1M46A

Crystal structure of mlc1p bound to iq4 of myo2p, a class v myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle protein
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 44
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A01
2Y1NA 4UPGA 2L98A 1Y1UA 1JF2A 3SG6A 1AK8A 1CMGA 1KSOA 1TNXA 5F6TA 4NDCA 2TN4A 2KI4B 2ZN9A 3KO0A 3PLFB 3JTDB 1OZSA 3GK2A 3DF0A 4MBEA 1SRAA 4OCIA 1M45A 2IS9A 3PALA 3EKHA 4QJ5B 5G08A 1MF8B 1CFCA 1AJ5A 1WLZA 1QV1A 2KQYA 4TNCA 2I7AA 1B9AA 2NCPA 4ETOA 1TIZA 3AKBA 2JRFA 3DVEA 4PE4A 2K7DA 1AJ4A 2LVIA 1S6IA 1EL4A 4USLA 1RECA 3JVTC 4GFTA 1SY9A 4YGDB 1QLSA 1VRKA 4U8DA 3RM1A 1JFJA 3WXAA 1NCZA 1DF0A 2Y5IA 4XJKA 1S5GZ 1PSRA 3FIAA 1IWQA 4BY5A 2JQ6A 1AUIB 1Q80A 3D0YA 1KSMA 2KI6D 1IRJA 4A4CA 3K21A 2PRUA 3OX6A 1WDCB 4CFQA 1J1EA 2L2EA 4GPLB 1J7RA 5CSFA 1K9PA 1BG1A 2K7BA 5HLVA 1ALWA 1G8IA 1WRKA 4DCKA 1YUSA 2LANA 1TRFA 1C7WA 1C7VA 1OMRA 2LHIA 1X02A 1S1EA 4MRXA 2KYCA 3OP0A 4PHJA 3SIAA 1QV0A 2KGBC 1N0YA 4Q04A 2M29A 1UURA 2FOTA 2V53A 3BUWB 1BOCA 1TCFA 2LVJA 2H61A 2KHNA 2FCDA 5I2QA 3FWBA 3SG2A 2OTGC 3DVJA 2O60A 1BR4B 1QATA 1KQVA 2L50A 5ER4X 3WNXB 1RTP1 2JPTA 1RROA 1KFUS 1W7JB 1B7TZ 4M2OA 4YGAA 1YR5A 4PCWA 2BKHB 1YVHA 1JFKA 1JWDA 3GK1A 3TZ1A 1EJ3A 1R2UA 1FPWA 1DJYA 1B4CA 2LLSA 1UHHA 3O4YA 1FF1A 2PASA 3BXKA 5DKRA 3KPXA 1LA0A 1TOPA 1SKTA 3I5IB 1XFXO 3CGAA 2WOSA 2PVBA 2H2KA 3NXAA 4I5JA 4MZLA 4QJ4B 2RGIA 3NSLA 1QASA 4CLNA 1QS7A 1ZUZA 1K9KA 4MRYA 2BCAA 1ZOTB 3I5HB 2OPOA 4WQ3A 2E30A 3NSOA 1LXFC 5AERA 1CFDA 3WHTB 1IJ6A 5B8IB 4NDDA 4MZKA 1M39A 3EK4A 1XK4A 3TDUA 5K89A 2FCEA 1QVIZ 2LMTA 3AAJA 1ODBA 3ZWHA 1KFXL 1CNPA 2BKIB 2OS8B 2WC8A 4M2PA 3DVMA 4BY4A 1SCVA 1YRTB 1EG4A 1YX7A 2NXQA 1PALA 3I5GB 2JU0A 1B8RA 4CFRA 1BLQA 2QACA 3M0WA 4C0KA 1W7IB 1Y1AA 1SL7A 2K7OA 4MLWA 1CTRA 1F8HA 1SK6D 1V1GA 1IKUA 2BE6A 1A75A 1CLBA 2EC6B 4FQOA 2F3ZA 1NX3A 3BYAA 4YGEB 1JBAA 3PN7B 2OTGB 2KDHA 3VROA 3PATA 1B47A 2FJUB 3BQ3A 3BUOB 1F55A 1MUXA 1YURA 3TS5C 2KAXA 2M1UA 2KI6C 2KSPA 3EK7A 2CXJA 2CNPA 1NPQA 1G4YR 1NWDA 1RK9A 4MZJA 5DKQA 2MJWB 3IF7A 2WCFA 2ZKMX 2NZ0A 5AEQA 1SBJA 1CLLA 2Q91A 4GGNA 4PHMA 2BL0B 1L2OC 2MRDA 2HETA 3GK4X 1NX2A 1FW4A 1MXLC 1J7PA 1S6CA 1XFZO 5JOLA 1BU3A 2D8NA 4GBAA 2M0RA 1YRUB 1NYAA 1CFPA 3CR5X 3TUYB 4DRWA 2F3YA 2G9BA 2JT3A 2F2OA 1A75B 1SPYA 3KEVA 1KK7Y 1E8AA 2KGRA 4GGFA 1NX0A 1MXEA 4AOMA 5HKZA 3CR2A 1FI5A 3NSKA 1JUOA 3I5FB 5CSNA 3VGOA 5FYXA 5AANA 2MLFC 1N65A 2K8MB 2GGMA 5GQQC 1KK8B 4L9MA 2HF5A 3A4UB 2I2RE 1NCXA 1FBVA 3O78A 3LL8B 2MAZA 3HX4A 4YGBB 5AXIA 1S36A 5CPVA 1B8LA 2M9GA 4HSZA 4I5NB 4WRIA 4ORAB 1IGVA 1SW8A 3SG3A 4PHKA 2KFHA 1UHJA 3IQQA 4JPZB 3CLNA 2M7NA 3D10A 4MSPA 2WCBA 1C07A 1KQMB 4PALA 1OMVA 5JJGA 1TN4A 3VRQA 1BF5A 1J7QA 4N1GA 2L51A 1PULA 1PSBA 3WHUB 4AQJA 2JC2A 1A4PA 1CM4A 2EGDA 1S3PA 1RFJA 1F54A 2HPSA 1SYMA 3OX5A 1DMOA 1ZACA 1YVLA 2Y1MA 4HRHA 2M49B 1QIWA 2LCPA 4OR9B 1K94A 2F8PA 2ZFDA 2M7LA 1YUTA 2SASA 5I2LA 5KSZA 4F0ZB 1A29A 4QJ3B 2M3WA 1JC2A 4IL1A 5CSIA 4DUQA 2I94A 1V1FA 1XFUO 2EHBA 1M46A 2JTTA 2JXLA 3BOWB 1CMFA 1S6JA 3SIBA 5CSJA 4A4BA 3CR4X 5D69A 1L2OB 2LM5A 1HQVA 2LAPA 2WCEA 2JNFA 1QXPA 1Y6WA 2KI4C 3SG7A 1U5IA 3JTDC 1LA3A 4D1EA 3JVTB 1XK4C 1B7TY 3TDZA 3BUXB 3CS1A 4ICBA 4MVFA 1CB1A 3H4SE 1XO5A 1IJ5A 4JWQA 2JULA 3VRRA 4PE7A 2O5GA 2WORA 1DVIA 1Y1XA 1KFUL 1NCYA 4R1EA 3DVKA 1F4QA 1SMGA 1TTXA 1K95A 1LKJA 1DJWA 2LUCA 4GNKB 4NQGA 2LVVA 2JT0A 3DD4A 4YGCB 1MWNA 1CDLA 3CZTX 1M63B 1XFWO 1TCOB 2VRGA 3C1VA 1WRLA 2JZIA 2GGZA 3CWGA 1ALVA 1EG3A 2CCMA 1G33A 3QRXA 1OZOA 4HRGA 4MEWA 1NSHA 2ZNDA 1YX8A 4PE1A 1DJGA 1PVAA 1QLKA 1UUSA 1MHOA 3E3RA 5KU1A 4XYNA 2M8UA 2M97A 2JOJA 5J3XA 3LLEA 3LCPC 3OB1B 1KWOC 1EXRA 3KF9A 1XFYO 4OVNF 2BCXA 2LVKA 3O6BA 5I8NA 1DJZA 1CM1A 1Y0VH 1RJVA 2DOQA 2MHHA 5HKWA 1DT7B 4N5XA 1U5IB 2LLUA 1CKKA 2LMVA 2JXCA 3SJSA 1SL9A 2ISDA 2K61A 3ICBA 4C0JA 2HQWA 3O2PA 1BODA 1XYDA 2LLTA 2L5XB 1S26D 1LVCD 1DJXA 1QJTA 3LK1A 1F71A 1XVJA 1GGWA 1K90D 3FWCA 1LINA 2A4JA 2K7CA 4ORCB 2LMUA 3F45A 1R6PA 1IH0A 1SNLA 4OKHA 2QPTA 2LE9B 2PMYA 1NUBA 2B1UA 2E6WA 2KFFA 4P5OE 4YBHB 1D1OA 2KOTA 4CPVA 3AKAA 1UHKA 1OMDA 1RWYA 3BUNB 1YTZC 1MR8A 1QX2A 4JQ0D 4ORBB 1SCMC 4GGFC 1OQPA 1IQ5A 1QX7A 1QIVA 2AAOA 4HREE 1FI6A 1SL8A 2PALA 1N2DA 1XFVO 1M31A 2L0PA 3RLZA 5HYDA 1K9UA 3CTNA 1KK7Z 3SG5A 3BUMB 2I18A 1H8BA 2LP2A 1CDMA 1QX5B 2LV7A 2ZRTA 4YI8A 1BMOA 2BE4A 1PVBA 2MBXA 5AFPA 2LP3A 3GOFA 3I5IC 3PM8A 1B1GA 4DIRA 1WY9A 2KBMA 3VRPA 5DKNA 2KBIA 1F70A 1SR6C 2COLB 3AAKA 4FTGA 2KFGA 3OHMB 4PDZA 1L7ZA 3BOWA 2CTNA 2AUCA 3I5HC 2JT8A 4N1FA 1BJFA 2H61C 1CDNA 1CDPA 1AHRA 2KAVA 2M1KB 1PK0D 1S5GY 1UWOA 2G2BA 4OV2A 1IQ3A 1DTLA 1KWOB 3KHEA 2AMIA 1NIWA 1CFFA 2K0JA 2MA2A 4WQ2A 1F4OA 1QTXA 4YI9A 2OS8C 1OSAA 3MSEB 3DF0B 1K2HA 1K93D 1WRZA 4MN0A 3EVVA 3VRNA 1HT9A 1PRWA 1XA5A 1UHNA 5HLOA 4AQIA 3TS5B 4GUKA 2BECA 3I5GC 5ER5A 5D7FA 1YUUA 1OE9B 4I5KA 1MQ1A 2LC5A 5BPJA 3EKJA 4E68A 3FS7A 2CT9A 1A03A 1J7OA 1ZMZA 3TDIA 4PHNA 2EC6C 2GV5A 2JNXA 2L4IA 5KTYA 3PN7C 3EVRA 3EVUA 1UP5A 2KAYA 3PFVA 1WLMA 1DF0B 4XJKB 1TNWA 2WNDA 5PALA 1J1DA 1A2XA 1SCMB 2NCOA 2ZN8A 4YRUA 3EK8A 1DJIA 1NX1A 3OB2B 3D0YB 3A8RA 1K96A 1NP8A 1CLMA 1KCYA 4ZCVA 1J55A 2BBMA 1KFXS 1AP4A 2BCBA 4DS7A 2BL0C 2KYFA 4NDBA 2HQ8A 4M2QA 4GAOA 2ZNEA 2SCPA 4PE0A 2K2FA 1K8UA 2BBNA 4ZCUA 1DGUA 1GQMA 1SR6B 1TNQA 1TNPA 2KQ6A 2ZRSA 5TNCA 2Y4QA 5IBWA 2P6BB 1H4BA 3TUYC 1JF0A 2NLNA 1OOJA 3IQOA 3ZNIA 2LHLA 4I5LB 4C0LA 2Q4UA 2JTZA 2KNEA 2PSRA 3SG4A 1B8CA 3I5FC 1GGZA 1JSAA 1QVIY 1GJYA 1UHIA 2F2PA 1KK8C 2F33A 5I2OA 3LK0A 1WDCC 2L4HA 2MLEC 1IG5A 1BT6A 2JWWA 2LUXA 1EH2A 1DGVA 4P2YB 4CIDA 5HKYA 3HCMA 3NSIA 1DJHA 3PSRA 1ZFSA 2LNKA 2K2AA 1BR1B 2R2IA 1KQMC 1AVSA 2CBLA
