2FOTA

Crystal structure of the complex between calmodulin and alphaii-spectrin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
134
Chain Sequence
EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding, structural protein
molecule keywords Calmodulin
publication title Structure of the calmodulin alphaII-spectrin complex provides insight into the regulation of cell plasticity.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 134
sequence length 142
ec nomenclature
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fotA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fotA02
2HF5A 1K95A 5AFPA 1IQ5A 3JVTC 3NSOA 1B7TZ 4MLWA 3WHTB 1NP8A 1CNPA 2KYCA 3FS7A 2FCEA 4GUKA 4HRGA 2JPTA 4MZJA 5CSJA 4TNCA 5K89A 2KSPA 2KI6D 2M0RA 1S6CA 1L2OC 2L4HA 2JXCA 5HKZA 5HKYA 2M8UA 1PVBA 1J55A 4NQGA 3TDIA 1QV0A 1QX5B 1S36A 3DVKA 3C1VA 4P5OE 5TNCA 4L9MA 5I8NA 2M49B 2ZNEA 1BR1B 1OMVA 1B4CA 4BY5A 3IQOA 3K21A 4XJKA 1IH0A 3OHMB 1OMDA 1BU3A 1Y6WA 1FI6A 4ZCVA 1H8BA 1E8AA 2I94A 1YX8A 1A75A 4QJ4B 1PULA 1XYDA 1IJ6A 2MLFC 3CGAA 1TCFA 1TNQA 4DUQA 2KYFA 4GPLB 5BPJA 3NSLA 5AERA 2G9BA 1M45A 1DT7B 2MRDA 3SG4A 4PHMA 4GFTA 2VRGA 2MBXA 1CMFA 3I5FB 4YBHB 1PALA 3KF9A 3EVRA 1GGWA 1DTLA 2CBLA 2GGZA 4MZKA 4PALA 4YGDB 2LV7A 5J3XA 1CTRA 1F55A 2Y5IA 2F33A 3PN7B 1G4YR 4MEWA 2LUCA 3SIAA 1SCVA 2JXLA 2LANA 4FTGA 2F2PA 1A4PA 1OMRA 1K96A 1QV1A 3I5FC 3SG3A 1CFPA 2EGDA 4N1GA 1R6PA 3VRPA 3A8RA 3EK8A 4JQ0D 3OB1B 1DF0A 2R2IA 5HLVA 4QJ5B 1AK8A 1BOCA 1RJVA 3PN7C 1W7IB 3CS1A 2OS8B 1YX7A 2KFGA 1XFWO 4UPGA 3FIAA 2MA2A 1DJXA 3VRRA 1WLMA 1EJ3A 2Y1MA 1WRKA 2HPSA 1KSMA 3LK1A 3AKBA 4PE4A 4YI8A 2WCBA 2BKHB 4WQ2A 4MN0A 2OS8C 3ZWHA 1RWYA 5KU1A 1JUOA 4ICBA 2K7OA 2G2BA 1IJ5A 1TN4A 1J7QA 5PALA 2FCDA 1JWDA 1QVIZ 1N0YA 2L98A 1KCYA 2AAOA 1S5GZ 1SL9A 1QX7A 4NDBA 2CNPA 2KFHA 1RTP1 4OCIA 3IQQA 1RROA 1KFXL 1KK8C 4PE0A 4A4CA 3KO0A 1AJ4A 1B8RA 2RGIA 2K7DA 4PHJA 1QATA 1RECA 3CWGA 2LLTA 2LVIA 4ORCB 4USLA 2GGMA 1GGZA 1PVAA 1QLSA 2M7LA 4XYNA 1X02A 1SL7A 1ZOTB 1NX0A 1KQMB 1BR4B 4I5KA 4ETOA 1J7RA 2JNXA 2QACA 1EXRA 1UWOA 1DJIA 2JZIA 1TRFA 1TNPA 2KI4C 2HQWA 5I2LA 3SG2A 2KOTA 2ZNDA 3BQ3A 3OX5A 4FQOA 4PHKA 1SL8A 1A03A 2LMTA 1GJYA 1K9UA 1KQMC 1S3PA 3KPXA 1LA3A 1OZOA 2I18A 1PRWA 4OR9B 1UHNA 4ORAB 3TDUA 4CIDA 3O6BA 2K7CA 3RM1A 3BUWB 1YUUA 3DVJA 2LUXA 2COLB 1PSBA 3EK4A 3HCMA 3PM8A 5B8IB 4C0KA 5AXIA 1BLQA 4GAOA 1SNLA 4YGAA 2JOJA 2JT3A 1U5IB 1XFYO 4GBAA 4Q04A 2WCEA 1LA0A 2I2RE 2M1KB 1K90D 1B47A 2PMYA 1NX3A 3O4YA 2LC5A 1DJGA 3NSKA 4N1FA 2BBMA 2ISDA 4AQJA 1AP4A 