1M46A

Crystal structure of mlc1p bound to iq4 of myo2p, a class v myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle protein
total genus 44
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A01
2KDHA 3DF0B 3ZNIA 1GJYA 5AERA 2BE4A 3CZTX 4YGCB 1NX2A 2CTNA 2L98A 3GK1A 1BLQA 2MJWB 2M3WA 4GNKB 2KAXA 2K2FA 1S5GZ 3VGOA 2QPTA 3AKAA 2JOJA 1DJHA 4WQ2A 2LAPA 4AOMA 2AUCA 4U8DA 1WLZA 2L51A 2JNFA 5KTYA 1XFXO 4MRYA 3VROA 1KQMC 2RGIA 4USLA 3SG2A 2LUCA 1S26D 5CSIA 4OKHA 1UP5A 2JTTA 1BR4B 1E8AA 2KI6D 5HYDA 1CMGA 1LINA 2LANA 1OOJA 1ZACA 1CFCA 2LLTA 2JNXA 3E3RA 3I5GB 3LK0A 1SYMA 3NSKA 1KFUL 2PMYA 1OQPA 1YUSA 1SMGA 1CM4A 1X02A 2M7NA 1Y1UA 2KNEA 1OSAA 4DCKA 2M29A 1XFUO 1R2UA 1SRAA 2BBMA 4MBEA 5HKWA 4PHKA 1YRUB 2JC2A 4P2YB 2K0JA 4N1FA 4PHNA 5CSNA 2Y4QA 1TCFA 2E30A 3WXAA 4WQ3A 3KPXA 5DKNA 2JXCA 2KAYA 1BJFA 4GFTA 1QX5B 1A29A 1SL8A 1NX3A 2HF5A 1QX7A 1G8IA 2G2BA 4YGAA 4QJ5B 2WOSA 1MWNA 1CKKA 2IS9A 2OTGB 1PSBA 1BU3A 1QTXA 5CPVA 3TDIA 1TOPA 1J55A 2BL0B 2AMIA 2KHNA 1KWOB 1LKJA 1SBJA 2OS8B 1FF1A 4I5LB 4YGDB 1CFDA 4XJKA 3BOWA 2LHIA 4MVFA 1B7TZ 5TNCA 3SJSA 1IWQA 1XK4C 2F2OA 2K7CA 1LXFC 2Q4UA 3BQ3A 3D0YB 1D1OA 1CFFA 1DJXA 2H61A 1J1DA 1UUSA 2MA2A 2LM5A 2GGZA 3LK1A 1SCVA 2ZRSA 2JULA 3CWGA 1XK4A 2JXLA 1A75B 2L4IA 4R1EA 2M9GA 3H4SE 1QLKA 3OP0A 4PALA 5KU1A 2K7DA 3RM1A 4HRGA 1DGUA 2JRFA 4I5JA 1RFJA 3ZWHA 1J7PA 1GQMA 1KFXS 3QRXA 4M2OA 3BYAA 2LLUA 4YGBB 1AJ5A 4ZCVA 1K94A 2H2KA 4ORBB 1SW8A 4WRIA 4M2PA 4YI8A 1F55A 1UWOA 3IQQA 3IQOA 2HQWA 2VRGA 1WLMA 1AJ4A 1XO5A 2M97A 1IJ6A 1KK7Y 1QV1A 2I7AA 2BCXA 1QIVA 3EKJA 1HQVA 1WDCC 3AKBA 2LCPA 1N65A 2JPTA 3WNXB 3WHTB 2O5GA 1YVLA 2F2PA 2KYCA 1HT9A 1B8LA 1DTLA 1EG4A 2KSPA 1PSRA 1CTRA 2L50A 1J7QA 4F0ZB 1S6CA 1K9PA 2K7OA 2HQ8A 1NSHA 2JT0A 1SL7A 4AQIA 1KQVA 5DKRA 2LMTA 4PE1A 5I8NA 4MZJA 1S6JA 1UHKA 2EC6C 2L2EA 5HKZA 1NCZA 2MAZA 1XVJA 1L7ZA 1TTXA 2MHHA 2PSRA 1AK8A 4N5XA 1FI6A 4TNCA 1Q80A 1SPYA 3CTNA 1DGVA 2CXJA 3DVJA 3I5FC 4Q04A 5F6TA 5J3XA 1S36A 4PE4A 5D7FA 1FI5A 3KF9A 2I94A 3BUXB 3OB2B 1J7RA 1CLMA 1FPWA 3M0WA 1A03A 1N2DA 1OE9B 2CCMA 3PATA 2AAOA 3SIBA 4C0JA 1B9AA 5D69A 2FCDA 5AANA 1MXEA 2BCBA 2BKHB 2KBIA 2HPSA 1SK6D 2SASA 2Y1NA 4GBAA 1ALWA 2K8MB 2KGRA 2O60A 1H8BA 3EVVA 3EVRA 4MSPA 1OMDA 3I5IB 2WNDA 1BMOA 3HCMA 3EK8A 1UURA 4D1EA 1TN4A 1MXLC 2NXQA 3OHMB 2KQ6A 4JPZB 2ZN8A 3AAKA 3EKHA 4A4BA 3TS5B 1K90D 4YBHB 1FW4A 1DJYA 1QVIZ 1SY9A 4YGEB 1BR1B 2MLFC 2WCBA 4A4CA 5PALA 2LVJA 4ZCUA 4GAOA 3GK4X 3IF7A 3MSEB 1JBAA 1XFVO 1YRTB 3CR5X 1XFZO 3FWCA 3TDUA 1L2OC 1SCMC 3KEVA 1DJWA 4FTGA 2QACA 1MQ1A 2K61A 4ORCB 2BECA 1Y0VH 2LLSA 2ZFDA 3TUYC 2F3ZA 1PRWA 1R6PA 4N1GA 4C0KA 2ZN9A 3LCPC 3DVKA 4OV2A 3BUNB 1PVAA 2KBMA 5FYXA 3BUWB 1B4CA 1U5IB 3NXAA 3O2PA 1PULA 1S5GY 1M63B 2GGMA 1RJVA 1SL9A 1B8RA 1CDMA 1K8UA 1LA3A 3DF0A 2FCEA 2ZRTA 1OMRA 4MN0A 3VRNA 1DF0B 1NX0A 1KSOA 5HKYA 2NLNA 5AXIA 1BF5A 1KK8B 1CNPA 1FBVA 4GGNA 1IG5A 1SKTA 2H61C 1B8CA 4PHJA 2DOQA 3SG7A 1UHIA 2KI4C 1JF2A 3JTDB 1K9KA 1OMVA 1OZOA 1K9UA 1JF0A 3I5GC 4MZKA 1Y6WA 3SG6A 4NDCA 1ZMZA 4YRUA 1K96A 1F54A 1M39A 1SR6C 2KFFA 3EVUA 3KO0A 1F4QA 3NSLA 3I5HB 1KSMA 3SIAA 3PN7B 2PASA 1QV0A 1AVSA 1CLBA 3OX6A 1TNXA 1C7WA 1EXRA 1GGWA 4PE7A 1K93D 4BY5A 4HSZA 4NQGA 2WORA 1MUXA 2LVKA 1H4BA 2BKIB 3FS7A 2EHBA 3O78A 2I2RE 1V1FA 2NCPA 5G08A 2SCPA 3I5FB 4CIDA 2F8PA 2LE9B 2CNPA 2M1UA 1AP4A 2LUXA 5HLVA 2TN4A 1YX8A 3NSIA 1DVIA 5AEQA 1F70A 1KQMB 2JU0A 3CR4X 2BBNA 1F4OA 2Y5IA 3FIAA 1JUOA 1QLSA 3BUMB 4MEWA 4ICBA 1K2HA 2L0PA 1IQ3A 1XA5A 2R2IA 3PM8A 1NYAA 2OTGC 1G4YR 4CPVA 1PALA 3GK2A 2BL0C 2BE6A 1ODBA 2V53A 1UHJA 3HX4A 1KFUS 1QXPA 2OS8C 4NDDA 5K89A 4HREE 1QIWA 1DMOA 4QJ4B 4OR9B 1W7IB 3TZ1A 1M46A 2LHLA 3JVTC 1DF0A 3CLNA 2JTZA 2MLEC 2Q91A 2G9BA 1Y1XA 1B7TY 1RK9A 3A8RA 1NPQA 3WHUB 1OZSA 4OVNF 1TRFA 1J7OA 2WCFA 1NX1A 1L2OB 1SCMB 3TDZA 1CB1A 2ISDA 1CDPA 1NWDA 1ZUZA 1CM1A 1ZFSA 3D0YA 2L5XB 1RTP1 4DRWA 1QASA 1RROA 1WRLA 2I18A 1S3PA 1Y1AA 1NUBA 2COLB 2PVBA 1B1GA 1CFPA 4MLWA 1M45A 3EK4A 5I2OA 5IBWA 1A75A 1YUUA 2F33A 1NIWA 4DS7A 1NCXA 2P6BB 1F8HA 3KHEA 2Y1MA 4XJKB 3O4YA 2JWWA 3BOWB 2A4JA 1EH2A 4PE0A 3D10A 1EG3A 3DD4A 3VRRA 5KSZA 1PVBA 2LP2A 1VRKA 3AAJA 1CMFA 4IL1A 1G33A 4P5OE 1B47A 3PFVA 2B1UA 4M2QA 3LL8B 4C0LA 3SG4A 3BXKA 3LLEA 5I2QA 1NCYA 2KI4B 2CT9A 1IKUA 2LVIA 2M0RA 2LV7A 1IH0A 1TIZA 1QX2A 4I5NB 3SG3A 1C7VA 1SR6B 2BCAA 4UPGA 1C07A 1GGZA 2M1KB 1A2XA 1XFWO 5JOLA 5GQQC 1DJIA 4MZLA 2NCOA 1TNQA 4NDBA 5ER4X 2LMUA 2GV5A 4PCWA 3CS1A 2KI6C 2NZ0A 3ICBA 4I5KA 4XYNA 1TCOB 1BT6A 1CLLA 1UHHA 2L4HA 4GPLB 3A4UB 2CBLA 1LVCD 1K95A 1TNPA 2LVVA 3NSOA 1BODA 5ER5A 1YX7A 1EJ3A 2JT8A 1YVHA 2FOTA 1BOCA 5HLOA 2EGDA 2LNKA 3DVMA 1PK0D 3C1VA 1WRKA 1CDLA 1KK7Z 4CFRA 5B8IB 2PALA 4DIRA 4CFQA 1IJ5A 3OX5A 1YURA 1WDCB 2FJUB 2ZNEA 2WC8A 4QJ3B 1ALVA 3I5IC 2JZIA 2K7BA 1QJTA 5AFPA 2OPOA 3CGAA 1EL4A 1IQ5A 4L9MA 3GOFA 3O6BA 3VRQA 3EK7A 3TS5C 2D8NA 5JJGA 1QVIY 1MF8B 2EC6B 2ZNDA 5I2LA 1WY9A 2JT3A 4HRHA 1XYDA 3CR2A 2K2AA 1F71A 3JVTB 1MHOA 2KYFA 1A4PA 5DKQA 1J1EA 2KFGA 4YI9A 2LC5A 2LMVA 4FQOA 2WCEA 1S6IA 1JFKA 2PRUA 1DJZA 2KQYA 2LP3A 1ZOTB 1W7JB 4CLNA 2KOTA 1LA0A 3K21A 4GUKA 4DUQA 1DJGA 3F45A 1KCYA 1M31A 1XFYO 2KFHA 4E68A 1JSAA 2KGBC 4PHMA 3SG5A 2M8UA 3OB1B 4AQJA 1UHNA 5CSJA 4GGFC 1BG1A 2KAVA 4PDZA 1JC2A 1MR8A 1JWDA 4MRXA 1IRJA 2HETA 1KWOC 1AHRA 1AUIB 1N0YA 1RECA 4ETOA 3DVEA 1DT7B 1NP8A 1V1GA 1U5IA 3PLFB 4ORAB 4GGFA 1KK8C 2ZKMX 4BY4A 4OCIA 1WRZA 3PSRA 3RLZA 2M49B 3JTDC 1YR5A 3FWBA 2MRDA 2F3YA 1RWYA 1JFJA 1QATA 1QS7A 4JQ0D 3I5HC 1S1EA 1YTZC 2JQ6A 1TNWA 2M7LA 4JWQA 3PN7C 1IGVA 1SNLA 3PALA 2E6WA 3VRPA 5CSFA 1KFXL 3BUOB 2MBXA 3TUYB 1CDNA 1YUTA 5BPJA
