1M46A

Crystal structure of mlc1p bound to iq4 of myo2p, a class v myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle protein
total genus 44
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m46A01
2I2RE 2CNPA 2O60A 2M1KB 2KFFA 1K95A 4OCIA 2LUCA 1R2UA 1XFUO 4XJKB 2Y4QA 5I2OA 2JWWA 1EG4A 2Y1NA 1XFVO 5GQQC 1FW4A 2KHNA 2LVIA 3VRRA 1QX5B 3VRPA 4YBHB 1OZOA 2BBNA 3D10A 3GK4X 2KGBC 4ORAB 2BE6A 1CFFA 1V1FA 4PDZA 1QIWA 1GJYA 2KQYA 4GNKB 1CDNA 1NCYA 4DCKA 4WQ3A 1JC2A 2LVVA 4ZCUA 4QJ5B 3GOFA 1LA3A 3WHTB 1G8IA 4HRHA 4Q04A 1N65A 1KWOB 1K96A 1UUSA 1BR1B 5IBWA 1YURA 3FS7A 1NIWA 2E30A 1NX2A 1DJHA 3CR5X 2NCOA 3JTDC 4WRIA 4D1EA 2COLB 2Q91A 1NCXA 2LP2A 3CR4X 2OS8C 1QX7A 4CFQA 2G9BA 2MAZA 2F3ZA 2L4HA 1R6PA 3TZ1A 2EHBA 2LLSA 2WCFA 3BUWB 4USLA 2L50A 2JOJA 5CSJA 5HKZA 1IWQA 2FJUB 3SG5A 4N1GA 1AK8A 1J7QA 1XK4A 1Y1XA 2BL0B 1DVIA 3VRQA 1DGVA 5DKQA 2F2OA 4YI9A 1NP8A 3DVEA 3LK0A 4N5XA 4PHNA 1XK4C 1DJZA 1OE9B 2I94A 1K8UA 1NX1A 1KK7Y 1A4PA 1ODBA 4AQJA 1NSHA 1SBJA 4MEWA 3A8RA 2KAXA 2KI4C 2ZNEA 1XFYO 1EG3A 1TNWA 4F0ZB 1ZOTB 3D0YA 2EGDA 1IJ5A 2GV5A 3ZNIA 5HLOA 1GGWA 1M39A 1AHRA 2AUCA 1A75B 1EJ3A 4WQ2A 3SG2A 5AXIA 2F3YA 2QACA 4JPZB 1A29A 1YVHA 3PLFB 3C1VA 1OOJA 2LC5A 1SK6D 2PMYA 1G4YR 2OPOA 1K2HA 1WRZA 2NXQA 1F4OA 1YX7A 1RWYA 2L2EA 2NZ0A 3BOWA 1NX0A 4A4CA 3DVKA 1M46A 1QLKA 4YI8A 2M0RA 2CCMA 4TNCA 1DF0B 2CXJA 1CKKA 2BECA 1QVIZ 1B7TY 2V53A 2I7AA 1EL4A 2PVBA 2JTZA 1MF8B 2KFHA 1A2XA 1S5GY 4MVFA 3OP0A 1IQ3A 3CS1A 2LLTA 2O5GA 3I5FB 4PE0A 1IH0A 1F55A 3DF0B 2M8UA 2AMIA 2JC2A 1MUXA 2WORA 1JBAA 1LA0A 2WNDA 4MRYA 1KFXS 1ZFSA 1IJ6A 1IGVA 3KPXA 2JT3A 3SG7A 1IKUA 2HQWA 2KBIA 3TS5B 3TDUA 1JFJA 1ALWA 3EVUA 2BCBA 2LNKA 1CLLA 3I5IC 1BODA 4MZJA 2MRDA 1Y1AA 4A4BA 3HX4A 1MXLC 1UP5A 3EK8A 3FIAA 4JQ0D 4YGCB 1QASA 1NPQA 1ALVA 2JULA 1M63B 5CPVA 1Q80A 4QJ4B 1J7OA 1JWDA 4OR9B 2L98A 1KFXL 4ICBA 1NX3A 1S26D 4HREE 1L2OC 1UHJA 3JVTB 3VRNA 3WHUB 4E68A 1CNPA 1N2DA 1Y1UA 1E8AA 3PATA 2KNEA 4CFRA 1PALA 2SASA 2K7BA 1SR6B 5AERA 1B47A 3BUMB 3NSKA 1IRJA 1MXEA 1QS7A 2M3WA 1CFDA 1DJGA 4MBEA 1JUOA 2FOTA 2HPSA 1BU3A 3SIBA 2M29A 1V1GA 1OMDA 1F4QA 2Y5IA 2BKIB 1JSAA 2FCEA 3QRXA 1OMVA 1SNLA 3WNXB 1DJYA 2NLNA 1C7VA 2E6WA 2HETA 1C07A 5FYXA 1SY9A 1MR8A 2M97A 1WDCC 1SKTA 5CSNA 2KI6D 2RGIA 3PSRA 1L7ZA 1J7RA 1KK8C 4C0LA 4DUQA 4I5LB 1K9KA 1Y6WA 1D1OA 2LV7A 4DS7A 3FWCA 2R2IA 2OS8B 1SCMC 4YGEB 3OHMB 1QTXA 2FCDA 1W7IB 2MHHA 1PULA 2TN4A 4YGBB 1SPYA 3HCMA 1PSRA 2SCPA 5HYDA 1QX2A 2VRGA 3VROA 3WXAA 4FQOA 1HQVA 2CBLA 4QJ3B 1RK9A 1XFZO 2BCXA 1CFCA 1CDMA 1GQMA 4DRWA 2LP3A 1SRAA 3OX5A 1DGUA 3NSOA 1CLBA 1TCFA 3I5HC 1TRFA 2LMUA 1UHNA 2PALA 3O6BA 5AFPA 4M2PA 2CT9A 1KFUL 1YUTA 2KI4B 1XO5A 1WRKA 3I5GC 1KWOC 1J1DA 3EVRA 1IQ5A 4YGDB 3AAJA 1CLMA 2QPTA 1LXFC 1TTXA 4UPGA 3D0YB 1NCZA 1S6JA 3DD4A 3PN7B 4GGNA 2K61A 1SL9A 2PSRA 5B8IB 1FF1A 1AJ5A 3CR2A 4YRUA 5CSIA 3SG4A 4OV2A 5DKNA 4PE7A 1YUUA 2L0PA 1B9AA 2K7CA 2WC8A 1ZMZA 2M7NA 5J3XA 1S3PA 3LCPC 1TNPA 2WCEA 3BOWB 3TUYC 4I5JA 1B1GA 1UHKA 2ZNDA 1GGZA 4FTGA 1KQMC 1QLSA 1SL7A 2LM5A 5I8NA 2K8MB 1CM1A 3PM8A 1YVLA 4PHKA 2BBMA 4ZCVA 3BUOB 4I5NB 1KCYA 1BMOA 1K9PA 2LUXA 4GUKA 1AUIB 1LKJA 5KSZA 3KO0A 3SIAA 1SYMA 1YRTB 4M2OA 3OB2B 2HQ8A 3AKAA 1TN4A 2P6BB 1CTRA 2KBMA 4P5OE 1J7PA 2WOSA 1WLMA 3TDIA 1YTZC 3ZWHA 2K7OA 4HRGA 1FPWA 3I5IB 2MLEC 2Q4UA 2L5XB 1JF2A 2D8NA 3LK1A 4MN0A 4BY4A 4GAOA 4MZKA 4BY5A 1KK7Z 4C0JA 1FBVA 1H8BA 4GGFA 3EK7A 4PE1A 1BR4B 3K21A 1QV0A 3KHEA 4GGFC 2JNXA 1LVCD 1G33A 1RROA 5BPJA 3I5FC 3NSIA 4PHJA 2B1UA 1L2OB 1C7WA 2MBXA 5DKRA 1SW8A 2JXLA 2KI6C 1PSBA 2EC6C 2M1UA 3O4YA 5AANA 2KFGA 3CTNA 4C0KA 3LLEA 1QV1A 1BT6A 1NUBA 2JRFA 1QXPA 3BQ3A 5I2QA 2LLUA 1EH2A 2K0JA 3GK2A 2Y1MA 1OSAA 2NCPA 3AKBA 1YUSA 1XYDA 2K2FA 3F45A 4CPVA 4DIRA 1BG1A 2JNFA 5F6TA 1FI6A 1M31A 2LAPA 1B7TZ 2LHLA 2F2PA 1DJWA 4N1FA 1AVSA 1N0YA 1U5IA 1Y0VH 1B8RA 5ER4X 1B4CA 1CDPA 4YGAA 1S5GZ 2MJWB 4AOMA 3O2PA 2JQ6A 3A4UB 4XYNA 3IQOA 5AEQA 3PFVA 1F70A 1TNQA 3ICBA 1KK8B 1KQVA 1W7JB 1S6IA 2H61A 5HKWA 1X02A 1SR6C 2MLFC 1JFKA 2H61C 2JPTA 3DVJA 1UHIA 1SCMB 2OTGC 2LMTA 3SG6A 3JTDB 4XJKA 1J55A 1KFUS 1MQ1A 3O78A 1DMOA 4M2QA 1CMFA 3EKHA 1H4BA 2JXCA 4NDDA 1WY9A 3OB1B 1QATA 2ZRTA 2HF5A 2CTNA 1BJFA 1BF5A 3NSLA 1KSMA 5D7FA 3I5HB 1M45A 1NYAA 1ZACA 3KF9A 1QVIY 3I5GB 2KYFA 3CGAA 2L4IA 1UHHA 1NWDA 1F8HA 2G2BA 1PVBA 1A03A 4GFTA 4MSPA 2BKHB 2ZN8A 5KU1A 2WCBA 1K90D 1CMGA 3PALA 4PE4A 1K9UA 2KDHA 4L9MA 2LE9B 3OX6A 4NQGA 4MRXA 3DVMA 1MWNA 2AAOA 2F8PA 4NDBA 3MSEB 3TUYB 3TDZA 1KSOA 1WRLA 2A4JA 4OKHA 1SMGA 1KQMB 1CDLA 4ORBB 1YX8A 2K7DA 2BL0C 2LHIA 2JT0A 1QJTA 2LVJA 4MZLA 4U8DA 3RM1A 2JZIA 3RLZA 2ZKMX 2JU0A 5K89A 2GGMA 2LCPA 3FWBA 4PHMA 3CZTX 2MA2A 3SJSA 1S6CA 1DTLA 2KYCA 3PN7C 1DT7B 2ZN9A 1A75A 1UURA 2L51A 2LANA 4ETOA 1AP4A 3EK4A 3KEVA 1J1EA 2BCAA 1XFWO 4PALA 3BUXB 2KGRA 1B8LA 4PCWA 1AJ4A 3EVVA 1RJVA 3H4SE 5HKYA 3CLNA 3EKJA 2KSPA 2DOQA 1K93D 1QIVA 1RECA 2KOTA 3BXKA 2K2AA 3SG3A 3CWGA 1DF0A 4NDCA 4MLWA 1CFPA 1OQPA 5HLVA 4GBAA 1DJIA 1S1EA 3VGOA 1PK0D 3AAKA 1MHOA 2IS9A 1RTP1 3IF7A 3E3RA 4AQIA 2M7LA 1WLZA 5TNCA 5JOLA 2PASA 3DF0A 1YR5A 5D69A 1PVAA 1XA5A 2KAYA 3BYAA 2KAVA 2KQ6A 1FI5A 1ZUZA 2LMVA 2EC6B 1TCOB 3IQQA 3LL8B 1IG5A 1LINA 1TIZA 1XVJA 1OZSA 2JTTA 2M9GA 4I5KA 5CSFA 5PALA 4CLNA 1VRKA 5JJGA 4GPLB 2JT8A 1TOPA 1RFJA 4IL1A 4R1EA 2H2KA 2ZRSA 5ER5A 3TS5C 5G08A 1TNXA 2ZFDA 3GK1A 1JF0A 1F54A 1B8CA 1CB1A 1OMRA 1SL8A 4CIDA 1HT9A 2F33A 1SCVA 1XFXO 1PRWA 1YRUB 4ORCB 2BE4A 1BOCA 1CM4A 1S36A 1U5IB 2PRUA 1EXRA 1DJXA 1K94A 2M49B 2I18A 3M0WA 2ISDA 1UWOA 1BLQA 5I2LA 1WDCB 4HSZA 4OVNF 2LVKA 4P2YB 3JVTC 5KTYA 4JWQA 2GGZA 3NXAA 2OTGB 3BUNB 1F71A
