2FOTA

Crystal structure of the complex between calmodulin and alphaii-spectrin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
134
Chain Sequence
EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of the calmodulin alphaII-spectrin complex provides insight into the regulation of cell plasticity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, structural protein
total genus 43
structure length 134
sequence length 142
ec nomenclature
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fotA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fotA02
1FBVA 1IRJA 3I5IC 4PHKA 1QS7A 2NLNA 4NDDA 2M7NA 1V1FA 5I8NA 4D1EA 1S6CA 1KFUS 2Y1NA 2L4HA 1NX0A 1A03A 3I5HC 3SG3A 3VRQA 1EG4A 4I5NB 1IJ5A 1AK8A 2JTTA 3I5GC 1NX2A 1SKTA 1CDNA 1UHJA 2K7BA 1TNWA 4OV2A 1DGUA 2LLUA 1CLLA 3TS5C 3PN7C 2JU0A 1TCFA 3O4YA 1XFWO 4PHNA 5DKQA 1SMGA 2LUCA 3TUYB 4UPGA 1VRKA 2KBMA 2KNEA 2KFFA 1XVJA 2I7AA 4JPZB 4BY4A 4NQGA 2JZIA 1B1GA 2KYCA 1MXEA 2WORA 4PE0A 1SL8A 4GGNA 3SG2A 4GUKA 2ZN9A 2FOTA 2NZ0A 4GGFA 1M45A 1A4PA 1G8IA 2ISDA 1YR5A 4A4BA 3BOWB 2BECA 2CCMA 2JT0A 1IG5A 3ZNIA 4YBHB 1S36A 4GFTA 5PALA 5AANA 5CPVA 4NDCA 1QX2A 1K9UA 1OSAA 3NXAA 5I2LA 2WC8A 4GNKB 3I5FC 4QJ4B 1IGVA 2I2RE 3SJSA 3D0YA 1MXLC 1DJXA 4DIRA 2LP3A 4MBEA 4DUQA 1SY9A 2M8UA 4IL1A 4USLA 2BL0C 2OTGB 3CTNA 4P2YB 4XJKB 1PALA 1NP8A 2LVIA 5BPJA 1K94A 2LE9B 4YGEB 4XYNA 2Y1MA 4YGAA 1SNLA 2KAYA 1QX7A 2I18A 3CWGA 3FS7A 1YTZC 4YGDB 2KSPA 2KQYA 1S5GY 3OX6A 2JT8A 2O60A 2JXLA 4ORBB 1D1OA 2KFGA 1C7WA 1KK7Z 1NCZA 4MZJA 3RM1A 1JF0A 2CXJA 2L98A 1KK8B 2K7DA 1DJWA 1S6JA 2BBNA 3GOFA 4WRIA 1ZACA 2Q4UA 4N1GA 2LP2A 2NCPA 1DJYA 1UP5A 4N1FA 1F4QA 2K0JA 4PE4A 3WHTB 1SW8A 2LNKA 3HCMA 2NXQA 2VRGA 3ICBA 2AUCA 3NSLA 3ZWHA 2WOSA 1DF0A 1KQMC 2IS9A 1K90D 2LLTA 2HQWA 3VRPA 1GJYA 1K9PA 1F8HA 5JOLA 2G2BA 1DJIA 2BCXA 1ODBA 1UHIA 2MBXA 4YRUA 3JTDC 1SR6C 2OS8C 4QJ5B 1BLQA 1KFUL 1N0YA 1OZOA 1RK9A 1ZFSA 2K7OA 1Y0VH 3BYAA 2M3WA 2SCPA 4TNCA 4YI8A 5F6TA 3FWBA 4C0JA 1CFCA 2M1KB 1B4CA 1R6PA 2F3ZA 2FJUB 1N65A 3VGOA 2GV5A 2JRFA 2EC6B 1RTP1 1UHHA 1IQ5A 3CR2A 2MHHA 1JF2A 1MF8B 2F2OA 3BUNB 1F4OA 1Y1UA 3EK4A 1IWQA 1OE9B 4AOMA 5HKYA 1AVSA 1LVCD 1B47A 1QIWA 1S26D 1WDCC 2ZKMX 2PALA 5CSJA 2H2KA 3BQ3A 1B7TZ 3DVMA 5DKRA 1CM4A 2P6BB 4ORCB 4PHJA 5D7FA 1J7OA 4NDBA 4OR9B 4DRWA 3DD4A 2A4JA 1B8RA 2LCPA 5CSFA 3LK1A 1TRFA 1KFXL 1F71A 2E6WA 1B8CA 2JWWA 3VRRA 4MSPA 1BU3A 1SCVA 3DVKA 2KI4B 1U5IB 2EHBA 1IQ3A 1GGWA 1XO5A 2F33A 2LMTA 3BOWA 1IKUA 1AHRA 1EL4A 1MR8A 1QLSA 1PSRA 1NUBA 1F70A 1W7JB 1HQVA 1LKJA 2K2AA 4FQOA 1BODA 1WRLA 1YX7A 1PVBA 1NWDA 1ZMZA 2JPTA 3GK4X 1E8AA 3FIAA 3DF0B 1JFJA 3AAJA 4HSZA 3PATA 1YUUA 3EK7A 3KHEA 1S1EA 2BE6A 4GGFC 2GGMA 4OVNF 1CLBA 2OTGC 3AKBA 4PHMA 1FF1A 1NX1A 2V53A 4XJKA 2WCBA 3D10A 1H8BA 1CTRA 1LA3A 2H61C 2H61A 3LCPC 3EKJA 4AQIA 3M0WA 1M31A 1KWOC 1UUSA 4HRGA 2M7LA 2F8PA 1QATA 5AEQA 2ZNEA 3I5IB 2CT9A 1AJ4A 1YUSA 1M39A 2LHLA 1SCMC 2JOJA 5G08A 1QASA 3A4UB 1YVHA 2ZRSA 5I2OA 1WY9A 4MZLA 1QVIY 2DOQA 2FCDA 3CR5X 5AXIA 1FI5A 1K9KA 4CLNA 2JNXA 5AERA 4YI9A 1XYDA 4GAOA 2LV7A 2M29A 3PSRA 1SRAA 2BBMA 4CFQA 1L2OC 3KEVA 1BMOA 4I5JA 3TS5B 1YURA 1F55A 3PN7B 1K8UA 2WCEA 4E68A 1A2XA 4WQ3A 1SK6D 2CTNA 5I2QA 1QX5B 2JXCA 3NSIA 1CDMA 2RGIA 3KPXA 4CIDA 1J7RA 1TCOB 5KSZA 5KTYA 2PVBA 4PE1A 4CPVA 5ER4X 2M1UA 1YRUB 2JTZA 2KOTA 4I5LB 4PALA 3TDZA 1AJ5A 1H4BA 5FYXA 1M63B 5CSIA 5AFPA 2F2PA 1SL9A 1S5GZ 1V1GA 4M2QA 1KCYA 1CFPA 1YX8A 1TN4A 1NPQA 2L0PA 5HKZA 2HQ8A 1S6IA 5GQQC 2MA2A 2ZN8A 2KBIA 2PMYA 1NIWA 1NSHA 1SYMA 3DVJA 3JVTB 4R1EA 2BL0B 1PSBA 3AKAA 1SL7A 1FPWA 1TTXA 5HLVA 5D69A 4MEWA 1CMFA 1MWNA 2E30A 1F54A 1X02A 1CB1A 1UWOA 1DVIA 1S3PA 2HPSA 3K21A 1KQVA 1YUTA 3CZTX 2KAVA 3VROA 1BR4B 1TNPA 1EJ3A 3OB2B 2B1UA 1YVLA 3SG7A 1BJFA 2KI6C 3O78A 4YGCB 5ER5A 1CNPA 1DT7B 2PRUA 2KI4C 2BKHB 1BF5A 1SBJA 1HT9A 1QV1A 1LA0A 1UURA 2KGRA 1DF0B 4L9MA 1FI6A 1JFKA 1KQMB 3RLZA 1JC2A 2LVJA 3VRNA 1DTLA 2NCOA 4YGBB 2LVKA 2LANA 3EK8A 1QIVA 1J55A 2MLFC 2MJWB 1PRWA 2O5GA 1KSMA 1LINA 3TUYC 2COLB 1EXRA 1SR6B 2OS8B 3JTDB 3DF0A 2FCEA 1DGVA 4ZCUA 4AQJA 1WRKA 1JSAA 3GK2A 1BT6A 1M46A 1DJHA 1TIZA 3CS1A 2M97A 4JQ0D 1OZSA 1UHNA 2K2FA 4GBAA 3OP0A 4F0ZB 1RECA 2PSRA 3KF9A 3SG4A 1K95A 1SPYA 2CNPA 5IBWA 1G4YR 1N2DA 3F45A 4MLWA 3PLFB 4MN0A 1NCXA 1B9AA 3A8RA 3KO0A 2JT3A 1OMVA 5HYDA 1A75B 2Y4QA 1Y6WA 1XFZO 2ZFDA 2LVVA 4JWQA 1WDCB 2M49B 2MLEC 1QJTA 1Y1XA 2CBLA 2LHIA 2ZRTA 5B8IB 2QACA 2KDHA 3EVRA 2WCFA 2EGDA 3NSKA 1XFYO 1DJGA 4BY5A 3CGAA 3IQQA 3QRXA 2AAOA 1XFXO 2LLSA 1L7ZA 3H4SE 1J7PA 1XFVO 1RROA 1J7QA 4A4CA 1WLMA 1ZOTB 1KK8C 3PM8A 1K93D 4C0KA 4C0LA 2GGZA 3DVEA 2JNFA 2OPOA 3I5HB 3MSEB 3O6BA 3EVUA 2L5XB 1NX3A 3E3RA 4Q04A 1G33A 3I5GB 3SG5A 2KI6D 2LMVA 4WQ2A 1W7IB 1DJZA 3WNXB 4DS7A 4M2PA 1ALVA 1PVAA 2KFHA 3BUMB 1EG3A 1PK0D 4HRHA 1TOPA 4I5KA 4ZCVA 3BUOB 3PALA 3WHUB 5JJGA 2BKIB 1BR1B 4N5XA 1QVIZ 1WLZA 2R2IA 2M0RA 4ICBA 1KK7Y 3JVTC 1K96A 4HREE 1KFXS 5CSNA 1PULA 1ZUZA 2ZNDA 4PDZA 3IQOA 2BCBA 1NCYA 4CFRA 2L2EA 2WNDA 2HF5A 4QJ3B 4OCIA 4P5OE 2LM5A 1C07A 1XFUO 1MQ1A 3BUWB 1OMDA 1ALWA 1KWOB 1K2HA 3C1VA 3TZ1A 4MRYA 1DMOA 3TDIA 3I5FB 3D0YB 3SIAA 3TDUA 3FWCA 1SCMB 2EC6C 1RJVA 3EKHA 2M9GA 1R2UA 1TNXA 1IH0A 2MAZA 1QTXA 5K89A 4OKHA 1WRZA 1CFDA 2LMUA 3LK0A 2I94A 2MRDA 3OB1B 1QXPA 2F3YA 3HX4A 1A29A 2BCAA 2LAPA 3SIBA 1L2OB 2KGBC 2L4IA 2K61A 1NYAA 1OOJA 1MUXA 1Y1AA 3OX5A 1CFFA 2KYFA 3LL8B 1RWYA 2AMIA 1XK4C 1JWDA 1GGZA 1XK4A 3NSOA 2KAXA 1JUOA 1BG1A 1IJ6A 2JULA 1MHOA 4PCWA 4PE7A 3OHMB 3CR4X 1OQPA 2PASA 2L51A 1B8LA 2JQ6A 2QPTA 3BXKA 1RFJA 2K8MB 2SASA 4U8DA 1CMGA 5HLOA 1J1DA 1U5IA 2KHNA 5HKWA 2K7CA 4MZKA 2Q91A 5KU1A 1Q80A 1OMRA 3BUXB 3IF7A 1AUIB 3EVVA 1B7TY 3GK1A 4ETOA 1CKKA 4MRXA 5DKNA 1GQMA 1XA5A 3CLNA 4FTGA 1UHKA 1CDLA 1LXFC 2D8NA 2Y5IA 5J3XA 4MVFA 1KSOA 2LC5A 4GPLB 3WXAA 4M2OA 2JC2A 1A75A 2L50A 3AAKA 1EH2A 2LUXA 3PFVA 1JBAA 1TNQA 1C7VA 2HETA 4ORAB 3O2PA 1CLMA 1CDPA 1J1EA 1FW4A 2BE4A 2TN4A 4DCKA 1YRTB 2G9BA 2KQ6A 3SG6A 1BOCA 3LLEA 1QV0A 1CM1A 1QLKA 1AP4A 5TNCA
