A;  1JSA A;  2WC8 A;  4C0L A;  1QAT A;  4I5J A;  2FOT A;  1S5G Y;  3PAT A;  1SW8 A;  2LLT A;  1KFU S;  4PDZ A;  1YUR A;  2JRF A;  2LV7 A;  2KYF A;  2JOJ A;  1GJY A;  5DKN A;  2GGZ A;  1DJW A;  2LAN A;  2JUL A;  3O78 A;  4GAO A;  4JPZ B;  2AUC A;  4YI9 A;  3TDI A;  3NSO A;  1MQ1 A;  1SK6 D;  3H4S E;  2KI4 B;  2BCB A;  1L2O C;  2JTZ A;  2F2P A;  1YTZ C;  1RWY A;  3KPX A;  3HCM A;  2L0P A;  1S1E A;  1F54 A;  3A8R A;  1S36 A;  1F4O A;  1N0Y A;  1VRK A;  2KAY A;  2OS8 C;  1F55 A;  2H61 C;  2NCO A;  1QAS A;  1QIV A;  1XFZ O;  1YRT B;  3A4U B;  4PE1 A;  4D1E A;  2QPT A;  1LXF C;  4QJ3 B;  3C1V A;  1MXE A;  1IJ5 A;  1SYM A;  3TDZ A;  1CFP A;  1K9U A;  1NP8 A;  2P6B B;  1NWD A;  1J7P A;  1S26 D;  1UUR A;  1AK8 A;  4NDC A;  1R6P A;  1IKU A;  4PHJ A;  3LCP C;  1HT9 A;  1PAL A;  4BY4 A;  3CLN A;  2BCA A;  2ZRS A;  1WLZ A;  2F2O A;  1QV0 A;  4OVN F;  1MWN A;  1KFX S;  1ZOT B;  2KI4 C;  1K8U A;  5G08 A;  2M3W A;  2Y1N A;  2JNX A;  4GBA A;  4N1G A;  1GGW A;  5HKW A;  3DD4 A;  2ZRT A;  1REC A;  1XK4 C;  2KQY A;  2IS9 A;  3K21 A;  1QLS A;  2O5G A;  4MSP A;  2JC2 A;  3SG5 A;  4I5K A;  2PSR A;  1RTP 1;  1UHK A;  1JFK A;  1EG4 A;  2VRG A;  3SG3 A;  1K93 D;  1R2U A;  4Q04 A;  2LHI A;  2K0J A;  1BG1 A;  1NX1 A;  3OP0 A;  1YUU A;  3WHT B;  1CLB A;  4OKH A;  4WQ3 A;  2LVJ A;  1KQM C;  3AAJ A;  1PSB A;  2MHH A;  3PSR A;  1SR6 B;  1V1F A;  4MBE A;  4MZL A;  1SY9 A;  3I5H C;  4A4C A;  2EC6 B;  3E3R A;  2L50 A;  1BF5 A;  4BY5 A;  3BQ3 A;  1TNX A;  2L98 A;  1N2D A;  2K7O A;  2M0R A;  1Y1U A;  2NLN A;  5KTY A;  1IRJ A;  1DJZ A;  1K9K A;  1Y1X A;  2LP3 A;  3I5I B;  1MHO A;  1AJ5 A;  5B8I B;  4MVF A;  1RK9 A;  1A75 A;  2KBM A;  4QJ5 B;  1AHR A;  4PHM A;  5I2Q A;  4PE7 A;  1J7R A;  1AVS A;  4PHK A;  1QVI Z;  1YX8 A;  3BUX B;  5AEQ A;  1XVJ A;  1B47 A;  2FCD A;  2KAX A;  4HSZ A;  5CSF A;  1Y6W A;  3GK4 X;  1DJH A;  1QXP A;  2NZ0 A;  1J7O A;  3OHM B;  4I5L B;  5J3X A;  2AAO A;  1XO5 A;  2PAS A;  1L2O B;  4YI8 A;  1QS7 A;  1K2H A;  1SR6 C;  3EVU A;  4ORB B;  1PVA A;  4M2O A;  2LVV A;  2LP2 A;  2BBN A;  5TNC A;  3TS5 B;  2H61 A;  3SG6 A;  2I2R E;  4AOM A;  1CLM A;  3DVK A;  1OMD A;  2RGI A;  5KU1 A;  2R2I A;  1E8A A;  1F8H A;  2LCP A;  2ZN9 A;  3I5I C;  2KFH A;  1ALV A;  1DGV A;  1DTL A;  1JF2 A;  2KDH A;  2F33 A;  3HX4 A;  4JQ0 D;  4UPG A;  1FPW A;  3LK1 A;  1KFX L;  3OX6 A;  1ODB A;  1Y1A A;  