chains in the Genus database with same CATH superfamily
2I2RE 3R1PA 2CNPA 2O60A 2M1KB 2KFFA 1K95A 4OCIA 2LUCA 1R2UA 1XFUO 2L5YA 4XJKB 2Y4QA 5I2OA 2JWWA 1EG4A 2Y1NA 1XFVO 5GQQC 1FW4A 2KHNA 1IIOA 2LVIA 3SS3A 2BAPA 3VRRA 1QX5B 3VRPA 4YBHB 1OZOA 3DXLA 2BBNA 3D10A 3GK4X 2KGBC 4ORAB 2BE6A 3S0BA 1CFFA 1V1FA 4PDZA 1QIWA 1GJYA 2KQYA 4GNKB 1CDNA 1NCYA 4KYNA 3VB1A 4DCKA 4WQ3A 1JC2A 2LVVA 4ZCUA 4QJ5B 1Z4HA 3GOFA 1DEKA 1LA3A 3WHTB 1G8IA 4HRHA 4Q04A 1N65A 1KWOB 1K96A 1UUSA 1BR1B 5IBWA 1YURA 4F7FA 3FS7A 1NIWA 2E30A 1NX2A 1DJHA 3CR5X 2NCOA 3JTDC 4WRIA 2WC6A 2COLB 4D1EA 2Q91A 1NCXA 2LP2A 3CR4X 2OS8C 5FI7A 1QX7A 4CFQA 2G9BA 2MAZA 2F3ZA 2L4HA 1R6PA 3TZ1A 2L2CA 2EHBA 2LLSA 2WCFA 3BUWB 4USLA 2L50A 2JOJA 5CSJA 5HKZA 1IWQA 1LS8A 2FJUB 4N1GA 2P70A 3SG5A 1AK8A 1J7QA 1XK4A 1Y1XA 2BL0B 1DVIA 3VRQA 1DGVA 5DKQA 2F2OA 2PQLA 4YI9A 1NP8A 3DVEA 3LK0A 4N5XA 4PHNA 1XK4C 1DJZA 1OE9B 2I94A 1K8UA 1NX1A 1KK7Y 3S0EA 1A4PA 1ODBA 4AQJA 1NSHA 1SBJA 4MEWA 3A8RA 2KAXA 2KI4C 2ZNEA 1XFYO 1EG3A 1TNWA 3FE6A 4JD9A 4F0ZB 1ZOTB 3D0YA 2EGDA 3R1VA 1IJ5A 2GV5A 3ZNIA 5HLOA 1GGWA 1M39A 1AHRA 2AUCA 1A75B 1EJ3A 2WCJA 4WQ2A 3SG2A 5AXIA 2F3YA 3FE8A 2QACA 4JPZB 1A29A 1YVHA 3PLFB 3C1VA 1OOJA 2LC5A 1SK6D 2PMYA 1G4YR 2OPOA 1K2HA 1WRZA 2NXQA 1F4OA 3DY9A 1YX7A 3S0AA 1RWYA 2L2EA 2NZ0A 3BOWA 1NX0A 4A4CA 3DVKA 1M46A 1QLKA 4YI8A 2M0RA 2CCMA 3BUNB 4TNCA 1DF0B 2CXJA 3SS5A 1CKKA 2BNXA 2BECA 1QVIZ 2FJYA 1B7TY 2V53A 2I7AA 1EL4A 2PVBA 2JTZA 1MF8B 1DC1A 2KFHA 1A2XA 1S5GY 4MVFA 3OP0A 1IQ3A 3CS1A 2LLTA 2O5GA 3I5FB 4PE0A 3UO9A 1IH0A 4FQTA 1F55A 3DF0B 2M8UA 2AMIA 2JC2A 1MUXA 2WORA 1JBAA 1SSEB 1LA0A 2WNDA 4MRYA 3FE9A 1KFXS 1ZFSA 1IJ6A 1IGVA 1XFRA 3KPXA 2JT3A 3SG7A 1IKUA 2HQWA 2KBIA 3NGVA 3TS5B 4INWA 3TDUA 1JFJA 1ALWA 3EVUA 2BCBA 2QEVA 2LNKA 1CLLA 3I5IC 1BODA 3OBVA 4MZJA 2MRDA 1GM0A 1Y1AA 4A4BA 3HX4A 1MXLC 1UP5A 3EK8A 3FIAA 4JQ0D 2QEOA 1QASA 1NPQA 1ALVA 2JULA 4YGCB 3DZTA 1M63B 5CPVA 3S0FA 3BFHA 1Q80A 3SS4A 4QJ4B 1J7OA 1JWDA 4OR9B 2L98A 1KFXL 4ICBA 1NX3A 1S26D 4HREE 1L2OC 1UHJA 5EL2A 3JVTB 3VRNA 3WHUB 4E68A 1CNPA 1N2DA 1Y1UA 1E8AA 3PATA 2KNEA 4CFRA 2K60A 1PALA 2SASA 2K7BA 1SR6B 2ERBA 5AERA 1B47A 3BUMB 3NSKA 1IRJA 1MXEA 1QS7A 2KLDA 2M3WA 1CFDA 1DJGA 4MBEA 1JUOA 1Z2CB 2FOTA 2HPSA 1BU3A 3SIBA 2M29A 1V1GA 1OMDA 1F4QA 2QDIA 2Y5IA 3D73A 3S0DA 2BKIB 1JSAA 2FCEA 3QRXA 1OMVA 1SNLA 3WNXB 1DJYA 2NLNA 1C7VA 2E6WA 2HETA 1C07A 5FYXA 1SY9A 1MR8A 2M97A 1WDCC 1SKTA 5CSNA 2KI6D 2RGIA 3CZ1A 3PSRA 1L7ZA 1J7RA 1KK8C 4C0LA 4DUQA 4I5LB 1K9KA 1Y6WA 4INXA 1D1OA 2LV7A 4DS7A 3FWCA 3K1EA 2H8VA 2OS8B 1SCMC 2R2IA 3OHMB 4YGEB 1QTXA 2FCDA 1W7IB 2MHHA 1PULA 2TN4A 4YGBB 1SPYA 2YGUA 3D77A 1PSRA 3HCMA 5I94A 3CZ0A 2SCPA 5HYDA 1QX2A 2VRGA 3Q8IA 3VROA 3WXAA 3B86A 1OOHA 4FQOA 1HQVA 2CBLA 4QJ3B 1RK9A 1XFZO 2BCXA 1CFCA 1CDMA 5D3OA 1GQMA 4DRWA 2LP3A 1SRAA 3OX5A 1DGUA 3NSOA 1CLBA 1TCFA 3I5HC 1TRFA 2LMUA 1UHNA 2PALA 3O6BA 5AFPA 4M2PA 2CT9A 1KFUL 1YUTA 2KI4B 1XO5A 4IJ7A 1WRKA 3I5GC 1KWOC 1J1DA 3EVRA 1IQ5A 4YGDB 3AAJA 1CLMA 2QPTA 1LXFC 1TTXA 4UPGA 3D0YB 1NCZA 1S6JA 3DD4A 3PN7B 4GGNA 2K61A 1SL9A 2PSRA 5B8IB 1FF1A 1AJ5A 3CR2A 4YRUA 3N7HA 5CSIA 3SG4A 4OV2A 5DKNA 3EG5B 4PE7A 2PYQA 1YUUA 2L0PA 1B9AA 2K7CA 2WC8A 1ZMZA 2M7NA 5J3XA 1S3PA 3LCPC 5FI6A 1TNPA 2WCEA 3BOWB 3TUYC 4I5JA 1B1GA 1UHKA 2ZNDA 1GGZA 4FTGA 1KQMC 1DELA 1QLSA 1SL7A 2LM5A 5I8NA 2K8MB 3O4XA 1CM1A 3PM8A 5HL1A 1YVLA 4PHKA 2BBMA 4ZCVA 3BUOB 1T14A 4I5NB 1KCYA 3BFBA 3V2LA 1BMOA 1K9PA 1P28A 2LUXA 4GUKA 1AUIB 1LKJA 3CABA 5KSZA 3KO0A 3SIAA 1SYMA 1YRTB 4M2OA 3OB2B 3D75A 2HQ8A 3AKAA 3L4AA 1TN4A 2P6BB 1CTRA 2KBMA 4P5OE 1J7PA 2WOSA 1WLMA 3TDIA 2WCMA 1YTZC 3ZWHA 2K7OA 4HRGA 3L47A 1FPWA 3CZ2A 3I5IB 2MLEC 2Q4UA 2L5XB 1JF2A 2D8NA 3LK1A 4MN0A 4BY4A 4GAOA 4MZKA 4BY5A 1KK7Z 4C0JA 1FBVA 1H8BA 4GGFA 3EK7A 4PE1A 1BR4B 3K21A 1QV0A 3KHEA 4GGFC 2JNXA 1W9ZA 1TUJA 1LVCD 1G33A 3NHIA 1RROA 5BPJA 3I5FC 3NSIA 4PHJA 2QEBA 2B1UA 1L2OB 1C7WA 2MBXA 5DKRA 3L4LA 1SW8A 2JXLA 2KI6C 1PSBA 2EC6C 2M1UA 3O4YA 5AANA 2KFGA 3CTNA 4C0KA 3LLEA 1QV1A 1BT6A 1NUBA 2JRFA 5DICA 1QXPA 3BQ3A 5I2QA 2LLUA 1EH2A 3RZSA 2K0JA 3GK2A 2Y1MA 1OSAA 2NCPA 3AKBA 1YUSA 1XYDA 3IVTA 2K2FA 2KPHA 3D76A 3F45A 4CPVA 3UNWA 4DIRA 1BG1A 2JNFA 5F6TA 3PJIA 1FI6A 1M31A 2LAPA 1B7TZ 2LHLA 2F2PA 1DJWA 4N1FA 1AVSA 1N0YA 1U5IA 1Y0VH 1B8RA 5ER4X 1B4CA 1CDPA 4YGAA 1S5GZ 2MJWB 4AOMA 3O2PA 2JQ6A 3A4UB 4XYNA 3IQOA 5AEQA 3PFVA 1F70A 1TNQA 3ICBA 1KK8B 3D74A 1KQVA 1W7JB 1S6IA 3S0GA 2H61A 5HKWA 1X02A 1SR6C 2WCHA 2MLFC 1JFKA 2H61C 2JPTA 2QEHA 3DVJA 1UHIA 1SCMB 2OTGC 2LMTA 3CYZA 3SG6A 3JTDB 4XJKA 1J55A 1KFUS 1MQ1A 1TWOA 3O78A 3PM2A 1DMOA 2JPOA 4M2QA 1CMFA 3EKHA 3NHTA 1H4BA 2JXCA 4NDDA 1WY9A 2GTEA 3OB1B 1QATA 2ZRTA 2HF5A 2CTNA 1BJFA 1BF5A 3NSLA 4PT1A 1KSMA 3R1OA 5D7FA 3I5HB 1M45A 1NYAA 1ZACA 3KF9A 4JKTA 1ORGA 1QVIY 3CDNA 3I5GB 2KYFA 3CGAA 2L4IA 1UHHA 1NWDA 1F8HA 2G2BA 1PVBA 1A03A 4GFTA 4MSPA 2BKHB 2ZN8A 5KU1A 1C3YA 2WCBA 1K90D 1CMGA 3PALA 4PE4A 1K9UA 2KDHA 4L9MA 2LE9B 3OX6A 4NQGA 4MRXA 3DVMA 1MWNA 2AAOA 3OGNA 2F8PA 4NDBA 2WCKA 3MSEB 3TUYB 3TDZA 1KSOA 1WRLA 2A4JA 4OKHA 1SMGA 1KQMB 1CDLA 4ORBB 1OOGA 1YX8A 2K7DA 2BL0C 2LHIA 2JT0A 1QJTA 2LVJA 4MZLA 4U8DA 2KLEA 3RM1A 2JZIA 