chains in the Genus database with same CATH superfamily
1FBVA 1IRJA 3I5IC 4PHKA 3S0EA 1QS7A 2NLNA 4NDDA 2M7NA 1V1FA 5I8NA 1OOIX 4D1EA 1S6CA 1KFUS 2Y1NA 1Z4HA 1NX0A 2L4HA 1A03A 1OOFA 1DC1A 3I5HC 3SG3A 3VRQA 1EG4A 4I5NB 1IJ5A 2QEBA 2JTTA 3FE9A 3I5GC 1AK8A 3O4XA 1NX2A 1SKTA 1CDNA 1UHJA 2K7BA 1TNWA 4OV2A 3SS5A 1DGUA 2LLUA 1CLLA 3TS5C 3PN7C 2JU0A 1TCFA 3O4YA 1XFWO 4PHNA 5DKQA 1SMGA 2LUCA 3TUYB 4UPGA 1VRKA 2KBMA 2KNEA 2KFFA 1XVJA 2I7AA 4JPZB 4BY4A 4NQGA 2JZIA 1B1GA 2KYCA 1MXEA 2WORA 3D75A 4PE0A 3S0FA 1SL8A 3D73A 4GGNA 4KYNA 3SG2A 4GUKA 2ZN9A 2FOTA 2NZ0A 4GGFA 1M45A 1A4PA 1G8IA 2ISDA 1YR5A 2ERBA 3BOWB 2BECA 2CCMA 2JT0A 3S0GA 4A4BA 1IG5A 3ZNIA 4YBHB 1S36A 4GFTA 5PALA 5AANA 5CPVA 4NDCA 1QX2A 1K9UA 1OSAA 3CZ0A 3NXAA 3R1PA 5I2LA 2WC8A 4GNKB 3I5FC 4QJ4B 1IGVA 2I2RE 3SJSA 3D0YA 2BNXA 2P71A 1Z2CB 1MXLC 3NHIA 3EG5B 1DJXA 4DIRA 1TWOA 2LP3A 3BFHA 4MBEA 1SY9A 4DUQA 2M8UA 4IL1A 4USLA 2BL0C 2OTGB 3CTNA 4P2YB 4XJKB 1PALA 1NP8A 2LVIA 2WC5A 1K94A 5BPJA 2LE9B 4YGEB 4XYNA 2Y1MA 4YGAA 1SNLA 2KAYA 1QX7A 2I18A 3S0BA 3CWGA 3FS7A 1YTZC 4YGDB 3BFAA 2KSPA 2KQYA 1S5GY 3OX6A 2JT8A 2O60A 2JXLA 4ORBB 1D1OA 2KFGA 1C7WA 1KK7Z 1NCZA 4MZJA 3RM1A 1JF0A 2CXJA 2L98A 1KK8B 2K7DA 2WCHA 1DJWA 1S6JA 2BBNA 3GOFA 4WRIA 1ZACA 2Q4UA 4N1GA 2LP2A 2NCPA 1DJYA 1UP5A 4N1FA 2PQLA 1F4QA 2K0JA 4PE4A 3WHTB 1SW8A 2LNKA 3HCMA 4FQTA 2NXQA 2VRGA 3ICBA 2AUCA 3NSLA 3ZWHA 2WOSA 1DF0A 1KQMC 2IS9A 1K90D 2LLTA 3CDNA 2HQWA 3VRPA 1GJYA 3DY9A 1K9PA 4INXA 1F8HA 5JOLA 2G2BA 1DJIA 3K1EA 2BCXA 1ODBA 1UHIA 2MBXA 4YRUA 3L4AA 3JTDC 1SR6C 2OS8C 3UO9A 4QJ5B 1ZFSA 1KFUL 1N0YA 1OZOA 1RK9A 2K7OA 1Y0VH 3BYAA 2M3WA 2SCPA 4TNCA 4YI8A 5F6TA 3FWBA 4C0JA 2FJYA 1CFCA 2M1KB 1B4CA 1R6PA 2F3ZA 3D78A 2FJUB 1N65A 3VGOA 2GV5A 2JRFA 2EC6B 1RTP1 3OBVA 1UHHA 1IQ5A 1BLQA 3CR2A 2MHHA 5HL1A 1JF2A 1MF8B 2BAPA 2F2OA 3BUNB 1F4OA 1Y1UA 4INWA 1SSEB 1OOGA 3EK4A 1IWQA 1OE9B 4AOMA 5HKYA 1AVSA 3R1OA 1LVCD 1B47A 1QIWA 1S26D 1WDCC 2ZKMX 2PALA 5CSJA 2H2KA 3BQ3A 1B7TZ 3DVMA 5DKRA 1CM4A 2P6BB 4ORCB 4PHJA 5D7FA 5DICA 1J7OA 4NDBA 4OR9B 4DRWA 3DD4A 2A4JA 1B8RA 2LCPA 5CSFA 3LK1A 1GM0A 1TRFA 1KFXL 1OOHA 1F71A 2E6WA 2P70A 1B8CA 2JWWA 3VRRA 4MSPA 1BU3A 1SCVA 2QDIA 3DVKA 2KI4B 1U5IB 2EHBA 1IQ3A 1GGWA 5FI2A 1XO5A 2F33A 2LMTA 3BOWA 1IKUA 1AHRA 1DQEA 1EL4A 1MR8A 1QLSA 1PSRA 3L4LA 1NUBA 1F70A 1W7JB 1HQVA 1LKJA 2K2AA 4FQOA 1BODA 3VB1A 1WRLA 1YX7A 1PVBA 1NWDA 1ZMZA 2JPTA 3GK4X 1E8AA 3FIAA 3DF0B 1JFJA 3AAJA 4HSZA 2PYQA 3PATA 1YUUA 3EK7A 3KHEA 1S1EA 2BE6A 4GGFC 2GGMA 4OVNF 1CLBA 2OTGC 3AKBA 4PHMA 1FF1A 1NX1A 2V53A 4XJKA 3CZ1A 2WCBA 3D10A 1W9ZA 3S0AA 1H8BA 1CTRA 1LA3A 2H61C 2H61A 3LCPC 3EKJA 4AQIA 3M0WA 1M31A 1KWOC 5FI7A 1UUSA 4HRGA 2WC6A 2M7LA 2F8PA 1QATA 5AEQA 2ZNEA 3I5IB 2CT9A 1AJ4A 1YUSA 1M39A 2LHLA 1SCMC 2JOJA 5G08A 3UNWA 1QASA 3A4UB 1YVHA 2ZRSA 5I2OA 1WY9A 4MZLA 1QVIY 2DOQA 2FCDA 3CR5X 3FE6A 5AXIA 1FI5A 2L2CA 3IVTA 1K9KA 4CLNA 2JNXA 5AERA 4YI9A 1XYDA 3SS4A 3OGNA 4GAOA 2LV7A 2M29A 3PSRA 1SRAA 2BBMA 4CFQA 1L2OC 3KEVA 1BMOA 4I5JA 3TS5B 1YURA 2QEHA 1F55A 3PN7B 1K8UA 2WCEA 4E68A 1A2XA 4WQ3A 1SK6D 2CTNA 4OZDA 5I2QA 1QX5B 2JXCA 3NSIA 1CDMA 2RGIA 3KPXA 4CIDA 1J7RA 1TCOB 5KSZA 5KTYA 2PVBA 4PE1A 4CPVA 5ER4X 4F7FA 2M1UA 1YRUB 2JTZA 2KOTA 4I5LB 4PALA 3TDZA 1AJ5A 1H4BA 5FYXA 1M63B 5CSIA 5AFPA 1T14A 2F2PA 1SL9A 1S5GZ 1V1GA 4M2QA 1KCYA 3R72A 1CFPA 1YX8A 1TN4A 3SS3A 1NPQA 2L0PA 5HKZA 2HQ8A 1S6IA 5GQQC 2MA2A 2ZN8A 2KBIA 2PMYA 1NIWA 3DYEA 1NSHA 3BJHA 1SYMA 3DVJA 3JVTB 4R1EA 2GTEA 2BL0B 1PSBA 3AKAA 1SL7A 1FPWA 1TTXA 5HLVA 5D69A 4MEWA 1CMFA 1MWNA 3DXLA 2E30A 3Q8IA 1F54A 1X02A 1CB1A 1UWOA 1DVIA 1S3PA 2HPSA 3K21A 1KQVA 1YUTA 3CZTX 2KAVA 3VROA 1BR4B 1TNPA 1EJ3A 5I94A 3OB2B 2KLEA 2B1UA 1YVLA 3SG7A 1BJFA 2KI6C 3O78A 4YGCB 5ER5A 1CNPA 1DT7B 2PRUA 2KI4C 2BKHB 1BF5A 1SBJA 1HT9A 1QV1A 1LA0A 1UURA 2KGRA 1DF0B 4L9MA 1FI6A 1JFKA 1KQMB 3RLZA 1JC2A 3PJIA 2LVJA 3VRNA 1DTLA 2NCOA 4YGBB 2LVKA 2LANA 3EK8A 1QIVA 1J55A 2MLFC 2MJWB 1PRWA 2O5GA 1KSMA 1LINA 3TUYC 3B6XA 2COLB 1EXRA 1SR6B 2OS8B 3JTDB 3DZTA 3DF0A 2FCEA 1DGVA 4ZCUA 4AQJA 1WRKA 1JSAA 3GK2A 1BT6A 1M46A 1DJHA 1TIZA 2KPHA 3CS1A 2M97A 4JQ0D 1OZSA 1UHNA 2K2FA 4GBAA 3OP0A 4F0ZB 1RECA 2PSRA 3D74A 3KF9A 3SG4A 1K95A 1SPYA 2CNPA 5IBWA 1G4YR 1N2DA 3F45A 4MLWA 3PLFB 4MN0A 1NCXA 1B9AA 3A8RA 3KO0A 2JT3A 1OMVA 5HYDA 1A75B 2Y4QA 1IIOA 1Y6WA 1XFZO 2ZFDA 2LVVA 4JWQA 1WDCB 2M49B 2MLEC 1QJTA 1Y1XA 1DEKA 2CBLA 2LHIA 2ZRTA 5B8IB 2QACA 2KDHA 3EVRA 2WCFA 3D77A 5EL2A 1QWVA 1OW4A 2EGDA 1XFYO 3NSKA 1DJGA 4BY5A 3CGAA 3IQQA 3QRXA 2AAOA 1XFXO 2LLSA 1L7ZA 3H4SE 1J7PA 1XFVO 3BFBA 1RROA 1J7QA 4A4CA 1WLMA 1ZOTB 1KK8C 2KLDA 3B86A 1K93D 3D76A 3PM8A 4IJ7A 4C0KA 2GGZA 4C0LA 3DVEA 3R1VA 2JNFA 2OPOA 3B7AA 3I5HB 3MSEB 3EVUA 3O6BA 2L5XB 1NX3A 3E3RA 4Q04A 1G33A 3I5GB 2K60A 3SG5A 2KI6D 2LMVA 4WQ2A 1W7IB 1DJZA 3WNXB 1LS8A 3CABA 4DS7A 4M2PA 1ALVA 1PVAA 2KFHA 4JD9A 3BUMB 1EG3A 1PK0D 4HRHA 