3CR5 X;  4P2Y B;  2KGB C;  1M31 A;  2BL0 C;  4ORA B;  2F8P A;  1OMV A;  2GGM A;  1FF1 A;  1PUL A;  3BUW B;  4OV2 A;  3QRX A;  1IQ5 A;  4L9M A;  2JU0 A;  3IF7 A;  1JC2 A;  1EG3 A;  5CSI A;  1EL4 A;  1NCX A;  1TCF A;  5AXI A;  1UHJ A;  3I5F B;  2F3Z A;  4GGN A;  2LMU A;  3BOW A;  1BR4 B;  4ZCU A;  1CM1 A;  1QJT A;  1UP5 A;  3EVV A;  1XK4 A;  2PRU A;  3BOW B;  1A2X A;  1PSR A;  4R1E A;  2K2A A;  2OTG C;  2M7N A;  1WDC C;  3TS5 C;  1CFD A;  1BLQ A;  3WNX B;  2HQW A;  2LNK A;  1J1D A;  2LE9 B;  1EH2 A;  3EK8 A;  1K95 A;  1IJ6 A;  5D7F A;  2KGR A;  1QV1 A;  1K9P A;  1RFJ A;  3O2P A;  3TZ1 A;  1SPY A;  3SG7 A;  1BR1 B;  2I7A A;  2OPO A;  4QJ4 B;  2K7C A;  1OSA A;  1L7Z A;  1LIN A;  1MF8 B;  2ZKM X;  2M1K B;  4N5X A;  2I94 A;  1KQV A;  1KQM B;  1JF0 A;  5GQQ C;  1KK7 Y;  4CFQ A;  1JBA A;  5AAN A;  3VRP A;  4YRU A;  3I5H B;  3NSI A;  1QLK A;  2KNE A;  2WOS A;  3FS7 A;  3GK1 A;  1B8C A;  1TTX A;  2FCE A;  4JWQ A;  3EKJ A;  3I5F C;  3DVJ A;  1YVH A;  3VRN A;  1KK7 Z;  2TN4 A;  2CCM A;  1B7T Z;  2KFG A;  2A4J A;  4P5O E;  2D8N A;  1AP4 A;  2KBI A;  5I8N A;  1DT7 B;  2K7B A;  2FJU B;  5CSJ A;  1MUX A;  2CXJ A;  1NYA A;  3GK2 A;  1B1G A;  1B4C A;  4XYN A;  1YR5 A;  4DCK A;  3PFV A;  1BMO A;  2KI6 C;  1QTX A;  2M8U A;  1JUO A;  2ISD A;  1HQV A;  1SL7 A;  1YRU B;  2LUX A;  2L5X B;  2BKH B;  4GFT A;  5JOL A;  1J55 A;  4GGF C;  2COL B;  2M9G A;  4M2Q A;  1H4B A;  4DS7 A;  2WCB A;  4HRE E;  4CFR A;  1WRK A;  1D1O A;  1OZS A;  2ZND A;  1KFU L;  2KOT A;  4NDB A;  3FWB A;  1IH0 A;  5HKZ A;  2LHL A;  3VRR A;  2JT8 A;  1DVI A;  4F0Z B;  1QVI Y;  3PLF B;  1FW4 A;  5JJG A;  2KAV A;  1OMR A;  5CSN A;  4MEW A;  3SIB A;  2L4H A;  3SG4 A;  2SAS A;  3AKB A;  3DVM A;  1NCZ A;  3PN7 C;  1M63 B;  3I5G B;  1ZUZ A;  2LUC A;  1NPQ A;  2BE4 A;  2HET A;  4TNC A;  3SG2 A;  3D10 A;  2BL0 B;  2QAC A;  3EKH A;  2NCP A;  3BXK A;  3KF9 A;  1XFW O;  1K90 D;  1SCM C;  3LLE A;  1CMG A;  1B8R A;  2BCX A;  3CR4 X;  4DRW A;  3WHU B;  2L51 A;  2CTN A;  2LMV A;  1CFC A;  2ZNE A;  1AUI B;  3JTD C;  3GOF A;  5ER5 A;  1SRA A;  3WXA A;  5DKR A;  5HLV A;  3RLZ A;  1GGZ A;  4MRY A;  1DMO A;  1CFF A;  2EHB A;  2OTG B;  2K8M B;  1WDC B;  3OB2 B;  2NXQ A;  1C07 A;  2V53 A;  3F45 A;  4PAL A;  1PVB A;  1DGU A;  4C0J A;  4GPL B;  1SCV A;  5DKQ A;  1TRF A;  3AKA A;  1BOD A;  2SCP A;  4YGD B;  4NQG A;  1UWO A;  3CS1 A;  