3B87A 3RLZA 2ZKMX 2JU0A 3QMEA 5K89A 2GGMA 2LCPA 3FWBA 4PHMA 3CZTX 2MA2A 3SJSA 1OOIX 1S6CA 1DTLA 2KYCA 3PN7C 1DT7B 2ZN9A 1A75A 1UURA 2L51A 4OZDA 2LANA 4ETOA 1AP4A 3EK4A 3KEVA 1J1EA 2BCAA 1XFWO 4PALA 1QWVA 3BUXB 2KGRA 1B8LA 4PCWA 1AJ4A 3EVVA 2P71A 1RJVA 3D78A 3H4SE 5HKYA 3CLNA 3EKJA 1OOFA 2KSPA 2DOQA 1K93D 1RECA 1QIVA 2KOTA 1DQEA 2K2AA 3BFAA 3BXKA 3SG3A 2WCLA 3CWGA 1DF0A 4NDCA 4MLWA 1CFPA 1OQPA 5HLVA 4GBAA 1DJIA 1S1EA 3VGOA 1PK0D 3BJHA 3AAKA 1MHOA 2IS9A 1RTP1 3IF7A 3E3RA 4AQIA 2M7LA 1WLZA 5TNCA 5JOLA 2PASA 3DF0A 1YR5A 5D69A 1PVAA 1XA5A 2KAYA 3BYAA 2KAVA 2KQ6A 3R72A 1ZUZA 1FI5A 2LMVA 2EC6B 1TCOB 3IQQA 3LL8B 1IG5A 1LINA 1TIZA 1XVJA 1OZSA 2JTTA 2M9GA 3B7AA 4I5KA 5FI2A 5CSFA 5PALA 4CLNA 1OW4A 1VRKA 4GPLB 2JT8A 1TOPA 3B6XA 1RFJA 4IL1A 5JJGA 4R1EA 2H2KA 2ZRSA 3DYEA 5ER5A 3TS5C 5G08A 1TNXA 2ZFDA 3GK1A 1JF0A 1F54A 1B8CA 1CB1A 1OMRA 1SL8A 4CIDA 1HT9A 2F33A 1SCVA 1XFXO 1PRWA 1YRUB 4ORCB 2BE4A 1BOCA 1CM4A 1S36A 1U5IB 2PRUA 1EXRA 1DJXA 1K94A 2M49B 2I18A 3M0WA 2ISDA 1UWOA 1BLQA 1C3ZA 5I2LA 1WDCB 2WC5A 4HSZA 4OVNF 2LVKA 4P2YB 3B88A 3JVTC 5KTYA 4JWQA 2GGZA 3NXAA 2OTGB 1TUZA 1F71A
chains in the Genus database with same CATH topology
2I2RE 2CNPA 2O60A 2M1KB 2KFFA 1K95A 4OCIA 2LUCA 1R2UA 1XFUO 4XJKB 2Y4QA 5I2OA 2JWWA 1EG4A 2Y1NA 1XFVO 5GQQC 1FW4A 2KHNA 2LVIA 3VRRA 1QX5B 3VRPA 4YBHB 1OZOA 2BBNA 3D10A 3GK4X 2KGBC 4ORAB 2BE6A 1CFFA 1V1FA 4PDZA 1QIWA 1GJYA 2KQYA 4GNKB 1CDNA 1NCYA 4DCKA 4WQ3A 1JC2A 2LVVA 4ZCUA 4QJ5B 3GOFA 1LA3A 3WHTB 1G8IA 4HRHA 4Q04A 1N65A 1KWOB 1K96A 1UUSA 1BR1B 5IBWA 1YURA 3FS7A 1NIWA 2E30A 1NX2A 1DJHA 3CR5X 2NCOA 3JTDC 4WRIA 4D1EA 2COLB 2Q91A 1NCXA 2LP2A 3CR4X 2OS8C 1QX7A 4CFQA 2G9BA 2MAZA 2F3ZA 2L4HA 1R6PA 3TZ1A 2EHBA 2LLSA 2WCFA 3BUWB 4USLA 2L50A 2JOJA 5CSJA 5HKZA 1IWQA 2FJUB 3SG5A 4N1GA 1AK8A 1J7QA 1XK4A 1Y1XA 2BL0B 1DVIA 3VRQA 1DGVA 5DKQA 2F2OA 4YI9A 1NP8A 3DVEA 3LK0A 4N5XA 4PHNA 1XK4C 1DJZA 1OE9B 2I94A 1K8UA 1NX1A 1KK7Y 1A4PA 1ODBA 4AQJA 1NSHA 1SBJA 4MEWA 3A8RA 2KAXA 2KI4C 2ZNEA 1XFYO 1EG3A 1TNWA 4F0ZB 1ZOTB 3D0YA 2EGDA 1IJ5A 2GV5A 3ZNIA 5HLOA 1GGWA 1M39A 1AHRA 2AUCA 1A75B 1EJ3A 4WQ2A 3SG2A 5AXIA 2F3YA 2QACA 4JPZB 1A29A 1YVHA 3PLFB 3C1VA 1OOJA 2LC5A 1SK6D 2PMYA 1G4YR 2OPOA 1K2HA 1WRZA 2NXQA 1F4OA 1YX7A 1RWYA 2L2EA 2NZ0A 3BOWA 1NX0A 4A4CA 3DVKA 1M46A 1QLKA 4YI8A 2M0RA 2CCMA 4TNCA 1DF0B 2CXJA 1CKKA 2BECA 1QVIZ 1B7TY 2V53A 2I7AA 1EL4A 2PVBA 2JTZA 1MF8B 2KFHA 1A2XA 1S5GY 4MVFA 3OP0A 1IQ3A 3CS1A 2LLTA 2O5GA 3I5FB 4PE0A 1IH0A 1F55A 3DF0B 2M8UA 2AMIA 2JC2A 1MUXA 2WORA 1JBAA 1LA0A 2WNDA 4MRYA 1KFXS 1ZFSA 1IJ6A 1IGVA 3KPXA 2JT3A 3SG7A 1IKUA 2HQWA 2KBIA 3TS5B 3TDUA 1JFJA 1ALWA 3EVUA 2BCBA 2LNKA 1CLLA 3I5IC 1BODA 4MZJA 2MRDA 1Y1AA 4A4BA 3HX4A 1MXLC 1UP5A 3EK8A 3FIAA 4JQ0D 4YGCB 1QASA 1NPQA 1ALVA 2JULA 1M63B 5CPVA 1Q80A 4QJ4B 1J7OA 1JWDA 4OR9B 2L98A 1KFXL 4ICBA 1NX3A 1S26D 4HREE 1L2OC 1UHJA 3JVTB 3VRNA 3WHUB 4E68A 1CNPA 1N2DA 1Y1UA 1E8AA 3PATA 2KNEA 4CFRA 1PALA 2SASA 2K7BA 1SR6B 5AERA 1B47A 3BUMB 3NSKA 1IRJA 1MXEA 1QS7A 2M3WA 1CFDA 1DJGA 4MBEA 1JUOA 2FOTA 2HPSA 1BU3A 3SIBA 2M29A 1V1GA 1OMDA 1F4QA 2Y5IA 2BKIB 1JSAA 2FCEA 3QRXA 1OMVA 1SNLA 3WNXB 1DJYA 2NLNA 1C7VA 2E6WA 2HETA 1C07A 5FYXA 1SY9A 1MR8A 2M97A 1WDCC 1SKTA 5CSNA 2KI6D 2RGIA 3PSRA 1L7ZA 1J7RA 1KK8C 4C0LA 4DUQA 4I5LB 1K9KA 1Y6WA 1D1OA 2LV7A 4DS7A 3FWCA 2R2IA 2OS8B 1SCMC 4YGEB 3OHMB 1QTXA 2FCDA 1W7IB 2MHHA 1PULA 2TN4A 4YGBB 1SPYA 3HCMA 1PSRA 2SCPA 5HYDA 1QX2A 2VRGA 3VROA 3WXAA 4FQOA 1HQVA 2CBLA 4QJ3B 1RK9A 1XFZO 2BCXA 1CFCA 1CDMA 1GQMA 4DRWA 2LP3A 1SRAA 3OX5A 1DGUA 3NSOA 1CLBA 1TCFA 3I5HC 1TRFA 2LMUA 1UHNA 2PALA 3O6BA 5AFPA 4M2PA 2CT9A 1KFUL 1YUTA 2KI4B 1XO5A 1WRKA 3I5GC 1KWOC 1J1DA 3EVRA 1IQ5A 4YGDB 3AAJA 1CLMA 2QPTA 1LXFC 1TTXA 4UPGA 3D0YB 1NCZA 1S6JA 3DD4A 3PN7B 4GGNA 2K61A 1SL9A 2PSRA 5B8IB 1FF1A 1AJ5A 3CR2A 4YRUA 5CSIA 3SG4A 4OV2A 5DKNA 4PE7A 1YUUA 2L0PA 1B9AA 2K7CA 2WC8A 1ZMZA 2M7NA 5J3XA 1S3PA 3LCPC 1TNPA 2WCEA 3BOWB 3TUYC 4I5JA 1B1GA 1UHKA 2ZNDA 1GGZA 4FTGA 1KQMC 1QLSA 1SL7A 2LM5A 5I8NA 2K8MB 1CM1A 3PM8A 1YVLA 4PHKA 2BBMA 4ZCVA 3BUOB 4I5NB 1KCYA 1BMOA 1K9PA 2LUXA 4GUKA 1AUIB 1LKJA 5KSZA 3KO0A 3SIAA 1SYMA 1YRTB 4M2OA 3OB2B 2HQ8A 3AKAA 1TN4A 2P6BB 1CTRA 2KBMA 4P5OE 1J7PA 2WOSA 1WLMA 3TDIA 1YTZC 3ZWHA 2K7OA 4HRGA 1FPWA 3I5IB 2MLEC 2Q4UA 2L5XB 1JF2A 2D8NA 3LK1A 4MN0A 4BY4A 4GAOA 4MZKA 4BY5A 1KK7Z 4C0JA 1FBVA 1H8BA 4GGFA 3EK7A 4PE1A 1BR4B 3K21A 1QV0A 3KHEA 4GGFC 2JNXA 1LVCD 1G33A 1RROA 5BPJA 3I5FC 3NSIA 4PHJA 2B1UA 1L2OB 1C7WA 2MBXA 5DKRA 1SW8A 2JXLA 2KI6C 1PSBA 2EC6C 2M1UA 3O4YA 5AANA 2KFGA 3CTNA 4C0KA 3LLEA 1QV1A 1BT6A 1NUBA 2JRFA 1QXPA 3BQ3A 5I2QA 2LLUA 1EH2A 2K0JA 3GK2A 2Y1MA 1OSAA 2NCPA 3AKBA 1YUSA 1XYDA 2K2FA 3F45A 4CPVA 4DIRA 1BG1A 2JNFA 5F6TA 1FI6A 1M31A 2LAPA 1B7TZ 2LHLA 2F2PA 1DJWA 4N1FA 1AVSA 1N0YA 1U5IA 1Y0VH 1B8RA 5ER4X 1B4CA 1CDPA 4YGAA 1S5GZ 2MJWB 4AOMA 3O2PA 2JQ6A 3A4UB 4XYNA 3IQOA 5AEQA 3PFVA 1F70A 1TNQA 3ICBA 1KK8B 1KQVA 1W7JB 1S6IA 2H61A 5HKWA 1X02A 1SR6C 2MLFC 1JFKA 2H61C 2JPTA 3DVJA 1UHIA 1SCMB 2OTGC 2LMTA 3SG6A 3JTDB 4XJKA 1J55A 1KFUS 1MQ1A 3O78A 1DMOA 4M2QA 1CMFA 3EKHA 1H4BA 2JXCA 4NDDA 1WY9A 3OB1B 1QATA 2ZRTA 2HF5A 2CTNA 1BJFA 1BF5A 3NSLA 1KSMA 5D7FA 3I5HB 1M45A 1NYAA 1ZACA 3KF9A 1QVIY 3I5GB 2KYFA 3CGAA 2L4IA 1UHHA 1NWDA 1F8HA 2G2BA 1PVBA 1A03A 4GFTA 4MSPA 2BKHB 2ZN8A 5KU1A 2WCBA 1K90D 1CMGA 3PALA 4PE4A 1K9UA 2KDHA 4L9MA 2LE9B 3OX6A 