chains in the Genus database with same CATH superfamily
2Y1NA 3B7AA 3PM2A 4UPGA 2L98A 1Y1UA 1JF2A 3SG6A 1AK8A 3B87A 1CMGA 1KSOA 1TNXA 5F6TA 4NDCA 2TN4A 2WCKA 2KI4B 2ZN9A 3KO0A 3PLFB 3JTDB 1OZSA 3GK2A 3DF0A 4MBEA 1SRAA 4OCIA 1M45A 2IS9A 3PALA 3EKHA 4QJ5B 5G08A 1MF8B 1CFCA 1AJ5A 1WLZA 1QV1A 2L2CA 1C3YA 2KQYA 4TNCA 2I7AA 1B9AA 2NCPA 4ETOA 1TIZA 3FE8A 3AKBA 2JRFA 3DVEA 4PE4A 3UO9A 2K7DA 1AJ4A 1TUZA 2LVIA 3L4LA 1S6IA 1EL4A 4USLA 1RECA 3JVTC 4GFTA 1SY9A 4YGDB 1QLSA 1VRKA 4U8DA 3RM1A 1JFJA 3L47A 3WXAA 3D73A 1NCZA 1DF0A 2Y5IA 1OOIX 4XJKA 3DZTA 1S5GZ 1PSRA 3FIAA 3O4XA 3SS3A 1IWQA 3S0DA 2YGUA 4BY5A 2JQ6A 1AUIB 1Q80A 3D0YA 1KSMA 2KI6D 1IRJA 2WCJA 4A4CA 3K21A 2PRUA 3OX6A 1WDCB 4CFQA 3EG5B 1J1EA 2L2EA 4GPLB 1J7RA 5CSFA 1K9PA 3SS5A 1BG1A 2K7BA 5HLVA 1ALWA 1G8IA 1WRKA 4DCKA 1YUSA 2LANA 5FI7A 1TRFA 2QEVA 1C7WA 1C7VA 1OMRA 2LHIA 1X02A 1S1EA 4MRXA 2KYCA 3OP0A 4PHJA 3SIAA 1QV0A 2KGBC 1N0YA 4Q04A 2M29A 3S0EA 3N7HA 1UURA 2FOTA 1P28A 2V53A 1TUJA 3BUWB 1BOCA 2QDIA 1TCFA 2LVJA 2H61A 2KHNA 2FCDA 5I2QA 2KPHA 3FWBA 3SG2A 2OTGC 3DVJA 2O60A 1BR4B 1QATA 1KQVA 2L50A 5ER4X 3WNXB 1RTP1 2JPTA 1RROA 2QEHA 1KFUS 1W7JB 1B7TZ 4M2OA 4YGAA 2WCLA 1YR5A 3D74A 2BKHB 4PCWA 1YVHA 1JFKA 1JWDA 3GK1A 3TZ1A 1EJ3A 1R2UA 1FPWA 1DJYA 1B4CA 2LLSA 1UHHA 3O4YA 1FF1A 2PASA 3BXKA 5DKRA 1IIOA 3KPXA 1LA0A 1TOPA 1SKTA 3I5IB 1XFXO 3CGAA 2WOSA 2PVBA 2H2KA 3NXAA 1W9ZA 4I5JA 4MZLA 4QJ4B 2RGIA 3NSLA 1QASA 2JPOA 1QS7A 1ZUZA 1K9KA 4MRYA 2BCAA 1ZOTB 4CLNA 3I5HB 2OPOA 4WQ3A 2E30A 3NSOA 1LXFC 5FI2A 5AERA 1CFDA 3OGNA 2WC6A 3WHTB 1IJ6A 5B8IB 1OOGA 4MZKA 4NDDA 1M39A 1OW4A 3EK4A 1XK4A 3TDUA 5K89A 3S0AA 2FCEA 1QVIZ 2LMTA 3AAJA 1ODBA 3ZWHA 1KFXL 5D3OA 1CNPA 2BKIB 2OS8B 2WC8A 3BJHA 4KYNA 4M2PA 4JKTA 3DVMA 4BY4A 1SCVA 1DC1A 2FJYA 1DELA 1YRTB 1EG4A 2GTEA 3R1VA 1YX7A 2NXQA 1PALA 3I5GB 5EL2A 2JU0A 3CYZA 1B8RA 3R1PA 4CFRA 3K1EA 1BLQA 3S0GA 2QACA 3M0WA 4C0KA 1W7IB 1Y1AA 1SL7A 2K7OA 2P70A 1CTRA 4MLWA 1F8HA 1SK6D 1V1GA 1IKUA 1A75A 2BE6A 1CLBA 2EC6B 1C3ZA 4FQOA 2F3ZA 1NX3A 3BYAA 4YGEB 5DICA 3PN7B 1JBAA 2OTGB 2KDHA 3VROA 3PATA 1B47A 2FJUB 3BQ3A 3BUOB 3DYEA 1MUXA 1YURA 3TS5C 1F55A 2KAXA 2M1UA 2KI6C 2KSPA 3EK7A 2CXJA 2CNPA 1NPQA 1G4YR 1NWDA 1RK9A 4MZJA 5DKQA 2MJWB 3IF7A 2WCFA 2ZKMX 1TWOA 2NZ0A 4INWA 5AEQA 1SBJA 1CLLA 2Q91A 4GGNA 4PHMA 2L5YA 3B86A 2BL0B 1L2OC 2MRDA 2HETA 3GK4X 1NX2A 1FW4A 1MXLC 1J7PA 1S6CA 1XFZO 5JOLA 1BU3A 2D8NA 3D75A 4GBAA 2M0RA 1YRUB 1NYAA 1CFPA 3CR5X 3TUYB 4DRWA 2F3YA 2G9BA 2JT3A 2F2OA 1A75B 3DY9A 1SPYA 3KEVA 1KK7Y 1E8AA 2KGRA 4GGFA 1NX0A 2KLDA 1MXEA 4AOMA 5HKZA 3CR2A 1FI5A 1CB1A 3NSKA 1JUOA 3I5FB 5CSNA 3VGOA 5FYXA 5AANA 2BAPA 1N65A 2MLFC 2K8MB 2GGMA 5GQQC 1KK8B 4L9MA 2HF5A 3A4UB 2I2RE 1NCXA 1FBVA 3O78A 3LL8B 2MAZA 3HX4A 4YGBB 5AXIA 1S36A 5CPVA 5HL1A 1B8LA 2M9GA 4HSZA 4I5NB 3R1OA 4WRIA 4ORAB 1IGVA 1SW8A 3SG3A 4PHKA 2KFHA 1UHJA 3OBVA 3IQQA 3V2LA 4JPZB 3CLNA 2M7NA 3D10A 4MSPA 3IVTA 2WCBA 1C07A 1KQMB 4PALA 1OMVA 5JJGA 1TN4A 3VRQA 1BF5A 1J7QA 4N1GA 2L51A 1PULA 1XFRA 1PSBA 1GM0A 3WHUB 4AQJA 2JC2A 1A4PA 1CM4A 2EGDA 1S3PA 1RFJA 1F54A 2HPSA 3D78A 1SYMA 3OX5A 1DMOA 1ZACA 1YVLA 2Y1MA 4HRHA 2M49B 1QIWA 2LCPA 3B88A 4OR9B 3FE9A 1K94A 2F8PA 2ZFDA 2M7LA 1YUTA 2SASA 5I2LA 5KSZA 4F0ZB 2BNXA 1A29A 3CDNA 2M3WA 4QJ3B 1JC2A 4IL1A 5CSIA 4DUQA 2P71A 2I94A 1V1FA 1XFUO 2EHBA 1M46A 2JTTA 2JXLA 3BOWB 1CMFA 1S6JA 3SIBA 5CSJA 4A4BA 3CR4X 1QWVA 3Q8IA 5D69A 1L2OB 2LM5A 1HQVA 2LAPA 2WCEA 2JNFA 1QXPA 1Y6WA 2KI4C 3SG7A 1U5IA 3JTDC 1LA3A 4D1EA 3JVTB 1XK4C 1B7TY 1OOFA 3TDZA 3BUXB 3CS1A 4ICBA 4MVFA 4PT1A 3H4SE 1T14A 1ORGA 1IJ5A 1XO5A 2JULA 4JWQA 3D77A 3VRRA 4PE7A 2O5GA 2WORA 1DVIA 1Y1XA 1KFUL 1NCYA 4R1EA 3DVKA 1F4QA 1SMGA 1TTXA 2PQLA 1K95A 1LKJA 3CZ0A 1DJWA 2LUCA 4GNKB 4NQGA 2LVVA 2JT0A 3DD4A 4YGCB 1MWNA 1CDLA 3CZTX 1M63B 4OZDA 1XFWO 1TCOB 2VRGA 3S0FA 3C1VA 1WRLA 1LS8A 2JZIA 2GGZA 3CWGA 1ALVA 3RZSA 1EG3A 2CCMA 1G33A 3QRXA 1OZOA 4HRGA 4MEWA 1NSHA 2ZNDA 1YX8A 4PE1A 1DJGA 1PVAA 1QLKA 1UUSA 1MHOA 3E3RA 5KU1A 4XYNA 2M8UA 2M97A 2JOJA 5J3XA 3LLEA 3LCPC 3OB1B 1KWOC 1EXRA 3KF9A 1XFYO 4OVNF 2BCXA 2LVKA 4INXA 3O6BA 5I8NA 1DJZA 1CM1A 1Y0VH 1RJVA 2DOQA 2MHHA 5HKWA 1DT7B 4N5XA 1U5IB 2LLUA 1CKKA 2LMVA 2JXCA 3SJSA 1SL9A 2ISDA 2K61A 3ICBA 4C0JA 2HQWA 3O2PA 1BODA 1XYDA 2LLTA 3L4AA 2L5XB 1S26D 1LVCD 3CZ1A 1DJXA 1QJTA 3LK1A 1F71A 1XVJA 1GGWA 1K90D 3FWCA 1LINA 2A4JA 2K7CA 4ORCB 2LMUA 3F45A 1R6PA 1IH0A 1SNLA 4OKHA 2QPTA 2LE9B 2PMYA 1NUBA 2B1UA 2E6WA 2KFFA 4P5OE 4YBHB 1D1OA 2KOTA 4CPVA 3AKAA 1UHKA 1OMDA 1RWYA 3BUNB 1YTZC 1MR8A 1QX2A 4JQ0D 4ORBB 1SCMC 4GGFC 1OQPA 1IQ5A 1QX7A 3DXLA 1Z4HA 1QIVA 2AAOA 4HREE 1FI6A 1SL8A 2PALA 1N2DA 1XFVO 1M31A 2L0PA 3RLZA 3SS4A 5HYDA 1K9UA 3CTNA 1KK7Z 3SG5A 2ERBA 3BUMB 2I18A 1H8BA 2LP2A 1CDMA 1QX5B 2LV7A 2ZRTA 4YI8A 1BMOA 1PVBA 2BE4A 2MBXA 5AFPA 2LP3A 3GOFA 3I5IC 3PM8A 1B1GA 4DIRA 3BFBA 1WY9A 2KBMA 3VRPA 5DKNA 2KBIA 1F70A 1SR6C 3CABA 3CZ2A 2COLB 3B6XA 3AAKA 4FTGA 2KFGA 3OHMB 4PDZA 1L7ZA 3BOWA 2CTNA 3R72A 2AUCA 3I5HC 2JT8A 4N1FA 5I94A 1BJFA 2K60A 2H61C 1CDNA 1CDPA 2H8VA 1AHRA 2KAVA 2M1KB 1PK0D 1S5GY 1UWOA 2G2BA 1Z2CB 4OV2A 1IQ3A 1DTLA 1KWOB 3KHEA 2AMIA 1NIWA 1CFFA 