1TOPA 4I5KA 4ZCVA 3BUOB 3PALA 3WHUB 5JJGA 3B88A 2BKIB 1BR1B 4N5XA 1P28A 2L5YA 1QVIZ 1WLZA 2R2IA 2M0RA 2WCJA 1KK7Y 3B87A 4ICBA 3JVTC 1K96A 4HREE 5FI6A 1KFXS 5CSNA 1PULA 1ZUZA 2ZNDA 4PDZA 2QEOA 3IQOA 2BCBA 1NCYA 4JKTA 4CFRA 2L2EA 2WNDA 2HF5A 4QJ3B 4OCIA 4P5OE 2LM5A 1C07A 2QEVA 1XFUO 1MQ1A 3BUWB 1OMDA 1ALWA 1KWOB 1TUJA 1K2HA 3C1VA 3TZ1A 4MRYA 1DMOA 3TDIA 3I5FB 3D0YB 4PT1A 3SIAA 3TDUA 3CZ2A 3FWCA 1SCMB 2EC6C 1RJVA 3EKHA 2M9GA 1R2UA 1C3ZA 1TNXA 1IH0A 2MAZA 2JPOA 1QTXA 5K89A 4OKHA 1WRZA 1CFDA 2LMUA 3CYZA 3LK0A 3S0DA 2I94A 2MRDA 3OB1B 1QXPA 2F3YA 3HX4A 1A29A 2BCAA 2LAPA 3SIBA 1L2OB 2KGBC 2L4IA 2K61A 1NYAA 1OOJA 1MUXA 1Y1AA 3OX5A 1CFFA 2KYFA 3LL8B 1RWYA 2AMIA 1XK4C 1C3YA 1GGZA 3FE8A 1JWDA 1XK4A 3NSOA 3L47A 2KAXA 1JUOA 3N7HA 1BG1A 1IJ6A 2JULA 1MHOA 4PCWA 4PE7A 3OHMB 3CR4X 1OQPA 2PASA 2L51A 1B8LA 2JQ6A 2QPTA 3BXKA 1RFJA 2K8MB 5D3OA 2SASA 2WCMA 4U8DA 1CMGA 5HLOA 1J1DA 1ORGA 2H8VA 1U5IA 2KHNA 5HKWA 2K7CA 4MZKA 2Q91A 5KU1A 1Q80A 1OMRA 1DELA 3BUXB 2WCKA 3IF7A 1AUIB 3EVVA 1B7TY 3GK1A 3QMEA 4ETOA 1CKKA 4MRXA 5DKNA 1GQMA 1XA5A 3CLNA 3RZSA 4FTGA 1UHKA 1CDLA 1LXFC 1XFRA 2D8NA 3PM2A 2YGUA 2Y5IA 5J3XA 4MVFA 1KSOA 2LC5A 4GPLB 3WXAA 4M2OA 2JC2A 1A75A 2L50A 2WCLA 3AAKA 1EH2A 2LUXA 3PFVA 1JBAA 1TNQA 1C7VA 1TUZA 2HETA 3NGVA 4ORAB 3O2PA 1CLMA 1CDPA 1J1EA 1FW4A 2BE4A 2TN4A 4DCKA 1YRTB 2G9BA 2KQ6A 3NHTA 3SG6A 1BOCA 3LLEA 3V2LA 1QV0A 1CM1A 1QLKA 1AP4A 5TNCA
chains in the Genus database with same CATH topology
1FBVA 1IRJA 3I5IC 4PHKA 1QS7A 2NLNA 4NDDA 2M7NA 1V1FA 5I8NA 4D1EA 1S6CA 1KFUS 2Y1NA 2L4HA 1NX0A 1A03A 3I5HC 3SG3A 3VRQA 1EG4A 4I5NB 1IJ5A 1AK8A 2JTTA 3I5GC 1NX2A 1SKTA 1CDNA 1UHJA 2K7BA 1TNWA 4OV2A 1DGUA 2LLUA 1CLLA 3TS5C 3PN7C 2JU0A 1TCFA 3O4YA 1XFWO 4PHNA 5DKQA 1SMGA 2LUCA 3TUYB 4UPGA 1VRKA 2KBMA 2KNEA 2KFFA 1XVJA 2I7AA 4JPZB 4BY4A 4NQGA 2JZIA 1B1GA 2KYCA 1MXEA 2WORA 4PE0A 1SL8A 4GGNA 3SG2A 4GUKA 2ZN9A 2FOTA 2NZ0A 4GGFA 1M45A 1A4PA 1G8IA 2ISDA 1YR5A 4A4BA 3BOWB 2BECA 2CCMA 2JT0A 1IG5A 3ZNIA 4YBHB 1S36A 4GFTA 5PALA 5AANA 5CPVA 4NDCA 1QX2A 1K9UA 1OSAA 3NXAA 5I2LA 2WC8A 4GNKB 3I5FC 4QJ4B 1IGVA 2I2RE 3SJSA 3D0YA 1MXLC 1DJXA 4DIRA 2LP3A 4MBEA 4DUQA 1SY9A 2M8UA 4IL1A 4USLA 2BL0C 2OTGB 3CTNA 4P2YB 4XJKB 1PALA 1NP8A 2LVIA 5BPJA 1K94A 2LE9B 4YGEB 4XYNA 2Y1MA 4YGAA 1SNLA 2KAYA 1QX7A 2I18A 3CWGA 3FS7A 1YTZC 4YGDB 2KSPA 2KQYA 1S5GY 3OX6A 2JT8A 2O60A 2JXLA 4ORBB 1D1OA 2KFGA 1C7WA 1KK7Z 1NCZA 4MZJA 3RM1A 1JF0A 2CXJA 2L98A 1KK8B 2K7DA 1DJWA 1S6JA 2BBNA 3GOFA 4WRIA 1ZACA 2Q4UA 4N1GA 2LP2A 2NCPA 1DJYA 1UP5A 4N1FA 1F4QA 2K0JA 4PE4A 3WHTB 1SW8A 2LNKA 3HCMA 2NXQA 2VRGA 3ICBA 2AUCA 3NSLA 3ZWHA 2WOSA 1DF0A 1KQMC 2IS9A 1K90D 2LLTA 2HQWA 3VRPA 1GJYA 1K9PA 1F8HA 5JOLA 2G2BA 1DJIA 2BCXA 1ODBA 1UHIA 2MBXA 4YRUA 3JTDC 1SR6C 2OS8C 4QJ5B 1BLQA 1KFUL 1N0YA 1OZOA 1RK9A 1ZFSA 2K7OA 1Y0VH 3BYAA 2M3WA 2SCPA 4TNCA 4YI8A 5F6TA 3FWBA 4C0JA 1CFCA 2M1KB 1B4CA 1R6PA 2F3ZA 2FJUB 1N65A 3VGOA 2GV5A 2JRFA 2EC6B 1RTP1 1UHHA 1IQ5A 3CR2A 2MHHA 1JF2A 1MF8B 2F2OA 3BUNB 1F4OA 1Y1UA 3EK4A 1IWQA 1OE9B 4AOMA 5HKYA 1AVSA 1LVCD 1B47A 1QIWA 1S26D 1WDCC 2ZKMX 2PALA 5CSJA 2H2KA 3BQ3A 1B7TZ 3DVMA 5DKRA 1CM4A 2P6BB 4ORCB 4PHJA 5D7FA 1J7OA 4NDBA 4OR9B 4DRWA 3DD4A 2A4JA 1B8RA 2LCPA 5CSFA 3LK1A 1TRFA 1KFXL 1F71A 2E6WA 1B8CA 2JWWA 3VRRA 4MSPA 1BU3A 1SCVA 3DVKA 2KI4B 1U5IB 2EHBA 1IQ3A 1GGWA 1XO5A 2F33A 2LMTA 3BOWA 1IKUA 1AHRA 1EL4A 1MR8A 1QLSA 1PSRA 1NUBA 1F70A 1W7JB 1HQVA 1LKJA 2K2AA 4FQOA 1BODA 1WRLA 1YX7A 1PVBA 1NWDA 1ZMZA 2JPTA 3GK4X 1E8AA 3FIAA 3DF0B 1JFJA 3AAJA 4HSZA 3PATA 1YUUA 3EK7A 3KHEA 1S1EA 2BE6A 4GGFC 2GGMA 4OVNF 1CLBA 2OTGC 3AKBA 4PHMA 1FF1A 1NX1A 2V53A 4XJKA 2WCBA 3D10A 1H8BA 1CTRA 1LA3A 2H61C 2H61A 3LCPC 3EKJA 4AQIA 3M0WA 1M31A 1KWOC 1UUSA 4HRGA 2M7LA 2F8PA 1QATA 5AEQA 2ZNEA 3I5IB 2CT9A 1AJ4A 1YUSA 1M39A 2LHLA 1SCMC 2JOJA 5G08A 1QASA 3A4UB 1YVHA 2ZRSA 5I2OA 1WY9A 4MZLA 1QVIY 2DOQA 2FCDA 3CR5X 5AXIA 1FI5A 1K9KA 4CLNA 2JNXA 5AERA 4YI9A 1XYDA 4GAOA 2LV7A 2M29A 3PSRA 1SRAA 2BBMA 4CFQA 1L2OC 3KEVA 1BMOA 4I5JA 3TS5B 1YURA 1F55A 3PN7B 1K8UA 2WCEA 4E68A 1A2XA 4WQ3A 1SK6D 2CTNA 5I2QA 1QX5B 2JXCA 3NSIA 1CDMA 2RGIA 3KPXA 4CIDA 1J7RA 1TCOB 5KSZA 5KTYA 2PVBA 4PE1A 4CPVA 5ER4X 2M1UA 1YRUB 2JTZA 2KOTA 4I5LB 4PALA 3TDZA 1AJ5A 1H4BA 5FYXA 1M63B 5CSIA 5AFPA 2F2PA 1SL9A 1S5GZ 1V1GA 4M2QA 1KCYA 1CFPA 1YX8A 1TN4A 1NPQA 2L0PA 5HKZA 2HQ8A 1S6IA 5GQQC 2MA2A 2ZN8A 2KBIA 2PMYA 1NIWA 1NSHA 1SYMA 3DVJA 3JVTB 4R1EA 2BL0B 1PSBA 3AKAA 1SL7A 1FPWA 1TTXA 5HLVA 5D69A 4MEWA 1CMFA 1MWNA 2E30A 1F54A 1X02A 1CB1A 1UWOA 1DVIA 1S3PA 2HPSA 3K21A 1KQVA 1YUTA 3CZTX 2KAVA 3VROA 1BR4B 1TNPA 1EJ3A 3OB2B 2B1UA 1YVLA 3SG7A 1BJFA 2KI6C 3O78A 4YGCB 5ER5A 1CNPA 1DT7B 2PRUA 2KI4C 2BKHB 1BF5A 1SBJA 1HT9A 1QV1A 1LA0A 1UURA 2KGRA 1DF0B 4L9MA 1FI6A 1JFKA 1KQMB 3RLZA 1JC2A 2LVJA 3VRNA 1DTLA 2NCOA 4YGBB 2LVKA 2LANA 3EK8A 1QIVA 1J55A 2MLFC 2MJWB 1PRWA 2O5GA 1KSMA 1LINA 3TUYC 2COLB 1EXRA 1SR6B 2OS8B 3JTDB 3DF0A 2FCEA 1DGVA 4ZCUA 4AQJA 1WRKA 1JSAA 3GK2A 1BT6A 1M46A 1DJHA 1TIZA 3CS1A 2M97A 4JQ0D 1OZSA 1UHNA 2K2FA 4GBAA 3OP0A 4F0ZB 1RECA 2PSRA 3KF9A 3SG4A 1K95A 1SPYA 2CNPA 5IBWA 1G4YR 1N2DA 3F45A 4MLWA 3PLFB 4MN0A 1NCXA 1B9AA 3A8RA 3KO0A 2JT3A 1OMVA 5HYDA 1A75B 2Y4QA 1Y6WA 1XFZO 2ZFDA 2LVVA 4JWQA 1WDCB 2M49B 2MLEC 1QJTA 1Y1XA 2CBLA 2LHIA 2ZRTA 5B8IB 2QACA 2KDHA 3EVRA 2WCFA 2EGDA 3NSKA 1XFYO 1DJGA 4BY5A 3CGAA 3IQQA 3QRXA 2AAOA 1XFXO 2LLSA 1L7ZA 3H4SE 1J7PA 1XFVO 1RROA 1J7QA 4A4CA 1WLMA 