4NQGA 4MRXA 3DVMA 1MWNA 2AAOA 2F8PA 4NDBA 3MSEB 3TUYB 3TDZA 1KSOA 1WRLA 2A4JA 4OKHA 1SMGA 1KQMB 1CDLA 4ORBB 1YX8A 2K7DA 2BL0C 2LHIA 2JT0A 1QJTA 2LVJA 4MZLA 4U8DA 3RM1A 2JZIA 3RLZA 2ZKMX 2JU0A 5K89A 2GGMA 2LCPA 3FWBA 4PHMA 3CZTX 2MA2A 3SJSA 1S6CA 1DTLA 2KYCA 3PN7C 1DT7B 2ZN9A 1A75A 1UURA 2L51A 2LANA 4ETOA 1AP4A 3EK4A 3KEVA 1J1EA 2BCAA 1XFWO 4PALA 3BUXB 2KGRA 1B8LA 4PCWA 1AJ4A 3EVVA 1RJVA 3H4SE 5HKYA 3CLNA 3EKJA 2KSPA 2DOQA 1K93D 1QIVA 1RECA 2KOTA 3BXKA 2K2AA 3SG3A 3CWGA 1DF0A 4NDCA 4MLWA 1CFPA 1OQPA 5HLVA 4GBAA 1DJIA 1S1EA 3VGOA 1PK0D 3AAKA 1MHOA 2IS9A 1RTP1 3IF7A 3E3RA 4AQIA 2M7LA 1WLZA 5TNCA 5JOLA 2PASA 3DF0A 1YR5A 5D69A 1PVAA 1XA5A 2KAYA 3BYAA 2KAVA 2KQ6A 1FI5A 1ZUZA 2LMVA 2EC6B 1TCOB 3IQQA 3LL8B 1IG5A 1LINA 1TIZA 1XVJA 1OZSA 2JTTA 2M9GA 4I5KA 5CSFA 5PALA 4CLNA 1VRKA 5JJGA 4GPLB 2JT8A 1TOPA 1RFJA 4IL1A 4R1EA 2H2KA 2ZRSA 5ER5A 3TS5C 5G08A 1TNXA 2ZFDA 3GK1A 1JF0A 1F54A 1B8CA 1CB1A 1OMRA 1SL8A 4CIDA 1HT9A 2F33A 1SCVA 1XFXO 1PRWA 1YRUB 4ORCB 2BE4A 1BOCA 1CM4A 1S36A 1U5IB 2PRUA 1EXRA 1DJXA 1K94A 2M49B 2I18A 3M0WA 2ISDA 1UWOA 1BLQA 5I2LA 1WDCB 4HSZA 4OVNF 2LVKA 4P2YB 3JVTC 5KTYA 4JWQA 2GGZA 3NXAA 2OTGB 3BUNB 1F71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2R E;  2CNP A;  2O60 A;  2M1K B;  2KFF A;  1K95 A;  4OCI A;  2LUC A;  1R2U A;  1XFU O;  4XJK B;  2Y4Q A;  5I2O A;  2JWW A;  1EG4 A;  2Y1N A;  1XFV O;  5GQQ C;  1FW4 A;  2KHN A;  2LVI A;  3VRR A;  1QX5 B;  3VRP A;  4YBH B;  1OZO A;  2BBN A;  3D10 A;  3GK4 X;  2KGB C;  4ORA B;  2BE6 A;  1CFF A;  1V1F A;  4PDZ A;  1QIW A;  1GJY A;  2KQY A;  4GNK B;  1CDN A;  1NCY A;  4DCK A;  4WQ3 A;  1JC2 A;  2LVV A;  4ZCU A;  4QJ5 B;  3GOF A;  1LA3 A;  3WHT B;  1G8I A;  4HRH A;  4Q04 A;  1N65 A;  1KWO B;  1K96 A;  1UUS A;  1BR1 B;  5IBW A;  1YUR A;  3FS7 A;  1NIW A;  2E30 A;  1NX2 A;  1DJH A;  3CR5 X;  2NCO A;  3JTD C;  4WRI A;  4D1E A;  2COL B;  2Q91 A;  1NCX A;  2LP2 A;  3CR4 X;  2OS8 C;  1QX7 A;  4CFQ A;  2G9B A;  2MAZ A;  2F3Z A;  2L4H A;  1R6P A;  3TZ1 A;  2EHB A;  2LLS A;  2WCF A;  3BUW B;  4USL A;  2L50 A;  2JOJ A;  5CSJ A;  5HKZ A;  1IWQ A;  2FJU B;  3SG5 A;  4N1G A;  1AK8 A;  1J7Q A;  1XK4 A;  1Y1X A;  2BL0 B;  1DVI A;  3VRQ A;  1DGV A;  5DKQ A;  2F2O A;  4YI9 A;  1NP8 A;  3DVE A;  3LK0 A;  4N5X A;  4PHN A;  1XK4 C;  1DJZ A;  1OE9 B;  2I94 A;  1K8U A;  1NX1 A;  1KK7 Y;  1A4P A;  1ODB A;  4AQJ A;  1NSH A;  1SBJ A;  4MEW A;  3A8R A;  2KAX A;  2KI4 C;  2ZNE A;  1XFY O;  1EG3 A;  1TNW A;  4F0Z B;  1ZOT B;  3D0Y A;  2EGD A;  1IJ5 A;  2GV5 A;  3ZNI A;  5HLO A;  1GGW A;  1M39 A;  1AHR A;  2AUC A;  1A75 B;  1EJ3 A;  4WQ2 A;  3SG2 A;  5AXI A;  2F3Y A;  2QAC A;  4JPZ B;  1A29 A;  1YVH A;  3PLF B;  3C1V A;  1OOJ A;  2LC5 A;  1SK6 D;  2PMY A;  1G4Y R;  2OPO A;  1K2H A;  1WRZ A;  2NXQ A;  1F4O A;  1YX7 A;  1RWY A;  2L2E A;  2NZ0 A;  3BOW A;  1NX0 A;  4A4C A;  3DVK A;  1M46 A;  1QLK A;  4YI8 A;  2M0R A;  2CCM A;  4TNC A;  1DF0 B;  2CXJ A;  1CKK A;  2BEC A;  1QVI Z;  1B7T Y;  2V53 A;  2I7A A;  1EL4 A;  2PVB A;  2JTZ A;  1MF8 B;  2KFH A;  1A2X A;  1S5G Y;  4MVF A;  3OP0 A;  1IQ3 A;  3CS1 A;  2LLT A;  2O5G A;  3I5F B;  4PE0 A;  1IH0 A;  1F55 A;  3DF0 B;  2M8U A;  2AMI A;  2JC2 A;  1MUX A;  2WOR A;  1JBA A;  1LA0 A;  2WND A;  4MRY A;  1KFX S;  1ZFS A;  1IJ6 A;  1IGV A;  3KPX A;  2JT3 A;  3SG7 A;  1IKU A;  2HQW A;  2KBI A;  3TS5 B;  3TDU A;  1JFJ A;  1ALW A;  3EVU A;  2BCB A;  2LNK A;  1CLL A;  3I5I C;  1BOD A;  4MZJ A;  2MRD A;  1Y1A A;  4A4B A;  3HX4 A;  1MXL C;  1UP5 A;  3EK8 A;  3FIA A;  4JQ0 D;  4YGC B;  1QAS A;  1NPQ A;  1ALV A;  2JUL A;  1M63 B;  5CPV A;  1Q80 A;  4QJ4 B;  1J7O A;  1JWD A;  4OR9 B;  2L98 A;  1KFX L;  4ICB A;  1NX3 A;  1S26 D;  4HRE E;  1L2O C;  1UHJ A;  3JVT B;  3VRN A;  3WHU B;  4E68 A;  1CNP A;  1N2D A;  1Y1U A;  1E8A A;  3PAT A;  2KNE A;  4CFR A;  1PAL A;  2SAS A;  2K7B A;  1SR6 B;  5AER A;  1B47 A;  3BUM B;  3NSK A;  1IRJ A;  1MXE A;  1QS7 A;  2M3W A;  1CFD A;  1DJG A;  4MBE A;  1JUO A;  2FOT A;  2HPS A;  1BU3 A;  3SIB A;  2M29 A;  1V1G A;  1OMD A;  1F4Q A;  2Y5I A;  2BKI B;  1JSA A;  2FCE A;  3QRX A;  1OMV A;  1SNL A;  3WNX B;  1DJY A;  2NLN A;  1C7V A;  2E6W A;  2HET A;  1C07 A;  5FYX A;  1SY9 A;  1MR8 A;  2M97 A;  1WDC C;  1SKT A;  5CSN A;  2KI6 D;  2RGI A;  3PSR A;  1L7Z A;  1J7R A;  1KK8 C;  4C0L A;  4DUQ A;  4I5L B;  1K9K A;  1Y6W A;  1D1O A;  2LV7 A;  4DS7 A;  3FWC A;  2R2I A;  2OS8 B;  1SCM C;  4YGE B;  3OHM B;  1QTX A;  2FCD A;  1W7I B;  2MHH A;  1PUL A;  2TN4 A;  4YGB B;  1SPY A;  3HCM A;  1PSR A;  2SCP A;  5HYD A;  1QX2 A;  2VRG A;  3VRO A;  3WXA A;  4FQO A;  1HQV A;  2CBL A;  4QJ3 B;  1RK9 A;  1XFZ O;  2BCX A;  1CFC A;  1CDM A;  1GQM A;  4DRW A;  2LP3 A;  1SRA A;  3OX5 A;  1DGU A;  3NSO A;  1CLB A;  1TCF A;  3I5H C;  1TRF A;  2LMU A;  1UHN A;  2PAL A;  3O6B A;  5AFP A;  4M2P A;  2CT9 A;  1KFU L;  1YUT A;  2KI4 B;  1XO5 A;  1WRK A;  3I5G C;  1KWO C;  1J1D A;  3EVR A;  1IQ5 A;  4YGD B;  3AAJ A;  1CLM A;  2QPT A;  1LXF C;  1TTX A;  4UPG A;  3D0Y B;  1NCZ A;  1S6J A;  3DD4 A;  3PN7 B;  4GGN A;  2K61 A;  1SL9 A;  2PSR A;  5B8I B;  1FF1 A;  1AJ5 A;  3CR2 A;  4YRU A;  5CSI A;  3SG4 A;  4OV2 A;  5DKN A;  4PE7 A;  1YUU A;  2L0P A;  1B9A A;  2K7C A;  2WC8 A;  1ZMZ A;  2M7N A;  5J3X A;  1S3P A;  3LCP C;  1TNP A;  2WCE A;  3BOW B;  3TUY C;  4I5J A;  