chains in the Genus database with same CATH superfamily
2KDHA 3DF0B 3ZNIA 1GJYA 5AERA 2BE4A 3CZTX 4YGCB 1NX2A 2CTNA 2L98A 3GK1A 1BLQA 2MJWB 2M3WA 4GNKB 2KAXA 2K2FA 1S5GZ 3VGOA 2QPTA 3AKAA 2JOJA 1DJHA 4WQ2A 3IVTA 2LAPA 4AOMA 2KPHA 2AUCA 4U8DA 1WLZA 2L51A 2JNFA 5KTYA 1XFXO 4MRYA 3VROA 1KQMC 2RGIA 4USLA 3SG2A 2LUCA 1S26D 5CSIA 4OKHA 1UP5A 1SSEB 2JTTA 1BR4B 1E8AA 2KI6D 4INWA 5HYDA 1CMGA 1LINA 3FE8A 2LANA 1OOJA 1ZACA 1CFCA 2LLTA 2JNXA 3E3RA 3I5GB 3LK0A 1W9ZA 1SYMA 3NSKA 1KFUL 2PMYA 1OQPA 1YUSA 1SMGA 1TUJA 2QEHA 1CM4A 1X02A 2M7NA 1Y1UA 2KNEA 1OSAA 4DCKA 2M29A 1XFUO 1R2UA 1SRAA 2BBMA 4MBEA 5HKWA 4PHKA 1YRUB 2JC2A 4P2YB 2K0JA 4N1FA 3L4AA 4PHNA 3CDNA 1T14A 5CSNA 2Y4QA 1TCFA 2E30A 3DYEA 3WXAA 3RZSA 4WQ3A 3KPXA 5DKNA 2JXCA 2KAYA 1BJFA 1P28A 4GFTA 1QX5B 1A29A 1SL8A 1NX3A 2HF5A 1QX7A 1G8IA 2WC6A 2G2BA 4YGAA 4QJ5B 2WOSA 1MWNA 1CKKA 2IS9A 2OTGB 1PSBA 1BU3A 1QTXA 5CPVA 1XFRA 3TDIA 1TOPA 3BFHA 1J55A 2BL0B 3SS4A 2AMIA 2KHNA 1KWOB 1LKJA 1SBJA 2OS8B 3B88A 3BJHA 1FF1A 4I5LB 4YGDB 1CFDA 4XJKA 2FJYA 4F7FA 3BOWA 2LHIA 4MVFA 1B7TZ 5TNCA 3SJSA 1IWQA 1XK4C 2F2OA 2K7CA 1LXFC 2Q4UA 3BQ3A 3D0YB 1D1OA 1CFFA 1DJXA 3Q8IA 2H61A 1J1DA 1UUSA 2MA2A 2LM5A 2GGZA 3LK1A 1SCVA 2ZRSA 1LS8A 3D78A 2JULA 3CWGA 1XK4A 2JXLA 1A75B 2L4IA 4R1EA 2M9GA 3H4SE 1QLKA 3OP0A 4PALA 5KU1A 2K7DA 3RM1A 2KLDA 4HRGA 1DGUA 2JRFA 4I5JA 1RFJA 3ZWHA 1J7PA 1GQMA 1KFXS 3QRXA 4M2OA 3BYAA 2LLUA 4YGBB 3SS3A 1AJ5A 4ZCVA 3OBVA 3V2LA 1K94A 2H2KA 4ORBB 1SW8A 4WRIA 4M2PA 4YI8A 1F55A 1UWOA 3S0DA 3IQQA 3IQOA 2HQWA 2VRGA 1WLMA 2JPOA 1AJ4A 1XO5A 2BNXA 2M97A 1IJ6A 1KK7Y 1QV1A 2I7AA 2BCXA 1QIVA 3EKJA 1HQVA 1WDCC 3AKBA 2LCPA 1IIOA 1N65A 2JPTA 3WNXB 3WHTB 2O5GA 1YVLA 2F2PA 2KYCA 1HT9A 1B8LA 1DTLA 3DY9A 1EG4A 2KSPA 1PSRA 1CTRA 2L50A 1J7QA 4F0ZB 1S6CA 1K9PA 2K7OA 2HQ8A 3B7AA 1NSHA 2JT0A 2WCHA 1SL7A 4AQIA 1KQVA 5DKRA 2LMTA 3R1PA 4PE1A 5I8NA 4MZJA 1S6JA 1UHKA 2EC6C 2WCMA 2L2EA 5HKZA 1NCZA 2MAZA 1XVJA 5I94A 3CZ0A 1OOIX 1L7ZA 1TTXA 2MHHA 2PSRA 3B86A 1AK8A 4N5XA 3NHTA 1FI6A 1DEKA 1Q80A 1SPYA 3CTNA 1DGVA 2CXJA 3DVJA 3I5FC 4Q04A 4TNCA 5EL2A 5F6TA 1S36A 5J3XA 4PE4A 5FI7A 5D7FA 1FI5A 3KF9A 3O4XA 1OOGA 2I94A 3BUXB 3OB2B 1J7RA 1CLMA 1FPWA 3M0WA 1A03A 1N2DA 1OE9B 2CCMA 3PATA 2AAOA 3SIBA 4C0JA 1B9AA 5D69A 2FCDA 5AANA 1MXEA 2BCBA 2BKHB 2KBIA 2HPSA 1SK6D 2SASA 2Y1NA 4GBAA 1ALWA 2K8MB 2KGRA 1ORGA 2O60A 3EVVA 1H8BA 3EVRA 4MSPA 1OMDA 3I5IB 2WNDA 1BMOA 3HCMA 3EK8A 1UURA 4D1EA 1TN4A 1MXLC 2NXQA 3OHMB 2KQ6A 4JPZB 2ZN8A 3FE9A 3AAKA 3EKHA 2PYQA 3TS5B 1K90D 4YBHB 4A4BA 4PT1A 5HL1A 1FW4A 1DJYA 1QVIZ 1SY9A 4YGEB 1BR1B 2MLFC 2WCBA 4A4CA 5PALA 2LVJA 4ZCUA 4GAOA 3GK4X 3IF7A 3MSEB 1JBAA 1XFVO 1YRTB 4KYNA 3CR5X 1XFZO 3FWCA 3TDUA 3S0AA 1L2OC 1Z2CB 1SCMC 1C3ZA 3KEVA 1DC1A 1DJWA 4FTGA 2QACA 1MQ1A 2K61A 4ORCB 2BECA 1Y0VH 2LLSA 2ZFDA 3TUYC 2F3ZA 2PQLA 1PRWA 1R6PA 4N1GA 4C0KA 4INXA 3L4LA 2ZN9A 3LCPC 3DVKA 2WCLA 4OV2A 3BUNB 1PVAA 2KBMA 5FYXA 3BUWB 1B4CA 1U5IB 3NXAA 3O2PA 1PULA 1S5GY 1M63B 2GGMA 1RJVA 1SL9A 1B8RA 1CDMA 1K8UA 1LA3A 3DF0A 2FCEA 2ZRTA 1OMRA 4MN0A 3VRNA 1DF0B 1NX0A 1KSOA 5HKYA 1C3YA 2NLNA 5AXIA 1BF5A 1KK8B 1CNPA 1FBVA 3CABA 4GGNA 1IG5A 1SKTA 2H61C 1B8CA 4PHJA 2DOQA 3SG7A 1UHIA 2KI4C 1JF2A 3JTDB 1K9KA 1OMVA 1OZOA 1K9UA 1JF0A 3I5GC 2P70A 4MZKA 1Z4HA 1Y6WA 3CYZA 4NDCA 1ZMZA 3SG6A 1K96A 3BFBA 4YRUA 1F54A 1M39A 1SR6C 2KFFA 3EVUA 3KO0A 1F4QA 2WCJA 3NSLA 3I5HB 1KSMA 3SIAA 3PN7B 2PASA 2WCKA 1QV0A 1AVSA 1CLBA 3OX6A 1TNXA 1C7WA 1EXRA 1GGWA 4PE7A 1K93D 4BY5A 3D77A 4HSZA 4NQGA 2WORA 1MUXA 2LVKA 1H4BA 2BKIB 3FS7A 2EHBA 3O78A 2I2RE 1V1FA 2NCPA 5G08A 2SCPA 3I5FB 4CIDA 2F8PA 3D74A 2LE9B 2CNPA 3DXLA 2M1UA 1AP4A 2LUXA 5HLVA 2TN4A 1YX8A 3NSIA 1DVIA 5AEQA 1F70A 2GTEA 1KQMB 2JU0A 3CR4X 3D76A 2BBNA 1F4OA 2Y5IA 3FIAA 1JUOA 1QLSA 3BUMB 4MEWA 4ICBA 2P71A 1K2HA 2L0PA 1IQ3A 1XA5A 2R2IA 3PM8A 5FI2A 1NYAA 2OTGC 1G4YR 4CPVA 3CZ2A 1PALA 4IJ7A 3GK2A 2QDIA 2BL0C 3R1VA 2BE6A 1ODBA 2V53A 1UHJA 1TUZA 3HX4A 1KFUS 2L2CA 3FE6A 1QXPA 2OS8C 4NDDA 5K89A 4HREE 1QIWA 1DMOA 4QJ4B 4OR9B 1W7IB 3DZTA 3TZ1A 1M46A 1DELA 2LHLA 3JVTC 2QEOA 1DF0A 3CLNA 2JTZA 2MLEC 2Q91A 2G9BA 1Y1XA 1B7TY 1RK9A 3A8RA 1NPQA 3WHUB 1OZSA 4OVNF 1TRFA 1J7OA 2WCFA 1NX1A 1L2OB 1SCMB 3TDZA 1CB1A 2ISDA 3SS5A 1CDPA 1NWDA 1ZUZA 2QEBA 1CM1A 1ZFSA 3D0YA 2L5XB 1RTP1 2ERBA 1QASA 1RROA 4DRWA 1WRLA 2I18A 1S3PA 1Y1AA 1NUBA 2COLB 2PVBA 3NGVA 1B1GA 1CFPA 3S0FA 4MLWA 1M45A 3EK4A 5I2OA 5IBWA 1A75A 1YUUA 2F33A 1NIWA 4DS7A 1NCXA 2P6BB 3PM2A 1F8HA 3KHEA 2Y1MA 4XJKB 3O4YA 2JWWA 3D75A 3BOWB 2A4JA 3L47A 5FI6A 1EH2A 1GM0A 4PE0A 3D10A 1EG3A 3DD4A 3VRRA 5KSZA 1PVBA 2LP2A 1VRKA 3AAJA 1CMFA 4IL1A 1G33A 4P5OE 1B47A 3PFVA 2B1UA 4M2QA 3LL8B 4C0LA 3SG4A 3BXKA 3LLEA 5DICA 5I2QA 1NCYA 2KI4B 4JKTA 1OOFA 2CT9A 1IKUA 2LVIA 2M0RA 2LV7A 3UO9A 1IH0A 1TIZA 2YGUA 1QX2A 4I5NB 3SG3A 1C7VA 1SR6B 2BCAA 4UPGA 1C07A 1GGZA 2M1KB 3UNWA 1A2XA 1XFWO 5JOLA 5GQQC 1DJIA 4MZLA 2NCOA 1TNQA 4NDBA 5ER4X 2LMUA 2GV5A 4PCWA 2L5YA 3CS1A 2KI6C 2NZ0A 2BAPA 3ICBA 3B87A 4I5KA 4XYNA 1TCOB 5D3OA 1BT6A 1CLLA 2WC5A 1UHHA 3R72A 2L4HA 4GPLB 3A4UB 2CBLA 1LVCD 1K95A 1TNPA 2LVVA 1DQEA 3NSOA 5ER5A 3S0GA 1BODA 1YX7A 1EJ3A 2JT8A 1YVHA 2FOTA 1QWVA 3S0EA 1BOCA 5HLOA 2EGDA 