1ZOTB 1KK8C 3PM8A 1K93D 4C0KA 4C0LA 2GGZA 3DVEA 2JNFA 2OPOA 3I5HB 3MSEB 3O6BA 3EVUA 2L5XB 1NX3A 3E3RA 4Q04A 1G33A 3I5GB 3SG5A 2KI6D 2LMVA 4WQ2A 1W7IB 1DJZA 3WNXB 4DS7A 4M2PA 1ALVA 1PVAA 2KFHA 3BUMB 1EG3A 1PK0D 4HRHA 1TOPA 4I5KA 4ZCVA 3BUOB 3PALA 3WHUB 5JJGA 2BKIB 1BR1B 4N5XA 1QVIZ 1WLZA 2R2IA 2M0RA 4ICBA 1KK7Y 3JVTC 1K96A 4HREE 1KFXS 5CSNA 1PULA 1ZUZA 2ZNDA 4PDZA 3IQOA 2BCBA 1NCYA 4CFRA 2L2EA 2WNDA 2HF5A 4QJ3B 4OCIA 4P5OE 2LM5A 1C07A 1XFUO 1MQ1A 3BUWB 1OMDA 1ALWA 1KWOB 1K2HA 3C1VA 3TZ1A 4MRYA 1DMOA 3TDIA 3I5FB 3D0YB 3SIAA 3TDUA 3FWCA 1SCMB 2EC6C 1RJVA 3EKHA 2M9GA 1R2UA 1TNXA 1IH0A 2MAZA 1QTXA 5K89A 4OKHA 1WRZA 1CFDA 2LMUA 3LK0A 2I94A 2MRDA 3OB1B 1QXPA 2F3YA 3HX4A 1A29A 2BCAA 2LAPA 3SIBA 1L2OB 2KGBC 2L4IA 2K61A 1NYAA 1OOJA 1MUXA 1Y1AA 3OX5A 1CFFA 2KYFA 3LL8B 1RWYA 2AMIA 1XK4C 1JWDA 1GGZA 1XK4A 3NSOA 2KAXA 1JUOA 1BG1A 1IJ6A 2JULA 1MHOA 4PCWA 4PE7A 3OHMB 3CR4X 1OQPA 2PASA 2L51A 1B8LA 2JQ6A 2QPTA 3BXKA 1RFJA 2K8MB 2SASA 4U8DA 1CMGA 5HLOA 1J1DA 1U5IA 2KHNA 5HKWA 2K7CA 4MZKA 2Q91A 5KU1A 1Q80A 1OMRA 3BUXB 3IF7A 1AUIB 3EVVA 1B7TY 3GK1A 4ETOA 1CKKA 4MRXA 5DKNA 1GQMA 1XA5A 3CLNA 4FTGA 1UHKA 1CDLA 1LXFC 2D8NA 2Y5IA 5J3XA 4MVFA 1KSOA 2LC5A 4GPLB 3WXAA 4M2OA 2JC2A 1A75A 2L50A 3AAKA 1EH2A 2LUXA 3PFVA 1JBAA 1TNQA 1C7VA 2HETA 4ORAB 3O2PA 1CLMA 1CDPA 1J1EA 1FW4A 2BE4A 2TN4A 4DCKA 1YRTB 2G9BA 2KQ6A 3SG6A 1BOCA 3LLEA 1QV0A 1CM1A 1QLKA 1AP4A 5TNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  1IRJ A;  3I5I C;  4PHK A;  1QS7 A;  2NLN A;  4NDD A;  2M7N A;  1V1F A;  5I8N A;  4D1E A;  1S6C A;  1KFU S;  2Y1N A;  2L4H A;  1NX0 A;  1A03 A;  3I5H C;  3SG3 A;  3VRQ A;  1EG4 A;  4I5N B;  1IJ5 A;  1AK8 A;  2JTT A;  3I5G C;  1NX2 A;  1SKT A;  1CDN A;  1UHJ A;  2K7B A;  1TNW A;  4OV2 A;  1DGU A;  2LLU A;  1CLL A;  3TS5 C;  3PN7 C;  2JU0 A;  1TCF A;  3O4Y A;  1XFW O;  4PHN A;  5DKQ A;  1SMG A;  2LUC A;  3TUY B;  4UPG A;  1VRK A;  2KBM A;  2KNE A;  2KFF A;  1XVJ A;  2I7A A;  4JPZ B;  4BY4 A;  4NQG A;  2JZI A;  1B1G A;  2KYC A;  1MXE A;  2WOR A;  4PE0 A;  1SL8 A;  4GGN A;  3SG2 A;  4GUK A;  2ZN9 A;  2FOT A;  2NZ0 A;  4GGF A;  1M45 A;  1A4P A;  1G8I A;  2ISD A;  1YR5 A;  4A4B A;  3BOW B;  2BEC A;  2CCM A;  2JT0 A;  1IG5 A;  3ZNI A;  4YBH B;  1S36 A;  4GFT A;  5PAL A;  5AAN A;  5CPV A;  4NDC A;  1QX2 A;  1K9U A;  1OSA A;  3NXA A;  5I2L A;  2WC8 A;  4GNK B;  3I5F C;  4QJ4 B;  1IGV A;  2I2R E;  3SJS A;  3D0Y A;  1MXL C;  1DJX A;  4DIR A;  2LP3 A;  4MBE A;  4DUQ A;  1SY9 A;  2M8U A;  4IL1 A;  4USL A;  2BL0 C;  2OTG B;  3CTN A;  4P2Y B;  4XJK B;  1PAL A;  1NP8 A;  2LVI A;  5BPJ A;  1K94 A;  2LE9 B;  4YGE B;  4XYN A;  2Y1M A;  4YGA A;  1SNL A;  2KAY A;  1QX7 A;  2I18 A;  3CWG A;  3FS7 A;  1YTZ C;  4YGD B;  2KSP A;  2KQY A;  1S5G Y;  3OX6 A;  2JT8 A;  2O60 A;  2JXL A;  4ORB B;  1D1O A;  2KFG A;  1C7W A;  1KK7 Z;  1NCZ A;  4MZJ A;  3RM1 A;  1JF0 A;  2CXJ A;  2L98 A;  1KK8 B;  2K7D A;  1DJW A;  1S6J A;  2BBN A;  3GOF A;  4WRI A;  1ZAC A;  2Q4U A;  4N1G A;  2LP2 A;  2NCP A;  1DJY A;  1UP5 A;  4N1F A;  1F4Q A;  2K0J A;  4PE4 A;  3WHT B;  1SW8 A;  2LNK A;  3HCM A;  2NXQ A;  2VRG A;  3ICB A;  2AUC A;  3NSL A;  3ZWH A;  2WOS A;  1DF0 A;  1KQM C;  2IS9 A;  1K90 D;  2LLT A;  2HQW A;  3VRP A;  1GJY A;  1K9P A;  1F8H A;  5JOL A;  2G2B A;  1DJI A;  2BCX A;  1ODB A;  1UHI A;  2MBX A;  4YRU A;  3JTD C;  1SR6 C;  2OS8 C;  4QJ5 B;  1BLQ A;  1KFU L;  1N0Y A;  1OZO A;  1RK9 A;  1ZFS A;  2K7O A;  1Y0V H;  3BYA A;  2M3W A;  2SCP A;  4TNC A;  4YI8 A;  5F6T A;  3FWB A;  4C0J A;  1CFC A;  2M1K B;  1B4C A;  1R6P A;  2F3Z A;  2FJU B;  1N65 A;  3VGO A;  2GV5 A;  2JRF A;  2EC6 B;  1RTP 1;  1UHH A;  1IQ5 A;  3CR2 A;  2MHH A;  1JF2 A;  1MF8 B;  2F2O A;  3BUN B;  1F4O A;  1Y1U A;  3EK4 A;  1IWQ A;  1OE9 B;  4AOM A;  5HKY A;  1AVS A;  1LVC D;  1B47 A;  1QIW A;  1S26 D;  1WDC C;  2ZKM X;  2PAL A;  5CSJ A;  2H2K A;  3BQ3 A;  1B7T Z;  3DVM A;  5DKR A;  1CM4 A;  2P6B B;  4ORC B;  4PHJ A;  5D7F A;  1J7O A;  4NDB A;  4OR9 B;  4DRW A;  3DD4 A;  2A4J A;  1B8R A;  2LCP A;  5CSF A;  3LK1 A;  1TRF A;  1KFX L;  1F71 A;  2E6W A;  1B8C A;  2JWW A;  3VRR A;  4MSP A;  1BU3 A;  1SCV A;  3DVK A;  2KI4 B;  1U5I B;  2EHB A;  1IQ3 A;  1GGW A;  1XO5 A;  2F33 A;  2LMT A;  3BOW A;  1IKU A;  1AHR A;  1EL4 A;  1MR8 A;  1QLS A;  1PSR A;  1NUB A;  1F70 A;  1W7J B;  1HQV A;  1LKJ A;  2K2A A;  4FQO A;  1BOD A;  1WRL A;  1YX7 A;  1PVB A;  1NWD A;  1ZMZ A;  2JPT A;  3GK4 X;  1E8A A;  3FIA A;  3DF0 B;  1JFJ A;  3AAJ A;  4HSZ A;  3PAT A;  1YUU A;  3EK7 A;  3KHE A;  1S1E A;  2BE6 A;  4GGF C;  2GGM A;  4OVN F;  1CLB A;  2OTG C;  3AKB A;  4PHM A;  1FF1 A;  1NX1 A;  2V53 A;  4XJK A;  2WCB A;  3D10 A;  1H8B A;  1CTR A;  1LA3 A;  2H61 C;  2H61 A;  3LCP C;  3EKJ A;  4AQI A;  3M0W A;  1M31 A;  1KWO C;  1UUS A;  4HRG A;  2M7L A;  2F8P A;  1QAT A;  5AEQ A;  2ZNE A;  3I5I B;  2CT9 A;  1AJ4 A;  1YUS A;  1M39 A;  2LHL A;  1SCM C;  2JOJ A;  5G08 A;  1QAS A;  3A4U B;  1YVH A;  2ZRS A;  5I2O A;  1WY9 A;  4MZL A;  1QVI Y;  2DOQ A;  2FCD A;  3CR5 X;  5AXI A;  1FI5 A;  1K9K A;  4CLN A;  2JNX A;  5AER A;  4YI9 A;  1XYD A;  4GAO A;  2LV7 A;  2M29 A;  3PSR A;  1SRA A;  2BBM A;  4CFQ A;  1L2O C;  3KEV A;  1BMO A;  4I5J A;  3TS5 B;  1YUR A;  1F55 A;  3PN7 B;  1K8U A;  2WCE A;  4E68 A;  1A2X A;  4WQ3 A;  1SK6 D;  2CTN A;  5I2Q A;  1QX5 B;  2JXC A;  3NSI A;  1CDM A;  