1B1G A;  1UHK A;  2ZND A;  1GGZ A;  4FTG A;  1KQM C;  1QLS A;  1SL7 A;  2LM5 A;  5I8N A;  2K8M B;  1CM1 A;  3PM8 A;  1YVL A;  4PHK A;  2BBM A;  4ZCV A;  3BUO B;  4I5N B;  1KCY A;  1BMO A;  1K9P A;  2LUX A;  4GUK A;  1AUI B;  1LKJ A;  5KSZ A;  3KO0 A;  3SIA A;  1SYM A;  1YRT B;  4M2O A;  3OB2 B;  2HQ8 A;  3AKA A;  1TN4 A;  2P6B B;  1CTR A;  2KBM A;  4P5O E;  1J7P A;  2WOS A;  1WLM A;  3TDI A;  1YTZ C;  3ZWH A;  2K7O A;  4HRG A;  1FPW A;  3I5I B;  2MLE C;  2Q4U A;  2L5X B;  1JF2 A;  2D8N A;  3LK1 A;  4MN0 A;  4BY4 A;  4GAO A;  4MZK A;  4BY5 A;  1KK7 Z;  4C0J A;  1FBV A;  1H8B A;  4GGF A;  3EK7 A;  4PE1 A;  1BR4 B;  3K21 A;  1QV0 A;  3KHE A;  4GGF C;  2JNX A;  1LVC D;  1G33 A;  1RRO A;  5BPJ A;  3I5F C;  3NSI A;  4PHJ A;  2B1U A;  1L2O B;  1C7W A;  2MBX A;  5DKR A;  1SW8 A;  2JXL A;  2KI6 C;  1PSB A;  2EC6 C;  2M1U A;  3O4Y A;  5AAN A;  2KFG A;  3CTN A;  4C0K A;  3LLE A;  1QV1 A;  1BT6 A;  1NUB A;  2JRF A;  1QXP A;  3BQ3 A;  5I2Q A;  2LLU A;  1EH2 A;  2K0J A;  3GK2 A;  2Y1M A;  1OSA A;  2NCP A;  3AKB A;  1YUS A;  1XYD A;  2K2F A;  3F45 A;  4CPV A;  4DIR A;  1BG1 A;  2JNF A;  5F6T A;  1FI6 A;  1M31 A;  2LAP A;  1B7T Z;  2LHL A;  2F2P A;  1DJW A;  4N1F A;  1AVS A;  1N0Y A;  1U5I A;  1Y0V H;  1B8R A;  5ER4 X;  1B4C A;  1CDP A;  4YGA A;  1S5G Z;  2MJW B;  4AOM A;  3O2P A;  2JQ6 A;  3A4U B;  4XYN A;  3IQO A;  5AEQ A;  3PFV A;  1F70 A;  1TNQ A;  3ICB A;  1KK8 B;  1KQV A;  1W7J B;  1S6I A;  2H61 A;  5HKW A;  1X02 A;  1SR6 C;  2MLF C;  1JFK A;  2H61 C;  2JPT A;  3DVJ A;  1UHI A;  1SCM B;  2OTG C;  2LMT A;  3SG6 A;  3JTD B;  4XJK A;  1J55 A;  1KFU S;  1MQ1 A;  3O78 A;  1DMO A;  4M2Q A;  1CMF A;  3EKH A;  1H4B A;  2JXC A;  4NDD A;  1WY9 A;  3OB1 B;  1QAT A;  2ZRT A;  2HF5 A;  2CTN A;  1BJF A;  1BF5 A;  3NSL A;  1KSM A;  5D7F A;  3I5H B;  1M45 A;  1NYA A;  1ZAC A;  3KF9 A;  1QVI Y;  3I5G B;  2KYF A;  3CGA A;  2L4I A;  1UHH A;  1NWD A;  1F8H A;  2G2B A;  1PVB A;  1A03 A;  4GFT A;  4MSP A;  2BKH B;  2ZN8 A;  5KU1 A;  2WCB A;  1K90 D;  1CMG A;  3PAL A;  4PE4 A;  1K9U A;  2KDH A;  4L9M A;  2LE9 B;  3OX6 A;  4NQG A;  4MRX A;  3DVM A;  1MWN A;  2AAO A;  2F8P A;  4NDB A;  3MSE B;  3TUY B;  3TDZ A;  1KSO A;  1WRL A;  2A4J A;  4OKH A;  1SMG A;  1KQM B;  1CDL A;  4ORB B;  1YX8 A;  2K7D A;  2BL0 C;  2LHI A;  2JT0 A;  1QJT A;  2LVJ A;  4MZL A;  4U8D A;  3RM1 A;  2JZI A;  3RLZ A;  2ZKM X;  2JU0 A;  5K89 A;  2GGM A;  2LCP A;  3FWB A;  4PHM A;  3CZT X;  2MA2 A;  3SJS A;  1S6C A;  1DTL A;  2KYC A;  3PN7 C;  1DT7 B;  2ZN9 A;  1A75 A;  1UUR A;  2L51 A;  2LAN A;  4ETO A;  1AP4 A;  3EK4 A;  3KEV A;  1J1E A;  2BCA A;  1XFW O;  4PAL A;  3BUX B;  2KGR A;  1B8L A;  4PCW A;  1AJ4 A;  3EVV A;  1RJV A;  3H4S E;  5HKY A;  3CLN A;  3EKJ A;  2KSP A;  2DOQ A;  1K93 D;  1QIV A;  1REC A;  2KOT A;  3BXK A;  2K2A A;  3SG3 A;  3CWG A;  1DF0 A;  4NDC A;  4MLW A;  1CFP A;  1OQP A;  5HLV A;  4GBA A;  1DJI A;  1S1E A;  3VGO A;  1PK0 D;  3AAK A;  1MHO A;  2IS9 A;  1RTP 1;  3IF7 A;  3E3R A;  4AQI A;  2M7L A;  1WLZ A;  5TNC A;  5JOL A;  2PAS A;  3DF0 A;  1YR5 A;  5D69 A;  1PVA A;  1XA5 A;  2KAY A;  3BYA A;  2KAV A;  2KQ6 A;  1FI5 A;  1ZUZ A;  2LMV A;  2EC6 B;  1TCO B;  3IQQ A;  3LL8 B;  1IG5 A;  1LIN A;  1TIZ A;  1XVJ A;  1OZS A;  2JTT A;  2M9G A;  4I5K A;  5CSF A;  5PAL A;  4CLN A;  1VRK A;  5JJG A;  4GPL B;  2JT8 A;  1TOP A;  1RFJ A;  4IL1 A;  4R1E A;  2H2K A;  2ZRS A;  5ER5 A;  3TS5 C;  5G08 A;  1TNX A;  2ZFD A;  3GK1 A;  1JF0 A;  1F54 A;  1B8C A;  1CB1 A;  1OMR A;  1SL8 A;  4CID A;  1HT9 A;  2F33 A;  1SCV A;  1XFX O;  1PRW A;  1YRU B;  4ORC B;  2BE4 A;  1BOC A;  1CM4 A;  1S36 A;  1U5I B;  2PRU A;  1EXR A;  1DJX A;  1K94 A;  2M49 B;  2I18 A;  3M0W A;  2ISD A;  1UWO A;  1BLQ A;  5I2L A;  1WDC B;  4HSZ A;  4OVN F;  2LVK A;  4P2Y B;  3JVT C;  5KTY A;  4JWQ A;  2GGZ A;  3NXA A;  2OTG B;  3BUN B;  1F71 A; 
#chains in the Genus database with same CATH topology
 2I2R E;  3R1P A;  2CNP A;  2O60 A;  2M1K B;  2KFF A;  1K95 A;  4OCI A;  2LUC A;  1R2U A;  1XFU O;  2L5Y A;  4XJK B;  2Y4Q A;  5I2O A;  2JWW A;  1EG4 A;  2Y1N A;  1XFV O;  5GQQ C;  1FW4 A;  2KHN A;  1IIO A;  2LVI A;  3SS3 A;  2BAP A;  3VRR A;  1QX5 B;  3VRP A;  4YBH B;  1OZO A;  3DXL A;  2BBN A;  3D10 A;  3GK4 X;  2KGB C;  4ORA B;  2BE6 A;  3S0B A;  1CFF A;  1V1F A;  4PDZ A;  1QIW A;  1GJY A;  2KQY A;  4GNK B;  1CDN A;  1NCY A;  4KYN A;  3VB1 A;  4DCK A;  4WQ3 A;  1JC2 A;  2LVV A;  4ZCU A;  4QJ5 B;  1Z4H A;  3GOF A;  1DEK A;  1LA3 A;  3WHT B;  1G8I A;  4HRH A;  4Q04 A;  1N65 A;  1KWO B;  1K96 A;  1UUS A;  1BR1 B;  5IBW A;  1YUR A;  4F7F A;  3FS7 A;  1NIW A;  2E30 A;  1NX2 A;  1DJH A;  3CR5 X;  2NCO A;  3JTD C;  4WRI A;  2WC6 A;  2COL B;  4D1E A;  2Q91 A;  1NCX A;  2LP2 A;  3CR4 X;  2OS8 C;  5FI7 A;  1QX7 A;  4CFQ A;  2G9B A;  2MAZ A;  2F3Z A;  2L4H A;  1R6P A;  3TZ1 A;  2L2C A;  2EHB A;  2LLS A;  2WCF A;  3BUW B;  4USL A;  2L50 A;  2JOJ A;  5CSJ A;  5HKZ A;  1IWQ A;  1LS8 A;  2FJU B;  4N1G A;  2P70 A;  3SG5 A;  1AK8 A;  1J7Q A;  1XK4 A;  1Y1X A;  2BL0 B;  1DVI A;  3VRQ A;  1DGV A;  5DKQ A;  2F2O A;  2PQL A;  4YI9 A;  1NP8 A;  3DVE A;  3LK0 A;  4N5X A;  4PHN A;  1XK4 C;  1DJZ A;  1OE9 B;  2I94 A;  1K8U A;  1NX1 A;  1KK7 Y;  3S0E A;  1A4P A;  1ODB A;  4AQJ A;  1NSH A;  1SBJ A;  4MEW A;  3A8R A;  2KAX A;  2KI4 