1LVCD 1UUSA 1NCXA 2JT0A 2KAYA 1QJTA 1EH2A 3PSRA 1PSRA 2HETA 2A4JA 5HYDA 1DGVA 2GV5A 2KFFA 1F8HA 3IF7A 4GGFA 1OE9B 2EHBA 1IRJA 1CFCA 2K2FA 2AMIA 4YRUA 1DGUA 4PE1A 2M9GA 1IWQA 1FPWA 4HREE 1QX2A 3H4SE 1YR5A 1SY9A 2CXJA 2PSRA 1M31A 1R2UA 2CCMA 3JTDB 5JJGA 1IKUA 1KFUL 4WQ3A 2F8PA 1OZSA 1EG3A 1JF2A 3KHEA 2JT8A 1ZMZA 4JWQA 1NSHA 2LVJA 4NDDA 3SIBA 1KQVA 1SBJA 1UHIA 2MJWB 3JTDC 1D1OA 1IQ3A 4MRYA 2KDHA 2M29A 1NYAA 1J7OA 4I5NB 1F4QA 5ER4X 3CTNA 1B7TY 2CT9A 3GK1A 1ODBA 1C7VA 1CM1A 1B9AA 2TN4A 1F70A 3EK7A 1UURA 4D1EA 3RLZA 2PRUA 2JTZA 1QTXA 1LXFC 1BMOA 4GGFC 2LAPA 5CSFA 2BL0B 2FJUB 1NX1A 4JPZB 1J1DA 4C0JA 1K9KA 1B1GA 2JRFA 3TZ1A 2Q91A 2QPTA 1N2DA 4MRXA 1TTXA 5ER5A 3LCPC 4CLNA 3M0WA 1CDNA 1WRLA 2JWWA 1LKJA 1B8LA 3I5GB 1K9PA 3VROA 3CLNA 4MSPA 2K0JA 5I2QA 1SKTA 1C7WA 2P6BB 5CSIA 5KSZA 1FF1A 4YI9A 3WNXB 2M7NA 2LCPA 3LLEA 4C0LA 1CMGA 1XO5A 1SYMA 3I5GC 1QS7A 1KSOA 1CDPA 2JC2A 1KK7Y 1UP5A 1XVJA 2BE6A 1OOJA 2JULA 3AAJA 4ZCUA 1F4OA 4R1EA 1J7PA 2BCAA 1LINA 1NCYA 2F3YA 2E6WA 3GK2A 2SCPA 4HRHA 4U8DA 4DS7A 4YGEB 2PVBA 4MZLA 4HSZA 1RFJA 2FOTA 1U5IA 5DKQA 1RK9A 3ICBA 1OQPA 2EC6B 3A4UB 3OP0A 2D8NA 3DF0B 3MSEB 2LVVA 1YURA 3WXAA 2JQ6A 2L51A 3NSIA 2MHHA 1ZUZA 1EG4A 2L0PA 5FYXA 1UHJA 2LMVA 1MUXA 5DKRA 5D69A 3AAKA 3TDZA 2M3WA 2M97A 2KI6C 2EC6C 1W7JB 3FWCA 2BCBA 2PALA 2NCPA 1MXLC 2KAVA 1NCZA 2LLUA 1SPYA 4CPVA 1G8IA 1TNXA 1XFUO 4N5XA 1NIWA 3SJSA 3CR2A 1JF0A 1Y1UA 4PCWA 1YUSA 1ZACA 2KQYA 1SRAA 1YRTB 1DVIA 1BODA 3EKJA 3LK0A 1J1EA 2V53A 3BOWB 1SCMB 3I5IB 4PE7A 1JFKA 3AKAA 4QJ3B 3WHUB 4CFRA 1DMOA 1L7ZA 1QASA 2JTTA 3CR4X 5D7FA 1S5GY 4M2PA 1C07A 2KBMA 2JNFA 5IBWA 3BUMB 2Y1NA 2OTGB 3ZNIA 3JVTB 1DJZA 3I5IC 1MWNA 2KAXA 3D0YB 3QRXA 2M1UA 4P2YB 5G08A 2NCOA 1CLMA 1XA5A 1DJWA 3VGOA 5HLOA 4DIRA 3D10A 2LP2A 1AJ5A 3O2PA 3PALA 5HKWA 2OTGC 1YUTA 2OPOA 2O5GA 1N65A 4CFQA 2WORA 2ZFDA 1TCOB 1M46A 3FWBA 1SMGA 1KWOB 4PHNA 4I5JA 1A29A 1XFZO 1IG5A 1BJFA 3KEVA 4GNKB 4OVNF 1CLLA 1TNWA 1CFDA 3DVEA 2F3ZA 5CSNA 1G33A 2AUCA 1H4BA 5JOLA 1KWOC 1ALWA 1ALVA 1WLZA 4OV2A 2I7AA 2O60A 2BBNA 1M39A 2K7BA 4DCKA 3DD4A 1MR8A 5AEQA 2PASA 4A4BA 1MF8B 3SG5A 1AHRA 2K8MB 2KGRA 2ZRSA 3BUXB 3SG7A 1XK4A 2CTNA 1JFJA 1FW4A 1K94A 1HT9A 1F71A 5F6TA 4IL1A 2WC8A 4F0ZB 3I5HB 1KK7Z 1YRUB 2L2EA 1M63B 1PK0D 2K2AA 1KFXS 1NUBA 2JU0A 1UHHA 4AOMA 5GQQC 1TOPA 1OSAA 1XFXO 3NXAA 2MLEC 1QXPA 2BL0C 2LNKA 3I5HC 3EKHA 2WOSA 4XJKB 1EL4A 1JSAA 1K93D 3DF0A 3LL8B 2KHNA 1MQ1A 2L50A 3F45A 1F54A 3CR5X 4YGBB 1SR6B 2B1UA 3EVVA 1K8UA 1A75B 1V1GA 3BUNB 1QLKA 2HQ8A 4ORBB 1YVHA 2BE4A 1S6JA 