2K0JA 4FQTA 1DEKA 2MA2A 4WQ2A 1F4OA 1QTXA 4YI9A 2OS8C 1OSAA 3MSEB 3DF0B 3BFAA 1K2HA 1K93D 1WRZA 4MN0A 3EVVA 3VRNA 1HT9A 1PRWA 1XA5A 1UHNA 5HLOA 4AQIA 2WCMA 3FE6A 3TS5B 4GUKA 2BECA 3I5GC 1OOHA 5ER5A 5D7FA 1YUUA 1OE9B 3D76A 4I5KA 3S0BA 1MQ1A 2LC5A 5BPJA 3EKJA 4E68A 3FS7A 2CT9A 3BFHA 1A03A 1J7OA 1ZMZA 3TDIA 3QMEA 2PYQA 4PHNA 2QEBA 2EC6C 2GV5A 2JNXA 2L4IA 5KTYA 3PN7C 3EVRA 3EVUA 1UP5A 2KAYA 3PFVA 1WLMA 3NHIA 1DF0B 4XJKB 1TNWA 2WNDA 4JD9A 5PALA 1J1DA 1A2XA 1SCMB 2NCOA 2ZN8A 4YRUA 3EK8A 1DJIA 1NX1A 3PJIA 2WC5A 3OB2B 3D0YB 3A8RA 1K96A 1NP8A 1CLMA 1KCYA 4ZCVA 1J55A 2BBMA 1KFXS 1AP4A 2BCBA 4DS7A 2BL0C 2KYFA 4NDBA 1DQEA 2HQ8A 4M2QA 4GAOA 2ZNEA 2SCPA 4PE0A 2K2FA 1K8UA 2BBNA 4ZCUA 1DGUA 1GQMA 1SR6B 1TNQA 1TNPA 2KQ6A 2ZRSA 5TNCA 2Y4QA 5IBWA 2P6BB 1H4BA 3TUYC 1JF0A 2NLNA 1OOJA 3IQOA 5FI6A 3ZNIA 2LHLA 3VB1A 1SSEB 3NGVA 4I5LB 4C0LA 2WCHA 2Q4UA 2JTZA 2KNEA 2PSRA 3SG4A 1B8CA 3I5FC 1GGZA 1JSAA 1QVIY 1GJYA 1UHIA 3NHTA 2F2PA 1KK8C 2F33A 5I2OA 3LK0A 1WDCC 2L4HA 2MLEC 1IG5A 1BT6A 2JWWA 2LUXA 1EH2A 1DGVA 4P2YB 4CIDA 5HKYA 3HCMA 3NSIA 1DJHA 3PSRA 4F7FA 1ZFSA 2LNKA 2K2AA 1BR1B 3UNWA 2QEOA 2R2IA 2KLEA 1KQMC 4IJ7A 1AVSA 2CBLA
chains in the Genus database with same CATH topology
2Y1NA 4UPGA 2L98A 1Y1UA 1JF2A 3SG6A 1AK8A 1CMGA 1KSOA 1TNXA 5F6TA 4NDCA 2TN4A 2KI4B 2ZN9A 3KO0A 3PLFB 3JTDB 1OZSA 3GK2A 3DF0A 4MBEA 1SRAA 4OCIA 1M45A 2IS9A 3PALA 3EKHA 4QJ5B 5G08A 1MF8B 1CFCA 1AJ5A 1WLZA 1QV1A 2KQYA 4TNCA 2I7AA 1B9AA 2NCPA 4ETOA 1TIZA 3AKBA 2JRFA 3DVEA 4PE4A 2K7DA 1AJ4A 2LVIA 1S6IA 1EL4A 4USLA 1RECA 3JVTC 4GFTA 1SY9A 4YGDB 1QLSA 1VRKA 4U8DA 3RM1A 1JFJA 3WXAA 1NCZA 1DF0A 2Y5IA 4XJKA 1S5GZ 1PSRA 3FIAA 1IWQA 4BY5A 2JQ6A 1AUIB 1Q80A 3D0YA 1KSMA 2KI6D 1IRJA 4A4CA 3K21A 2PRUA 3OX6A 1WDCB 4CFQA 1J1EA 2L2EA 4GPLB 1J7RA 5CSFA 1K9PA 1BG1A 2K7BA 5HLVA 1ALWA 1G8IA 1WRKA 4DCKA 1YUSA 2LANA 1TRFA 1C7WA 1C7VA 1OMRA 2LHIA 1X02A 1S1EA 4MRXA 2KYCA 3OP0A 4PHJA 3SIAA 1QV0A 2KGBC 1N0YA 4Q04A 2M29A 1UURA 2FOTA 2V53A 3BUWB 1BOCA 1TCFA 2LVJA 2H61A 2KHNA 2FCDA 5I2QA 3FWBA 3SG2A 2OTGC 3DVJA 2O60A 1BR4B 1QATA 1KQVA 2L50A 5ER4X 3WNXB 1RTP1 2JPTA 1RROA 1KFUS 1W7JB 1B7TZ 4M2OA 4YGAA 1YR5A 4PCWA 2BKHB 1YVHA 1JFKA 1JWDA 3GK1A 3TZ1A 1EJ3A 1R2UA 1FPWA 1DJYA 1B4CA 2LLSA 1UHHA 3O4YA 1FF1A 2PASA 3BXKA 5DKRA 3KPXA 1LA0A 1TOPA 1SKTA 3I5IB 1XFXO 3CGAA 2WOSA 2PVBA 2H2KA 3NXAA 4I5JA 4MZLA 4QJ4B 2RGIA 3NSLA 1QASA 4CLNA 1QS7A 1ZUZA 1K9KA 4MRYA 2BCAA 1ZOTB 3I5HB 2OPOA 4WQ3A 2E30A 3NSOA 1LXFC 5AERA 1CFDA 3WHTB 1IJ6A 5B8IB 4NDDA 4MZKA 1M39A 3EK4A 1XK4A 3TDUA 5K89A 2FCEA 1QVIZ 2LMTA 3AAJA 1ODBA 3ZWHA 1KFXL 1CNPA 2BKIB 2OS8B 2WC8A 4M2PA 3DVMA 4BY4A 1SCVA 1YRTB 1EG4A 1YX7A 2NXQA 1PALA 3I5GB 2JU0A 1B8RA 4CFRA 1BLQA 2QACA 3M0WA 4C0KA 1W7IB 1Y1AA 1SL7A 2K7OA 4MLWA 1CTRA 1F8HA 1SK6D 1V1GA 1IKUA 2BE6A 1A75A 1CLBA 2EC6B 4FQOA 2F3ZA 1NX3A 3BYAA 4YGEB 1JBAA 3PN7B 2OTGB 2KDHA 3VROA 3PATA 1B47A 2FJUB 3BQ3A 3BUOB 1F55A 1MUXA 1YURA 3TS5C 2KAXA 2M1UA 2KI6C 2KSPA 3EK7A 2CXJA 2CNPA 1NPQA 1G4YR 1NWDA 1RK9A 4MZJA 5DKQA 2MJWB 3IF7A 2WCFA 2ZKMX 2NZ0A 5AEQA 1SBJA 1CLLA 2Q91A 4GGNA 4PHMA 2BL0B 1L2OC 2MRDA 2HETA 3GK4X 1NX2A 1FW4A 1MXLC 1J7PA 1S6CA 1XFZO 5JOLA 1BU3A 2D8NA 4GBAA 2M0RA 1YRUB 1NYAA 1CFPA 3CR5X 3TUYB 4DRWA 2F3YA 2G9BA 2JT3A 2F2OA 1A75B 1SPYA 3KEVA 1KK7Y 1E8AA 2KGRA 4GGFA 1NX0A 1MXEA 4AOMA 5HKZA 3CR2A 1FI5A 3NSKA 1JUOA 3I5FB 5CSNA 3VGOA 5FYXA 5AANA 2MLFC 1N65A 2K8MB 2GGMA 5GQQC 1KK8B 4L9MA 2HF5A 3A4UB 2I2RE 1NCXA 1FBVA 3O78A 3LL8B 2MAZA 3HX4A 4YGBB 5AXIA 1S36A 5CPVA 1B8LA 2M9GA 4HSZA 4I5NB 4WRIA 4ORAB 1IGVA 1SW8A 3SG3A 4PHKA 2KFHA 1UHJA 3IQQA 4JPZB 3CLNA 2M7NA 3D10A 4MSPA 2WCBA 1C07A 1KQMB 4PALA 1OMVA 5JJGA 1TN4A 3VRQA 1BF5A 1J7QA 4N1GA 2L51A 1PULA 1PSBA 3WHUB 4AQJA 2JC2A 1A4PA 1CM4A 2EGDA 1S3PA 1RFJA 1F54A 2HPSA 1SYMA 3OX5A 1DMOA 1ZACA 1YVLA 2Y1MA 4HRHA 2M49B 1QIWA 2LCPA 4OR9B 1K94A 2F8PA 2ZFDA 2M7LA 1YUTA 2SASA 5I2LA 5KSZA 4F0ZB 1A29A 4QJ3B 2M3WA 1JC2A 4IL1A 5CSIA 4DUQA 2I94A 1V1FA 1XFUO 2EHBA 1M46A 2JTTA 2JXLA 3BOWB 1CMFA 1S6JA 3SIBA 5CSJA 4A4BA 3CR4X 5D69A 1L2OB 2LM5A 1HQVA 2LAPA 2WCEA 2JNFA 1QXPA 1Y6WA 2KI4C 3SG7A 1U5IA 3JTDC 1LA3A 4D1EA 3JVTB 1XK4C 1B7TY 3TDZA 3BUXB 3CS1A 4ICBA 4MVFA 1CB1A 3H4SE 1XO5A 1IJ5A 4JWQA 2JULA 3VRRA 4PE7A 2O5GA 2WORA 1DVIA 1Y1XA 1KFUL 1NCYA 4R1EA 3DVKA 1F4QA 1SMGA 1TTXA 1K95A 1LKJA 1DJWA 2LUCA 4GNKB 4NQGA 2LVVA 2JT0A 3DD4A 4YGCB 1MWNA 1CDLA 3CZTX 1M63B 1XFWO 1TCOB 2VRGA 3C1VA 1WRLA 2JZIA 2GGZA 3CWGA 1ALVA 1EG3A 2CCMA 1G33A 3QRXA 1OZOA 4HRGA 4MEWA 1NSHA 2ZNDA 1YX8A 4PE1A 1DJGA 1PVAA 1QLKA 1UUSA 1MHOA 3E3RA 5KU1A 4XYNA 2M8UA 2M97A 2JOJA 5J3XA 3LLEA 3LCPC 3OB1B 1KWOC 1EXRA 3KF9A 1XFYO 4OVNF 2BCXA 2LVKA 3O6BA 5I8NA 1DJZA 1CM1A 1Y0VH 1RJVA 2DOQA 2MHHA 5HKWA 1DT7B 4N5XA 1U5IB 2LLUA 1CKKA 2LMVA 2JXCA 3SJSA 1SL9A 2ISDA 2K61A 3ICBA 4C0JA 2HQWA 3O2PA 1BODA 1XYDA 2LLTA 2L5XB 1S26D 1LVCD 1DJXA 1QJTA 3LK1A 1F71A 1XVJA 1GGWA 1K90D 3FWCA 1LINA 2A4JA 2K7CA 4ORCB 2LMUA 3F45A 1R6PA 1IH0A 1SNLA 4OKHA 2QPTA 2LE9B 2PMYA 1NUBA 2B1UA 2E6WA 2KFFA 4P5OE 4YBHB 1D1OA 2KOTA 4CPVA 3AKAA 1UHKA 1OMDA 1RWYA 3BUNB 1YTZC 1MR8A 1QX2A 4JQ0D 4ORBB 1SCMC 4GGFC 1OQPA 1IQ5A 1QX7A 1QIVA 2AAOA 4HREE 1FI6A 1SL8A 2PALA 1N2DA 1XFVO 1M31A 2L0PA 3RLZA 5HYDA 1K9UA 3CTNA 1KK7Z 3SG5A 3BUMB 2I18A 1H8BA 2LP2A 1CDMA 1QX5B 2LV7A 2ZRTA 4YI8A 1BMOA 2BE4A 1PVBA 2MBXA 5AFPA 2LP3A 3GOFA 3I5IC 3PM8A 1B1GA 4DIRA 1WY9A 2KBMA 3VRPA 