C;  2ZNE A;  1XFY O;  1EG3 A;  1TNW A;  3FE6 A;  4JD9 A;  4F0Z B;  1ZOT B;  3D0Y A;  2EGD A;  3R1V A;  1IJ5 A;  2GV5 A;  3ZNI A;  5HLO A;  1GGW A;  1M39 A;  1AHR A;  2AUC A;  1A75 B;  1EJ3 A;  2WCJ A;  4WQ2 A;  3SG2 A;  5AXI A;  2F3Y A;  3FE8 A;  2QAC A;  4JPZ B;  1A29 A;  1YVH A;  3PLF B;  3C1V A;  1OOJ A;  2LC5 A;  1SK6 D;  2PMY A;  1G4Y R;  2OPO A;  1K2H A;  1WRZ A;  2NXQ A;  1F4O A;  3DY9 A;  1YX7 A;  3S0A A;  1RWY A;  2L2E A;  2NZ0 A;  3BOW A;  1NX0 A;  4A4C A;  3DVK A;  1M46 A;  1QLK A;  4YI8 A;  2M0R A;  2CCM A;  3BUN B;  4TNC A;  1DF0 B;  2CXJ A;  3SS5 A;  1CKK A;  2BNX A;  2BEC A;  1QVI Z;  2FJY A;  1B7T Y;  2V53 A;  2I7A A;  1EL4 A;  2PVB A;  2JTZ A;  1MF8 B;  1DC1 A;  2KFH A;  1A2X A;  1S5G Y;  4MVF A;  3OP0 A;  1IQ3 A;  3CS1 A;  2LLT A;  2O5G A;  3I5F B;  4PE0 A;  3UO9 A;  1IH0 A;  4FQT A;  1F55 A;  3DF0 B;  2M8U A;  2AMI A;  2JC2 A;  1MUX A;  2WOR A;  1JBA A;  1SSE B;  1LA0 A;  2WND A;  4MRY A;  3FE9 A;  1KFX S;  1ZFS A;  1IJ6 A;  1IGV A;  1XFR A;  3KPX A;  2JT3 A;  3SG7 A;  1IKU A;  2HQW A;  2KBI A;  3NGV A;  3TS5 B;  4INW A;  3TDU A;  1JFJ A;  1ALW A;  3EVU A;  2BCB A;  2QEV A;  2LNK A;  1CLL A;  3I5I C;  1BOD A;  3OBV A;  4MZJ A;  2MRD A;  1GM0 A;  1Y1A A;  4A4B A;  3HX4 A;  1MXL C;  1UP5 A;  3EK8 A;  3FIA A;  4JQ0 D;  2QEO A;  1QAS A;  1NPQ A;  1ALV A;  2JUL A;  4YGC B;  3DZT A;  1M63 B;  5CPV A;  3S0F A;  3BFH A;  1Q80 A;  3SS4 A;  4QJ4 B;  1J7O A;  1JWD A;  4OR9 B;  2L98 A;  1KFX L;  4ICB A;  1NX3 A;  1S26 D;  4HRE E;  1L2O C;  1UHJ A;  5EL2 A;  3JVT B;  3VRN A;  3WHU B;  4E68 A;  1CNP A;  1N2D A;  1Y1U A;  1E8A A;  3PAT A;  2KNE A;  4CFR A;  2K60 A;  1PAL A;  2SAS A;  2K7B A;  1SR6 B;  2ERB A;  5AER A;  1B47 A;  3BUM B;  3NSK A;  1IRJ A;  1MXE A;  1QS7 A;  2KLD A;  2M3W A;  1CFD A;  1DJG A;  4MBE A;  1JUO A;  1Z2C B;  2FOT A;  2HPS A;  1BU3 A;  3SIB A;  2M29 A;  1V1G A;  1OMD A;  1F4Q A;  2QDI A;  2Y5I A;  3D73 A;  3S0D A;  2BKI B;  1JSA A;  2FCE A;  3QRX A;  1OMV A;  1SNL A;  3WNX B;  1DJY A;  2NLN A;  1C7V A;  2E6W A;  2HET A;  1C07 A;  5FYX A;  1SY9 A;  1MR8 A;  2M97 A;  1WDC C;  1SKT A;  5CSN A;  2KI6 D;  2RGI A;  3CZ1 A;  3PSR A;  1L7Z A;  1J7R A;  1KK8 C;  4C0L A;  4DUQ A;  4I5L B;  1K9K A;  1Y6W A;  4INX A;  1D1O A;  2LV7 A;  4DS7 A;  3FWC A;  3K1E A;  2H8V A;  2OS8 B;  1SCM C;  2R2I A;  3OHM B;  4YGE B;  1QTX A;  2FCD A;  1W7I B;  2MHH A;  1PUL A;  2TN4 A;  4YGB B;  1SPY A;  2YGU A;  3D77 A;  1PSR A;  3HCM A;  5I94 A;  3CZ0 A;  2SCP A;  5HYD A;  1QX2 A;  2VRG A;  3Q8I A;  3VRO A;  3WXA A;  3B86 A;  1OOH A;  4FQO A;  1HQV A;  2CBL A;  4QJ3 B;  1RK9 A;  1XFZ O;  2BCX A;  1CFC A;  1CDM A;  5D3O A;  1GQM A;  4DRW A;  2LP3 A;  1SRA A;  3OX5 A;  1DGU A;  3NSO A;  1CLB A;  1TCF A;  3I5H C;  1TRF A;  2LMU A;  1UHN A;  2PAL A;  3O6B A;  5AFP A;  4M2P A;  2CT9 A;  1KFU L;  1YUT A;  2KI4 B;  1XO5 A;  4IJ7 A;  1WRK A;  3I5G C;  1KWO C;  1J1D A;  3EVR A;  1IQ5 A;  4YGD B;  3AAJ A;  1CLM A;  2QPT A;  1LXF C;  1TTX A;  4UPG A;  3D0Y B;  1NCZ A;  1S6J A;  3DD4 A;  3PN7 B;  4GGN A;  2K61 A;  1SL9 A;  2PSR A;  5B8I B;  1FF1 A;  1AJ5 A;  3CR2 A;  4YRU A;  3N7H A;  5CSI A;  3SG4 A;  4OV2 A;  5DKN A;  3EG5 B;  4PE7 A;  2PYQ A;  1YUU A;  2L0P A;  1B9A A;  2K7C A;  2WC8 A;  1ZMZ A;  2M7N A;  5J3X A;  1S3P A;  3LCP C;  5FI6 A;  1TNP A;  2WCE A;  3BOW B;  3TUY C;  4I5J A;  1B1G A;  1UHK A;  2ZND A;  1GGZ A;  4FTG A;  1KQM C;  1DEL A;  1QLS A;  1SL7 A;  2LM5 A;  5I8N A;  2K8M B;  3O4X A;  1CM1 A;  3PM8 A;  5HL1 A;  1YVL A;  4PHK A;  2BBM A;  4ZCV A;  3BUO B;  1T14 A;  4I5N B;  1KCY A;  3BFB A;  3V2L A;  1BMO A;  1K9P A;  1P28 A;  2LUX A;  4GUK A;  1AUI B;  1LKJ A;  3CAB A;  5KSZ A;  3KO0 A;  3SIA A;  1SYM A;  1YRT B;  4M2O A;  3OB2 B;  3D75 A;  2HQ8 A;  3AKA A;  3L4A A;  1TN4 A;  2P6B B;  1CTR A;  2KBM A;  4P5O E;  1J7P A;  2WOS A;  1WLM A;  3TDI A;  2WCM A;  1YTZ C;  3ZWH A;  2K7O A;  4HRG A;  3L47 A;  1FPW A;  3CZ2 A;  3I5I B;  2MLE C;  2Q4U A;  2L5X B;  1JF2 A;  2D8N A;  3LK1 A;  4MN0 A;  4BY4 A;  4GAO A;  4MZK A;  4BY5 A;  1KK7 Z;  4C0J A;  1FBV A;  1H8B A;  4GGF A;  3EK7 A;  4PE1 A;  1BR4 B;  3K21 A;  1QV0 A;  3KHE A;  4GGF C;  2JNX A;  1W9Z A;  1TUJ A;  1LVC D;  1G33 A;  3NHI A;  1RRO A;  5BPJ A;  3I5F C;  3NSI A;  4PHJ A;  2QEB A;  2B1U A;  1L2O B;  1C7W A;  2MBX A;  5DKR A;  3L4L A;  1SW8 A;  2JXL A;  2KI6 C;  1PSB A;  2EC6 C;  2M1U A;  3O4Y A;  5AAN A;  2KFG A;  3CTN A;  4C0K A;  3LLE A;  1QV1 A;  1BT6 A;  1NUB A;  2JRF A;  5DIC A;  1QXP A;  3BQ3 A;  5I2Q A;  2LLU A;  1EH2 A;  3RZS A;  2K0J A;  3GK2 A;  2Y1M A;  1OSA A;  2NCP A;  3AKB A;  1YUS A;  1XYD A;  3IVT A;  2K2F A;  2KPH A;  3D76 A;  3F45 A;  4CPV A;  3UNW A;  4DIR A;  1BG1 A;  2JNF A;  5F6T A;  3PJI A;  1FI6 A;  1M31 A;  2LAP A;  1B7T Z;  2LHL A;  2F2P A;  1DJW A;  4N1F A;  1AVS A;  1N0Y A;  1U5I A;  1Y0V H;  1B8R A;  5ER4 X;  1B4C A;  1CDP A;  4YGA A;  1S5G Z;  2MJW B;  4AOM A;  3O2P A;  2JQ6 A;  3A4U B;  4XYN A;  3IQO A;  5AEQ A;  3PFV A;  1F70 A;  1TNQ A;  3ICB A;  1KK8 B;  3D74 A;  1KQV A;  1W7J B;  1S6I A;  3S0G A;  2H61 A;  5HKW A;  1X02 A;  1SR6 C;  2WCH A;  2MLF C;  1JFK A;  2H61 C;  2JPT A;  2QEH A;  3DVJ A;  1UHI A;  1SCM B;  2OTG C;  2LMT A;  3CYZ A;  3SG6 A;  3JTD B;  4XJK A;  1J55 A;  1KFU S;  1MQ1 A;  1TWO A;  3O78 A;  