2LNKA 3DVMA 1PK0D 3C1VA 1WRKA 1CDLA 1KK7Z 3K1EA 4CFRA 2PALA 4DIRA 5B8IB 4CFQA 1IJ5A 3OX5A 1YURA 3PJIA 1WDCB 3VB1A 2FJUB 2ZNEA 2WC8A 4QJ3B 3S0BA 1ALVA 3I5IC 2JZIA 2K7BA 1QJTA 5AFPA 2OPOA 3CGAA 1EL4A 1IQ5A 4L9MA 3GOFA 3O6BA 2KLEA 3BFAA 3VRQA 3EK7A 3TS5C 2D8NA 2K60A 3QMEA 5JJGA 3N7HA 3NHIA 1QVIY 1MF8B 1TWOA 2EC6B 2ZNDA 3CZ1A 5I2LA 1WY9A 2JT3A 4HRHA 1XYDA 3CR2A 2K2AA 1F71A 3JVTB 1MHOA 2KYFA 1A4PA 5DKQA 1J1EA 2KFGA 3OGNA 4YI9A 2LC5A 2LMVA 4FQOA 2WCEA 1S6IA 1JFKA 2PRUA 1DJZA 2KQYA 2LP3A 1ZOTB 1W7JB 4CLNA 2KOTA 1LA0A 3K21A 4GUKA 4DUQA 1DJGA 3F45A 1KCYA 1M31A 1XFYO 2KFHA 4E68A 4FQTA 1JSAA 2KGBC 4PHMA 3SG5A 2M8UA 3B6XA 3OB1B 1UHNA 4AQJA 5CSJA 4GGFC 1BG1A 2KAVA 3R1OA 4PDZA 1MR8A 1JC2A 1JWDA 4MRXA 1IRJA 2HETA 1KWOC 1AHRA 1AUIB 1N0YA 1RECA 4ETOA 3DVEA 2QEVA 1OOHA 1NP8A 1DT7B 1V1GA 1U5IA 3PLFB 4ORAB 4GGFA 1KK8C 2ZKMX 4BY4A 4OCIA 1WRZA 3PSRA 3RLZA 2M49B 3JTDC 1OW4A 2H8VA 1YR5A 3FWBA 2MRDA 4JD9A 2F3YA 1RWYA 1JFJA 1QATA 1QS7A 4JQ0D 3I5HC 1S1EA 1YTZC 2JQ6A 1TNWA 2M7LA 4JWQA 3PN7C 1IGVA 1SNLA 3PALA 2E6WA 3VRPA 5CSFA 1KFXL 3D73A 3EG5B 3BUOB 2MBXA 3TUYB 1CDNA 1YUTA 4OZDA 5BPJA
chains in the Genus database with same CATH topology
2KDHA 3DF0B 3ZNIA 1GJYA 5AERA 2BE4A 3CZTX 4YGCB 1NX2A 2CTNA 2L98A 3GK1A 1BLQA 2MJWB 2M3WA 4GNKB 2KAXA 2K2FA 1S5GZ 3VGOA 2QPTA 3AKAA 2JOJA 1DJHA 4WQ2A 2LAPA 4AOMA 2AUCA 4U8DA 1WLZA 2L51A 2JNFA 5KTYA 1XFXO 4MRYA 3VROA 1KQMC 2RGIA 4USLA 3SG2A 2LUCA 1S26D 5CSIA 4OKHA 1UP5A 2JTTA 1BR4B 1E8AA 2KI6D 5HYDA 1CMGA 1LINA 2LANA 1OOJA 1ZACA 1CFCA 2LLTA 2JNXA 3E3RA 3I5GB 3LK0A 1SYMA 3NSKA 1KFUL 2PMYA 1OQPA 1YUSA 1SMGA 1CM4A 1X02A 2M7NA 1Y1UA 2KNEA 1OSAA 4DCKA 2M29A 1XFUO 1R2UA 1SRAA 2BBMA 4MBEA 5HKWA 4PHKA 1YRUB 2JC2A 4P2YB 2K0JA 4N1FA 4PHNA 5CSNA 2Y4QA 1TCFA 2E30A 3WXAA 4WQ3A 3KPXA 5DKNA 2JXCA 2KAYA 1BJFA 4GFTA 1QX5B 1A29A 1SL8A 1NX3A 2HF5A 1QX7A 1G8IA 2G2BA 4YGAA 4QJ5B 2WOSA 1MWNA 1CKKA 2IS9A 2OTGB 1PSBA 1BU3A 1QTXA 5CPVA 3TDIA 1TOPA 1J55A 2BL0B 2AMIA 2KHNA 1KWOB 1LKJA 1SBJA 2OS8B 1FF1A 4I5LB 4YGDB 1CFDA 4XJKA 3BOWA 2LHIA 4MVFA 1B7TZ 5TNCA 3SJSA 1IWQA 1XK4C 2F2OA 2K7CA 1LXFC 2Q4UA 3BQ3A 3D0YB 1D1OA 1CFFA 1DJXA 2H61A 1J1DA 1UUSA 2MA2A 2LM5A 2GGZA 3LK1A 1SCVA 2ZRSA 2JULA 3CWGA 1XK4A 2JXLA 1A75B 2L4IA 4R1EA 2M9GA 3H4SE 1QLKA 3OP0A 4PALA 5KU1A 2K7DA 3RM1A 4HRGA 1DGUA 2JRFA 4I5JA 1RFJA 3ZWHA 1J7PA 1GQMA 1KFXS 3QRXA 4M2OA 3BYAA 2LLUA 4YGBB 1AJ5A 4ZCVA 1K94A 2H2KA 4ORBB 1SW8A 4WRIA 4M2PA 4YI8A 1F55A 1UWOA 3IQQA 3IQOA 2HQWA 2VRGA 1WLMA 1AJ4A 1XO5A 2M97A 1IJ6A 1KK7Y 1QV1A 2I7AA 2BCXA 1QIVA 3EKJA 1HQVA 1WDCC 3AKBA 2LCPA 1N65A 2JPTA 3WNXB 3WHTB 2O5GA 1YVLA 2F2PA 2KYCA 1HT9A 1B8LA 1DTLA 1EG4A 2KSPA 1PSRA 1CTRA 2L50A 1J7QA 4F0ZB 1S6CA 1K9PA 2K7OA 2HQ8A 1NSHA 2JT0A 1SL7A 4AQIA 1KQVA 5DKRA 2LMTA 4PE1A 5I8NA 4MZJA 1S6JA 1UHKA 2EC6C 2L2EA 5HKZA 1NCZA 2MAZA 1XVJA 1L7ZA 1TTXA 2MHHA 2PSRA 1AK8A 4N5XA 1FI6A 4TNCA 1Q80A 1SPYA 3CTNA 1DGVA 2CXJA 3DVJA 3I5FC 4Q04A 5F6TA 5J3XA 1S36A 4PE4A 5D7FA 1FI5A 3KF9A 2I94A 3BUXB 3OB2B 1J7RA 1CLMA 1FPWA 3M0WA 1A03A 1N2DA 1OE9B 2CCMA 3PATA 2AAOA 3SIBA 4C0JA 1B9AA 5D69A 2FCDA 5AANA 1MXEA 2BCBA 2BKHB 2KBIA 2HPSA 1SK6D 2SASA 2Y1NA 4GBAA 1ALWA 2K8MB 2KGRA 2O60A 1H8BA 3EVVA 3EVRA 4MSPA 1OMDA 3I5IB 2WNDA 1BMOA 3HCMA 3EK8A 1UURA 4D1EA 1TN4A 1MXLC 2NXQA 3OHMB 2KQ6A 4JPZB 2ZN8A 3AAKA 3EKHA 4A4BA 3TS5B 1K90D 4YBHB 1FW4A 1DJYA 1QVIZ 1SY9A 4YGEB 1BR1B 2MLFC 2WCBA 4A4CA 5PALA 2LVJA 4ZCUA 4GAOA 3GK4X 3IF7A 3MSEB 1JBAA 1XFVO 1YRTB 3CR5X 1XFZO 3FWCA 3TDUA 1L2OC 1SCMC 3KEVA 1DJWA 4FTGA 2QACA 1MQ1A 2K61A 4ORCB 2BECA 1Y0VH 2LLSA 2ZFDA 3TUYC 2F3ZA 1PRWA 1R6PA 4N1GA 4C0KA 2ZN9A 3LCPC 3DVKA 4OV2A 3BUNB 1PVAA 2KBMA 5FYXA 3BUWB 1B4CA 1U5IB 3NXAA 3O2PA 1PULA 1S5GY 1M63B 2GGMA 1RJVA 1SL9A 1B8RA 1CDMA 1K8UA 1LA3A 3DF0A 2FCEA 2ZRTA 1OMRA 4MN0A 3VRNA 1DF0B 1NX0A 1KSOA 5HKYA 2NLNA 5AXIA 1BF5A 1KK8B 1CNPA 1FBVA 4GGNA 1IG5A 1SKTA 2H61C 1B8CA 4PHJA 2DOQA 3SG7A 1UHIA 2KI4C 1JF2A 3JTDB 1K9KA 1OMVA 1OZOA 1K9UA 1JF0A 3I5GC 4MZKA 1Y6WA 3SG6A 4NDCA 1ZMZA 4YRUA 1K96A 1F54A 1M39A 1SR6C 2KFFA 3EVUA 3KO0A 1F4QA 3NSLA 3I5HB 1KSMA 3SIAA 3PN7B 2PASA 1QV0A 1AVSA 1CLBA 3OX6A 1TNXA 1C7WA 1EXRA 1GGWA 4PE7A 1K93D 4BY5A 4HSZA 4NQGA 2WORA 1MUXA 2LVKA 1H4BA 2BKIB 3FS7A 2EHBA 3O78A 2I2RE 1V1FA 2NCPA 5G08A 2SCPA 3I5FB 4CIDA 2F8PA 2LE9B 2CNPA 2M1UA 1AP4A 2LUXA 5HLVA 2TN4A 1YX8A 3NSIA 1DVIA 5AEQA 1F70A 1KQMB 2JU0A 3CR4X 2BBNA 1F4OA 2Y5IA 3FIAA 1JUOA 1QLSA 3BUMB 4MEWA 4ICBA 1K2HA 2L0PA 1IQ3A 1XA5A 2R2IA 3PM8A 1NYAA 2OTGC 1G4YR 4CPVA 1PALA 3GK2A 2BL0C 2BE6A 1ODBA 2V53A 1UHJA 3HX4A 1KFUS 1QXPA 2OS8C 4NDDA 5K89A 4HREE 1QIWA 1DMOA 4QJ4B 4OR9B 1W7IB 3TZ1A 1M46A 2LHLA 3JVTC 1DF0A 3CLNA 2JTZA 2MLEC 2Q91A 2G9BA 1Y1XA 1B7TY 1RK9A 3A8RA 1NPQA 3WHUB 1OZSA 4OVNF 1TRFA 1J7OA 2WCFA 1NX1A 1L2OB 1SCMB 3TDZA 1CB1A 2ISDA 1CDPA 1NWDA 1ZUZA 1CM1A 1ZFSA 3D0YA 2L5XB 1RTP1 4DRWA 1QASA 1RROA 1WRLA 2I18A 1S3PA 1Y1AA 1NUBA 2COLB 2PVBA 1B1GA 1CFPA 4MLWA 1M45A 3EK4A 5I2OA 5IBWA 1A75A 1YUUA 2F33A 1NIWA 4DS7A 1NCXA 2P6BB 1F8HA 3KHEA 2Y1MA 4XJKB 3O4YA 2JWWA 3BOWB 2A4JA 1EH2A 4PE0A 3D10A 1EG3A 3DD4A 3VRRA 5KSZA 1PVBA 2LP2A 1VRKA 3AAJA 1CMFA 4IL1A 1G33A 4P5OE 1B47A 3PFVA 2B1UA 4M2QA 3LL8B 4C0LA 3SG4A 3BXKA 3LLEA 5I2QA 1NCYA 2KI4B 2CT9A 1IKUA 2LVIA 2M0RA 2LV7A 1IH0A 1TIZA 1QX2A 4I5NB 3SG3A 1C7VA 1SR6B 2BCAA 4UPGA 1C07A 1GGZA 2M1KB 1A2XA 1XFWO 5JOLA 5GQQC 1DJIA 4MZLA 2NCOA 1TNQA 4NDBA 5ER4X 