2RGI A;  3KPX A;  4CID A;  1J7R A;  1TCO B;  5KSZ A;  5KTY A;  2PVB A;  4PE1 A;  4CPV A;  5ER4 X;  2M1U A;  1YRU B;  2JTZ A;  2KOT A;  4I5L B;  4PAL A;  3TDZ A;  1AJ5 A;  1H4B A;  5FYX A;  1M63 B;  5CSI A;  5AFP A;  2F2P A;  1SL9 A;  1S5G Z;  1V1G A;  4M2Q A;  1KCY A;  1CFP A;  1YX8 A;  1TN4 A;  1NPQ A;  2L0P A;  5HKZ A;  2HQ8 A;  1S6I A;  5GQQ C;  2MA2 A;  2ZN8 A;  2KBI A;  2PMY A;  1NIW A;  1NSH A;  1SYM A;  3DVJ A;  3JVT B;  4R1E A;  2BL0 B;  1PSB A;  3AKA A;  1SL7 A;  1FPW A;  1TTX A;  5HLV A;  5D69 A;  4MEW A;  1CMF A;  1MWN A;  2E30 A;  1F54 A;  1X02 A;  1CB1 A;  1UWO A;  1DVI A;  1S3P A;  2HPS A;  3K21 A;  1KQV A;  1YUT A;  3CZT X;  2KAV A;  3VRO A;  1BR4 B;  1TNP A;  1EJ3 A;  3OB2 B;  2B1U A;  1YVL A;  3SG7 A;  1BJF A;  2KI6 C;  3O78 A;  4YGC B;  5ER5 A;  1CNP A;  1DT7 B;  2PRU A;  2KI4 C;  2BKH B;  1BF5 A;  1SBJ A;  1HT9 A;  1QV1 A;  1LA0 A;  1UUR A;  2KGR A;  1DF0 B;  4L9M A;  1FI6 A;  1JFK A;  1KQM B;  3RLZ A;  1JC2 A;  2LVJ A;  3VRN A;  1DTL A;  2NCO A;  4YGB B;  2LVK A;  2LAN A;  3EK8 A;  1QIV A;  1J55 A;  2MLF C;  2MJW B;  1PRW A;  2O5G A;  1KSM A;  1LIN A;  3TUY C;  2COL B;  1EXR A;  1SR6 B;  2OS8 B;  3JTD B;  3DF0 A;  2FCE A;  1DGV A;  4ZCU A;  4AQJ A;  1WRK A;  1JSA A;  3GK2 A;  1BT6 A;  1M46 A;  1DJH A;  1TIZ A;  3CS1 A;  2M97 A;  4JQ0 D;  1OZS A;  1UHN A;  2K2F A;  4GBA A;  3OP0 A;  4F0Z B;  1REC A;  2PSR A;  3KF9 A;  3SG4 A;  1K95 A;  1SPY A;  2CNP A;  5IBW A;  1G4Y R;  1N2D A;  3F45 A;  4MLW A;  3PLF B;  4MN0 A;  1NCX A;  1B9A A;  3A8R A;  3KO0 A;  2JT3 A;  1OMV A;  5HYD A;  1A75 B;  2Y4Q A;  1Y6W A;  1XFZ O;  2ZFD A;  2LVV A;  4JWQ A;  1WDC B;  2M49 B;  2MLE C;  1QJT A;  1Y1X A;  2CBL A;  2LHI A;  2ZRT A;  5B8I B;  2QAC A;  2KDH A;  3EVR A;  2WCF A;  2EGD A;  3NSK A;  1XFY O;  1DJG A;  4BY5 A;  3CGA A;  3IQQ A;  3QRX A;  2AAO A;  1XFX O;  2LLS A;  1L7Z A;  3H4S E;  1J7P A;  1XFV O;  1RRO A;  1J7Q A;  4A4C A;  1WLM A;  1ZOT B;  1KK8 C;  3PM8 A;  1K93 D;  4C0K A;  4C0L A;  2GGZ A;  3DVE A;  2JNF A;  2OPO A;  3I5H B;  3MSE B;  3O6B A;  3EVU A;  2L5X B;  1NX3 A;  3E3R A;  4Q04 A;  1G33 A;  3I5G B;  3SG5 A;  2KI6 D;  2LMV A;  4WQ2 A;  1W7I B;  1DJZ A;  3WNX B;  4DS7 A;  4M2P A;  1ALV A;  1PVA A;  2KFH A;  3BUM B;  1EG3 A;  1PK0 D;  4HRH A;  1TOP A;  4I5K A;  4ZCV A;  3BUO B;  3PAL A;  3WHU B;  5JJG A;  2BKI B;  1BR1 B;  4N5X A;  1QVI Z;  1WLZ A;  2R2I A;  2M0R A;  4ICB A;  1KK7 Y;  3JVT C;  1K96 A;  4HRE E;  1KFX S;  5CSN A;  1PUL A;  1ZUZ A;  2ZND A;  4PDZ A;  3IQO A;  2BCB A;  1NCY A;  4CFR A;  2L2E A;  2WND A;  2HF5 A;  4QJ3 B;  4OCI A;  4P5O E;  2LM5 A;  1C07 A;  1XFU O;  1MQ1 A;  3BUW B;  1OMD A;  1ALW A;  1KWO B;  1K2H A;  3C1V A;  3TZ1 A;  4MRY A;  1DMO A;  3TDI A;  3I5F B;  3D0Y B;  3SIA A;  3TDU A;  3FWC A;  1SCM B;  2EC6 C;  1RJV A;  3EKH A;  2M9G A;  1R2U A;  1TNX A;  1IH0 A;  2MAZ A;  1QTX A;  5K89 A;  4OKH A;  1WRZ A;  1CFD A;  2LMU A;  3LK0 A;  2I94 A;  2MRD A;  3OB1 B;  1QXP A;  2F3Y A;  3HX4 A;  1A29 A;  2BCA A;  2LAP A;  3SIB A;  1L2O B;  2KGB C;  2L4I A;  2K61 A;  1NYA A;  1OOJ A;  1MUX A;  1Y1A A;  3OX5 A;  1CFF A;  2KYF A;  3LL8 B;  1RWY A;  2AMI A;  1XK4 C;  1JWD A;  1GGZ A;  1XK4 A;  3NSO A;  2KAX A;  1JUO A;  1BG1 A;  1IJ6 A;  2JUL A;  1MHO A;  4PCW A;  4PE7 A;  3OHM B;  3CR4 X;  1OQP A;  2PAS A;  2L51 A;  1B8L A;  2JQ6 A;  2QPT A;  3BXK A;  1RFJ A;  2K8M B;  2SAS A;  4U8D A;  1CMG A;  5HLO A;  1J1D A;  1U5I A;  2KHN A;  5HKW A;  2K7C A;  4MZK A;  2Q91 A;  5KU1 A;  1Q80 A;  1OMR A;  3BUX B;  3IF7 A;  1AUI B;  3EVV A;  1B7T Y;  3GK1 A;  4ETO A;  1CKK A;  4MRX A;  5DKN A;  1GQM A;  1XA5 A;  3CLN A;  4FTG A;  1UHK A;  1CDL A;  1LXF C;  2D8N A;  2Y5I A;  5J3X A;  4MVF A;  1KSO A;  2LC5 A;  4GPL B;  3WXA A;  4M2O A;  2JC2 A;  1A75 A;  2L50 A;  3AAK A;  1EH2 A;  2LUX A;  3PFV A;  1JBA A;  1TNQ A;  1C7V A;  2HET A;  4ORA B;  3O2P A;  1CLM A;  1CDP A;  1J1E A;  1FW4 A;  2BE4 A;  2TN4 A;  4DCK A;  1YRT B;  2G9B A;  2KQ6 A;  3SG6 A;  1BOC A;  3LLE A;  1QV0 A;  1CM1 A;  1QLK A;  1AP4 A;  5TNC A; 
#chains in the Genus database with same CATH topology
 1FBV A;  1IRJ A;  3I5I C;  4PHK A;  3S0E A;  1QS7 A;  2NLN A;  4NDD A;  2M7N A;  1V1F A;  5I8N A;  1OOI X;  4D1E A;  1S6C A;  1KFU S;  2Y1N A;  1Z4H A;  1NX0 A;  2L4H A;  1A03 A;  1OOF A;  1DC1 A;  3I5H C;  3SG3 A;  3VRQ A;  1EG4 A;  4I5N B;  1IJ5 A;  2QEB A;  2JTT A;  3FE9 A;  3I5G C;  1AK8 A;  3O4X A;  1NX2 A;  1SKT A;  1CDN A;  1UHJ A;  2K7B A;  1TNW A;  4OV2 A;  3SS5 A;  1DGU A;  2LLU A;  1CLL A;  3TS5 C;  3PN7 C;  2JU0 A;  1TCF A;  3O4Y A;  1XFW O;  4PHN A;  5DKQ A;  1SMG A;  2LUC A;  3TUY B;  4UPG A;  1VRK A;  2KBM A;  2KNE A;  2KFF A;  1XVJ A;  2I7A A;  4JPZ B;  4BY4 A;  4NQG A;  2JZI A;  1B1G A;  2KYC A;  1MXE A;  2WOR A;  3D75 A;  4PE0 A;  3S0F A;  1SL8 A;  3D73 A;  4GGN A;  4KYN A;  3SG2 A;  4GUK A;  2ZN9 A;  2FOT A;  2NZ0 A;  4GGF A;  1M45 A;  1A4P A;  1G8I A;  2ISD A;  1YR5 A;  2ERB A;  3BOW B;  2BEC A;  2CCM A;  2JT0 A;  3S0G A;  4A4B A;  1IG5 A;  3ZNI A;  4YBH B;  1S36 A;  4GFT A;  5PAL A;  5AAN A;  5CPV A;  4NDC A;  1QX2 A;  1K9U A;  1OSA A;  3CZ0 A;  3NXA A;  3R1P A;  5I2L A;  2WC8 A;  4GNK B;  3I5F C;  4QJ4 B;  1IGV A;  2I2R E;  3SJS A;  3D0Y A;  2BNX A;  2P71 A;  1Z2C B;  1MXL C;  3NHI A;  3EG5 B;  1DJX A;  4DIR A;  1TWO A;  2LP3 A;  3BFH A;  4MBE A;  1SY9 