5DKNA 2KBIA 1F70A 1SR6C 2COLB 3AAKA 4FTGA 2KFGA 3OHMB 4PDZA 1L7ZA 3BOWA 2CTNA 2AUCA 3I5HC 2JT8A 4N1FA 1BJFA 2H61C 1CDNA 1CDPA 1AHRA 2KAVA 2M1KB 1PK0D 1S5GY 1UWOA 2G2BA 4OV2A 1IQ3A 1DTLA 1KWOB 3KHEA 2AMIA 1NIWA 1CFFA 2K0JA 2MA2A 4WQ2A 1F4OA 1QTXA 4YI9A 2OS8C 1OSAA 3MSEB 3DF0B 1K2HA 1K93D 1WRZA 4MN0A 3EVVA 3VRNA 1HT9A 1PRWA 1XA5A 1UHNA 5HLOA 4AQIA 3TS5B 4GUKA 2BECA 3I5GC 5ER5A 5D7FA 1YUUA 1OE9B 4I5KA 1MQ1A 2LC5A 5BPJA 3EKJA 4E68A 3FS7A 2CT9A 1A03A 1J7OA 1ZMZA 3TDIA 4PHNA 2EC6C 2GV5A 2JNXA 2L4IA 5KTYA 3PN7C 3EVRA 3EVUA 1UP5A 2KAYA 3PFVA 1WLMA 1DF0B 4XJKB 1TNWA 2WNDA 5PALA 1J1DA 1A2XA 1SCMB 2NCOA 2ZN8A 4YRUA 3EK8A 1DJIA 1NX1A 3OB2B 3D0YB 3A8RA 1K96A 1NP8A 1CLMA 1KCYA 4ZCVA 1J55A 2BBMA 1KFXS 1AP4A 2BCBA 4DS7A 2BL0C 2KYFA 4NDBA 2HQ8A 4M2QA 4GAOA 2ZNEA 2SCPA 4PE0A 2K2FA 1K8UA 2BBNA 4ZCUA 1DGUA 1GQMA 1SR6B 1TNQA 1TNPA 2KQ6A 2ZRSA 5TNCA 2Y4QA 5IBWA 2P6BB 1H4BA 3TUYC 1JF0A 2NLNA 1OOJA 3IQOA 3ZNIA 2LHLA 4I5LB 4C0LA 2Q4UA 2JTZA 2KNEA 2PSRA 3SG4A 1B8CA 3I5FC 1GGZA 1JSAA 1QVIY 1GJYA 1UHIA 2F2PA 1KK8C 2F33A 5I2OA 3LK0A 1WDCC 2L4HA 2MLEC 1IG5A 1BT6A 2JWWA 2LUXA 1EH2A 1DGVA 4P2YB 4CIDA 5HKYA 3HCMA 3NSIA 1DJHA 3PSRA 1ZFSA 2LNKA 2K2AA 1BR1B 2R2IA 1KQMC 1AVSA 2CBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  4UPG A;  2L98 A;  1Y1U A;  1JF2 A;  3SG6 A;  1AK8 A;  1CMG A;  1KSO A;  1TNX A;  5F6T A;  4NDC A;  2TN4 A;  2KI4 B;  2ZN9 A;  3KO0 A;  3PLF B;  3JTD B;  1OZS A;  3GK2 A;  3DF0 A;  4MBE A;  1SRA A;  4OCI A;  1M45 A;  2IS9 A;  3PAL A;  3EKH A;  4QJ5 B;  5G08 A;  1MF8 B;  1CFC A;  1AJ5 A;  1WLZ A;  1QV1 A;  2KQY A;  4TNC A;  2I7A A;  1B9A A;  2NCP A;  4ETO A;  1TIZ A;  3AKB A;  2JRF A;  3DVE A;  4PE4 A;  2K7D A;  1AJ4 A;  2LVI A;  1S6I A;  1EL4 A;  4USL A;  1REC A;  3JVT C;  4GFT A;  1SY9 A;  4YGD B;  1QLS A;  1VRK A;  4U8D A;  3RM1 A;  1JFJ A;  3WXA A;  1NCZ A;  1DF0 A;  2Y5I A;  4XJK A;  1S5G Z;  1PSR A;  3FIA A;  1IWQ A;  4BY5 A;  2JQ6 A;  1AUI B;  1Q80 A;  3D0Y A;  1KSM A;  2KI6 D;  1IRJ A;  4A4C A;  3K21 A;  2PRU A;  3OX6 A;  1WDC B;  4CFQ A;  1J1E A;  2L2E A;  4GPL B;  1J7R A;  5CSF A;  1K9P A;  1BG1 A;  2K7B A;  5HLV A;  1ALW A;  1G8I A;  1WRK A;  4DCK A;  1YUS A;  2LAN A;  1TRF A;  1C7W A;  1C7V A;  1OMR A;  2LHI A;  1X02 A;  1S1E A;  4MRX A;  2KYC A;  3OP0 A;  4PHJ A;  3SIA A;  1QV0 A;  2KGB C;  1N0Y A;  4Q04 A;  2M29 A;  1UUR A;  2FOT A;  2V53 A;  3BUW B;  1BOC A;  1TCF A;  2LVJ A;  2H61 A;  2KHN A;  2FCD A;  5I2Q A;  3FWB A;  3SG2 A;  2OTG C;  3DVJ A;  2O60 A;  1BR4 B;  1QAT A;  1KQV A;  2L50 A;  5ER4 X;  3WNX B;  1RTP 1;  2JPT A;  1RRO A;  1KFU S;  1W7J B;  1B7T Z;  4M2O A;  4YGA A;  1YR5 A;  4PCW A;  2BKH B;  1YVH A;  1JFK A;  1JWD A;  3GK1 A;  3TZ1 A;  1EJ3 A;  1R2U A;  1FPW A;  1DJY A;  1B4C A;  2LLS A;  1UHH A;  3O4Y A;  1FF1 A;  2PAS A;  3BXK A;  5DKR A;  3KPX A;  1LA0 A;  1TOP A;  1SKT A;  3I5I B;  1XFX O;  3CGA A;  2WOS A;  2PVB A;  2H2K A;  3NXA A;  4I5J A;  4MZL A;  4QJ4 B;  2RGI A;  3NSL A;  1QAS A;  4CLN A;  1QS7 A;  1ZUZ A;  1K9K A;  4MRY A;  2BCA A;  1ZOT B;  3I5H B;  2OPO A;  4WQ3 A;  2E30 A;  3NSO A;  1LXF C;  5AER A;  1CFD A;  3WHT B;  1IJ6 A;  5B8I B;  4NDD A;  4MZK A;  1M39 A;  3EK4 A;  1XK4 A;  3TDU A;  5K89 A;  2FCE A;  1QVI Z;  2LMT A;  3AAJ A;  1ODB A;  3ZWH A;  1KFX L;  1CNP A;  2BKI B;  2OS8 B;  2WC8 A;  4M2P A;  3DVM A;  4BY4 A;  1SCV A;  1YRT B;  1EG4 A;  1YX7 A;  2NXQ A;  1PAL A;  3I5G B;  2JU0 A;  1B8R A;  4CFR A;  1BLQ A;  2QAC A;  3M0W A;  4C0K A;  1W7I B;  1Y1A A;  1SL7 A;  2K7O A;  4MLW A;  1CTR A;  1F8H A;  1SK6 D;  1V1G A;  1IKU A;  2BE6 A;  1A75 A;  1CLB A;  2EC6 B;  4FQO A;  2F3Z A;  1NX3 A;  3BYA A;  4YGE B;  1JBA A;  3PN7 B;  2OTG B;  2KDH A;  3VRO A;  3PAT A;  1B47 A;  2FJU B;  3BQ3 A;  3BUO B;  1F55 A;  1MUX A;  1YUR A;  3TS5 C;  2KAX A;  2M1U A;  2KI6 C;  2KSP A;  3EK7 A;  2CXJ A;  2CNP A;  1NPQ A;  1G4Y R;  1NWD A;  1RK9 A;  4MZJ A;  5DKQ A;  2MJW B;  3IF7 A;  2WCF A;  2ZKM X;  2NZ0 A;  5AEQ A;  1SBJ A;  1CLL A;  2Q91 A;  4GGN A;  4PHM A;  2BL0 B;  1L2O C;  2MRD A;  2HET A;  3GK4 X;  1NX2 A;  1FW4 A;  1MXL C;  1J7P A;  1S6C A;  1XFZ O;  5JOL A;  1BU3 A;  2D8N A;  4GBA A;  2M0R A;  1YRU B;  1NYA A;  1CFP A;  3CR5 X;  3TUY B;  4DRW A;  2F3Y A;  2G9B A;  2JT3 A;  2F2O A;  1A75 B;  1SPY A;  3KEV A;  1KK7 Y;  1E8A A;  2KGR A;  4GGF A;  1NX0 A;  1MXE A;  4AOM A;  5HKZ A;  3CR2 A;  1FI5 A;  3NSK A;  1JUO A;  3I5F B;  5CSN A;  3VGO A;  5FYX A;  5AAN A;  2MLF C;  1N65 A;  2K8M B;  2GGM A;  5GQQ C;  1KK8 B;  4L9M A;  2HF5 A;  3A4U B;  2I2R E;  1NCX A;  1FBV A;  3O78 A;  3LL8 B;  2MAZ A;  3HX4 A;  4YGB B;  5AXI A;  1S36 A;  5CPV A;  1B8L A;  2M9G A;  4HSZ A;  4I5N B;  4WRI A;  4ORA B;  1IGV A;  1SW8 A;  3SG3 A;  4PHK A;  2KFH A;  1UHJ A;  3IQQ A;  4JPZ B;  3CLN A;  2M7N A;  3D10 A;  4MSP A;  2WCB A;  1C07 A;  1KQM B;  4PAL A;  1OMV A;  5JJG A;  1TN4 A;  3VRQ A;  1BF5 A;  1J7Q A;  4N1G A;  2L51 A;  1PUL A;  1PSB A;  3WHU B;  4AQJ A;  2JC2 A;  1A4P A;  1CM4 A;  2EGD A;  1S3P A;  1RFJ A;  1F54 A;  2HPS A;  1SYM A;  3OX5 A;  1DMO A;  1ZAC A;  1YVL A;  2Y1M A;  4HRH A;  2M49 B;  1QIW A;  2LCP A;  4OR9 B;  1K94 A;  2F8P A;  2ZFD A;  2M7L A;  1YUT A;  2SAS A;  5I2L A;  5KSZ A;  4F0Z B;  1A29 A;  4QJ3 B;  2M3W A;  1JC2 A;  4IL1 A;  5CSI A;  4DUQ A;  2I94 A;  1V1F A;  1XFU O;  2EHB