2LMUA 2GV5A 4PCWA 3CS1A 2KI6C 2NZ0A 3ICBA 4I5KA 4XYNA 1TCOB 1BT6A 1CLLA 1UHHA 2L4HA 4GPLB 3A4UB 2CBLA 1LVCD 1K95A 1TNPA 2LVVA 3NSOA 1BODA 5ER5A 1YX7A 1EJ3A 2JT8A 1YVHA 2FOTA 1BOCA 5HLOA 2EGDA 2LNKA 3DVMA 1PK0D 3C1VA 1WRKA 1CDLA 1KK7Z 4CFRA 5B8IB 2PALA 4DIRA 4CFQA 1IJ5A 3OX5A 1YURA 1WDCB 2FJUB 2ZNEA 2WC8A 4QJ3B 1ALVA 3I5IC 2JZIA 2K7BA 1QJTA 5AFPA 2OPOA 3CGAA 1EL4A 1IQ5A 4L9MA 3GOFA 3O6BA 3VRQA 3EK7A 3TS5C 2D8NA 5JJGA 1QVIY 1MF8B 2EC6B 2ZNDA 5I2LA 1WY9A 2JT3A 4HRHA 1XYDA 3CR2A 2K2AA 1F71A 3JVTB 1MHOA 2KYFA 1A4PA 5DKQA 1J1EA 2KFGA 4YI9A 2LC5A 2LMVA 4FQOA 2WCEA 1S6IA 1JFKA 2PRUA 1DJZA 2KQYA 2LP3A 1ZOTB 1W7JB 4CLNA 2KOTA 1LA0A 3K21A 4GUKA 4DUQA 1DJGA 3F45A 1KCYA 1M31A 1XFYO 2KFHA 4E68A 1JSAA 2KGBC 4PHMA 3SG5A 2M8UA 3OB1B 4AQJA 1UHNA 5CSJA 4GGFC 1BG1A 2KAVA 4PDZA 1JC2A 1MR8A 1JWDA 4MRXA 1IRJA 2HETA 1KWOC 1AHRA 1AUIB 1N0YA 1RECA 4ETOA 3DVEA 1DT7B 1NP8A 1V1GA 1U5IA 3PLFB 4ORAB 4GGFA 1KK8C 2ZKMX 4BY4A 4OCIA 1WRZA 3PSRA 3RLZA 2M49B 3JTDC 1YR5A 3FWBA 2MRDA 2F3YA 1RWYA 1JFJA 1QATA 1QS7A 4JQ0D 3I5HC 1S1EA 1YTZC 2JQ6A 1TNWA 2M7LA 4JWQA 3PN7C 1IGVA 1SNLA 3PALA 2E6WA 3VRPA 5CSFA 1KFXL 3BUOB 2MBXA 3TUYB 1CDNA 1YUTA 5BPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDH A;  3DF0 B;  3ZNI A;  1GJY A;  5AER A;  2BE4 A;  3CZT X;  4YGC B;  1NX2 A;  2CTN A;  2L98 A;  3GK1 A;  1BLQ A;  2MJW B;  2M3W A;  4GNK B;  2KAX A;  2K2F A;  1S5G Z;  3VGO A;  2QPT A;  3AKA A;  2JOJ A;  1DJH A;  4WQ2 A;  2LAP A;  4AOM A;  2AUC A;  4U8D A;  1WLZ A;  2L51 A;  2JNF A;  5KTY A;  1XFX O;  4MRY A;  3VRO A;  1KQM C;  2RGI A;  4USL A;  3SG2 A;  2LUC A;  1S26 D;  5CSI A;  4OKH A;  1UP5 A;  2JTT A;  1BR4 B;  1E8A A;  2KI6 D;  5HYD A;  1CMG A;  1LIN A;  2LAN A;  1OOJ A;  1ZAC A;  1CFC A;  2LLT A;  2JNX A;  3E3R A;  3I5G B;  3LK0 A;  1SYM A;  3NSK A;  1KFU L;  2PMY A;  1OQP A;  1YUS A;  1SMG A;  1CM4 A;  1X02 A;  2M7N A;  1Y1U A;  2KNE A;  1OSA A;  4DCK A;  2M29 A;  1XFU O;  1R2U A;  1SRA A;  2BBM A;  4MBE A;  5HKW A;  4PHK A;  1YRU B;  2JC2 A;  4P2Y B;  2K0J A;  4N1F A;  4PHN A;  5CSN A;  2Y4Q A;  1TCF A;  2E30 A;  3WXA A;  4WQ3 A;  3KPX A;  5DKN A;  2JXC A;  2KAY A;  1BJF A;  4GFT A;  1QX5 B;  1A29 A;  1SL8 A;  1NX3 A;  2HF5 A;  1QX7 A;  1G8I A;  2G2B A;  4YGA A;  4QJ5 B;  2WOS A;  1MWN A;  1CKK A;  2IS9 A;  2OTG B;  1PSB A;  1BU3 A;  1QTX A;  5CPV A;  3TDI A;  1TOP A;  1J55 A;  2BL0 B;  2AMI A;  2KHN A;  1KWO B;  1LKJ A;  1SBJ A;  2OS8 B;  1FF1 A;  4I5L B;  4YGD B;  1CFD A;  4XJK A;  3BOW A;  2LHI A;  4MVF A;  1B7T Z;  5TNC A;  3SJS A;  1IWQ A;  1XK4 C;  2F2O A;  2K7C A;  1LXF C;  2Q4U A;  3BQ3 A;  3D0Y B;  1D1O A;  1CFF A;  1DJX A;  2H61 A;  1J1D A;  1UUS A;  2MA2 A;  2LM5 A;  2GGZ A;  3LK1 A;  1SCV A;  2ZRS A;  2JUL A;  3CWG A;  1XK4 A;  2JXL A;  1A75 B;  2L4I A;  4R1E A;  2M9G A;  3H4S E;  1QLK A;  3OP0 A;  4PAL A;  5KU1 A;  2K7D A;  3RM1 A;  4HRG A;  1DGU A;  2JRF A;  4I5J A;  1RFJ A;  3ZWH A;  1J7P A;  1GQM A;  1KFX S;  3QRX A;  4M2O A;  3BYA A;  2LLU A;  4YGB B;  1AJ5 A;  4ZCV A;  1K94 A;  2H2K A;  4ORB B;  1SW8 A;  4WRI A;  4M2P A;  4YI8 A;  1F55 A;  1UWO A;  3IQQ A;  3IQO A;  2HQW A;  2VRG A;  1WLM A;  1AJ4 A;  1XO5 A;  2M97 A;  1IJ6 A;  1KK7 Y;  1QV1 A;  2I7A A;  2BCX A;  1QIV A;  3EKJ A;  1HQV A;  1WDC C;  3AKB A;  2LCP A;  1N65 A;  2JPT A;  3WNX B;  3WHT B;  2O5G A;  1YVL A;  2F2P A;  2KYC A;  1HT9 A;  1B8L A;  1DTL A;  1EG4 A;  2KSP A;  1PSR A;  1CTR A;  2L50 A;  1J7Q A;  4F0Z B;  1S6C A;  1K9P A;  2K7O A;  2HQ8 A;  1NSH A;  2JT0 A;  1SL7 A;  4AQI A;  1KQV A;  5DKR A;  2LMT A;  4PE1 A;  5I8N A;  4MZJ A;  1S6J A;  1UHK A;  2EC6 C;  2L2E A;  5HKZ A;  1NCZ A;  2MAZ A;  1XVJ A;  1L7Z A;  1TTX A;  2MHH A;  2PSR A;  1AK8 A;  4N5X A;  1FI6 A;  4TNC A;  1Q80 A;  1SPY A;  3CTN A;  1DGV A;  2CXJ A;  3DVJ A;  3I5F C;  4Q04 A;  5F6T A;  5J3X A;  1S36 A;  4PE4 A;  5D7F A;  1FI5 A;  3KF9 A;  2I94 A;  3BUX B;  3OB2 B;  1J7R A;  1CLM A;  1FPW A;  3M0W A;  1A03 A;  1N2D A;  1OE9 B;  2CCM A;  3PAT A;  2AAO A;  3SIB A;  4C0J A;  1B9A A;  5D69 A;  2FCD A;  5AAN A;  1MXE A;  2BCB A;  2BKH B;  2KBI A;  2HPS A;  1SK6 D;  2SAS A;  2Y1N A;  4GBA A;  1ALW A;  2K8M B;  2KGR A;  2O60 A;  1H8B A;  3EVV A;  3EVR A;  4MSP A;  1OMD A;  3I5I B;  2WND A;  1BMO A;  3HCM A;  3EK8 A;  1UUR A;  4D1E A;  1TN4 A;  1MXL C;  2NXQ A;  3OHM B;  2KQ6 A;  4JPZ B;  2ZN8 A;  3AAK A;  3EKH A;  4A4B A;  3TS5 B;  1K90 D;  4YBH B;  1FW4 A;  1DJY A;  1QVI Z;  1SY9 A;  4YGE B;  1BR1 B;  2MLF C;  2WCB A;  4A4C A;  5PAL A;  2LVJ A;  4ZCU A;  4GAO A;  3GK4 X;  3IF7 A;  3MSE B;  1JBA A;  1XFV O;  1YRT B;  3CR5 X;  1XFZ O;  3FWC A;  3TDU A;  1L2O C;  1SCM C;  3KEV A;  1DJW A;  4FTG A;  2QAC A;  1MQ1 A;  2K61 A;  4ORC B;  2BEC A;  1Y0V H;  2LLS A;  2ZFD A;  3TUY C;  2F3Z A;  1PRW A;  1R6P A;  4N1G A;  4C0K A;  2ZN9 A;  3LCP C;  3DVK A;  4OV2 A;  3BUN B;  1PVA A;  2KBM A;  5FYX A;  3BUW B;  1B4C A;  1U5I B;  3NXA A;  3O2P A;  1PUL A;  1S5G Y;  1M63 B;  2GGM A;  1RJV A;  1SL9 A;  1B8R A;  1CDM A;  1K8U A;  1LA3 A;  3DF0 A;  2FCE A;  2ZRT A;  1OMR A;  4MN0 A;  3VRN A;  1DF0 B;  1NX0 A;  1KSO A;  5HKY A;  2NLN A;  5AXI A;  1BF5 A;  1KK8 B;  1CNP A;  1FBV A;  4GGN A;  1IG5 A;  1SKT A;  2H61 C;  1B8C A;  4PHJ A;  2DOQ A;  3SG7 A;  1UHI A;  2KI4 C;  1JF2 A;  3JTD B;  1K9K A;  1OMV A;  1OZO A;  