4I5LB 1IGVA 2L5XB 1CM4A 1ZFSA 1QIVA 1XFVO 1CDLA 1CLBA 2KBIA 3EVUA 1SR6C 1S6IA 2H61A 3GK4X 4GGNA 2H2KA 2NLNA 1UHKA 1CDMA 2KQ6A 2ZKMX 1XK4C 2IS9A 2NZ0A 1WDCB 2DOQA 2LVKA 3TS5B 1S1EA 2SASA 1NWDA 1Y1AA 2LP3A 3OB2B 5KTYA 1SW8A 2LHIA 3BOWA 4PDZA 3TUYB 3VRQA 1KK8B 1DJHA 1JBAA 1JC2A 3O78A 4DRWA 1SK6D 1WDCC 3E3RA 1DF0B 3TS5C 2K61A 1FI5A 2NXQA 1V1FA 4M2QA 3GOFA 3TUYC 1NPQA 1Y0VH 2BCXA 2Q4UA 3D0YA 1YTZC 1TIZA 2LE9B 3PFVA 1GQMA 1CB1A 1A2XA 3BYAA 3DVMA 1BG1A 1HQVA 1B8CA 2KI4B 1S26D 1K2HA 2F2OA 1WRZA 2ZN8A 2E30A 3BUOB 1WY9A 1VRKA 1DJYA 2BKIB 1CKKA 5DKNA 1AUIB 1AVSA 1QIWA 3BXKA 4BY4A 1YVLA 2WNDA 1Y1XA 2ZRTA 1FBVA 3VRNA 3PLFB 1KFUS 1QVIY 2LHLA 1BF5A 1NX2A 2H61C 4OKHA 1BT6A 1MHOA 2KGBC 3SG6A 3OX6A 1MXEA 4NDCA 2L4IA 4WRIA 3CZTX 4MVFA 1CFFA 2LM5A 4AQIA 2Y4QA 4E68A 2LMUA 1SCMC 3PATA 3HX4A 1Q80A 4MBEA 2MAZA 4M2OA 2WCFA 2ZN9A 2BECA 5CPVA 5I2OA 2KNEA 5AANA 2LLSA 1L2OB 4YGCB
chains in the Genus database with same CATH superfamily
2HF5A 1K95A 5AFPA 1IQ5A 3JVTC 3NSOA 1B7TZ 4MLWA 3WHTB 1NP8A 1CNPA 2KYCA 3FS7A 2FCEA 4GUKA 4HRGA 2JPTA 4MZJA 5CSJA 2WC6A 4TNCA 5K89A 3SS5A 2KSPA 2KI6D 2M0RA 1S6CA 1L2OC 2L4HA 2JXCA 5HKZA 5HKYA 2M8UA 1PVBA 1J55A 4NQGA 3TDIA 1QV0A 1QX5B 1S36A 3DVKA 3C1VA 4P5OE 5TNCA 4L9MA 5I8NA 2M49B 2ZNEA 1BR1B 1OMVA 1B4CA 4BY5A 3IQOA 3K21A 4OZDA 4XJKA 1IH0A 3OHMB 1OMDA 1BU3A 1Y6WA 1FI6A 5EL2A 4ZCVA 1H8BA 1E8AA 2I94A 1YX8A 1A75A 4QJ4B 1PULA 1XYDA 1IJ6A 2MLFC 3CGAA 1TCFA 1TNQA 4DUQA 2KYFA 4GPLB 5BPJA 3NSLA 5AERA 2G9BA 1M45A 3CABA 1DT7B 2MRDA 4INWA 3SG4A 3S0AA 4PHMA 4GFTA 1DC1A 2VRGA 2MBXA 1CMFA 3L47A 5D3OA 3I5FB 4YBHB 1PALA 3KF9A 3EVRA 1GGWA 1DTLA 2CBLA 2GGZA 4MZKA 4PALA 4YGDB 2LV7A 5J3XA 1CTRA 1F55A 1Z4HA 2Y5IA 2F33A 3PN7B 3D76A 1G4YR 4MEWA 2LUCA 3SIAA 1SCVA 2JXLA 2LANA 4FTGA 2F2PA 1A4PA 1OMRA 1K96A 1QV1A 3I5FC 3SG3A 1CFPA 2EGDA 4N1GA 1R6PA 3VRPA 3A8RA 3EK8A 3FE8A 4JQ0D 1ORGA 1OW4A 3B7AA 3OB1B 3S0FA 1DF0A 2R2IA 5HLVA 4QJ5B 1AK8A 1BOCA 1RJVA 3PN7C 1W7IB 3CS1A 2OS8B 1YX7A 2KFGA 1XFWO 3L4LA 4UPGA 3FIAA 2MA2A 1DJXA 3VRRA 3R1VA 1WLMA 2BAPA 1EJ3A 2Y1MA 1WRKA 2H8VA 2HPSA 1KSMA 3LK1A 3AKBA 4PE4A 4YI8A 2WCBA 2BKHB 3D73A 4WQ2A 4MN0A 1TUZA 2OS8C 3ZWHA 1RWYA 5KU1A 1JUOA 4ICBA 2K7OA 2G2BA 3NHIA 2WCKA 1IJ5A 1TN4A 1J7QA 5PALA 2FCDA 1JWDA 1QVIZ 1N0YA 2L98A 1KCYA 2AAOA 1S5GZ 1SL9A 1QX7A 4NDBA 1DQEA 2CNPA 2KFHA 1RTP1 4OCIA 3IQQA 1RROA 1KFXL 1KK8C 4PE0A 4A4CA 3KO0A 1AJ4A 1B8RA 2RGIA 2K7DA 1OOHA 1QATA 4PHJA 1RECA 3CWGA 4PT1A 2LLTA 2LVIA 4ORCB 4USLA 2GGMA 1GGZA 1PVAA 1QLSA 2M7LA 4XYNA 1X02A 1SL7A 1ZOTB 1NX0A 1KQMB 