A;  1M46 A;  2JTT A;  2JXL A;  3BOW B;  1CMF A;  1S6J A;  3SIB A;  5CSJ A;  4A4B A;  3CR4 X;  5D69 A;  1L2O B;  2LM5 A;  1HQV A;  2LAP A;  2WCE A;  2JNF A;  1QXP A;  1Y6W A;  2KI4 C;  3SG7 A;  1U5I A;  3JTD C;  1LA3 A;  4D1E A;  3JVT B;  1XK4 C;  1B7T Y;  3TDZ A;  3BUX B;  3CS1 A;  4ICB A;  4MVF A;  1CB1 A;  3H4S E;  1XO5 A;  1IJ5 A;  4JWQ A;  2JUL A;  3VRR A;  4PE7 A;  2O5G A;  2WOR A;  1DVI A;  1Y1X A;  1KFU L;  1NCY A;  4R1E A;  3DVK A;  1F4Q A;  1SMG A;  1TTX A;  1K95 A;  1LKJ A;  1DJW A;  2LUC A;  4GNK B;  4NQG A;  2LVV A;  2JT0 A;  3DD4 A;  4YGC B;  1MWN A;  1CDL A;  3CZT X;  1M63 B;  1XFW O;  1TCO B;  2VRG A;  3C1V A;  1WRL A;  2JZI A;  2GGZ A;  3CWG A;  1ALV A;  1EG3 A;  2CCM A;  1G33 A;  3QRX A;  1OZO A;  4HRG A;  4MEW A;  1NSH A;  2ZND A;  1YX8 A;  4PE1 A;  1DJG A;  1PVA A;  1QLK A;  1UUS A;  1MHO A;  3E3R A;  5KU1 A;  4XYN A;  2M8U A;  2M97 A;  2JOJ A;  5J3X A;  3LLE A;  3LCP C;  3OB1 B;  1KWO C;  1EXR A;  3KF9 A;  1XFY O;  4OVN F;  2BCX A;  2LVK A;  3O6B A;  5I8N A;  1DJZ A;  1CM1 A;  1Y0V H;  1RJV A;  2DOQ A;  2MHH A;  5HKW A;  1DT7 B;  4N5X A;  1U5I B;  2LLU A;  1CKK A;  2LMV A;  2JXC A;  3SJS A;  1SL9 A;  2ISD A;  2K61 A;  3ICB A;  4C0J A;  2HQW A;  3O2P A;  1BOD A;  1XYD A;  2LLT A;  2L5X B;  1S26 D;  1LVC D;  1DJX A;  1QJT A;  3LK1 A;  1F71 A;  1XVJ A;  1GGW A;  1K90 D;  3FWC A;  1LIN A;  2A4J A;  2K7C A;  4ORC B;  2LMU A;  3F45 A;  1R6P A;  1IH0 A;  1SNL A;  4OKH A;  2QPT A;  2LE9 B;  2PMY A;  1NUB A;  2B1U A;  2E6W A;  2KFF A;  4P5O E;  4YBH B;  1D1O A;  2KOT A;  4CPV A;  3AKA A;  1UHK A;  1OMD A;  1RWY A;  3BUN B;  1YTZ C;  1MR8 A;  1QX2 A;  4JQ0 D;  4ORB B;  1SCM C;  4GGF C;  1OQP A;  1IQ5 A;  1QX7 A;  1QIV A;  2AAO A;  4HRE E;  1FI6 A;  1SL8 A;  2PAL A;  1N2D A;  1XFV O;  1M31 A;  2L0P A;  3RLZ A;  5HYD A;  1K9U A;  3CTN A;  1KK7 Z;  3SG5 A;  3BUM B;  2I18 A;  1H8B A;  2LP2 A;  1CDM A;  1QX5 B;  2LV7 A;  2ZRT A;  4YI8 A;  1BMO A;  2BE4 A;  1PVB A;  2MBX A;  5AFP A;  2LP3 A;  3GOF A;  3I5I C;  3PM8 A;  1B1G A;  4DIR A;  1WY9 A;  2KBM A;  3VRP A;  5DKN A;  2KBI A;  1F70 A;  1SR6 C;  2COL B;  3AAK A;  4FTG A;  2KFG A;  3OHM B;  4PDZ A;  1L7Z A;  3BOW A;  2CTN A;  2AUC A;  3I5H C;  2JT8 A;  4N1F A;  1BJF A;  2H61 C;  1CDN A;  1CDP A;  1AHR A;  2KAV A;  2M1K B;  1PK0 D;  1S5G Y;  1UWO A;  2G2B A;  4OV2 A;  1IQ3 A;  1DTL A;  1KWO B;  3KHE A;  2AMI A;  1NIW A;  1CFF A;  2K0J A;  2MA2 A;  4WQ2 A;  1F4O A;  1QTX A;  4YI9 A;  2OS8 C;  1OSA A;  3MSE B;  3DF0 B;  1K2H A;  1K93 D;  1WRZ A;  4MN0 A;  3EVV A;  3VRN A;  1HT9 A;  1PRW A;  1XA5 A;  1UHN A;  5HLO A;  4AQI A;  3TS5 B;  4GUK A;  2BEC A;  3I5G C;  5ER5 A;  5D7F A;  1YUU A;  1OE9 B;  4I5K A;  1MQ1 A;  2LC5 A;  5BPJ A;  3EKJ A;  4E68 A;  3FS7 A;  2CT9 A;  1A03 A;  1J7O A;  1ZMZ A;  3TDI A;  4PHN A;  2EC6 C;  2GV5 A;  2JNX A;  2L4I A;  5KTY A;  3PN7 C;  3EVR A;  3EVU A;  1UP5 A;  2KAY A;  3PFV A;  1WLM A;  1DF0 B;  4XJK B;  1TNW A;  2WND A;  5PAL A;  1J1D A;  1A2X A;  1SCM B;  2NCO A;  2ZN8 A;  4YRU A;  3EK8 A;  1DJI A;  1NX1 A;  3OB2 B;  3D0Y B;  3A8R A;  1K96 A;  1NP8 A;  1CLM A;  1KCY A;  4ZCV A;  1J55 A;  2BBM A;  1KFX S;  1AP4 A;  2BCB A;  4DS7 A;  2BL0 C;  2KYF A;  4NDB A;  2HQ8 A;  4M2Q A;  4GAO A;  2ZNE A;  2SCP A;  4PE0 A;  2K2F A;  1K8U A;  2BBN A;  4ZCU A;  1DGU A;  1GQM A;  1SR6 B;  1TNQ A;  1TNP A;  2KQ6 A;  2ZRS A;  5TNC A;  2Y4Q A;  5IBW A;  2P6B B;  1H4B A;  3TUY C;  1JF0 A;  2NLN A;  1OOJ A;  3IQO A;  3ZNI A;  2LHL A;  4I5L B;  4C0L A;  2Q4U A;  2JTZ A;  2KNE A;  2PSR A;  3SG4 A;  1B8C A;  3I5F C;  1GGZ A;  1JSA A;  1QVI Y;  1GJY A;  1UHI A;  2F2P A;  1KK8 C;  2F33 A;  5I2O A;  3LK0 A;  1WDC C;  2L4H A;  2MLE C;  1IG5 A;  1BT6 A;  2JWW A;  2LUX A;  1EH2 A;  1DGV A;  4P2Y B;  4CID A;  5HKY A;  3HCM A;  3NSI A;  1DJH A;  3PSR A;  1ZFS A;  2LNK A;  2K2A A;  1BR1 B;  2R2I A;  1KQM C;  1AVS A;  2CBL A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  3B7A A;  3PM2 A;  4UPG A;  2L98 A;  1Y1U A;  1JF2 A;  3SG6 A;  1AK8 A;  3B87 A;  1CMG A;  1KSO A;  1TNX A;  5F6T A;  4NDC A;  2TN4 A;  2WCK A;  2KI4 B;  2ZN9 A;  3KO0 A;  3PLF B;  3JTD B;  1OZS A;  3GK2 A;  3DF0 A;  4MBE A;  1SRA A;  4OCI A;  1M45 A;  2IS9 A;  3PAL A;  3EKH A;  4QJ5 B;  5G08 A;  1MF8 B;  1CFC A;  1AJ5 A;  1WLZ A;  1QV1 A;  2L2C A;  1C3Y A;  2KQY A;  4TNC A;  2I7A A;  1B9A A;  2NCP A;  4ETO A;  1TIZ A;  3FE8 A;  3AKB A;  2JRF A;  3DVE A;  4PE4 A;  3UO9 A;  2K7D A;  1AJ4 A;  1TUZ A;  2LVI A;  3L4L A;  1S6I A;  1EL4 A;  4USL A;  1REC A;  3JVT C;  4GFT A;  1SY9 A;  4YGD B;  1QLS A;  1VRK A;  4U8D A;  3RM1 A;  1JFJ A;  3L47 A;  3WXA A;  3D73 A;  1NCZ A;  1DF0 A;  2Y5I A;  1OOI X;  4XJK A;  3DZT A;  1S5G Z;  1PSR A;  3FIA A;  3O4X A;  3SS3 A;  1IWQ A;  3S0D A;  2YGU A;  4BY5 A;  2JQ6 A;  1AUI B;  1Q80 A;  3D0Y A;  1KSM A;  2KI6 D;  1IRJ A;  2WCJ A;  4A4C A;  3K21 A;  2PRU A;  3OX6 A;  1WDC B;  4CFQ A;  3EG5 B;  1J1E A;  2L2E A;  4GPL B;  1J7R A;  5CSF A;  1K9P A;  3SS5 A;  1BG1 A;  2K7B A;  5HLV A;  1ALW A;  1G8I A;  1WRK A;  4DCK A;  1YUS A;  2LAN A;  5FI7 A;  1TRF A;  2QEV A;  1C7W A;  1C7V A;  1OMR A;  2LHI A;  1X02 A;  1S1E A;  4MRX A;  2KYC A;  3OP0 A;  4PHJ A;  3SIA A;  1QV0 A;  2KGB C;  1N0Y A;  4Q04 A;  2M29 A;  3S0E A;  3N7H A;  1UUR A;  2FOT A;  1P28 A;  2V53 