1K9U A;  1JF0 A;  3I5G C;  4MZK A;  1Y6W A;  3SG6 A;  4NDC A;  1ZMZ A;  4YRU A;  1K96 A;  1F54 A;  1M39 A;  1SR6 C;  2KFF A;  3EVU A;  3KO0 A;  1F4Q A;  3NSL A;  3I5H B;  1KSM A;  3SIA A;  3PN7 B;  2PAS A;  1QV0 A;  1AVS A;  1CLB A;  3OX6 A;  1TNX A;  1C7W A;  1EXR A;  1GGW A;  4PE7 A;  1K93 D;  4BY5 A;  4HSZ A;  4NQG A;  2WOR A;  1MUX A;  2LVK A;  1H4B A;  2BKI B;  3FS7 A;  2EHB A;  3O78 A;  2I2R E;  1V1F A;  2NCP A;  5G08 A;  2SCP A;  3I5F B;  4CID A;  2F8P A;  2LE9 B;  2CNP A;  2M1U A;  1AP4 A;  2LUX A;  5HLV A;  2TN4 A;  1YX8 A;  3NSI A;  1DVI A;  5AEQ A;  1F70 A;  1KQM B;  2JU0 A;  3CR4 X;  2BBN A;  1F4O A;  2Y5I A;  3FIA A;  1JUO A;  1QLS A;  3BUM B;  4MEW A;  4ICB A;  1K2H A;  2L0P A;  1IQ3 A;  1XA5 A;  2R2I A;  3PM8 A;  1NYA A;  2OTG C;  1G4Y R;  4CPV A;  1PAL A;  3GK2 A;  2BL0 C;  2BE6 A;  1ODB A;  2V53 A;  1UHJ A;  3HX4 A;  1KFU S;  1QXP A;  2OS8 C;  4NDD A;  5K89 A;  4HRE E;  1QIW A;  1DMO A;  4QJ4 B;  4OR9 B;  1W7I B;  3TZ1 A;  1M46 A;  2LHL A;  3JVT C;  1DF0 A;  3CLN A;  2JTZ A;  2MLE C;  2Q91 A;  2G9B A;  1Y1X A;  1B7T Y;  1RK9 A;  3A8R A;  1NPQ A;  3WHU B;  1OZS A;  4OVN F;  1TRF A;  1J7O A;  2WCF A;  1NX1 A;  1L2O B;  1SCM B;  3TDZ A;  1CB1 A;  2ISD A;  1CDP A;  1NWD A;  1ZUZ A;  1CM1 A;  1ZFS A;  3D0Y A;  2L5X B;  1RTP 1;  4DRW A;  1QAS A;  1RRO A;  1WRL A;  2I18 A;  1S3P A;  1Y1A A;  1NUB A;  2COL B;  2PVB A;  1B1G A;  1CFP A;  4MLW A;  1M45 A;  3EK4 A;  5I2O A;  5IBW A;  1A75 A;  1YUU A;  2F33 A;  1NIW A;  4DS7 A;  1NCX A;  2P6B B;  1F8H A;  3KHE A;  2Y1M A;  4XJK B;  3O4Y A;  2JWW A;  3BOW B;  2A4J A;  1EH2 A;  4PE0 A;  3D10 A;  1EG3 A;  3DD4 A;  3VRR A;  5KSZ A;  1PVB A;  2LP2 A;  1VRK A;  3AAJ A;  1CMF A;  4IL1 A;  1G33 A;  4P5O E;  1B47 A;  3PFV A;  2B1U A;  4M2Q A;  3LL8 B;  4C0L A;  3SG4 A;  3BXK A;  3LLE A;  5I2Q A;  1NCY A;  2KI4 B;  2CT9 A;  1IKU A;  2LVI A;  2M0R A;  2LV7 A;  1IH0 A;  1TIZ A;  1QX2 A;  4I5N B;  3SG3 A;  1C7V A;  1SR6 B;  2BCA A;  4UPG A;  1C07 A;  1GGZ A;  2M1K B;  1A2X A;  1XFW O;  5JOL A;  5GQQ C;  1DJI A;  4MZL A;  2NCO A;  1TNQ A;  4NDB A;  5ER4 X;  2LMU A;  2GV5 A;  4PCW A;  3CS1 A;  2KI6 C;  2NZ0 A;  3ICB A;  4I5K A;  4XYN A;  1TCO B;  1BT6 A;  1CLL A;  1UHH A;  2L4H A;  4GPL B;  3A4U B;  2CBL A;  1LVC D;  1K95 A;  1TNP A;  2LVV A;  3NSO A;  1BOD A;  5ER5 A;  1YX7 A;  1EJ3 A;  2JT8 A;  1YVH A;  2FOT A;  1BOC A;  5HLO A;  2EGD A;  2LNK A;  3DVM A;  1PK0 D;  3C1V A;  1WRK A;  1CDL A;  1KK7 Z;  4CFR A;  5B8I B;  2PAL A;  4DIR A;  4CFQ A;  1IJ5 A;  3OX5 A;  1YUR A;  1WDC B;  2FJU B;  2ZNE A;  2WC8 A;  4QJ3 B;  1ALV A;  3I5I C;  2JZI A;  2K7B A;  1QJT A;  5AFP A;  2OPO A;  3CGA A;  1EL4 A;  1IQ5 A;  4L9M A;  3GOF A;  3O6B A;  3VRQ A;  3EK7 A;  3TS5 C;  2D8N A;  5JJG A;  1QVI Y;  1MF8 B;  2EC6 B;  2ZND A;  5I2L A;  1WY9 A;  2JT3 A;  4HRH A;  1XYD A;  3CR2 A;  2K2A A;  1F71 A;  3JVT B;  1MHO A;  2KYF A;  1A4P A;  5DKQ A;  1J1E A;  2KFG A;  4YI9 A;  2LC5 A;  2LMV A;  4FQO A;  2WCE A;  1S6I A;  1JFK A;  2PRU A;  1DJZ A;  2KQY A;  2LP3 A;  1ZOT B;  1W7J B;  4CLN A;  2KOT A;  1LA0 A;  3K21 A;  4GUK A;  4DUQ A;  1DJG A;  3F45 A;  1KCY A;  1M31 A;  1XFY O;  2KFH A;  4E68 A;  1JSA A;  2KGB C;  4PHM A;  3SG5 A;  2M8U A;  3OB1 B;  4AQJ A;  1UHN A;  5CSJ A;  4GGF C;  1BG1 A;  2KAV A;  4PDZ A;  1JC2 A;  1MR8 A;  1JWD A;  4MRX A;  1IRJ A;  2HET A;  1KWO C;  1AHR A;  1AUI B;  1N0Y A;  1REC A;  4ETO A;  3DVE A;  1DT7 B;  1NP8 A;  1V1G A;  1U5I A;  3PLF B;  4ORA B;  4GGF A;  1KK8 C;  2ZKM X;  4BY4 A;  4OCI A;  1WRZ A;  3PSR A;  3RLZ A;  2M49 B;  3JTD C;  1YR5 A;  3FWB A;  2MRD A;  2F3Y A;  1RWY A;  1JFJ A;  1QAT A;  1QS7 A;  4JQ0 D;  3I5H C;  1S1E A;  1YTZ C;  2JQ6 A;  1TNW A;  2M7L A;  4JWQ A;  3PN7 C;  1IGV A;  1SNL A;  3PAL A;  2E6W A;  3VRP A;  5CSF A;  1KFX L;  3BUO B;  2MBX A;  3TUY B;  1CDN A;  1YUT A;  5BPJ A; 
#chains in the Genus database with same CATH topology
 2KDH A;  3DF0 B;  3ZNI A;  1GJY A;  5AER A;  2BE4 A;  3CZT X;  4YGC B;  1NX2 A;  2CTN A;  2L98 A;  3GK1 A;  1BLQ A;  2MJW B;  2M3W A;  4GNK B;  2KAX A;  2K2F A;  1S5G Z;  3VGO A;  2QPT A;  3AKA A;  2JOJ A;  1DJH A;  4WQ2 A;  3IVT A;  2LAP A;  4AOM A;  2KPH A;  2AUC A;  4U8D A;  1WLZ A;  2L51 A;  2JNF A;  5KTY A;  1XFX O;  4MRY A;  3VRO A;  1KQM C;  2RGI A;  4USL A;  3SG2 A;  2LUC A;  1S26 D;  5CSI A;  4OKH A;  1UP5 A;  1SSE B;  2JTT A;  1BR4 B;  1E8A A;  2KI6 D;  4INW A;  5HYD A;  1CMG A;  1LIN A;  3FE8 A;  2LAN A;  1OOJ A;  1ZAC A;  1CFC A;  2LLT A;  2JNX A;  3E3R A;  3I5G B;  3LK0 A;  1W9Z A;  1SYM A;  3NSK A;  1KFU L;  2PMY A;  1OQP A;  1YUS A;  1SMG A;  1TUJ A;  2QEH A;  1CM4 A;  1X02 A;  2M7N A;  1Y1U A;  2KNE A;  1OSA A;  4DCK A;  2M29 A;  1XFU O;  1R2U A;  1SRA A;  2BBM A;  4MBE A;  5HKW A;  4PHK A;  1YRU B;  2JC2 A;  4P2Y B;  2K0J A;  4N1F A;  3L4A A;  4PHN A;  3CDN A;  1T14 A;  5CSN A;  2Y4Q A;  1TCF A;  2E30 A;  3DYE A;  3WXA A;  3RZS A;  4WQ3 A;  3KPX A;  5DKN A;  2JXC A;  2KAY A;  1BJF A;  1P28 A;  4GFT A;  1QX5 B;  1A29 A;  1SL8 A;  1NX3 A;  2HF5 A;  1QX7 A;  1G8I A;  2WC6 A;  2G2B A;  4YGA A;  4QJ5 B;  2WOS A;  1MWN A;  1CKK A;  2IS9 A;  2OTG B;  1PSB A;  1BU3 A;  1QTX A;  5CPV A;  1XFR A;  3TDI A;  1TOP A;  3BFH A;  1J55 A;  2BL0 B;  3SS4 A;  2AMI A;  2KHN A;  1KWO B;  1LKJ A;  1SBJ A;  2OS8 