A;  4DUQ A;  2M8U A;  4IL1 A;  4USL A;  2BL0 C;  2OTG B;  3CTN A;  4P2Y B;  4XJK B;  1PAL A;  1NP8 A;  2LVI A;  2WC5 A;  1K94 A;  5BPJ A;  2LE9 B;  4YGE B;  4XYN A;  2Y1M A;  4YGA A;  1SNL A;  2KAY A;  1QX7 A;  2I18 A;  3S0B A;  3CWG A;  3FS7 A;  1YTZ C;  4YGD B;  3BFA A;  2KSP A;  2KQY A;  1S5G Y;  3OX6 A;  2JT8 A;  2O60 A;  2JXL A;  4ORB B;  1D1O A;  2KFG A;  1C7W A;  1KK7 Z;  1NCZ A;  4MZJ A;  3RM1 A;  1JF0 A;  2CXJ A;  2L98 A;  1KK8 B;  2K7D A;  2WCH A;  1DJW A;  1S6J A;  2BBN A;  3GOF A;  4WRI A;  1ZAC A;  2Q4U A;  4N1G A;  2LP2 A;  2NCP A;  1DJY A;  1UP5 A;  4N1F A;  2PQL A;  1F4Q A;  2K0J A;  4PE4 A;  3WHT B;  1SW8 A;  2LNK A;  3HCM A;  4FQT A;  2NXQ A;  2VRG A;  3ICB A;  2AUC A;  3NSL A;  3ZWH A;  2WOS A;  1DF0 A;  1KQM C;  2IS9 A;  1K90 D;  2LLT A;  3CDN A;  2HQW A;  3VRP A;  1GJY A;  3DY9 A;  1K9P A;  4INX A;  1F8H A;  5JOL A;  2G2B A;  1DJI A;  3K1E A;  2BCX A;  1ODB A;  1UHI A;  2MBX A;  4YRU A;  3L4A A;  3JTD C;  1SR6 C;  2OS8 C;  3UO9 A;  4QJ5 B;  1ZFS A;  1KFU L;  1N0Y A;  1OZO A;  1RK9 A;  2K7O A;  1Y0V H;  3BYA A;  2M3W A;  2SCP A;  4TNC A;  4YI8 A;  5F6T A;  3FWB A;  4C0J A;  2FJY A;  1CFC A;  2M1K B;  1B4C A;  1R6P A;  2F3Z A;  3D78 A;  2FJU B;  1N65 A;  3VGO A;  2GV5 A;  2JRF A;  2EC6 B;  1RTP 1;  3OBV A;  1UHH A;  1IQ5 A;  1BLQ A;  3CR2 A;  2MHH A;  5HL1 A;  1JF2 A;  1MF8 B;  2BAP A;  2F2O A;  3BUN B;  1F4O A;  1Y1U A;  4INW A;  1SSE B;  1OOG A;  3EK4 A;  1IWQ A;  1OE9 B;  4AOM A;  5HKY A;  1AVS A;  3R1O A;  1LVC D;  1B47 A;  1QIW A;  1S26 D;  1WDC C;  2ZKM X;  2PAL A;  5CSJ A;  2H2K A;  3BQ3 A;  1B7T Z;  3DVM A;  5DKR A;  1CM4 A;  2P6B B;  4ORC B;  4PHJ A;  5D7F A;  5DIC A;  1J7O A;  4NDB A;  4OR9 B;  4DRW A;  3DD4 A;  2A4J A;  1B8R A;  2LCP A;  5CSF A;  3LK1 A;  1GM0 A;  1TRF A;  1KFX L;  1OOH A;  1F71 A;  2E6W A;  2P70 A;  1B8C A;  2JWW A;  3VRR A;  4MSP A;  1BU3 A;  1SCV A;  2QDI A;  3DVK A;  2KI4 B;  1U5I B;  2EHB A;  1IQ3 A;  1GGW A;  5FI2 A;  1XO5 A;  2F33 A;  2LMT A;  3BOW A;  1IKU A;  1AHR A;  1DQE A;  1EL4 A;  1MR8 A;  1QLS A;  1PSR A;  3L4L A;  1NUB A;  1F70 A;  1W7J B;  1HQV A;  1LKJ A;  2K2A A;  4FQO A;  1BOD A;  3VB1 A;  1WRL A;  1YX7 A;  1PVB A;  1NWD A;  1ZMZ A;  2JPT A;  3GK4 X;  1E8A A;  3FIA A;  3DF0 B;  1JFJ A;  3AAJ A;  4HSZ A;  2PYQ A;  3PAT A;  1YUU A;  3EK7 A;  3KHE A;  1S1E A;  2BE6 A;  4GGF C;  2GGM A;  4OVN F;  1CLB A;  2OTG C;  3AKB A;  4PHM A;  1FF1 A;  1NX1 A;  2V53 A;  4XJK A;  3CZ1 A;  2WCB A;  3D10 A;  1W9Z A;  3S0A A;  1H8B A;  1CTR A;  1LA3 A;  2H61 C;  2H61 A;  3LCP C;  3EKJ A;  4AQI A;  3M0W A;  1M31 A;  1KWO C;  5FI7 A;  1UUS A;  4HRG A;  2WC6 A;  2M7L A;  2F8P A;  1QAT A;  5AEQ A;  2ZNE A;  3I5I B;  2CT9 A;  1AJ4 A;  1YUS A;  1M39 A;  2LHL A;  1SCM C;  2JOJ A;  5G08 A;  3UNW A;  1QAS A;  3A4U B;  1YVH A;  2ZRS A;  5I2O A;  1WY9 A;  4MZL A;  1QVI Y;  2DOQ A;  2FCD A;  3CR5 X;  3FE6 A;  5AXI A;  1FI5 A;  2L2C A;  3IVT A;  1K9K A;  4CLN A;  2JNX A;  5AER A;  4YI9 A;  1XYD A;  3SS4 A;  3OGN A;  4GAO A;  2LV7 A;  2M29 A;  3PSR A;  1SRA A;  2BBM A;  4CFQ A;  1L2O C;  3KEV A;  1BMO A;  4I5J A;  3TS5 B;  1YUR A;  2QEH A;  1F55 A;  3PN7 B;  1K8U A;  2WCE A;  4E68 A;  1A2X A;  4WQ3 A;  1SK6 D;  2CTN A;  4OZD A;  5I2Q A;  1QX5 B;  2JXC A;  3NSI A;  1CDM A;  2RGI A;  3KPX A;  4CID A;  1J7R A;  1TCO B;  5KSZ A;  5KTY A;  2PVB A;  4PE1 A;  4CPV A;  5ER4 X;  4F7F A;  2M1U A;  1YRU B;  2JTZ A;  2KOT A;  4I5L B;  4PAL A;  3TDZ A;  1AJ5 A;  1H4B A;  5FYX A;  1M63 B;  5CSI A;  5AFP A;  1T14 A;  2F2P A;  1SL9 A;  1S5G Z;  1V1G A;  4M2Q A;  1KCY A;  3R72 A;  1CFP A;  1YX8 A;  1TN4 A;  3SS3 A;  1NPQ A;  2L0P A;  5HKZ A;  2HQ8 A;  1S6I A;  5GQQ C;  2MA2 A;  2ZN8 A;  2KBI A;  2PMY A;  1NIW A;  3DYE A;  1NSH A;  3BJH A;  1SYM A;  3DVJ A;  3JVT B;  4R1E A;  2GTE A;  2BL0 B;  1PSB A;  3AKA A;  1SL7 A;  1FPW A;  1TTX A;  5HLV A;  5D69 A;  4MEW A;  1CMF A;  1MWN A;  3DXL A;  2E30 A;  3Q8I A;  1F54 A;  1X02 A;  1CB1 A;  1UWO A;  1DVI A;  1S3P A;  2HPS A;  3K21 A;  1KQV A;  1YUT A;  3CZT X;  2KAV A;  3VRO A;  1BR4 B;  1TNP A;  1EJ3 A;  5I94 A;  3OB2 B;  2KLE A;  2B1U A;  1YVL A;  3SG7 A;  1BJF A;  2KI6 C;  3O78 A;  4YGC B;  5ER5 A;  1CNP A;  1DT7 B;  2PRU A;  2KI4 C;  2BKH B;  1BF5 A;  1SBJ A;  1HT9 A;  1QV1 A;  1LA0 A;  1UUR A;  2KGR A;  1DF0 B;  4L9M A;  1FI6 A;  1JFK A;  1KQM B;  3RLZ A;  1JC2 A;  3PJI A;  2LVJ A;  3VRN A;  1DTL A;  2NCO A;  4YGB B;  2LVK A;  2LAN A;  3EK8 A;  1QIV A;  1J55 A;  2MLF C;  2MJW B;  1PRW A;  2O5G A;  1KSM A;  1LIN A;  3TUY C;  3B6X A;  2COL B;  1EXR A;  1SR6 B;  2OS8 B;  3JTD B;  3DZT A;  3DF0 A;  2FCE A;  1DGV A;  4ZCU A;  4AQJ A;  1WRK A;  1JSA A;  3GK2 A;  1BT6 A;  1M46 A;  1DJH A;  1TIZ A;  2KPH A;  3CS1 A;  2M97 A;  4JQ0 D;  1OZS A;  1UHN A;  2K2F A;  4GBA A;  3OP0 A;  4F0Z B;  1REC A;  2PSR A;  3D74 A;  3KF9 A;  3SG4 A;  1K95 A;  1SPY A;  2CNP A;  5IBW A;  1G4Y R;  1N2D A;  3F45 A;  4MLW A;  3PLF B;  4MN0 A;  1NCX A;  1B9A A;  3A8R A;  3KO0 A;  2JT3 A;  1OMV A;  5HYD A;  1A75 B;  2Y4Q A;  1IIO A;  1Y6W A;  1XFZ O;  2ZFD A;  2LVV A;  4JWQ A;  1WDC B;  2M49 B;  2MLE C;  1QJT A;  1Y1X A;  1DEK A;  2CBL A;  2LHI A;  2ZRT A;  5B8I B;  2QAC A;  2KDH A;  3EVR A;  2WCF A;  3D77 A;  5EL2 A;  1QWV A;  1OW4 A;  2EGD A;  1XFY O;  3NSK A;  1DJG A;  4BY5 A;  3CGA A;  3IQQ A;  3QRX A;  2AAO A;  