3CZ1A 1BR4B 1TUJA 4I5KA 4ETOA 1J7RA 2JNXA 2QACA 1EXRA 1UWOA 3BFHA 1DJIA 2JZIA 1TRFA 1TNPA 2KI4C 2HQWA 5I2LA 3SG2A 2KOTA 2ZNDA 3BQ3A 3OX5A 4FQOA 4PHKA 1SL8A 2YGUA 1A03A 3DZTA 2KLEA 2LMTA 1GJYA 1K9UA 1KQMC 1S3PA 3KPXA 1LA3A 1OZOA 2I18A 1PRWA 4OR9B 1UHNA 4ORAB 3TDUA 1P28A 4CIDA 3BFBA 3O6BA 2P71A 2K7CA 3RM1A 3BUWB 1YUUA 3DVJA 2LUXA 2COLB 1PSBA 1QWVA 3EK4A 3HCMA 3PM8A 5B8IB 4C0KA 5AXIA 1BLQA 4GAOA 1SNLA 4YGAA 2JOJA 2JT3A 1U5IB 1XFYO 4GBAA 4Q04A 3S0GA 2WCEA 1LA0A 2I2RE 2M1KB 1K90D 3QMEA 1B47A 2PMYA 1NX3A 3O4YA 2LC5A 1DJGA 3NSKA 4N1FA 2BBMA 2ISDA 4AQJA 1AP4A 1LVCD 1UUSA 1NCXA 2JT0A 2KAYA 1QJTA 4IJ7A 3PSRA 1EH2A 1PSRA 2HETA 2A4JA 3NGVA 5HYDA 1DGVA 2GV5A 2KFFA 1F8HA 3IF7A 4GGFA 1OE9B 2EHBA 1IRJA 3CZ0A 1CFCA 2K2FA 2AMIA 3B6XA 4YRUA 1DGUA 4PE1A 2M9GA 1IWQA 1FPWA 4HREE 1QX2A 3DY9A 3H4SE 1YR5A 1SY9A 2CXJA 2PSRA 1M31A 1R2UA 2CCMA 3JTDB 3S0EA 5JJGA 1IKUA 1KFUL 4F7FA 4WQ3A 1TWOA 2F8PA 1OZSA 1EG3A 1JF2A 3CZ2A 3KHEA 2JT8A 1ZMZA 2WCJA 4JWQA 1NSHA 2LVJA 4NDDA 3SIBA 3B86A 1SBJA 1KQVA 1UHIA 2MJWB 3JTDC 1D1OA 1IQ3A 4MRYA 2KDHA 2M29A 1NYAA 1J7OA 4I5NB 1F4QA 2KPHA 5ER4X 3CTNA 3RZSA 1B7TY 2CT9A 3BFAA 1ODBA 3GK1A 1C7VA 1CM1A 1B9AA 2TN4A 1F70A 1T14A 1UURA 3EK7A 2L2CA 4D1EA 3RLZA 3BJHA 2PRUA 2JTZA 5FI6A 1QTXA 3CYZA 1LXFC 1BMOA 4GGFC 2LAPA 5CSFA 2BL0B 2FJUB 1NX1A 4JPZB 1J1DA 4C0JA 1K9KA 1B1GA 2JRFA 3TZ1A 2Q91A 2QPTA 1N2DA 4MRXA 1TTXA 5ER5A 3D77A 3LCPC 4CLNA 3M0WA 1CDNA 1WRLA 2JWWA 1LKJA 1B8LA 3I5GB 5I94A 1K9PA 4JKTA 3VROA 3CLNA 4MSPA 2K0JA 5I2QA 1SKTA 1C7WA 2P6BB 5CSIA 5KSZA 1FF1A 4YI9A 3WNXB 2M7NA 2LCPA 3LLEA 3O4XA 4C0LA 1CMGA 1XO5A 1OOFA 1SYMA 3I5GC 1QS7A 1KSOA 2KLDA 1CDPA 2JC2A 3OBVA 1KK7Y 1UP5A 1XVJA 2BE6A 1OOJA 2JULA 3AAJA 4ZCUA 1F4OA 4R1EA 3B88A 1J7PA 1OOGA 2BCAA 1LINA 1NCYA 2F3YA 3SS4A 3CDNA 2E6WA 3GK2A 2SCPA 4HRHA 4U8DA 3PM2A 4DS7A 4YGEB 2PVBA 4MZLA 4HSZA 1RFJA 3PJIA 2FOTA 1U5IA 5DKQA 1RK9A 3B87A 3ICBA 1OQPA 2EC6B 2QEBA 3VB1A 3A4UB 3OP0A 2D8NA 3DF0B 3MSEB 2LVVA 1YURA 3V2LA 3OGNA 3WXAA 2JQ6A 2L51A 3NSIA 2MHHA 1ZUZA 1EG4A 2L0PA 3D74A 5FYXA 1UHJA 2LMVA 1MUXA 4INXA 5D69A 3AAKA 5DKRA 2M3WA 2M97A 3TDZA 2KI6C 1LS8A 2EC6C 1W7JB 3FWCA 2BCBA 2PALA 3R72A 2NCPA 2ERBA 1MXLC 2KAVA 1NCZA 2LLUA 1SPYA 4CPVA 1G8IA 1TNXA 1XFUO 4N5XA 1NIWA 3K1EA 3CR2A 1JF0A 1Y1UA 4PCWA 5DICA 1XFRA 3SJSA 1YUSA 3N7HA 1ZACA 2KQYA 1SRAA 3D75A 1YRTB 1DVIA 1W9ZA 1BODA 3EKJA 3LK0A 1J1EA 2V53A 3BOWB 1SCMB 3DYEA 3I5IB 1JFKA 3AKAA 4PE7A 4QJ3B 3WHUB 4CFRA 1DMOA 1L7ZA 1QASA 2JTTA 3CR4X 5D7FA 3S0DA 1S5GY 4M2PA 1C07A 2KBMA 2WCLA 2JNFA 2PQLA 