B;  3B88 A;  3BJH A;  1FF1 A;  4I5L B;  4YGD B;  1CFD A;  4XJK A;  2FJY A;  4F7F A;  3BOW A;  2LHI A;  4MVF A;  1B7T Z;  5TNC A;  3SJS A;  1IWQ A;  1XK4 C;  2F2O A;  2K7C A;  1LXF C;  2Q4U A;  3BQ3 A;  3D0Y B;  1D1O A;  1CFF A;  1DJX A;  3Q8I A;  2H61 A;  1J1D A;  1UUS A;  2MA2 A;  2LM5 A;  2GGZ A;  3LK1 A;  1SCV A;  2ZRS A;  1LS8 A;  3D78 A;  2JUL A;  3CWG A;  1XK4 A;  2JXL A;  1A75 B;  2L4I A;  4R1E A;  2M9G A;  3H4S E;  1QLK A;  3OP0 A;  4PAL A;  5KU1 A;  2K7D A;  3RM1 A;  2KLD A;  4HRG A;  1DGU A;  2JRF A;  4I5J A;  1RFJ A;  3ZWH A;  1J7P A;  1GQM A;  1KFX S;  3QRX A;  4M2O A;  3BYA A;  2LLU A;  4YGB B;  3SS3 A;  1AJ5 A;  4ZCV A;  3OBV A;  3V2L A;  1K94 A;  2H2K A;  4ORB B;  1SW8 A;  4WRI A;  4M2P A;  4YI8 A;  1F55 A;  1UWO A;  3S0D A;  3IQQ A;  3IQO A;  2HQW A;  2VRG A;  1WLM A;  2JPO A;  1AJ4 A;  1XO5 A;  2BNX A;  2M97 A;  1IJ6 A;  1KK7 Y;  1QV1 A;  2I7A A;  2BCX A;  1QIV A;  3EKJ A;  1HQV A;  1WDC C;  3AKB A;  2LCP A;  1IIO A;  1N65 A;  2JPT A;  3WNX B;  3WHT B;  2O5G A;  1YVL A;  2F2P A;  2KYC A;  1HT9 A;  1B8L A;  1DTL A;  3DY9 A;  1EG4 A;  2KSP A;  1PSR A;  1CTR A;  2L50 A;  1J7Q A;  4F0Z B;  1S6C A;  1K9P A;  2K7O A;  2HQ8 A;  3B7A A;  1NSH A;  2JT0 A;  2WCH A;  1SL7 A;  4AQI A;  1KQV A;  5DKR A;  2LMT A;  3R1P A;  4PE1 A;  5I8N A;  4MZJ A;  1S6J A;  1UHK A;  2EC6 C;  2WCM A;  2L2E A;  5HKZ A;  1NCZ A;  2MAZ A;  1XVJ A;  5I94 A;  3CZ0 A;  1OOI X;  1L7Z A;  1TTX A;  2MHH A;  2PSR A;  3B86 A;  1AK8 A;  4N5X A;  3NHT A;  1FI6 A;  1DEK A;  1Q80 A;  1SPY A;  3CTN A;  1DGV A;  2CXJ A;  3DVJ A;  3I5F C;  4Q04 A;  4TNC A;  5EL2 A;  5F6T A;  1S36 A;  5J3X A;  4PE4 A;  5FI7 A;  5D7F A;  1FI5 A;  3KF9 A;  3O4X A;  1OOG A;  2I94 A;  3BUX B;  3OB2 B;  1J7R A;  1CLM A;  1FPW A;  3M0W A;  1A03 A;  1N2D A;  1OE9 B;  2CCM A;  3PAT A;  2AAO A;  3SIB A;  4C0J A;  1B9A A;  5D69 A;  2FCD A;  5AAN A;  1MXE A;  2BCB A;  2BKH B;  2KBI A;  2HPS A;  1SK6 D;  2SAS A;  2Y1N A;  4GBA A;  1ALW A;  2K8M B;  2KGR A;  1ORG A;  2O60 A;  3EVV A;  1H8B A;  3EVR A;  4MSP A;  1OMD A;  3I5I B;  2WND A;  1BMO A;  3HCM A;  3EK8 A;  1UUR A;  4D1E A;  1TN4 A;  1MXL C;  2NXQ A;  3OHM B;  2KQ6 A;  4JPZ B;  2ZN8 A;  3FE9 A;  3AAK A;  3EKH A;  2PYQ A;  3TS5 B;  1K90 D;  4YBH B;  4A4B A;  4PT1 A;  5HL1 A;  1FW4 A;  1DJY A;  1QVI Z;  1SY9 A;  4YGE B;  1BR1 B;  2MLF C;  2WCB A;  4A4C A;  5PAL A;  2LVJ A;  4ZCU A;  4GAO A;  3GK4 X;  3IF7 A;  3MSE B;  1JBA A;  1XFV O;  1YRT B;  4KYN A;  3CR5 X;  1XFZ O;  3FWC A;  3TDU A;  3S0A A;  1L2O C;  1Z2C B;  1SCM C;  1C3Z A;  3KEV A;  1DC1 A;  1DJW A;  4FTG A;  2QAC A;  1MQ1 A;  2K61 A;  4ORC B;  2BEC A;  1Y0V H;  2LLS A;  2ZFD A;  3TUY C;  2F3Z A;  2PQL A;  1PRW A;  1R6P A;  4N1G A;  4C0K A;  4INX A;  3L4L A;  2ZN9 A;  3LCP C;  3DVK A;  2WCL A;  4OV2 A;  3BUN B;  1PVA A;  2KBM A;  5FYX A;  3BUW B;  1B4C A;  1U5I B;  3NXA A;  3O2P A;  1PUL A;  1S5G Y;  1M63 B;  2GGM A;  1RJV A;  1SL9 A;  1B8R A;  1CDM A;  1K8U A;  1LA3 A;  3DF0 A;  2FCE A;  2ZRT A;  1OMR A;  4MN0 A;  3VRN A;  1DF0 B;  1NX0 A;  1KSO A;  5HKY A;  1C3Y A;  2NLN A;  5AXI A;  1BF5 A;  1KK8 B;  1CNP A;  1FBV A;  3CAB A;  4GGN A;  1IG5 A;  1SKT A;  2H61 C;  1B8C A;  4PHJ A;  2DOQ A;  3SG7 A;  1UHI A;  2KI4 C;  1JF2 A;  3JTD B;  1K9K A;  1OMV A;  1OZO A;  1K9U A;  1JF0 A;  3I5G C;  2P70 A;  4MZK A;  1Z4H A;  1Y6W A;  3CYZ A;  4NDC A;  1ZMZ A;  3SG6 A;  1K96 A;  3BFB A;  4YRU A;  1F54 A;  1M39 A;  1SR6 C;  2KFF A;  3EVU A;  3KO0 A;  1F4Q A;  2WCJ A;  3NSL A;  3I5H B;  1KSM A;  3SIA A;  3PN7 B;  2PAS A;  2WCK A;  1QV0 A;  1AVS A;  1CLB A;  3OX6 A;  1TNX A;  1C7W A;  1EXR A;  1GGW A;  4PE7 A;  1K93 D;  4BY5 A;  3D77 A;  4HSZ A;  4NQG A;  2WOR A;  1MUX A;  2LVK A;  1H4B A;  2BKI B;  3FS7 A;  2EHB A;  3O78 A;  2I2R E;  1V1F A;  2NCP A;  5G08 A;  2SCP A;  3I5F B;  4CID A;  2F8P A;  3D74 A;  2LE9 B;  2CNP A;  3DXL A;  2M1U A;  1AP4 A;  2LUX A;  5HLV A;  2TN4 A;  1YX8 A;  3NSI A;  1DVI A;  5AEQ A;  1F70 A;  2GTE A;  1KQM B;  2JU0 A;  3CR4 X;  3D76 A;  2BBN A;  1F4O A;  2Y5I A;  3FIA A;  1JUO A;  1QLS A;  3BUM B;  4MEW A;  4ICB A;  2P71 A;  1K2H A;  2L0P A;  1IQ3 A;  1XA5 A;  2R2I A;  3PM8 A;  5FI2 A;  1NYA A;  2OTG C;  1G4Y R;  4CPV A;  3CZ2 A;  1PAL A;  4IJ7 A;  3GK2 A;  2QDI A;  2BL0 C;  3R1V A;  2BE6 A;  1ODB A;  2V53 A;  1UHJ A;  1TUZ A;  3HX4 A;  1KFU S;  2L2C A;  3FE6 A;  1QXP A;  2OS8 C;  4NDD A;  5K89 A;  4HRE E;  1QIW A;  1DMO A;  4QJ4 B;  4OR9 B;  1W7I B;  3DZT A;  3TZ1 A;  1M46 A;  1DEL A;  2LHL A;  3JVT C;  2QEO A;  1DF0 A;  3CLN A;  2JTZ A;  2MLE C;  2Q91 A;  2G9B A;  1Y1X A;  1B7T Y;  1RK9 A;  3A8R A;  1NPQ A;  3WHU B;  1OZS A;  4OVN F;  1TRF A;  1J7O A;  2WCF A;  1NX1 A;  1L2O B;  1SCM B;  3TDZ A;  1CB1 A;  2ISD A;  3SS5 A;  1CDP A;  1NWD A;  1ZUZ A;  2QEB A;  1CM1 A;  1ZFS A;  3D0Y A;  2L5X B;  1RTP 1;  2ERB A;  1QAS A;  1RRO A;  4DRW A;  1WRL A;  2I18 A;  1S3P A;  1Y1A A;  1NUB A;  2COL B;  2PVB A;  3NGV A;  1B1G A;  1CFP A;  3S0F A;  4MLW A;  1M45 A;  3EK4 A;  5I2O A;  5IBW A;  1A75 A;  1YUU A;  2F33 A;  1NIW A;  4DS7 A;  1NCX A;  2P6B B;  3PM2 A;  1F8H A;  3KHE A;  2Y1M A;  4XJK B;  3O4Y A;  2JWW A;  3D75 A;  3BOW B;  2A4J A;  3L47 A;  5FI6 A;  1EH2 A;  1GM0 A;  4PE0 A;  3D10 A;  1EG3 A;  3DD4 A;  3VRR A;  5KSZ A;  1PVB A;  2LP2 A;  