1XFX O;  2LLS A;  1L7Z A;  3H4S E;  1J7P A;  1XFV O;  3BFB A;  1RRO A;  1J7Q A;  4A4C A;  1WLM A;  1ZOT B;  1KK8 C;  2KLD A;  3B86 A;  1K93 D;  3D76 A;  3PM8 A;  4IJ7 A;  4C0K A;  2GGZ A;  4C0L A;  3DVE A;  3R1V A;  2JNF A;  2OPO A;  3B7A A;  3I5H B;  3MSE B;  3EVU A;  3O6B A;  2L5X B;  1NX3 A;  3E3R A;  4Q04 A;  1G33 A;  3I5G B;  2K60 A;  3SG5 A;  2KI6 D;  2LMV A;  4WQ2 A;  1W7I B;  1DJZ A;  3WNX B;  1LS8 A;  3CAB A;  4DS7 A;  4M2P A;  1ALV A;  1PVA A;  2KFH A;  4JD9 A;  3BUM B;  1EG3 A;  1PK0 D;  4HRH A;  1TOP A;  4I5K A;  4ZCV A;  3BUO B;  3PAL A;  3WHU B;  5JJG A;  3B88 A;  2BKI B;  1BR1 B;  4N5X A;  1P28 A;  2L5Y A;  1QVI Z;  1WLZ A;  2R2I A;  2M0R A;  2WCJ A;  1KK7 Y;  3B87 A;  4ICB A;  3JVT C;  1K96 A;  4HRE E;  5FI6 A;  1KFX S;  5CSN A;  1PUL A;  1ZUZ A;  2ZND A;  4PDZ A;  2QEO A;  3IQO A;  2BCB A;  1NCY A;  4JKT A;  4CFR A;  2L2E A;  2WND A;  2HF5 A;  4QJ3 B;  4OCI A;  4P5O E;  2LM5 A;  1C07 A;  2QEV A;  1XFU O;  1MQ1 A;  3BUW B;  1OMD A;  1ALW A;  1KWO B;  1TUJ A;  1K2H A;  3C1V A;  3TZ1 A;  4MRY A;  1DMO A;  3TDI A;  3I5F B;  3D0Y B;  4PT1 A;  3SIA A;  3TDU A;  3CZ2 A;  3FWC A;  1SCM B;  2EC6 C;  1RJV A;  3EKH A;  2M9G A;  1R2U A;  1C3Z A;  1TNX A;  1IH0 A;  2MAZ A;  2JPO A;  1QTX A;  5K89 A;  4OKH A;  1WRZ A;  1CFD A;  2LMU A;  3CYZ A;  3LK0 A;  3S0D A;  2I94 A;  2MRD A;  3OB1 B;  1QXP A;  2F3Y A;  3HX4 A;  1A29 A;  2BCA A;  2LAP A;  3SIB A;  1L2O B;  2KGB C;  2L4I A;  2K61 A;  1NYA A;  1OOJ A;  1MUX A;  1Y1A A;  3OX5 A;  1CFF A;  2KYF A;  3LL8 B;  1RWY A;  2AMI A;  1XK4 C;  1C3Y A;  1GGZ A;  3FE8 A;  1JWD A;  1XK4 A;  3NSO A;  3L47 A;  2KAX A;  1JUO A;  3N7H A;  1BG1 A;  1IJ6 A;  2JUL A;  1MHO A;  4PCW A;  4PE7 A;  3OHM B;  3CR4 X;  1OQP A;  2PAS A;  2L51 A;  1B8L A;  2JQ6 A;  2QPT A;  3BXK A;  1RFJ A;  2K8M B;  5D3O A;  2SAS A;  2WCM A;  4U8D A;  1CMG A;  5HLO A;  1J1D A;  1ORG A;  2H8V A;  1U5I A;  2KHN A;  5HKW A;  2K7C A;  4MZK A;  2Q91 A;  5KU1 A;  1Q80 A;  1OMR A;  1DEL A;  3BUX B;  2WCK A;  3IF7 A;  1AUI B;  3EVV A;  1B7T Y;  3GK1 A;  3QME A;  4ETO A;  1CKK A;  4MRX A;  5DKN A;  1GQM A;  1XA5 A;  3CLN A;  3RZS A;  4FTG A;  1UHK A;  1CDL A;  1LXF C;  1XFR A;  2D8N A;  3PM2 A;  2YGU A;  2Y5I A;  5J3X A;  4MVF A;  1KSO A;  2LC5 A;  4GPL B;  3WXA A;  4M2O A;  2JC2 A;  1A75 A;  2L50 A;  2WCL A;  3AAK A;  1EH2 A;  2LUX A;  3PFV A;  1JBA A;  1TNQ A;  1C7V A;  1TUZ A;  2HET A;  3NGV A;  4ORA B;  3O2P A;  1CLM A;  1CDP A;  1J1E A;  1FW4 A;  2BE4 A;  2TN4 A;  4DCK A;  1YRT B;  2G9B A;  2KQ6 A;  3NHT A;  3SG6 A;  1BOC A;  3LLE A;  3V2L A;  1QV0 A;  1CM1 A;  1QLK A;  1AP4 A;  5TNC A; 
#chains in the Genus database with same CATH homology
 1FBV A;  1IRJ A;  3I5I C;  4PHK A;  1QS7 A;  2NLN A;  4NDD A;  2M7N A;  1V1F A;  5I8N A;  4D1E A;  1S6C A;  1KFU S;  2Y1N A;  2L4H A;  1NX0 A;  1A03 A;  3I5H C;  3SG3 A;  3VRQ A;  1EG4 A;  4I5N B;  1IJ5 A;  1AK8 A;  2JTT A;  3I5G C;  1NX2 A;  1SKT A;  1CDN A;  1UHJ A;  2K7B A;  1TNW A;  4OV2 A;  1DGU A;  2LLU A;  1CLL A;  3TS5 C;  3PN7 C;  2JU0 A;  1TCF A;  3O4Y A;  1XFW O;  4PHN A;  5DKQ A;  1SMG A;  2LUC A;  3TUY B;  4UPG A;  1VRK A;  2KBM A;  2KNE A;  2KFF A;  1XVJ A;  2I7A A;  4JPZ B;  4BY4 A;  4NQG A;  2JZI A;  1B1G A;  2KYC A;  1MXE A;  2WOR A;  4PE0 A;  1SL8 A;  4GGN A;  3SG2 A;  4GUK A;  2ZN9 A;  2FOT A;  2NZ0 A;  4GGF A;  1M45 A;  1A4P A;  1G8I A;  2ISD A;  1YR5 A;  4A4B A;  3BOW B;  2BEC A;  2CCM A;  2JT0 A;  1IG5 A;  3ZNI A;  4YBH B;  1S36 A;  4GFT A;  5PAL A;  5AAN A;  5CPV A;  4NDC A;  1QX2 A;  1K9U A;  1OSA A;  3NXA A;  5I2L A;  2WC8 A;  4GNK B;  3I5F C;  4QJ4 B;  1IGV A;  2I2R E;  3SJS A;  3D0Y A;  1MXL C;  1DJX A;  4DIR A;  2LP3 A;  4MBE A;  4DUQ A;  1SY9 A;  2M8U A;  4IL1 A;  4USL A;  2BL0 C;  2OTG B;  3CTN A;  4P2Y B;  4XJK B;  1PAL A;  1NP8 A;  2LVI A;  5BPJ A;  1K94 A;  2LE9 B;  4YGE B;  4XYN A;  2Y1M A;  4YGA A;  1SNL A;  2KAY A;  1QX7 A;  2I18 A;  3CWG A;  3FS7 A;  1YTZ C;  4YGD B;  2KSP A;  2KQY A;  1S5G Y;  3OX6 A;  2JT8 A;  2O60 A;  2JXL A;  4ORB B;  1D1O A;  2KFG A;  1C7W A;  1KK7 Z;  1NCZ A;  4MZJ A;  3RM1 A;  1JF0 A;  2CXJ A;  2L98 A;  1KK8 B;  2K7D A;  1DJW A;  1S6J A;  2BBN A;  3GOF A;  4WRI A;  1ZAC A;  2Q4U A;  4N1G A;  2LP2 A;  2NCP A;  1DJY A;  1UP5 A;  4N1F A;  1F4Q A;  2K0J A;  4PE4 A;  3WHT B;  1SW8 A;  2LNK A;  3HCM A;  2NXQ A;  2VRG A;  3ICB A;  2AUC A;  3NSL A;  3ZWH A;  2WOS A;  1DF0 A;  1KQM C;  2IS9 A;  1K90 D;  2LLT A;  2HQW A;  3VRP A;  1GJY A;  1K9P A;  1F8H A;  5JOL A;  2G2B A;  1DJI A;  2BCX A;  1ODB A;  1UHI A;  2MBX A;  4YRU A;  3JTD C;  1SR6 C;  2OS8 C;  4QJ5 B;  1BLQ A;  1KFU L;  1N0Y A;  1OZO A;  1RK9 A;  1ZFS A;  2K7O A;  1Y0V H;  3BYA A;  2M3W A;  2SCP A;  4TNC A;  4YI8 A;  5F6T A;  3FWB A;  4C0J A;  1CFC A;  2M1K B;  1B4C A;  1R6P A;  2F3Z A;  2FJU B;  1N65 A;  3VGO A;  2GV5 A;  2JRF A;  2EC6 B;  1RTP 1;  1UHH A;  1IQ5 A;  3CR2 A;  2MHH A;  1JF2 A;  1MF8 B;  2F2O A;  3BUN B;  1F4O A;  1Y1U A;  3EK4 A;  1IWQ A;  1OE9 B;  4AOM A;  5HKY A;  1AVS A;  1LVC D;  1B47 A;  1QIW A;  1S26 D;  1WDC C;  2ZKM X;  2PAL A;  5CSJ A;  2H2K A;  3BQ3 A;  1B7T Z;  3DVM A;  5DKR A;  1CM4 A;  2P6B B;  4ORC B;  4PHJ A;  5D7F A;  1J7O A;  4NDB A;  4OR9 B;  4DRW A;  3DD4 A;  2A4J A;  1B8R A;  2LCP A;  5CSF A;  3LK1 A;  1TRF A;  1KFX L;  1F71 A;  2E6W A;  1B8C A;  2JWW A;  