A;  1TUJ A;  3BUW B;  1BOC A;  2QDI A;  1TCF A;  2LVJ A;  2H61 A;  2KHN A;  2FCD A;  5I2Q A;  2KPH A;  3FWB A;  3SG2 A;  2OTG C;  3DVJ A;  2O60 A;  1BR4 B;  1QAT A;  1KQV A;  2L50 A;  5ER4 X;  3WNX B;  1RTP 1;  2JPT A;  1RRO A;  2QEH A;  1KFU S;  1W7J B;  1B7T Z;  4M2O A;  4YGA A;  2WCL A;  1YR5 A;  3D74 A;  2BKH B;  4PCW A;  1YVH A;  1JFK A;  1JWD A;  3GK1 A;  3TZ1 A;  1EJ3 A;  1R2U A;  1FPW A;  1DJY A;  1B4C A;  2LLS A;  1UHH A;  3O4Y A;  1FF1 A;  2PAS A;  3BXK A;  5DKR A;  1IIO A;  3KPX A;  1LA0 A;  1TOP A;  1SKT A;  3I5I B;  1XFX O;  3CGA A;  2WOS A;  2PVB A;  2H2K A;  3NXA A;  1W9Z A;  4I5J A;  4MZL A;  4QJ4 B;  2RGI A;  3NSL A;  1QAS A;  2JPO A;  1QS7 A;  1ZUZ A;  1K9K A;  4MRY A;  2BCA A;  1ZOT B;  4CLN A;  3I5H B;  2OPO A;  4WQ3 A;  2E30 A;  3NSO A;  1LXF C;  5FI2 A;  5AER A;  1CFD A;  3OGN A;  2WC6 A;  3WHT B;  1IJ6 A;  5B8I B;  1OOG A;  4MZK A;  4NDD A;  1M39 A;  1OW4 A;  3EK4 A;  1XK4 A;  3TDU A;  5K89 A;  3S0A A;  2FCE A;  1QVI Z;  2LMT A;  3AAJ A;  1ODB A;  3ZWH A;  1KFX L;  5D3O A;  1CNP A;  2BKI B;  2OS8 B;  2WC8 A;  3BJH A;  4KYN A;  4M2P A;  4JKT A;  3DVM A;  4BY4 A;  1SCV A;  1DC1 A;  2FJY A;  1DEL A;  1YRT B;  1EG4 A;  2GTE A;  3R1V A;  1YX7 A;  2NXQ A;  1PAL A;  3I5G B;  5EL2 A;  2JU0 A;  3CYZ A;  1B8R A;  3R1P A;  4CFR A;  3K1E A;  1BLQ A;  3S0G A;  2QAC A;  3M0W A;  4C0K A;  1W7I B;  1Y1A A;  1SL7 A;  2K7O A;  2P70 A;  1CTR A;  4MLW A;  1F8H A;  1SK6 D;  1V1G A;  1IKU A;  1A75 A;  2BE6 A;  1CLB A;  2EC6 B;  1C3Z A;  4FQO A;  2F3Z A;  1NX3 A;  3BYA A;  4YGE B;  5DIC A;  3PN7 B;  1JBA A;  2OTG B;  2KDH A;  3VRO A;  3PAT A;  1B47 A;  2FJU B;  3BQ3 A;  3BUO B;  3DYE A;  1MUX A;  1YUR A;  3TS5 C;  1F55 A;  2KAX A;  2M1U A;  2KI6 C;  2KSP A;  3EK7 A;  2CXJ A;  2CNP A;  1NPQ A;  1G4Y R;  1NWD A;  1RK9 A;  4MZJ A;  5DKQ A;  2MJW B;  3IF7 A;  2WCF A;  2ZKM X;  1TWO A;  2NZ0 A;  4INW A;  5AEQ A;  1SBJ A;  1CLL A;  2Q91 A;  4GGN A;  4PHM A;  2L5Y A;  3B86 A;  2BL0 B;  1L2O C;  2MRD A;  2HET A;  3GK4 X;  1NX2 A;  1FW4 A;  1MXL C;  1J7P A;  1S6C A;  1XFZ O;  5JOL A;  1BU3 A;  2D8N A;  3D75 A;  4GBA A;  2M0R A;  1YRU B;  1NYA A;  1CFP A;  3CR5 X;  3TUY B;  4DRW A;  2F3Y A;  2G9B A;  2JT3 A;  2F2O A;  1A75 B;  3DY9 A;  1SPY A;  3KEV A;  1KK7 Y;  1E8A A;  2KGR A;  4GGF A;  1NX0 A;  2KLD A;  1MXE A;  4AOM A;  5HKZ A;  3CR2 A;  1FI5 A;  1CB1 A;  3NSK A;  1JUO A;  3I5F B;  5CSN A;  3VGO A;  5FYX A;  5AAN A;  2BAP A;  1N65 A;  2MLF C;  2K8M B;  2GGM A;  5GQQ C;  1KK8 B;  4L9M A;  2HF5 A;  3A4U B;  2I2R E;  1NCX A;  1FBV A;  3O78 A;  3LL8 B;  2MAZ A;  3HX4 A;  4YGB B;  5AXI A;  1S36 A;  5CPV A;  5HL1 A;  1B8L A;  2M9G A;  4HSZ A;  4I5N B;  3R1O A;  4WRI A;  4ORA B;  1IGV A;  1SW8 A;  3SG3 A;  4PHK A;  2KFH A;  1UHJ A;  3OBV A;  3IQQ A;  3V2L A;  4JPZ B;  3CLN A;  2M7N A;  3D10 A;  4MSP A;  3IVT A;  2WCB A;  1C07 A;  1KQM B;  4PAL A;  1OMV A;  5JJG A;  1TN4 A;  3VRQ A;  1BF5 A;  1J7Q A;  4N1G A;  2L51 A;  1PUL A;  1XFR A;  1PSB A;  1GM0 A;  3WHU B;  4AQJ A;  2JC2 A;  1A4P A;  1CM4 A;  2EGD A;  1S3P A;  1RFJ A;  1F54 A;  2HPS A;  3D78 A;  1SYM A;  3OX5 A;  1DMO A;  1ZAC A;  1YVL A;  2Y1M A;  4HRH A;  2M49 B;  1QIW A;  2LCP A;  3B88 A;  4OR9 B;  3FE9 A;  1K94 A;  2F8P A;  2ZFD A;  2M7L A;  1YUT A;  2SAS A;  5I2L A;  5KSZ A;  4F0Z B;  2BNX A;  1A29 A;  3CDN A;  2M3W A;  4QJ3 B;  1JC2 A;  4IL1 A;  5CSI A;  4DUQ A;  2P71 A;  2I94 A;  1V1F A;  1XFU O;  2EHB A;  1M46 A;  2JTT A;  2JXL A;  3BOW B;  1CMF A;  1S6J A;  3SIB A;  5CSJ A;  4A4B A;  3CR4 X;  1QWV A;  3Q8I A;  5D69 A;  1L2O B;  2LM5 A;  1HQV A;  2LAP A;  2WCE A;  2JNF A;  1QXP A;  1Y6W A;  2KI4 C;  3SG7 A;  1U5I A;  3JTD C;  1LA3 A;  4D1E A;  3JVT B;  1XK4 C;  1B7T Y;  1OOF A;  3TDZ A;  3BUX B;  3CS1 A;  4ICB A;  4MVF A;  4PT1 A;  3H4S E;  1T14 A;  1ORG A;  1IJ5 A;  1XO5 A;  2JUL A;  4JWQ A;  3D77 A;  3VRR A;  4PE7 A;  2O5G A;  2WOR A;  1DVI A;  1Y1X A;  1KFU L;  1NCY A;  4R1E A;  3DVK A;  1F4Q A;  1SMG A;  1TTX A;  2PQL A;  1K95 A;  1LKJ A;  3CZ0 A;  1DJW A;  2LUC A;  4GNK B;  4NQG A;  2LVV A;  2JT0 A;  3DD4 A;  4YGC B;  1MWN A;  1CDL A;  3CZT X;  1M63 B;  4OZD A;  1XFW O;  1TCO B;  2VRG A;  3S0F A;  3C1V A;  1WRL A;  1LS8 A;  2JZI A;  2GGZ A;  3CWG A;  1ALV A;  3RZS A;  1EG3 A;  2CCM A;  1G33 A;  3QRX A;  1OZO A;  4HRG A;  4MEW A;  1NSH A;  2ZND A;  1YX8 A;  4PE1 A;  1DJG A;  1PVA A;  1QLK A;  1UUS A;  1MHO A;  3E3R A;  5KU1 A;  4XYN A;  2M8U A;  2M97 A;  2JOJ A;  5J3X A;  3LLE A;  3LCP C;  3OB1 B;  1KWO C;  1EXR A;  3KF9 A;  1XFY O;  4OVN F;  2BCX A;  2LVK A;  4INX A;  3O6B A;  5I8N A;  1DJZ A;  1CM1 A;  1Y0V H;  1RJV A;  2DOQ A;  2MHH A;  5HKW A;  1DT7 B;  4N5X A;  1U5I B;  2LLU A;  1CKK A;  2LMV A;  2JXC A;  3SJS A;  1SL9 A;  2ISD A;  2K61 A;  3ICB A;  4C0J A;  2HQW A;  3O2P A;  1BOD A;  1XYD A;  2LLT A;  3L4A A;  2L5X B;  1S26 D;  1LVC D;  3CZ1 A;  1DJX A;  1QJT A;  3LK1 A;  1F71 A;  1XVJ A;  1GGW A;  1K90 D;  3FWC A;  1LIN A;  2A4J A;  2K7C A;  4ORC B;  2LMU A;  3F45 A;  1R6P A;  1IH0 A;  1SNL A;  4OKH A;  2QPT A;  2LE9 B;  2PMY A;  1NUB A;  2B1U A;  2E6W A;  2KFF A;  4P5O E;  4YBH B;  1D1O A;  2KOT A;  4CPV A;  3AKA A;  1UHK A;  1OMD A;  1RWY A;  3BUN B;  1YTZ C;  1MR8 A;  1QX2 A;  4JQ0 D;  4ORB B;  1SCM C;  4GGF C;  1OQP A;  1IQ5 A;  1QX7 A;  