1VRK A;  3AAJ A;  1CMF A;  4IL1 A;  1G33 A;  4P5O E;  1B47 A;  3PFV A;  2B1U A;  4M2Q A;  3LL8 B;  4C0L A;  3SG4 A;  3BXK A;  3LLE A;  5DIC A;  5I2Q A;  1NCY A;  2KI4 B;  4JKT A;  1OOF A;  2CT9 A;  1IKU A;  2LVI A;  2M0R A;  2LV7 A;  3UO9 A;  1IH0 A;  1TIZ A;  2YGU A;  1QX2 A;  4I5N B;  3SG3 A;  1C7V A;  1SR6 B;  2BCA A;  4UPG A;  1C07 A;  1GGZ A;  2M1K B;  3UNW A;  1A2X A;  1XFW O;  5JOL A;  5GQQ C;  1DJI A;  4MZL A;  2NCO A;  1TNQ A;  4NDB A;  5ER4 X;  2LMU A;  2GV5 A;  4PCW A;  2L5Y A;  3CS1 A;  2KI6 C;  2NZ0 A;  2BAP A;  3ICB A;  3B87 A;  4I5K A;  4XYN A;  1TCO B;  5D3O A;  1BT6 A;  1CLL A;  2WC5 A;  1UHH A;  3R72 A;  2L4H A;  4GPL B;  3A4U B;  2CBL A;  1LVC D;  1K95 A;  1TNP A;  2LVV A;  1DQE A;  3NSO A;  5ER5 A;  3S0G A;  1BOD A;  1YX7 A;  1EJ3 A;  2JT8 A;  1YVH A;  2FOT A;  1QWV A;  3S0E A;  1BOC A;  5HLO A;  2EGD A;  2LNK A;  3DVM A;  1PK0 D;  3C1V A;  1WRK A;  1CDL A;  1KK7 Z;  3K1E A;  4CFR A;  2PAL A;  4DIR A;  5B8I B;  4CFQ A;  1IJ5 A;  3OX5 A;  1YUR A;  3PJI A;  1WDC B;  3VB1 A;  2FJU B;  2ZNE A;  2WC8 A;  4QJ3 B;  3S0B A;  1ALV A;  3I5I C;  2JZI A;  2K7B A;  1QJT A;  5AFP A;  2OPO A;  3CGA A;  1EL4 A;  1IQ5 A;  4L9M A;  3GOF A;  3O6B A;  2KLE A;  3BFA A;  3VRQ A;  3EK7 A;  3TS5 C;  2D8N A;  2K60 A;  3QME A;  5JJG A;  3N7H A;  3NHI A;  1QVI Y;  1MF8 B;  1TWO A;  2EC6 B;  2ZND A;  3CZ1 A;  5I2L A;  1WY9 A;  2JT3 A;  4HRH A;  1XYD A;  3CR2 A;  2K2A A;  1F71 A;  3JVT B;  1MHO A;  2KYF A;  1A4P A;  5DKQ A;  1J1E A;  2KFG A;  3OGN A;  4YI9 A;  2LC5 A;  2LMV A;  4FQO A;  2WCE A;  1S6I A;  1JFK A;  2PRU A;  1DJZ A;  2KQY A;  2LP3 A;  1ZOT B;  1W7J B;  4CLN A;  2KOT A;  1LA0 A;  3K21 A;  4GUK A;  4DUQ A;  1DJG A;  3F45 A;  1KCY A;  1M31 A;  1XFY O;  2KFH A;  4E68 A;  4FQT A;  1JSA A;  2KGB C;  4PHM A;  3SG5 A;  2M8U A;  3B6X A;  3OB1 B;  1UHN A;  4AQJ A;  5CSJ A;  4GGF C;  1BG1 A;  2KAV A;  3R1O A;  4PDZ A;  1MR8 A;  1JC2 A;  1JWD A;  4MRX A;  1IRJ A;  2HET A;  1KWO C;  1AHR A;  1AUI B;  1N0Y A;  1REC A;  4ETO A;  3DVE A;  2QEV A;  1OOH A;  1NP8 A;  1DT7 B;  1V1G A;  1U5I A;  3PLF B;  4ORA B;  4GGF A;  1KK8 C;  2ZKM X;  4BY4 A;  4OCI A;  1WRZ A;  3PSR A;  3RLZ A;  2M49 B;  3JTD C;  1OW4 A;  2H8V A;  1YR5 A;  3FWB A;  2MRD A;  4JD9 A;  2F3Y A;  1RWY A;  1JFJ A;  1QAT A;  1QS7 A;  4JQ0 D;  3I5H C;  1S1E A;  1YTZ C;  2JQ6 A;  1TNW A;  2M7L A;  4JWQ A;  3PN7 C;  1IGV A;  1SNL A;  3PAL A;  2E6W A;  3VRP A;  5CSF A;  1KFX L;  3D73 A;  3EG5 B;  3BUO B;  2MBX A;  3TUY B;  1CDN A;  1YUT A;  4OZD A;  5BPJ A; 
#chains in the Genus database with same CATH homology
 2KDH A;  3DF0 B;  3ZNI A;  1GJY A;  5AER A;  2BE4 A;  3CZT X;  4YGC B;  1NX2 A;  2CTN A;  2L98 A;  3GK1 A;  1BLQ A;  2MJW B;  2M3W A;  4GNK B;  2KAX A;  2K2F A;  1S5G Z;  3VGO A;  2QPT A;  3AKA A;  2JOJ A;  1DJH A;  4WQ2 A;  2LAP A;  4AOM A;  2AUC A;  4U8D A;  1WLZ A;  2L51 A;  2JNF A;  5KTY A;  1XFX O;  4MRY A;  3VRO A;  1KQM C;  2RGI A;  4USL A;  3SG2 A;  2LUC A;  1S26 D;  5CSI A;  4OKH A;  1UP5 A;  2JTT A;  1BR4 B;  1E8A A;  2KI6 D;  5HYD A;  1CMG A;  1LIN A;  2LAN A;  1OOJ A;  1ZAC A;  1CFC A;  2LLT A;  2JNX A;  3E3R A;  3I5G B;  3LK0 A;  1SYM A;  3NSK A;  1KFU L;  2PMY A;  1OQP A;  1YUS A;  1SMG A;  1CM4 A;  1X02 A;  2M7N A;  1Y1U A;  2KNE A;  1OSA A;  4DCK A;  2M29 A;  1XFU O;  1R2U A;  1SRA A;  2BBM A;  4MBE A;  5HKW A;  4PHK A;  1YRU B;  2JC2 A;  4P2Y B;  2K0J A;  4N1F A;  4PHN A;  5CSN A;  2Y4Q A;  1TCF A;  2E30 A;  3WXA A;  4WQ3 A;  3KPX A;  5DKN A;  2JXC A;  2KAY A;  1BJF A;  4GFT A;  1QX5 B;  1A29 A;  1SL8 A;  1NX3 A;  2HF5 A;  1QX7 A;  1G8I A;  2G2B A;  4YGA A;  4QJ5 B;  2WOS A;  1MWN A;  1CKK A;  2IS9 A;  2OTG B;  1PSB A;  1BU3 A;  1QTX A;  5CPV A;  3TDI A;  1TOP A;  1J55 A;  2BL0 B;  2AMI A;  2KHN A;  1KWO B;  1LKJ A;  1SBJ A;  2OS8 B;  1FF1 A;  4I5L B;  4YGD B;  1CFD A;  4XJK A;  3BOW A;  2LHI A;  4MVF A;  1B7T Z;  5TNC A;  3SJS A;  1IWQ A;  1XK4 C;  2F2O A;  2K7C A;  1LXF C;  2Q4U A;  3BQ3 A;  3D0Y B;  1D1O A;  1CFF A;  1DJX A;  2H61 A;  1J1D A;  1UUS A;  2MA2 A;  2LM5 A;  2GGZ A;  3LK1 A;  1SCV A;  2ZRS A;  2JUL A;  3CWG A;  1XK4 A;  2JXL A;  1A75 B;  2L4I A;  4R1E A;  2M9G A;  3H4S E;  1QLK A;  3OP0 A;  4PAL A;  5KU1 A;  2K7D A;  3RM1 A;  4HRG A;  1DGU A;  2JRF A;  4I5J A;  1RFJ A;  3ZWH A;  1J7P A;  1GQM A;  1KFX S;  3QRX A;  4M2O A;  3BYA A;  2LLU A;  4YGB B;  1AJ5 A;  4ZCV A;  1K94 A;  2H2K A;  4ORB B;  1SW8 A;  4WRI A;  4M2P A;  4YI8 A;  1F55 A;  1UWO A;  3IQQ A;  3IQO A;  2HQW A;  2VRG A;  1WLM A;  1AJ4 A;  1XO5 A;  2M97 A;  1IJ6 A;  1KK7 Y;  1QV1 A;  2I7A A;  2BCX A;  1QIV A;  3EKJ A;  1HQV A;  1WDC C;  3AKB A;  2LCP A;  1N65 A;  2JPT A;  3WNX B;  3WHT B;  2O5G A;  1YVL A;  2F2P A;  2KYC A;  1HT9 A;  1B8L A;  1DTL A;  1EG4 A;  2KSP A;  1PSR A;  1CTR A;  2L50 A;  1J7Q A;  4F0Z B;  1S6C A;  1K9P A;  2K7O A;  2HQ8 A;  1NSH A;  2JT0 A;  1SL7 A;  4AQI A;  1KQV A;  5DKR A;  2LMT A;  4PE1 A;  5I8N A;  4MZJ A;  1S6J A;  1UHK A;  2EC6 C;  2L2E A;  5HKZ A;  1NCZ A;  2MAZ A;  1XVJ A;  1L7Z A;  1TTX A;  2MHH A;  2PSR A;  1AK8 A;  4N5X A;  1FI6 A;  4TNC A;  1Q80 A;  1SPY A;  3CTN A;  1DGV A;  2CXJ A;  3DVJ A;  3I5F C;  4Q04 A;  5F6T A;  5J3X A;  1S36 A;  4PE4 A;  5D7F A;  1FI5 A;  3KF9 A;  2I94 A;  3BUX B;  3OB2 B;  1J7R A;  1CLM A;  