3PM2 A;  1DMO A;  2JPO A;  4M2Q A;  1CMF A;  3EKH A;  3NHT A;  1H4B A;  2JXC A;  4NDD A;  1WY9 A;  2GTE A;  3OB1 B;  1QAT A;  2ZRT A;  2HF5 A;  2CTN A;  1BJF A;  1BF5 A;  3NSL A;  4PT1 A;  1KSM A;  3R1O A;  5D7F A;  3I5H B;  1M45 A;  1NYA A;  1ZAC A;  3KF9 A;  4JKT A;  1ORG A;  1QVI Y;  3CDN A;  3I5G B;  2KYF A;  3CGA A;  2L4I A;  1UHH A;  1NWD A;  1F8H A;  2G2B A;  1PVB A;  1A03 A;  4GFT A;  4MSP A;  2BKH B;  2ZN8 A;  5KU1 A;  1C3Y A;  2WCB A;  1K90 D;  1CMG A;  3PAL A;  4PE4 A;  1K9U A;  2KDH A;  4L9M A;  2LE9 B;  3OX6 A;  4NQG A;  4MRX A;  3DVM A;  1MWN A;  2AAO A;  3OGN A;  2F8P A;  4NDB A;  2WCK A;  3MSE B;  3TUY B;  3TDZ A;  1KSO A;  1WRL A;  2A4J A;  4OKH A;  1SMG A;  1KQM B;  1CDL A;  4ORB B;  1OOG A;  1YX8 A;  2K7D A;  2BL0 C;  2LHI A;  2JT0 A;  1QJT A;  2LVJ A;  4MZL A;  4U8D A;  2KLE A;  3RM1 A;  2JZI A;  3B87 A;  3RLZ A;  2ZKM X;  2JU0 A;  3QME A;  5K89 A;  2GGM A;  2LCP A;  3FWB A;  4PHM A;  3CZT X;  2MA2 A;  3SJS A;  1OOI X;  1S6C A;  1DTL A;  2KYC A;  3PN7 C;  1DT7 B;  2ZN9 A;  1A75 A;  1UUR A;  2L51 A;  4OZD A;  2LAN A;  4ETO A;  1AP4 A;  3EK4 A;  3KEV A;  1J1E A;  2BCA A;  1XFW O;  4PAL A;  1QWV A;  3BUX B;  2KGR A;  1B8L A;  4PCW A;  1AJ4 A;  3EVV A;  2P71 A;  1RJV A;  3D78 A;  3H4S E;  5HKY A;  3CLN A;  3EKJ A;  1OOF A;  2KSP A;  2DOQ A;  1K93 D;  1REC A;  1QIV A;  2KOT A;  1DQE A;  2K2A A;  3BFA A;  3BXK A;  3SG3 A;  2WCL A;  3CWG A;  1DF0 A;  4NDC A;  4MLW A;  1CFP A;  1OQP A;  5HLV A;  4GBA A;  1DJI A;  1S1E A;  3VGO A;  1PK0 D;  3BJH A;  3AAK A;  1MHO A;  2IS9 A;  1RTP 1;  3IF7 A;  3E3R A;  4AQI A;  2M7L A;  1WLZ A;  5TNC A;  5JOL A;  2PAS A;  3DF0 A;  1YR5 A;  5D69 A;  1PVA A;  1XA5 A;  2KAY A;  3BYA A;  2KAV A;  2KQ6 A;  3R72 A;  1ZUZ A;  1FI5 A;  2LMV A;  2EC6 B;  1TCO B;  3IQQ A;  3LL8 B;  1IG5 A;  1LIN A;  1TIZ A;  1XVJ A;  1OZS A;  2JTT A;  2M9G A;  3B7A A;  4I5K A;  5FI2 A;  5CSF A;  5PAL A;  4CLN A;  1OW4 A;  1VRK A;  4GPL B;  2JT8 A;  1TOP A;  3B6X A;  1RFJ A;  4IL1 A;  5JJG A;  4R1E A;  2H2K A;  2ZRS A;  3DYE A;  5ER5 A;  3TS5 C;  5G08 A;  1TNX A;  2ZFD A;  3GK1 A;  1JF0 A;  1F54 A;  1B8C A;  1CB1 A;  1OMR A;  1SL8 A;  4CID A;  1HT9 A;  2F33 A;  1SCV A;  1XFX O;  1PRW A;  1YRU B;  4ORC B;  2BE4 A;  1BOC A;  1CM4 A;  1S36 A;  1U5I B;  2PRU A;  1EXR A;  1DJX A;  1K94 A;  2M49 B;  2I18 A;  3M0W A;  2ISD A;  1UWO A;  1BLQ A;  1C3Z A;  5I2L A;  1WDC B;  2WC5 A;  4HSZ A;  4OVN F;  2LVK A;  4P2Y B;  3B88 A;  3JVT C;  5KTY A;  4JWQ A;  2GGZ A;  3NXA A;  2OTG B;  1TUZ A;  1F71 A; 
#chains in the Genus database with same CATH homology
 2I2R E;  2CNP A;  2O60 A;  2M1K B;  2KFF A;  1K95 A;  4OCI A;  2LUC A;  1R2U A;  1XFU O;  4XJK B;  2Y4Q A;  5I2O A;  2JWW A;  1EG4 A;  2Y1N A;  1XFV O;  5GQQ C;  1FW4 A;  2KHN A;  2LVI A;  3VRR A;  1QX5 B;  3VRP A;  4YBH B;  1OZO A;  2BBN A;  3D10 A;  3GK4 X;  2KGB C;  4ORA B;  2BE6 A;  1CFF A;  1V1F A;  4PDZ A;  1QIW A;  1GJY A;  2KQY A;  4GNK B;  1CDN A;  1NCY A;  4DCK A;  4WQ3 A;  1JC2 A;  2LVV A;  4ZCU A;  4QJ5 B;  3GOF A;  1LA3 A;  3WHT B;  1G8I A;  4HRH A;  4Q04 A;  1N65 A;  1KWO B;  1K96 A;  1UUS A;  1BR1 B;  5IBW A;  1YUR A;  3FS7 A;  1NIW A;  2E30 A;  1NX2 A;  1DJH A;  3CR5 X;  2NCO A;  3JTD C;  4WRI A;  4D1E A;  2COL B;  2Q91 A;  1NCX A;  2LP2 A;  3CR4 X;  2OS8 C;  1QX7 A;  4CFQ A;  2G9B A;  2MAZ A;  2F3Z A;  2L4H A;  1R6P A;  3TZ1 A;  2EHB A;  2LLS A;  2WCF A;  3BUW B;  4USL A;  2L50 A;  2JOJ A;  5CSJ A;  5HKZ A;  1IWQ A;  2FJU B;  3SG5 A;  4N1G A;  1AK8 A;  1J7Q A;  1XK4 A;  1Y1X A;  2BL0 B;  1DVI A;  3VRQ A;  1DGV A;  5DKQ A;  2F2O A;  4YI9 A;  1NP8 A;  3DVE A;  3LK0 A;  4N5X A;  4PHN A;  1XK4 C;  1DJZ A;  1OE9 B;  2I94 A;  1K8U A;  1NX1 A;  1KK7 Y;  1A4P A;  1ODB A;  4AQJ A;  1NSH A;  1SBJ A;  4MEW A;  3A8R A;  2KAX A;  2KI4 C;  2ZNE A;  1XFY O;  1EG3 A;  1TNW A;  4F0Z B;  1ZOT B;  3D0Y A;  2EGD A;  1IJ5 A;  2GV5 A;  3ZNI A;  5HLO A;  1GGW A;  1M39 A;  1AHR A;  2AUC A;  1A75 B;  1EJ3 A;  4WQ2 A;  3SG2 A;  5AXI A;  2F3Y A;  2QAC A;  4JPZ B;  1A29 A;  1YVH A;  3PLF B;  3C1V A;  1OOJ A;  2LC5 A;  1SK6 D;  2PMY A;  1G4Y R;  2OPO A;  1K2H A;  1WRZ A;  2NXQ A;  1F4O A;  1YX7 A;  1RWY A;  2L2E A;  2NZ0 A;  3BOW A;  1NX0 A;  4A4C A;  3DVK A;  1M46 A;  1QLK A;  4YI8 A;  2M0R A;  2CCM A;  4TNC A;  1DF0 B;  2CXJ A;  1CKK A;  2BEC A;  1QVI Z;  1B7T Y;  2V53 A;  2I7A A;  1EL4 A;  2PVB A;  2JTZ A;  1MF8 B;  2KFH A;  1A2X A;  1S5G Y;  4MVF A;  3OP0 A;  1IQ3 A;  3CS1 A;  2LLT A;  2O5G A;  3I5F B;  4PE0 A;  1IH0 A;  1F55 A;  3DF0 B;  2M8U A;  2AMI A;  2JC2 A;  1MUX A;  2WOR A;  1JBA A;  1LA0 A;  2WND A;  4MRY A;  1KFX S;  1ZFS A;  1IJ6 A;  1IGV A;  3KPX A;  2JT3 A;  3SG7 A;  1IKU A;  2HQW A;  2KBI A;  3TS5 B;  3TDU A;  1JFJ A;  1ALW A;  3EVU A;  2BCB A;  2LNK A;  1CLL A;  3I5I C;  1BOD A;  4MZJ A;  2MRD A;  1Y1A A;  4A4B A;  3HX4 A;  1MXL C;  1UP5 A;  3EK8 A;  3FIA A;  4JQ0 D;  4YGC B;  1QAS A;  1NPQ A;  1ALV A;  2JUL A;  1M63 B;  5CPV A;  1Q80 A;  4QJ4 B;  1J7O A;  1JWD A;  4OR9 B;  2L98 A;  1KFX L;  4ICB A;  1NX3 A;  1S26 D;  4HRE E;  1L2O C;  1UHJ A;  3JVT B;  3VRN A;  3WHU B;  4E68 A;  1CNP A;  1N2D A;  1Y1U A;  1E8A A;  3PAT A;  2KNE A;  4CFR A;  1PAL A;  2SAS A;  2K7B A;  1SR6 B;  5AER A;  1B47 A;  3BUM B;  3NSK A;  1IRJ A;  1MXE A;  1QS7 A;  