3DXL A;  1Z4H A;  1QIV A;  2AAO A;  4HRE E;  1FI6 A;  1SL8 A;  2PAL A;  1N2D A;  1XFV O;  1M31 A;  2L0P A;  3RLZ A;  3SS4 A;  5HYD A;  1K9U A;  3CTN A;  1KK7 Z;  3SG5 A;  2ERB A;  3BUM B;  2I18 A;  1H8B A;  2LP2 A;  1CDM A;  1QX5 B;  2LV7 A;  2ZRT A;  4YI8 A;  1BMO A;  1PVB A;  2BE4 A;  2MBX A;  5AFP A;  2LP3 A;  3GOF A;  3I5I C;  3PM8 A;  1B1G A;  4DIR A;  3BFB A;  1WY9 A;  2KBM A;  3VRP A;  5DKN A;  2KBI A;  1F70 A;  1SR6 C;  3CAB A;  3CZ2 A;  2COL B;  3B6X A;  3AAK A;  4FTG A;  2KFG A;  3OHM B;  4PDZ A;  1L7Z A;  3BOW A;  2CTN A;  3R72 A;  2AUC A;  3I5H C;  2JT8 A;  4N1F A;  5I94 A;  1BJF A;  2K60 A;  2H61 C;  1CDN A;  1CDP A;  2H8V A;  1AHR A;  2KAV A;  2M1K B;  1PK0 D;  1S5G Y;  1UWO A;  2G2B A;  1Z2C B;  4OV2 A;  1IQ3 A;  1DTL A;  1KWO B;  3KHE A;  2AMI A;  1NIW A;  1CFF A;  2K0J A;  4FQT A;  1DEK A;  2MA2 A;  4WQ2 A;  1F4O A;  1QTX A;  4YI9 A;  2OS8 C;  1OSA A;  3MSE B;  3DF0 B;  3BFA A;  1K2H A;  1K93 D;  1WRZ A;  4MN0 A;  3EVV A;  3VRN A;  1HT9 A;  1PRW A;  1XA5 A;  1UHN A;  5HLO A;  4AQI A;  2WCM A;  3FE6 A;  3TS5 B;  4GUK A;  2BEC A;  3I5G C;  1OOH A;  5ER5 A;  5D7F A;  1YUU A;  1OE9 B;  3D76 A;  4I5K A;  3S0B A;  1MQ1 A;  2LC5 A;  5BPJ A;  3EKJ A;  4E68 A;  3FS7 A;  2CT9 A;  3BFH A;  1A03 A;  1J7O A;  1ZMZ A;  3TDI A;  3QME A;  2PYQ A;  4PHN A;  2QEB A;  2EC6 C;  2GV5 A;  2JNX A;  2L4I A;  5KTY A;  3PN7 C;  3EVR A;  3EVU A;  1UP5 A;  2KAY A;  3PFV A;  1WLM A;  3NHI A;  1DF0 B;  4XJK B;  1TNW A;  2WND A;  4JD9 A;  5PAL A;  1J1D A;  1A2X A;  1SCM B;  2NCO A;  2ZN8 A;  4YRU A;  3EK8 A;  1DJI A;  1NX1 A;  3PJI A;  2WC5 A;  3OB2 B;  3D0Y B;  3A8R A;  1K96 A;  1NP8 A;  1CLM A;  1KCY A;  4ZCV A;  1J55 A;  2BBM A;  1KFX S;  1AP4 A;  2BCB A;  4DS7 A;  2BL0 C;  2KYF A;  4NDB A;  1DQE A;  2HQ8 A;  4M2Q A;  4GAO A;  2ZNE A;  2SCP A;  4PE0 A;  2K2F A;  1K8U A;  2BBN A;  4ZCU A;  1DGU A;  1GQM A;  1SR6 B;  1TNQ A;  1TNP A;  2KQ6 A;  2ZRS A;  5TNC A;  2Y4Q A;  5IBW A;  2P6B B;  1H4B A;  3TUY C;  1JF0 A;  2NLN A;  1OOJ A;  3IQO A;  5FI6 A;  3ZNI A;  2LHL A;  3VB1 A;  1SSE B;  3NGV A;  4I5L B;  4C0L A;  2WCH A;  2Q4U A;  2JTZ A;  2KNE A;  2PSR A;  3SG4 A;  1B8C A;  3I5F C;  1GGZ A;  1JSA A;  1QVI Y;  1GJY A;  1UHI A;  3NHT A;  2F2P A;  1KK8 C;  2F33 A;  5I2O A;  3LK0 A;  1WDC C;  2L4H A;  2MLE C;  1IG5 A;  1BT6 A;  2JWW A;  2LUX A;  1EH2 A;  1DGV A;  4P2Y B;  4CID A;  5HKY A;  3HCM A;  3NSI A;  1DJH A;  3PSR A;  4F7F A;  1ZFS A;  2LNK A;  2K2A A;  1BR1 B;  3UNW A;  2QEO A;  2R2I A;  2KLE A;  1KQM C;  4IJ7 A;  1AVS A;  2CBL A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  4UPG A;  2L98 A;  1Y1U A;  1JF2 A;  3SG6 A;  1AK8 A;  1CMG A;  1KSO A;  1TNX A;  5F6T A;  4NDC A;  2TN4 A;  2KI4 B;  2ZN9 A;  3KO0 A;  3PLF B;  3JTD B;  1OZS A;  3GK2 A;  3DF0 A;  4MBE A;  1SRA A;  4OCI A;  1M45 A;  2IS9 A;  3PAL A;  3EKH A;  4QJ5 B;  5G08 A;  1MF8 B;  1CFC A;  1AJ5 A;  1WLZ A;  1QV1 A;  2KQY A;  4TNC A;  2I7A A;  1B9A A;  2NCP A;  4ETO A;  1TIZ A;  3AKB A;  2JRF A;  3DVE A;  4PE4 A;  2K7D A;  1AJ4 A;  2LVI A;  1S6I A;  1EL4 A;  4USL A;  1REC A;  3JVT C;  4GFT A;  1SY9 A;  4YGD B;  1QLS A;  1VRK A;  4U8D A;  3RM1 A;  1JFJ A;  3WXA A;  1NCZ A;  1DF0 A;  2Y5I A;  4XJK A;  1S5G Z;  1PSR A;  3FIA A;  1IWQ A;  4BY5 A;  2JQ6 A;  1AUI B;  1Q80 A;  3D0Y A;  1KSM A;  2KI6 D;  1IRJ A;  4A4C A;  3K21 A;  2PRU A;  3OX6 A;  1WDC B;  4CFQ A;  1J1E A;  2L2E A;  4GPL B;  1J7R A;  5CSF A;  1K9P A;  1BG1 A;  2K7B A;  5HLV A;  1ALW A;  1G8I A;  1WRK A;  4DCK A;  1YUS A;  2LAN A;  1TRF A;  1C7W A;  1C7V A;  1OMR A;  2LHI A;  1X02 A;  1S1E A;  4MRX A;  2KYC A;  3OP0 A;  4PHJ A;  3SIA A;  1QV0 A;  2KGB C;  1N0Y A;  4Q04 A;  2M29 A;  1UUR A;  2FOT A;  2V53 A;  3BUW B;  1BOC A;  1TCF A;  2LVJ A;  2H61 A;  2KHN A;  2FCD A;  5I2Q A;  3FWB A;  3SG2 A;  2OTG C;  3DVJ A;  2O60 A;  1BR4 B;  1QAT A;  1KQV A;  2L50 A;  5ER4 X;  3WNX B;  1RTP 1;  2JPT A;  1RRO A;  1KFU S;  1W7J B;  1B7T Z;  4M2O A;  4YGA A;  1YR5 A;  4PCW A;  2BKH B;  1YVH A;  1JFK A;  1JWD A;  3GK1 A;  3TZ1 A;  1EJ3 A;  1R2U A;  1FPW A;  1DJY A;  1B4C A;  2LLS A;  1UHH A;  3O4Y A;  1FF1 A;  2PAS A;  3BXK A;  5DKR A;  3KPX A;  1LA0 A;  1TOP A;  1SKT A;  3I5I B;  1XFX O;  3CGA A;  2WOS A;  2PVB A;  2H2K A;  3NXA A;  4I5J A;  4MZL A;  4QJ4 B;  2RGI A;  3NSL A;  1QAS A;  4CLN A;  1QS7 A;  1ZUZ A;  1K9K A;  4MRY A;  2BCA A;  1ZOT B;  3I5H B;  2OPO A;  4WQ3 A;  2E30 A;  3NSO A;  1LXF C;  5AER A;  1CFD A;  3WHT B;  1IJ6 A;  5B8I B;  4NDD A;  4MZK A;  1M39 A;  3EK4 A;  1XK4 A;  3TDU A;  5K89 A;  2FCE A;  1QVI Z;  2LMT A;  3AAJ A;  1ODB A;  3ZWH A;  1KFX L;  1CNP A;  2BKI B;  2OS8 B;  2WC8 A;  4M2P A;  3DVM A;  4BY4 A;  1SCV A;  1YRT B;  1EG4 A;  1YX7 A;  2NXQ A;  1PAL A;  3I5G B;  2JU0 A;  1B8R A;  4CFR A;  1BLQ A;  2QAC A;  3M0W A;  4C0K A;  1W7I B;  1Y1A A;  1SL7 A;  2K7O A;  4MLW A;  1CTR A;  1F8H A;  1SK6 D;  1V1G A;  1IKU A;  2BE6 A;  1A75 A;  1CLB A;  2EC6 B;  4FQO A;  2F3Z A;  1NX3 A;  3BYA A;  4YGE B;  1JBA A;  3PN7 B;  2OTG B;  2KDH A;  3VRO A;  3PAT A;  1B47 A;  2FJU B;  3BQ3 A;  3BUO B;  1F55 A;  1MUX A;  1YUR A;  3TS5 C;  2KAX A;  2M1U A;  2KI6 C;  2KSP A;  3EK7 A;  2CXJ A;  2CNP A;  1NPQ A;  1G4Y R;  1NWD A;  1RK9 A;  4MZJ A;  5DKQ A;  2MJW B;  3IF7 A;  2WCF A;  2ZKM X;  2NZ0 A;  