3BUMB 5IBWA 2Y1NA 2OTGB 3ZNIA 4JD9A 3JVTB 1DJZA 2L5YA 3I5IC 1MWNA 2KAXA 3D0YB 3QRXA 2M1UA 4P2YB 5G08A 2NCOA 2QDIA 1CLMA 1XA5A 1DJWA 4FQTA 3VGOA 5HLOA 2QEVA 4DIRA 3D10A 2LP2A 1AJ5A 3O2PA 3PALA 5HKWA 2OTGC 2WCMA 1YUTA 2OPOA 2O5GA 1N65A 4CFQA 2WORA 2ZFDA 1TCOB 1M46A 3L4AA 3FWBA 1SMGA 1KWOB 3Q8IA 1DEKA 4PHNA 1OOIX 4I5JA 1A29A 1XFZO 1IG5A 1BJFA 3KEVA 4GNKB 4OVNF 1CLLA 1TNWA 1CFDA 3DVEA 2F3ZA 5CSNA 1G33A 2AUCA 1H4BA 5JOLA 1SSEB 2QEOA 1KWOC 1IIOA 1ALWA 1ALVA 1WLZA 2JPOA 2I7AA 2O60A 3R1OA 4OV2A 1C3YA 2BBNA 1M39A 2K7BA 4DCKA 3DD4A 1MR8A 5AEQA 2PASA 4A4BA 1MF8B 3SG5A 1AHRA 2K8MB 2KGRA 2ZRSA 3BUXB 3SG7A 1XK4A 2CTNA 1JFJA 1FW4A 1K94A 1HT9A 1F71A 5F6TA 4IL1A 2P70A 2WC8A 4F0ZB 3I5HB 1KK7Z 1YRUB 2L2EA 1M63B 1PK0D 2FJYA 2K2AA 2QEHA 3D78A 1KFXS 1NUBA 3EG5B 5FI2A 2JU0A 1UHHA 3R1PA 3UO9A 4AOMA 5GQQC 1TOPA 1OSAA 1XFXO 3NXAA 2MLEC 1QXPA 2BL0C 2LNKA 3I5HC 3EKHA 2WOSA 4XJKB 1EL4A 1JSAA 1K93D 3DF0A 3LL8B 2KHNA 1MQ1A 2L50A 3F45A 1F54A 3CR5X 4YGBB 1SR6B 2B1UA 3EVVA 1K8UA 1A75B 1V1GA 3BUNB 1QLKA 2HQ8A 4ORBB 1YVHA 2PYQA 2BE4A 1S6JA 4I5LB 1IGVA 2L5XB 1CM4A 3DXLA 3FE9A 1ZFSA 1QIVA 1XFVO 1CDLA 1CLBA 2KBIA 2GTEA 1SR6C 3EVUA 1S6IA 2H61A 3GK4X 4GGNA 2H2KA 2NLNA 1UHKA 1CDMA 2KQ6A 2ZKMX 1XK4C 2IS9A 2NZ0A 1WDCB 2DOQA 2LVKA 3TS5B 1S1EA 2SASA 1NWDA 1Y1AA 2LP3A 3OB2B 5KTYA 1SW8A 2LHIA 3BOWA 4PDZA 3TUYB 3VRQA 1KK8B 1DJHA 1JBAA 1JC2A 3O78A 2BNXA 4DRWA 5HL1A 1SK6D 5FI7A 1DELA 1WDCC 3E3RA 1DF0B 3TS5C 2K61A 1FI5A 2NXQA 1V1FA 4M2QA 3GOFA 3NHTA 3TUYC 1NPQA 1Y0VH 2BCXA 2Q4UA 3D0YA 1YTZC 1TIZA 2LE9B 3PFVA 1GQMA 1CB1A 1A2XA 3BYAA 3DVMA 3IVTA 1BG1A 1HQVA 1B8CA 2KI4B 1S26D 4KYNA 1K2HA 2F2OA 1WRZA 2ZN8A 2E30A 3BUOB 1WY9A 1VRKA 1DJYA 2BKIB 1CKKA 5DKNA 1AUIB 1AVSA 1QIWA 3BXKA 4BY4A 1YVLA 2WNDA 1Y1XA 2ZRTA 1FBVA 3VRNA 3PLFB 1KFUS 1QVIY 2LHLA 1BF5A 1NX2A 2H61C 4OKHA 1BT6A 1MHOA 2KGBC 3SG6A 3OX6A 1MXEA 2WCHA 4NDCA 2L4IA 4WRIA 3CZTX 4MVFA 1CFFA 2LM5A 3UNWA 4AQIA 2Y4QA 4E68A 2LMUA 1SCMC 3FE6A 3PATA 3HX4A 1Z2CB 1Q80A 4MBEA 2MAZA 2WC5A 4M2OA 2WCFA 2ZN9A 1GM0A 2BECA 3SS3A 5CPVA 5I2OA 1C3ZA 2KNEA 5AANA 2LLSA 1L2OB 3S0BA 2K60A 4YGCB
chains in the Genus database with same CATH topology