2M3W A;  1CFD A;  1DJG A;  4MBE A;  1JUO A;  2FOT A;  2HPS A;  1BU3 A;  3SIB A;  2M29 A;  1V1G A;  1OMD A;  1F4Q A;  2Y5I A;  2BKI B;  1JSA A;  2FCE A;  3QRX A;  1OMV A;  1SNL A;  3WNX B;  1DJY A;  2NLN A;  1C7V A;  2E6W A;  2HET A;  1C07 A;  5FYX A;  1SY9 A;  1MR8 A;  2M97 A;  1WDC C;  1SKT A;  5CSN A;  2KI6 D;  2RGI A;  3PSR A;  1L7Z A;  1J7R A;  1KK8 C;  4C0L A;  4DUQ A;  4I5L B;  1K9K A;  1Y6W A;  1D1O A;  2LV7 A;  4DS7 A;  3FWC A;  2R2I A;  2OS8 B;  1SCM C;  4YGE B;  3OHM B;  1QTX A;  2FCD A;  1W7I B;  2MHH A;  1PUL A;  2TN4 A;  4YGB B;  1SPY A;  3HCM A;  1PSR A;  2SCP A;  5HYD A;  1QX2 A;  2VRG A;  3VRO A;  3WXA A;  4FQO A;  1HQV A;  2CBL A;  4QJ3 B;  1RK9 A;  1XFZ O;  2BCX A;  1CFC A;  1CDM A;  1GQM A;  4DRW A;  2LP3 A;  1SRA A;  3OX5 A;  1DGU A;  3NSO A;  1CLB A;  1TCF A;  3I5H C;  1TRF A;  2LMU A;  1UHN A;  2PAL A;  3O6B A;  5AFP A;  4M2P A;  2CT9 A;  1KFU L;  1YUT A;  2KI4 B;  1XO5 A;  1WRK A;  3I5G C;  1KWO C;  1J1D A;  3EVR A;  1IQ5 A;  4YGD B;  3AAJ A;  1CLM A;  2QPT A;  1LXF C;  1TTX A;  4UPG A;  3D0Y B;  1NCZ A;  1S6J A;  3DD4 A;  3PN7 B;  4GGN A;  2K61 A;  1SL9 A;  2PSR A;  5B8I B;  1FF1 A;  1AJ5 A;  3CR2 A;  4YRU A;  5CSI A;  3SG4 A;  4OV2 A;  5DKN A;  4PE7 A;  1YUU A;  2L0P A;  1B9A A;  2K7C A;  2WC8 A;  1ZMZ A;  2M7N A;  5J3X A;  1S3P A;  3LCP C;  1TNP A;  2WCE A;  3BOW B;  3TUY C;  4I5J A;  1B1G A;  1UHK A;  2ZND A;  1GGZ A;  4FTG A;  1KQM C;  1QLS A;  1SL7 A;  2LM5 A;  5I8N A;  2K8M B;  1CM1 A;  3PM8 A;  1YVL A;  4PHK A;  2BBM A;  4ZCV A;  3BUO B;  4I5N B;  1KCY A;  1BMO A;  1K9P A;  2LUX A;  4GUK A;  1AUI B;  1LKJ A;  5KSZ A;  3KO0 A;  3SIA A;  1SYM A;  1YRT B;  4M2O A;  3OB2 B;  2HQ8 A;  3AKA A;  1TN4 A;  2P6B B;  1CTR A;  2KBM A;  4P5O E;  1J7P A;  2WOS A;  1WLM A;  3TDI A;  1YTZ C;  3ZWH A;  2K7O A;  4HRG A;  1FPW A;  3I5I B;  2MLE C;  2Q4U A;  2L5X B;  1JF2 A;  2D8N A;  3LK1 A;  4MN0 A;  4BY4 A;  4GAO A;  4MZK A;  4BY5 A;  1KK7 Z;  4C0J A;  1FBV A;  1H8B A;  4GGF A;  3EK7 A;  4PE1 A;  1BR4 B;  3K21 A;  1QV0 A;  3KHE A;  4GGF C;  2JNX A;  1LVC D;  1G33 A;  1RRO A;  5BPJ A;  3I5F C;  3NSI A;  4PHJ A;  2B1U A;  1L2O B;  1C7W A;  2MBX A;  5DKR A;  1SW8 A;  2JXL A;  2KI6 C;  1PSB A;  2EC6 C;  2M1U A;  3O4Y A;  5AAN A;  2KFG A;  3CTN A;  4C0K A;  3LLE A;  1QV1 A;  1BT6 A;  1NUB A;  2JRF A;  1QXP A;  3BQ3 A;  5I2Q A;  2LLU A;  1EH2 A;  2K0J A;  3GK2 A;  2Y1M A;  1OSA A;  2NCP A;  3AKB A;  1YUS A;  1XYD A;  2K2F A;  3F45 A;  4CPV A;  4DIR A;  1BG1 A;  2JNF A;  5F6T A;  1FI6 A;  1M31 A;  2LAP A;  1B7T Z;  2LHL A;  2F2P A;  1DJW A;  4N1F A;  1AVS A;  1N0Y A;  1U5I A;  1Y0V H;  1B8R A;  5ER4 X;  1B4C A;  1CDP A;  4YGA A;  1S5G Z;  2MJW B;  4AOM A;  3O2P A;  2JQ6 A;  3A4U B;  4XYN A;  3IQO A;  5AEQ A;  3PFV A;  1F70 A;  1TNQ A;  3ICB A;  1KK8 B;  1KQV A;  1W7J B;  1S6I A;  2H61 A;  5HKW A;  1X02 A;  1SR6 C;  2MLF C;  1JFK A;  2H61 C;  2JPT A;  3DVJ A;  1UHI A;  1SCM B;  2OTG C;  2LMT A;  3SG6 A;  3JTD B;  4XJK A;  1J55 A;  1KFU S;  1MQ1 A;  3O78 A;  1DMO A;  4M2Q A;  1CMF A;  3EKH A;  1H4B A;  2JXC A;  4NDD A;  1WY9 A;  3OB1 B;  1QAT A;  2ZRT A;  2HF5 A;  2CTN A;  1BJF A;  1BF5 A;  3NSL A;  1KSM A;  5D7F A;  3I5H B;  1M45 A;  1NYA A;  1ZAC A;  3KF9 A;  1QVI Y;  3I5G B;  2KYF A;  3CGA A;  2L4I A;  1UHH A;  1NWD A;  1F8H A;  2G2B A;  1PVB A;  1A03 A;  4GFT A;  4MSP A;  2BKH B;  2ZN8 A;  5KU1 A;  2WCB A;  1K90 D;  1CMG A;  3PAL A;  4PE4 A;  1K9U A;  2KDH A;  4L9M A;  2LE9 B;  3OX6 A;  4NQG A;  4MRX A;  3DVM A;  1MWN A;  2AAO A;  2F8P A;  4NDB A;  3MSE B;  3TUY B;  3TDZ A;  1KSO A;  1WRL A;  2A4J A;  4OKH A;  1SMG A;  1KQM B;  1CDL A;  4ORB B;  1YX8 A;  2K7D A;  2BL0 C;  2LHI A;  2JT0 A;  1QJT A;  2LVJ A;  4MZL A;  4U8D A;  3RM1 A;  2JZI A;  3RLZ A;  2ZKM X;  2JU0 A;  5K89 A;  2GGM A;  2LCP A;  3FWB A;  4PHM A;  3CZT X;  2MA2 A;  3SJS A;  1S6C A;  1DTL A;  2KYC A;  3PN7 C;  1DT7 B;  2ZN9 A;  1A75 A;  1UUR A;  2L51 A;  2LAN A;  4ETO A;  1AP4 A;  3EK4 A;  3KEV A;  1J1E A;  2BCA A;  1XFW O;  4PAL A;  3BUX B;  2KGR A;  1B8L A;  4PCW A;  1AJ4 A;  3EVV A;  1RJV A;  3H4S E;  5HKY A;  3CLN A;  3EKJ A;  2KSP A;  2DOQ A;  1K93 D;  1QIV A;  1REC A;  2KOT A;  3BXK A;  2K2A A;  3SG3 A;  3CWG A;  1DF0 A;  4NDC A;  4MLW A;  1CFP A;  1OQP A;  5HLV A;  4GBA A;  1DJI A;  1S1E A;  3VGO A;  1PK0 D;  3AAK A;  1MHO A;  2IS9 A;  1RTP 1;  3IF7 A;  3E3R A;  4AQI A;  2M7L A;  1WLZ A;  5TNC A;  5JOL A;  2PAS A;  3DF0 A;  1YR5 A;  5D69 A;  1PVA A;  1XA5 A;  2KAY A;  3BYA A;  2KAV A;  2KQ6 A;  1FI5 A;  1ZUZ A;  2LMV A;  2EC6 B;  1TCO B;  3IQQ A;  3LL8 B;  1IG5 A;  1LIN A;  1TIZ A;  1XVJ A;  1OZS A;  2JTT A;  2M9G A;  4I5K A;  5CSF A;  5PAL A;  4CLN A;  1VRK A;  5JJG A;  4GPL B;  2JT8 A;  1TOP A;  1RFJ A;  4IL1 A;  4R1E A;  2H2K A;  2ZRS A;  5ER5 A;  3TS5 C;  5G08 A;  1TNX A;  2ZFD A;  3GK1 A;  1JF0 A;  1F54 A;  1B8C A;  1CB1 A;  1OMR A;  1SL8 A;  4CID A;  1HT9 A;  2F33 A;  1SCV A;  1XFX O;  1PRW A;  1YRU B;  4ORC B;  2BE4 A;  1BOC A;  1CM4 A;  1S36 A;  1U5I B;  2PRU A;  1EXR A;  1DJX A;  1K94 A;  2M49 B;  2I18 A;  3M0W A;  2ISD A;  1UWO A;  1BLQ A;  5I2L A;  1WDC B;  4HSZ A;  4OVN F;  2LVK A;  4P2Y B;  3JVT C;  5KTY A;  4JWQ A;  2GGZ A;  3NXA A;  2OTG B;  3BUN B;  1F71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...