3VRR A;  4MSP A;  1BU3 A;  1SCV A;  3DVK A;  2KI4 B;  1U5I B;  2EHB A;  1IQ3 A;  1GGW A;  1XO5 A;  2F33 A;  2LMT A;  3BOW A;  1IKU A;  1AHR A;  1EL4 A;  1MR8 A;  1QLS A;  1PSR A;  1NUB A;  1F70 A;  1W7J B;  1HQV A;  1LKJ A;  2K2A A;  4FQO A;  1BOD A;  1WRL A;  1YX7 A;  1PVB A;  1NWD A;  1ZMZ A;  2JPT A;  3GK4 X;  1E8A A;  3FIA A;  3DF0 B;  1JFJ A;  3AAJ A;  4HSZ A;  3PAT A;  1YUU A;  3EK7 A;  3KHE A;  1S1E A;  2BE6 A;  4GGF C;  2GGM A;  4OVN F;  1CLB A;  2OTG C;  3AKB A;  4PHM A;  1FF1 A;  1NX1 A;  2V53 A;  4XJK A;  2WCB A;  3D10 A;  1H8B A;  1CTR A;  1LA3 A;  2H61 C;  2H61 A;  3LCP C;  3EKJ A;  4AQI A;  3M0W A;  1M31 A;  1KWO C;  1UUS A;  4HRG A;  2M7L A;  2F8P A;  1QAT A;  5AEQ A;  2ZNE A;  3I5I B;  2CT9 A;  1AJ4 A;  1YUS A;  1M39 A;  2LHL A;  1SCM C;  2JOJ A;  5G08 A;  1QAS A;  3A4U B;  1YVH A;  2ZRS A;  5I2O A;  1WY9 A;  4MZL A;  1QVI Y;  2DOQ A;  2FCD A;  3CR5 X;  5AXI A;  1FI5 A;  1K9K A;  4CLN A;  2JNX A;  5AER A;  4YI9 A;  1XYD A;  4GAO A;  2LV7 A;  2M29 A;  3PSR A;  1SRA A;  2BBM A;  4CFQ A;  1L2O C;  3KEV A;  1BMO A;  4I5J A;  3TS5 B;  1YUR A;  1F55 A;  3PN7 B;  1K8U A;  2WCE A;  4E68 A;  1A2X A;  4WQ3 A;  1SK6 D;  2CTN A;  5I2Q A;  1QX5 B;  2JXC A;  3NSI A;  1CDM A;  2RGI A;  3KPX A;  4CID A;  1J7R A;  1TCO B;  5KSZ A;  5KTY A;  2PVB A;  4PE1 A;  4CPV A;  5ER4 X;  2M1U A;  1YRU B;  2JTZ A;  2KOT A;  4I5L B;  4PAL A;  3TDZ A;  1AJ5 A;  1H4B A;  5FYX A;  1M63 B;  5CSI A;  5AFP A;  2F2P A;  1SL9 A;  1S5G Z;  1V1G A;  4M2Q A;  1KCY A;  1CFP A;  1YX8 A;  1TN4 A;  1NPQ A;  2L0P A;  5HKZ A;  2HQ8 A;  1S6I A;  5GQQ C;  2MA2 A;  2ZN8 A;  2KBI A;  2PMY A;  1NIW A;  1NSH A;  1SYM A;  3DVJ A;  3JVT B;  4R1E A;  2BL0 B;  1PSB A;  3AKA A;  1SL7 A;  1FPW A;  1TTX A;  5HLV A;  5D69 A;  4MEW A;  1CMF A;  1MWN A;  2E30 A;  1F54 A;  1X02 A;  1CB1 A;  1UWO A;  1DVI A;  1S3P A;  2HPS A;  3K21 A;  1KQV A;  1YUT A;  3CZT X;  2KAV A;  3VRO A;  1BR4 B;  1TNP A;  1EJ3 A;  3OB2 B;  2B1U A;  1YVL A;  3SG7 A;  1BJF A;  2KI6 C;  3O78 A;  4YGC B;  5ER5 A;  1CNP A;  1DT7 B;  2PRU A;  2KI4 C;  2BKH B;  1BF5 A;  1SBJ A;  1HT9 A;  1QV1 A;  1LA0 A;  1UUR A;  2KGR A;  1DF0 B;  4L9M A;  1FI6 A;  1JFK A;  1KQM B;  3RLZ A;  1JC2 A;  2LVJ A;  3VRN A;  1DTL A;  2NCO A;  4YGB B;  2LVK A;  2LAN A;  3EK8 A;  1QIV A;  1J55 A;  2MLF C;  2MJW B;  1PRW A;  2O5G A;  1KSM A;  1LIN A;  3TUY C;  2COL B;  1EXR A;  1SR6 B;  2OS8 B;  3JTD B;  3DF0 A;  2FCE A;  1DGV A;  4ZCU A;  4AQJ A;  1WRK A;  1JSA A;  3GK2 A;  1BT6 A;  1M46 A;  1DJH A;  1TIZ A;  3CS1 A;  2M97 A;  4JQ0 D;  1OZS A;  1UHN A;  2K2F A;  4GBA A;  3OP0 A;  4F0Z B;  1REC A;  2PSR A;  3KF9 A;  3SG4 A;  1K95 A;  1SPY A;  2CNP A;  5IBW A;  1G4Y R;  1N2D A;  3F45 A;  4MLW A;  3PLF B;  4MN0 A;  1NCX A;  1B9A A;  3A8R A;  3KO0 A;  2JT3 A;  1OMV A;  5HYD A;  1A75 B;  2Y4Q A;  1Y6W A;  1XFZ O;  2ZFD A;  2LVV A;  4JWQ A;  1WDC B;  2M49 B;  2MLE C;  1QJT A;  1Y1X A;  2CBL A;  2LHI A;  2ZRT A;  5B8I B;  2QAC A;  2KDH A;  3EVR A;  2WCF A;  2EGD A;  3NSK A;  1XFY O;  1DJG A;  4BY5 A;  3CGA A;  3IQQ A;  3QRX A;  2AAO A;  1XFX O;  2LLS A;  1L7Z A;  3H4S E;  1J7P A;  1XFV O;  1RRO A;  1J7Q A;  4A4C A;  1WLM A;  1ZOT B;  1KK8 C;  3PM8 A;  1K93 D;  4C0K A;  4C0L A;  2GGZ A;  3DVE A;  2JNF A;  2OPO A;  3I5H B;  3MSE B;  3O6B A;  3EVU A;  2L5X B;  1NX3 A;  3E3R A;  4Q04 A;  1G33 A;  3I5G B;  3SG5 A;  2KI6 D;  2LMV A;  4WQ2 A;  1W7I B;  1DJZ A;  3WNX B;  4DS7 A;  4M2P A;  1ALV A;  1PVA A;  2KFH A;  3BUM B;  1EG3 A;  1PK0 D;  4HRH A;  1TOP A;  4I5K A;  4ZCV A;  3BUO B;  3PAL A;  3WHU B;  5JJG A;  2BKI B;  1BR1 B;  4N5X A;  1QVI Z;  1WLZ A;  2R2I A;  2M0R A;  4ICB A;  1KK7 Y;  3JVT C;  1K96 A;  4HRE E;  1KFX S;  5CSN A;  1PUL A;  1ZUZ A;  2ZND A;  4PDZ A;  3IQO A;  2BCB A;  1NCY A;  4CFR A;  2L2E A;  2WND A;  2HF5 A;  4QJ3 B;  4OCI A;  4P5O E;  2LM5 A;  1C07 A;  1XFU O;  1MQ1 A;  3BUW B;  1OMD A;  1ALW A;  1KWO B;  1K2H A;  3C1V A;  3TZ1 A;  4MRY A;  1DMO A;  3TDI A;  3I5F B;  3D0Y B;  3SIA A;  3TDU A;  3FWC A;  1SCM B;  2EC6 C;  1RJV A;  3EKH A;  2M9G A;  1R2U A;  1TNX A;  1IH0 A;  2MAZ A;  1QTX A;  5K89 A;  4OKH A;  1WRZ A;  1CFD A;  2LMU A;  3LK0 A;  2I94 A;  2MRD A;  3OB1 B;  1QXP A;  2F3Y A;  3HX4 A;  1A29 A;  2BCA A;  2LAP A;  3SIB A;  1L2O B;  2KGB C;  2L4I A;  2K61 A;  1NYA A;  1OOJ A;  1MUX A;  1Y1A A;  3OX5 A;  1CFF A;  2KYF A;  3LL8 B;  1RWY A;  2AMI A;  1XK4 C;  1JWD A;  1GGZ A;  1XK4 A;  3NSO A;  2KAX A;  1JUO A;  1BG1 A;  1IJ6 A;  2JUL A;  1MHO A;  4PCW A;  4PE7 A;  3OHM B;  3CR4 X;  1OQP A;  2PAS A;  2L51 A;  1B8L A;  2JQ6 A;  2QPT A;  3BXK A;  1RFJ A;  2K8M B;  2SAS A;  4U8D A;  1CMG A;  5HLO A;  1J1D A;  1U5I A;  2KHN A;  5HKW A;  2K7C A;  4MZK A;  2Q91 A;  5KU1 A;  1Q80 A;  1OMR A;  3BUX B;  3IF7 A;  1AUI B;  3EVV A;  1B7T Y;  3GK1 A;  4ETO A;  1CKK A;  4MRX A;  5DKN A;  1GQM A;  1XA5 A;  3CLN A;  4FTG A;  1UHK A;  1CDL A;  1LXF C;  2D8N A;  2Y5I A;  5J3X A;  4MVF A;  1KSO A;  2LC5 A;  4GPL B;  3WXA A;  4M2O A;  2JC2 A;  1A75 A;  2L50 A;  3AAK A;  1EH2 A;  2LUX A;  3PFV A;  1JBA A;  1TNQ A;  1C7V A;  2HET A;  4ORA B;  3O2P A;  1CLM A;  1CDP A;  1J1E A;  1FW4 A;  2BE4 A;  2TN4 A;  4DCK A;  1YRT B;  2G9B A;  2KQ6 A;  3SG6 A;  1BOC A;  3LLE A;  1QV0 A;  1CM1 A;  1QLK A;  1AP4 A;  5TNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...