2HF5A 1K95A 5AFPA 1IQ5A 3JVTC 3NSOA 1B7TZ 4MLWA 3WHTB 1NP8A 1CNPA 2KYCA 3FS7A 2FCEA 4GUKA 4HRGA 2JPTA 4MZJA 5CSJA 4TNCA 5K89A 2KSPA 2KI6D 2M0RA 1S6CA 1L2OC 2L4HA 2JXCA 5HKZA 5HKYA 2M8UA 1PVBA 1J55A 4NQGA 3TDIA 1QV0A 1QX5B 1S36A 3DVKA 3C1VA 4P5OE 5TNCA 4L9MA 5I8NA 2M49B 2ZNEA 1BR1B 1OMVA 1B4CA 4BY5A 3IQOA 3K21A 4XJKA 1IH0A 3OHMB 1OMDA 1BU3A 1Y6WA 1FI6A 4ZCVA 1H8BA 1E8AA 2I94A 1YX8A 1A75A 4QJ4B 1PULA 1XYDA 1IJ6A 2MLFC 3CGAA 1TCFA 1TNQA 4DUQA 2KYFA 4GPLB 5BPJA 3NSLA 5AERA 2G9BA 1M45A 1DT7B 2MRDA 3SG4A 4PHMA 4GFTA 2VRGA 2MBXA 1CMFA 3I5FB 4YBHB 1PALA 3KF9A 3EVRA 1GGWA 1DTLA 2CBLA 2GGZA 4MZKA 4PALA 4YGDB 2LV7A 5J3XA 1CTRA 1F55A 2Y5IA 2F33A 3PN7B 1G4YR 4MEWA 2LUCA 3SIAA 1SCVA 2JXLA 2LANA 4FTGA 2F2PA 1A4PA 1OMRA 1K96A 1QV1A 3I5FC 3SG3A 1CFPA 2EGDA 4N1GA 1R6PA 3VRPA 3A8RA 3EK8A 4JQ0D 3OB1B 1DF0A 2R2IA 5HLVA 4QJ5B 1AK8A 1BOCA 1RJVA 3PN7C 1W7IB 3CS1A 2OS8B 1YX7A 2KFGA 1XFWO 4UPGA 3FIAA 2MA2A 1DJXA 3VRRA 1WLMA 1EJ3A 2Y1MA 1WRKA 2HPSA 1KSMA 3LK1A 3AKBA 4PE4A 4YI8A 2WCBA 2BKHB 4WQ2A 4MN0A 2OS8C 3ZWHA 1RWYA 5KU1A 1JUOA 4ICBA 2K7OA 2G2BA 1IJ5A 1TN4A 1J7QA 5PALA 2FCDA 1JWDA 1QVIZ 1N0YA 2L98A 1KCYA 2AAOA 1S5GZ 1SL9A 1QX7A 4NDBA 2CNPA 2KFHA 1RTP1 4OCIA 3IQQA 1RROA 1KFXL 1KK8C 4PE0A 4A4CA 3KO0A 1AJ4A 1B8RA 2RGIA 2K7DA 4PHJA 1QATA 1RECA 3CWGA 2LLTA 2LVIA 4ORCB 4USLA 2GGMA 1GGZA 1PVAA 1QLSA 2M7LA 4XYNA 1X02A 1SL7A 1ZOTB 1NX0A 1KQMB 1BR4B 4I5KA 4ETOA 1J7RA 2JNXA 2QACA 1EXRA 1UWOA 1DJIA 2JZIA 1TRFA 1TNPA 2KI4C 2HQWA 5I2LA 3SG2A 2KOTA 2ZNDA 3BQ3A 3OX5A 4FQOA 4PHKA 1SL8A 1A03A 2LMTA 1GJYA 1K9UA 1KQMC 1S3PA 3KPXA 1LA3A 1OZOA 2I18A 1PRWA 4OR9B 1UHNA 4ORAB 3TDUA 4CIDA 3O6BA 2K7CA 3RM1A 3BUWB 1YUUA 3DVJA 2LUXA 2COLB 1PSBA 3EK4A 3HCMA 3PM8A 5B8IB 4C0KA 5AXIA 1BLQA 4GAOA 1SNLA 4YGAA 2JOJA 2JT3A 1U5IB 1XFYO 4GBAA 4Q04A 2WCEA 1LA0A 2I2RE 2M1KB 1K90D 1B47A 2PMYA 1NX3A 3O4YA 2LC5A 1DJGA 3NSKA 4N1FA 2BBMA 2ISDA 4AQJA 1AP4A 1LVCD 1UUSA 1NCXA 2JT0A 2KAYA 1QJTA 1EH2A 3PSRA 1PSRA 2HETA 2A4JA 5HYDA 1DGVA 2GV5A 2KFFA 1F8HA 3IF7A 4GGFA 1OE9B 2EHBA 1IRJA 1CFCA 2K2FA 2AMIA 4YRUA 1DGUA 4PE1A 2M9GA 1IWQA 1FPWA 4HREE 1QX2A 3H4SE 1YR5A 1SY9A 2CXJA 2PSRA 1M31A 1R2UA 2CCMA 3JTDB 5JJGA 1IKUA 1KFUL 4WQ3A 2F8PA 1OZSA 1EG3A 1JF2A 3KHEA 2JT8A 1ZMZA 4JWQA 1NSHA 2LVJA 4NDDA 3SIBA 1KQVA 1SBJA 1UHIA 2MJWB 3JTDC 1D1OA 1IQ3A 4MRYA 2KDHA 2M29A 1NYAA 1J7OA 4I5NB 1F4QA 5ER4X 3CTNA 1B7TY 2CT9A 3GK1A 1ODBA 1C7VA 1CM1A 1B9AA 2TN4A 1F70A 3EK7A 1UURA 4D1EA 3RLZA 2PRUA 2JTZA 1QTXA 1LXFC 1BMOA 4GGFC 2LAPA 5CSFA 2BL0B 2FJUB 1NX1A 4JPZB 1J1DA 4C0JA 1K9KA 1B1GA 2JRFA 3TZ1A 2Q91A 2QPTA 1N2DA 4MRXA 1TTXA 5ER5A 3LCPC 4CLNA 3M0WA 1CDNA 1WRLA 2JWWA 1LKJA 1B8LA 3I5GB 1K9PA 3VROA 3CLNA 4MSPA 2K0JA 5I2QA 1SKTA 1C7WA 2P6BB 5CSIA 5KSZA 1FF1A 4YI9A 3WNXB 2M7NA 2LCPA 3LLEA 4C0LA 1CMGA 1XO5A 1SYMA 3I5GC 1QS7A 1KSOA 1CDPA 2JC2A 1KK7Y 1UP5A 1XVJA 2BE6A 1OOJA 2JULA 3AAJA 4ZCUA 1F4OA 4R1EA 1J7PA 2BCAA 1LINA 1NCYA 