4HRH A;  4PE0 A;  3M0W A;  4YGB B;  3DF0 A;  5F6T A;  1NX2 A;  2E6W A;  3I5G C;  1CDM A;  2MRD A;  1LA3 A;  3CGA A;  1CNP A;  5IBW A;  2JNF A;  3DF0 B;  5BPJ A;  2LAP A;  3AAK A;  1DJY A;  1IWQ A;  5AFP A;  1OE9 B;  1TOP A;  1YUT A;  1IQ3 A;  2MJW B;  4PCW A;  4XJK B;  1QX5 B;  2BE6 A;  2EGD A;  1FI6 A;  2PVB A;  2E30 A;  2MA2 A;  2ZN8 A;  2HF5 A;  1K96 A;  2LMT A;  3VGO A;  1RJV A;  2F3Y A;  2KQ6 A;  1KSM A;  4MRX A;  1PRW A;  1OZO A;  3VRQ A;  1BU3 A;  4OR9 B;  4IL1 A;  2Y4Q A;  1WRL A;  2CT9 A;  2LC5 A;  3O4Y A;  1NX0 A;  4N1F A;  3KHE A;  2HQ8 A;  3CZT X;  5CPV A;  1FBV A;  1KSO A;  1UUS A;  1G33 A;  2LVK A;  1CB1 A;  1B8L A;  2LM5 A;  1CTR A;  1QX2 A;  3OB1 B;  4ETO A;  2BEC A;  3ZWH A;  4HRG A;  1C7V A;  1XYD A;  1LA0 A;  1S5G Z;  2JZI A;  2KYC A;  1KK8 B;  2JXL A;  1IGV A;  1U5I A;  2LVI A;  4MZJ A;  2Q91 A;  3OX5 A;  2JQ6 A;  4OCI A;  4GGF A;  2MLE C;  1U5I B;  1QX7 A;  3FWC A;  1DJX A;  1G4Y R;  2HPS A;  1S6I A;  1SNL A;  4MN0 A;  3ZNI A;  1B7T Y;  1NUB A;  2DOQ A;  4MLW A;  4ZCV A;  1LKJ A;  4YGE B;  1F70 A;  2BKI B;  2K2F A;  2L4I A;  3IQQ A;  1QIW A;  5HLO A;  5D69 A;  1A03 A;  1K94 A;  1CMF A;  4GUK A;  3EK4 A;  3DVE A;  1XFX O;  5PAL A;  2KSP A;  2MAZ A;  3NSK A;  2CNP A;  1M45 A;  2WCE A;  3BUM B;  1W7I B;  1ZMZ A;  1MR8 A;  5ER4 X;  4YGA A;  1TIZ A;  4A4B A;  1CDP A;  3KEV A;  3PN7 B;  4CLN A;  2H2K A;  3TUY B;  1TNQ A;  4MZK A;  5AER A;  2LLS A;  3SIA A;  1N65 A;  3O6B A;  1WY9 A;  1S6C A;  4DIR A;  1Q80 A;  4CID A;  1SCM B;  3IQO A;  2I18 A;  1UHH A;  4M2P A;  2JWW A;  1DJI A;  1KK8 C;  5FYX A;  3BYA A;  4PHN A;  1BOC A;  4PE4 A;  3JTD B;  1NSH A;  2KFF A;  3JVT B;  4FQO A;  1A4P A;  3RM1 A;  1RRO A;  3CWG A;  1YUS A;  1F4Q A;  1ALW A;  2M49 B;  1DF0 A;  2PMY A;  1LVC D;  2JTT A;  2L2E A;  3VRO A;  5HYD A;  1EXR A;  4YBH B;  5K89 A;  4E68 A;  1DF0 B;  1MXL C;  1TNW A;  4AQJ A;  1BJF A;  1NIW A;  1XFU O;  1KWO B;  3EK7 A;  3SJS A;  1SL8 A;  1ZAC A;  2MBX A;  1CM4 A;  1ZFS A;  4C0K A;  2LLU A;  2K61 A;  5HKY A;  1UHI A;  1SBJ A;  2GV5 A;  1JWD A;  4ICB A;  1Y0V H;  1WRZ A;  1PK0 D;  2BBM A;  2CBL A;  2Y1M A;  3TUY C;  1GQM A;  2JXC A;  1IG5 A;  1NX3 A;  1TN4 A;  1XFY O;  2ZFD A;  4I5N B;  1EJ3 A;  2WND A;  2KHN A;  4USL A;  4WRI A;  4U8D A;  1J1E A;  3PAL A;  4AQI A;  1YVL A;  2G2B A;  2JT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...