5AEQ A;  1SBJ A;  1CLL A;  2Q91 A;  4GGN A;  4PHM A;  2BL0 B;  1L2O C;  2MRD A;  2HET A;  3GK4 X;  1NX2 A;  1FW4 A;  1MXL C;  1J7P A;  1S6C A;  1XFZ O;  5JOL A;  1BU3 A;  2D8N A;  4GBA A;  2M0R A;  1YRU B;  1NYA A;  1CFP A;  3CR5 X;  3TUY B;  4DRW A;  2F3Y A;  2G9B A;  2JT3 A;  2F2O A;  1A75 B;  1SPY A;  3KEV A;  1KK7 Y;  1E8A A;  2KGR A;  4GGF A;  1NX0 A;  1MXE A;  4AOM A;  5HKZ A;  3CR2 A;  1FI5 A;  3NSK A;  1JUO A;  3I5F B;  5CSN A;  3VGO A;  5FYX A;  5AAN A;  2MLF C;  1N65 A;  2K8M B;  2GGM A;  5GQQ C;  1KK8 B;  4L9M A;  2HF5 A;  3A4U B;  2I2R E;  1NCX A;  1FBV A;  3O78 A;  3LL8 B;  2MAZ A;  3HX4 A;  4YGB B;  5AXI A;  1S36 A;  5CPV A;  1B8L A;  2M9G A;  4HSZ A;  4I5N B;  4WRI A;  4ORA B;  1IGV A;  1SW8 A;  3SG3 A;  4PHK A;  2KFH A;  1UHJ A;  3IQQ A;  4JPZ B;  3CLN A;  2M7N A;  3D10 A;  4MSP A;  2WCB A;  1C07 A;  1KQM B;  4PAL A;  1OMV A;  5JJG A;  1TN4 A;  3VRQ A;  1BF5 A;  1J7Q A;  4N1G A;  2L51 A;  1PUL A;  1PSB A;  3WHU B;  4AQJ A;  2JC2 A;  1A4P A;  1CM4 A;  2EGD A;  1S3P A;  1RFJ A;  1F54 A;  2HPS A;  1SYM A;  3OX5 A;  1DMO A;  1ZAC A;  1YVL A;  2Y1M A;  4HRH A;  2M49 B;  1QIW A;  2LCP A;  4OR9 B;  1K94 A;  2F8P A;  2ZFD A;  2M7L A;  1YUT A;  2SAS A;  5I2L A;  5KSZ A;  4F0Z B;  1A29 A;  4QJ3 B;  2M3W A;  1JC2 A;  4IL1 A;  5CSI A;  4DUQ A;  2I94 A;  1V1F A;  1XFU O;  2EHB A;  1M46 A;  2JTT A;  2JXL A;  3BOW B;  1CMF A;  1S6J A;  3SIB A;  5CSJ A;  4A4B A;  3CR4 X;  5D69 A;  1L2O B;  2LM5 A;  1HQV A;  2LAP A;  2WCE A;  2JNF A;  1QXP A;  1Y6W A;  2KI4 C;  3SG7 A;  1U5I A;  3JTD C;  1LA3 A;  4D1E A;  3JVT B;  1XK4 C;  1B7T Y;  3TDZ A;  3BUX B;  3CS1 A;  4ICB A;  4MVF A;  1CB1 A;  3H4S E;  1XO5 A;  1IJ5 A;  4JWQ A;  2JUL A;  3VRR A;  4PE7 A;  2O5G A;  2WOR A;  1DVI A;  1Y1X A;  1KFU L;  1NCY A;  4R1E A;  3DVK A;  1F4Q A;  1SMG A;  1TTX A;  1K95 A;  1LKJ A;  1DJW A;  2LUC A;  4GNK B;  4NQG A;  2LVV A;  2JT0 A;  3DD4 A;  4YGC B;  1MWN A;  1CDL A;  3CZT X;  1M63 B;  1XFW O;  1TCO B;  2VRG A;  3C1V A;  1WRL A;  2JZI A;  2GGZ A;  3CWG A;  1ALV A;  1EG3 A;  2CCM A;  1G33 A;  3QRX A;  1OZO A;  4HRG A;  4MEW A;  1NSH A;  2ZND A;  1YX8 A;  4PE1 A;  1DJG A;  1PVA A;  1QLK A;  1UUS A;  1MHO A;  3E3R A;  5KU1 A;  4XYN A;  2M8U A;  2M97 A;  2JOJ A;  5J3X A;  3LLE A;  3LCP C;  3OB1 B;  1KWO C;  1EXR A;  3KF9 A;  1XFY O;  4OVN F;  2BCX A;  2LVK A;  3O6B A;  5I8N A;  1DJZ A;  1CM1 A;  1Y0V H;  1RJV A;  2DOQ A;  2MHH A;  5HKW A;  1DT7 B;  4N5X A;  1U5I B;  2LLU A;  1CKK A;  2LMV A;  2JXC A;  3SJS A;  1SL9 A;  2ISD A;  2K61 A;  3ICB A;  4C0J A;  2HQW A;  3O2P A;  1BOD A;  1XYD A;  2LLT A;  2L5X B;  1S26 D;  1LVC D;  1DJX A;  1QJT A;  3LK1 A;  1F71 A;  1XVJ A;  1GGW A;  1K90 D;  3FWC A;  1LIN A;  2A4J A;  2K7C A;  4ORC B;  2LMU A;  3F45 A;  1R6P A;  1IH0 A;  1SNL A;  4OKH A;  2QPT A;  2LE9 B;  2PMY A;  1NUB A;  2B1U A;  2E6W A;  2KFF A;  4P5O E;  4YBH B;  1D1O A;  2KOT A;  4CPV A;  3AKA A;  1UHK A;  1OMD A;  1RWY A;  3BUN B;  1YTZ C;  1MR8 A;  1QX2 A;  4JQ0 D;  4ORB B;  1SCM C;  4GGF C;  1OQP A;  1IQ5 A;  1QX7 A;  1QIV A;  2AAO A;  4HRE E;  1FI6 A;  1SL8 A;  2PAL A;  1N2D A;  1XFV O;  1M31 A;  2L0P A;  3RLZ A;  5HYD A;  1K9U A;  3CTN A;  1KK7 Z;  3SG5 A;  3BUM B;  2I18 A;  1H8B A;  2LP2 A;  1CDM A;  1QX5 B;  2LV7 A;  2ZRT A;  4YI8 A;  1BMO A;  2BE4 A;  1PVB A;  2MBX A;  5AFP A;  2LP3 A;  3GOF A;  3I5I C;  3PM8 A;  1B1G A;  4DIR A;  1WY9 A;  2KBM A;  3VRP A;  5DKN A;  2KBI A;  1F70 A;  1SR6 C;  2COL B;  3AAK A;  4FTG A;  2KFG A;  3OHM B;  4PDZ A;  1L7Z A;  3BOW A;  2CTN A;  2AUC A;  3I5H C;  2JT8 A;  4N1F A;  1BJF A;  2H61 C;  1CDN A;  1CDP A;  1AHR A;  2KAV A;  2M1K B;  1PK0 D;  1S5G Y;  1UWO A;  2G2B A;  4OV2 A;  1IQ3 A;  1DTL A;  1KWO B;  3KHE A;  2AMI A;  1NIW A;  1CFF A;  2K0J A;  2MA2 A;  4WQ2 A;  1F4O A;  1QTX A;  4YI9 A;  2OS8 C;  1OSA A;  3MSE B;  3DF0 B;  1K2H A;  1K93 D;  1WRZ A;  4MN0 A;  3EVV A;  3VRN A;  1HT9 A;  1PRW A;  1XA5 A;  1UHN A;  5HLO A;  4AQI A;  3TS5 B;  4GUK A;  2BEC A;  3I5G C;  5ER5 A;  5D7F A;  1YUU A;  1OE9 B;  4I5K A;  1MQ1 A;  2LC5 A;  5BPJ A;  3EKJ A;  4E68 A;  3FS7 A;  2CT9 A;  1A03 A;  1J7O A;  1ZMZ A;  3TDI A;  4PHN A;  2EC6 C;  2GV5 A;  2JNX A;  2L4I A;  5KTY A;  3PN7 C;  3EVR A;  3EVU A;  1UP5 A;  2KAY A;  3PFV A;  1WLM A;  1DF0 B;  4XJK B;  1TNW A;  2WND A;  5PAL A;  1J1D A;  1A2X A;  1SCM B;  2NCO A;  2ZN8 A;  4YRU A;  3EK8 A;  1DJI A;  1NX1 A;  3OB2 B;  3D0Y B;  3A8R A;  1K96 A;  1NP8 A;  1CLM A;  1KCY A;  4ZCV A;  1J55 A;  2BBM A;  1KFX S;  1AP4 A;  2BCB A;  4DS7 A;  2BL0 C;  2KYF A;  4NDB A;  2HQ8 A;  4M2Q A;  4GAO A;  2ZNE A;  2SCP A;  4PE0 A;  2K2F A;  1K8U A;  2BBN A;  4ZCU A;  1DGU A;  1GQM A;  1SR6 B;  1TNQ A;  1TNP A;  2KQ6 A;  2ZRS A;  5TNC A;  2Y4Q A;  5IBW A;  2P6B B;  1H4B A;  3TUY C;  1JF0 A;  2NLN A;  1OOJ A;  3IQO A;  3ZNI A;  2LHL A;  4I5L B;  4C0L A;  2Q4U A;  2JTZ A;  2KNE A;  2PSR A;  3SG4 A;  1B8C A;  3I5F C;  1GGZ A;  1JSA A;  1QVI Y;  1GJY A;  1UHI A;  2F2P A;  1KK8 C;  2F33 A;  5I2O A;  3LK0 A;  1WDC C;  2L4H A;  2MLE C;  1IG5 A;  1BT6 A;  2JWW A;  2LUX A;  1EH2 A;  1DGV A;  4P2Y B;  4CID A;  5HKY A;  3HCM A;  3NSI A;  1DJH A;  3PSR A;  1ZFS A;  2LNK A;  2K2A A;  1BR1 B;  2R2I A;  1KQM C;  1AVS A;  2CBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...