2F3YA 2E6WA 3GK2A 2SCPA 4HRHA 4U8DA 4DS7A 4YGEB 2PVBA 4MZLA 4HSZA 1RFJA 2FOTA 1U5IA 5DKQA 1RK9A 3ICBA 1OQPA 2EC6B 3A4UB 3OP0A 2D8NA 3DF0B 3MSEB 2LVVA 1YURA 3WXAA 2JQ6A 2L51A 3NSIA 2MHHA 1ZUZA 1EG4A 2L0PA 5FYXA 1UHJA 2LMVA 1MUXA 5DKRA 5D69A 3AAKA 3TDZA 2M3WA 2M97A 2KI6C 2EC6C 1W7JB 3FWCA 2BCBA 2PALA 2NCPA 1MXLC 2KAVA 1NCZA 2LLUA 1SPYA 4CPVA 1G8IA 1TNXA 1XFUO 4N5XA 1NIWA 3SJSA 3CR2A 1JF0A 1Y1UA 4PCWA 1YUSA 1ZACA 2KQYA 1SRAA 1YRTB 1DVIA 1BODA 3EKJA 3LK0A 1J1EA 2V53A 3BOWB 1SCMB 3I5IB 4PE7A 1JFKA 3AKAA 4QJ3B 3WHUB 4CFRA 1DMOA 1L7ZA 1QASA 2JTTA 3CR4X 5D7FA 1S5GY 4M2PA 1C07A 2KBMA 2JNFA 5IBWA 3BUMB 2Y1NA 2OTGB 3ZNIA 3JVTB 1DJZA 3I5IC 1MWNA 2KAXA 3D0YB 3QRXA 2M1UA 4P2YB 5G08A 2NCOA 1CLMA 1XA5A 1DJWA 3VGOA 5HLOA 4DIRA 3D10A 2LP2A 1AJ5A 3O2PA 3PALA 5HKWA 2OTGC 1YUTA 2OPOA 2O5GA 1N65A 4CFQA 2WORA 2ZFDA 1TCOB 1M46A 3FWBA 1SMGA 1KWOB 4PHNA 4I5JA 1A29A 1XFZO 1IG5A 1BJFA 3KEVA 4GNKB 4OVNF 1CLLA 1TNWA 1CFDA 3DVEA 2F3ZA 5CSNA 1G33A 2AUCA 1H4BA 5JOLA 1KWOC 1ALWA 1ALVA 1WLZA 4OV2A 2I7AA 2O60A 2BBNA 1M39A 2K7BA 4DCKA 3DD4A 1MR8A 5AEQA 2PASA 4A4BA 1MF8B 3SG5A 1AHRA 2K8MB 2KGRA 2ZRSA 3BUXB 3SG7A 1XK4A 2CTNA 1JFJA 1FW4A 1K94A 1HT9A 1F71A 5F6TA 4IL1A 2WC8A 4F0ZB 3I5HB 1KK7Z 1YRUB 2L2EA 1M63B 1PK0D 2K2AA 1KFXS 1NUBA 2JU0A 1UHHA 4AOMA 5GQQC 1TOPA 1OSAA 1XFXO 3NXAA 2MLEC 1QXPA 2BL0C 2LNKA 3I5HC 3EKHA 2WOSA 4XJKB 1EL4A 1JSAA 1K93D 3DF0A 3LL8B 2KHNA 1MQ1A 2L50A 3F45A 1F54A 3CR5X 4YGBB 1SR6B 2B1UA 3EVVA 1K8UA 1A75B 1V1GA 3BUNB 1QLKA 2HQ8A 4ORBB 1YVHA 2BE4A 1S6JA 4I5LB 1IGVA 2L5XB 1CM4A 1ZFSA 1QIVA 1XFVO 1CDLA 1CLBA 2KBIA 3EVUA 1SR6C 1S6IA 2H61A 3GK4X 4GGNA 2H2KA 2NLNA 1UHKA 1CDMA 2KQ6A 2ZKMX 1XK4C 2IS9A 2NZ0A 1WDCB 2DOQA 2LVKA 3TS5B 1S1EA 2SASA 1NWDA 1Y1AA 2LP3A 3OB2B 5KTYA 1SW8A 2LHIA 3BOWA 4PDZA 3TUYB 3VRQA 1KK8B 1DJHA 1JBAA 1JC2A 3O78A 4DRWA 1SK6D 1WDCC 3E3RA 1DF0B 3TS5C 2K61A 1FI5A 2NXQA 1V1FA 4M2QA 3GOFA 3TUYC 1NPQA 1Y0VH 2BCXA 2Q4UA 3D0YA 1YTZC 1TIZA 2LE9B 3PFVA 1GQMA 1CB1A 1A2XA 3BYAA 3DVMA 1BG1A 1HQVA 1B8CA 2KI4B 1S26D 1K2HA 2F2OA 1WRZA 2ZN8A 2E30A 3BUOB 1WY9A 1VRKA 1DJYA 2BKIB 1CKKA 5DKNA 1AUIB 1AVSA 1QIWA 3BXKA 4BY4A 1YVLA 2WNDA 1Y1XA 2ZRTA 1FBVA 3VRNA 3PLFB 1KFUS 1QVIY 2LHLA 1BF5A 1NX2A 2H61C 4OKHA 1BT6A 1MHOA 2KGBC 3SG6A 3OX6A 1MXEA 4NDCA 2L4IA 4WRIA 3CZTX 4MVFA 1CFFA 2LM5A 4AQIA 2Y4QA 4E68A 2LMUA 1SCMC 3PATA 3HX4A 1Q80A 4MBEA 2MAZA 4M2OA 2WCFA 2ZN9A 2BECA 5CPVA 5I2OA 2KNEA 5AANA 2LLSA 1L2OB 4YGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  1K95 A;  5AFP A;  1IQ5 A;  3JVT C;  3NSO