1FPW A;  3M0W A;  1A03 A;  1N2D A;  1OE9 B;  2CCM A;  3PAT A;  2AAO A;  3SIB A;  4C0J A;  1B9A A;  5D69 A;  2FCD A;  5AAN A;  1MXE A;  2BCB A;  2BKH B;  2KBI A;  2HPS A;  1SK6 D;  2SAS A;  2Y1N A;  4GBA A;  1ALW A;  2K8M B;  2KGR A;  2O60 A;  1H8B A;  3EVV A;  3EVR A;  4MSP A;  1OMD A;  3I5I B;  2WND A;  1BMO A;  3HCM A;  3EK8 A;  1UUR A;  4D1E A;  1TN4 A;  1MXL C;  2NXQ A;  3OHM B;  2KQ6 A;  4JPZ B;  2ZN8 A;  3AAK A;  3EKH A;  4A4B A;  3TS5 B;  1K90 D;  4YBH B;  1FW4 A;  1DJY A;  1QVI Z;  1SY9 A;  4YGE B;  1BR1 B;  2MLF C;  2WCB A;  4A4C A;  5PAL A;  2LVJ A;  4ZCU A;  4GAO A;  3GK4 X;  3IF7 A;  3MSE B;  1JBA A;  1XFV O;  1YRT B;  3CR5 X;  1XFZ O;  3FWC A;  3TDU A;  1L2O C;  1SCM C;  3KEV A;  1DJW A;  4FTG A;  2QAC A;  1MQ1 A;  2K61 A;  4ORC B;  2BEC A;  1Y0V H;  2LLS A;  2ZFD A;  3TUY C;  2F3Z A;  1PRW A;  1R6P A;  4N1G A;  4C0K A;  2ZN9 A;  3LCP C;  3DVK A;  4OV2 A;  3BUN B;  1PVA A;  2KBM A;  5FYX A;  3BUW B;  1B4C A;  1U5I B;  3NXA A;  3O2P A;  1PUL A;  1S5G Y;  1M63 B;  2GGM A;  1RJV A;  1SL9 A;  1B8R A;  1CDM A;  1K8U A;  1LA3 A;  3DF0 A;  2FCE A;  2ZRT A;  1OMR A;  4MN0 A;  3VRN A;  1DF0 B;  1NX0 A;  1KSO A;  5HKY A;  2NLN A;  5AXI A;  1BF5 A;  1KK8 B;  1CNP A;  1FBV A;  4GGN A;  1IG5 A;  1SKT A;  2H61 C;  1B8C A;  4PHJ A;  2DOQ A;  3SG7 A;  1UHI A;  2KI4 C;  1JF2 A;  3JTD B;  1K9K A;  1OMV A;  1OZO A;  1K9U A;  1JF0 A;  3I5G C;  4MZK A;  1Y6W A;  3SG6 A;  4NDC A;  1ZMZ A;  4YRU A;  1K96 A;  1F54 A;  1M39 A;  1SR6 C;  2KFF A;  3EVU A;  3KO0 A;  1F4Q A;  3NSL A;  3I5H B;  1KSM A;  3SIA A;  3PN7 B;  2PAS A;  1QV0 A;  1AVS A;  1CLB A;  3OX6 A;  1TNX A;  1C7W A;  1EXR A;  1GGW A;  4PE7 A;  1K93 D;  4BY5 A;  4HSZ A;  4NQG A;  2WOR A;  1MUX A;  2LVK A;  1H4B A;  2BKI B;  3FS7 A;  2EHB A;  3O78 A;  2I2R E;  1V1F A;  2NCP A;  5G08 A;  2SCP A;  3I5F B;  4CID A;  2F8P A;  2LE9 B;  2CNP A;  2M1U A;  1AP4 A;  2LUX A;  5HLV A;  2TN4 A;  1YX8 A;  3NSI A;  1DVI A;  5AEQ A;  1F70 A;  1KQM B;  2JU0 A;  3CR4 X;  2BBN A;  1F4O A;  2Y5I A;  3FIA A;  1JUO A;  1QLS A;  3BUM B;  4MEW A;  4ICB A;  1K2H A;  2L0P A;  1IQ3 A;  1XA5 A;  2R2I A;  3PM8 A;  1NYA A;  2OTG C;  1G4Y R;  4CPV A;  1PAL A;  3GK2 A;  2BL0 C;  2BE6 A;  1ODB A;  2V53 A;  1UHJ A;  3HX4 A;  1KFU S;  1QXP A;  2OS8 C;  4NDD A;  5K89 A;  4HRE E;  1QIW A;  1DMO A;  4QJ4 B;  4OR9 B;  1W7I B;  3TZ1 A;  1M46 A;  2LHL A;  3JVT C;  1DF0 A;  3CLN A;  2JTZ A;  2MLE C;  2Q91 A;  2G9B A;  1Y1X A;  1B7T Y;  1RK9 A;  3A8R A;  1NPQ A;  3WHU B;  1OZS A;  4OVN F;  1TRF A;  1J7O A;  2WCF A;  1NX1 A;  1L2O B;  1SCM B;  3TDZ A;  1CB1 A;  2ISD A;  1CDP A;  1NWD A;  1ZUZ A;  1CM1 A;  1ZFS A;  3D0Y A;  2L5X B;  1RTP 1;  4DRW A;  1QAS A;  1RRO A;  1WRL A;  2I18 A;  1S3P A;  1Y1A A;  1NUB A;  2COL B;  2PVB A;  1B1G A;  1CFP A;  4MLW A;  1M45 A;  3EK4 A;  5I2O A;  5IBW A;  1A75 A;  1YUU A;  2F33 A;  1NIW A;  4DS7 A;  1NCX A;  2P6B B;  1F8H A;  3KHE A;  2Y1M A;  4XJK B;  3O4Y A;  2JWW A;  3BOW B;  2A4J A;  1EH2 A;  4PE0 A;  3D10 A;  1EG3 A;  3DD4 A;  3VRR A;  5KSZ A;  1PVB A;  2LP2 A;  1VRK A;  3AAJ A;  1CMF A;  4IL1 A;  1G33 A;  4P5O E;  1B47 A;  3PFV A;  2B1U A;  4M2Q A;  3LL8 B;  4C0L A;  3SG4 A;  3BXK A;  3LLE A;  5I2Q A;  1NCY A;  2KI4 B;  2CT9 A;  1IKU A;  2LVI A;  2M0R A;  2LV7 A;  1IH0 A;  1TIZ A;  1QX2 A;  4I5N B;  3SG3 A;  1C7V A;  1SR6 B;  2BCA A;  4UPG A;  1C07 A;  1GGZ A;  2M1K B;  1A2X A;  1XFW O;  5JOL A;  5GQQ C;  1DJI A;  4MZL A;  2NCO A;  1TNQ A;  4NDB A;  5ER4 X;  2LMU A;  2GV5 A;  4PCW A;  3CS1 A;  2KI6 C;  2NZ0 A;  3ICB A;  4I5K A;  4XYN A;  1TCO B;  1BT6 A;  1CLL A;  1UHH A;  2L4H A;  4GPL B;  3A4U B;  2CBL A;  1LVC D;  1K95 A;  1TNP A;  2LVV A;  3NSO A;  1BOD A;  5ER5 A;  1YX7 A;  1EJ3 A;  2JT8 A;  1YVH A;  2FOT A;  1BOC A;  5HLO A;  2EGD A;  2LNK A;  3DVM A;  1PK0 D;  3C1V A;  1WRK A;  1CDL A;  1KK7 Z;  4CFR A;  5B8I B;  2PAL A;  4DIR A;  4CFQ A;  1IJ5 A;  3OX5 A;  1YUR A;  1WDC B;  2FJU B;  2ZNE A;  2WC8 A;  4QJ3 B;  1ALV A;  3I5I C;  2JZI A;  2K7B A;  1QJT A;  5AFP A;  2OPO A;  3CGA A;  1EL4 A;  1IQ5 A;  4L9M A;  3GOF A;  3O6B A;  3VRQ A;  3EK7 A;  3TS5 C;  2D8N A;  5JJG A;  1QVI Y;  1MF8 B;  2EC6 B;  2ZND A;  5I2L A;  1WY9 A;  2JT3 A;  4HRH A;  1XYD A;  3CR2 A;  2K2A A;  1F71 A;  3JVT B;  1MHO A;  2KYF A;  1A4P A;  5DKQ A;  1J1E A;  2KFG A;  4YI9 A;  2LC5 A;  2LMV A;  4FQO A;  2WCE A;  1S6I A;  1JFK A;  2PRU A;  1DJZ A;  2KQY A;  2LP3 A;  1ZOT B;  1W7J B;  4CLN A;  2KOT A;  1LA0 A;  3K21 A;  4GUK A;  4DUQ A;  1DJG A;  3F45 A;  1KCY A;  1M31 A;  1XFY O;  2KFH A;  4E68 A;  1JSA A;  2KGB C;  4PHM A;  3SG5 A;  2M8U A;  3OB1 B;  4AQJ A;  1UHN A;  5CSJ A;  4GGF C;  1BG1 A;  2KAV A;  4PDZ A;  1JC2 A;  1MR8 A;  1JWD A;  4MRX A;  1IRJ A;  2HET A;  1KWO C;  1AHR A;  1AUI B;  1N0Y A;  1REC A;  4ETO A;  3DVE A;  1DT7 B;  1NP8 A;  1V1G A;  1U5I A;  3PLF B;  4ORA B;  4GGF A;  1KK8 C;  2ZKM X;  4BY4 A;  4OCI A;  1WRZ A;  3PSR A;  3RLZ A;  2M49 B;  3JTD C;  1YR5 A;  3FWB A;  2MRD A;  2F3Y A;  1RWY A;  1JFJ A;  1QAT A;  1QS7 A;  4JQ0 D;  3I5H C;  1S1E A;  1YTZ C;  2JQ6 A;  1TNW A;  2M7L A;  4JWQ A;  3PN7 C;  1IGV A;  1SNL A;  3PAL A;  2E6W A;  3VRP A;  5CSF A;  1KFX L;  3BUO B;  2MBX A;  3TUY B;  1CDN A;  1YUT A;  5BPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...