A;  1B7T Z;  4MLW A;  3WHT B;  1NP8 A;  1CNP A;  2KYC A;  3FS7 A;  2FCE A;  4GUK A;  4HRG A;  2JPT A;  4MZJ A;  5CSJ A;  4TNC A;  5K89 A;  2KSP A;  2KI6 D;  2M0R A;  1S6C A;  1L2O C;  2L4H A;  2JXC A;  5HKZ A;  5HKY A;  2M8U A;  1PVB A;  1J55 A;  4NQG A;  3TDI A;  1QV0 A;  1QX5 B;  1S36 A;  3DVK A;  3C1V A;  4P5O E;  5TNC A;  4L9M A;  5I8N A;  2M49 B;  2ZNE A;  1BR1 B;  1OMV A;  1B4C A;  4BY5 A;  3IQO A;  3K21 A;  4XJK A;  1IH0 A;  3OHM B;  1OMD A;  1BU3 A;  1Y6W A;  1FI6 A;  4ZCV A;  1H8B A;  1E8A A;  2I94 A;  1YX8 A;  1A75 A;  4QJ4 B;  1PUL A;  1XYD A;  1IJ6 A;  2MLF C;  3CGA A;  1TCF A;  1TNQ A;  4DUQ A;  2KYF A;  4GPL B;  5BPJ A;  3NSL A;  5AER A;  2G9B A;  1M45 A;  1DT7 B;  2MRD A;  3SG4 A;  4PHM A;  4GFT A;  2VRG A;  2MBX A;  1CMF A;  3I5F B;  4YBH B;  1PAL A;  3KF9 A;  3EVR A;  1GGW A;  1DTL A;  2CBL A;  2GGZ A;  4MZK A;  4PAL A;  4YGD B;  2LV7 A;  5J3X A;  1CTR A;  1F55 A;  2Y5I A;  2F33 A;  3PN7 B;  1G4Y R;  4MEW A;  2LUC A;  3SIA A;  1SCV A;  2JXL A;  2LAN A;  4FTG A;  2F2P A;  1A4P A;  1OMR A;  1K96 A;  1QV1 A;  3I5F C;  3SG3 A;  1CFP A;  2EGD A;  4N1G A;  1R6P A;  3VRP A;  3A8R A;  3EK8 A;  4JQ0 D;  3OB1 B;  1DF0 A;  2R2I A;  5HLV A;  4QJ5 B;  1AK8 A;  1BOC A;  1RJV A;  3PN7 C;  1W7I B;  3CS1 A;  2OS8 B;  1YX7 A;  2KFG A;  1XFW O;  4UPG A;  3FIA A;  2MA2 A;  1DJX A;  3VRR A;  1WLM A;  1EJ3 A;  2Y1M A;  1WRK A;  2HPS A;  1KSM A;  3LK1 A;  3AKB A;  4PE4 A;  4YI8 A;  2WCB A;  2BKH B;  4WQ2 A;  4MN0 A;  2OS8 C;  3ZWH A;  1RWY A;  5KU1 A;  1JUO A;  4ICB A;  2K7O A;  2G2B A;  1IJ5 A;  1TN4 A;  1J7Q A;  5PAL A;  2FCD A;  1JWD A;  1QVI Z;  1N0Y A;  2L98 A;  1KCY A;  2AAO A;  1S5G Z;  1SL9 A;  1QX7 A;  4NDB A;  2CNP A;  2KFH A;  1RTP 1;  4OCI A;  3IQQ A;  1RRO A;  1KFX L;  1KK8 C;  4PE0 A;  4A4C A;  3KO0 A;  1AJ4 A;  1B8R A;  2RGI A;  2K7D A;  4PHJ A;  1QAT A;  1REC A;  3CWG A;  2LLT A;  2LVI A;  4ORC B;  4USL A;  2GGM A;  1GGZ A;  1PVA A;  1QLS A;  2M7L A;  4XYN A;  1X02 A;  1SL7 A;  1ZOT B;  1NX0 A;  1KQM B;  1BR4 B;  4I5K A;  4ETO A;  1J7R A;  2JNX A;  2QAC A;  1EXR A;  1UWO A;  1DJI A;  2JZI A;  1TRF A;  1TNP A;  2KI4 C;  2HQW A;  5I2L A;  3SG2 A;  2KOT A;  2ZND A;  3BQ3 A;  3OX5 A;  4FQO A;  4PHK A;  1SL8 A;  1A03 A;  2LMT A;  1GJY A;  1K9U A;  1KQM C;  1S3P A;  3KPX A;  1LA3 A;  1OZO A;  2I18 A;  1PRW A;  4OR9 B;  1UHN A;  4ORA B;  3TDU A;  4CID A;  3O6B A;  2K7C A;  3RM1 A;  3BUW B;  1YUU A;  3DVJ A;  2LUX A;  2COL B;  1PSB A;  3EK4 A;  3HCM A;  3PM8 A;  5B8I B;  4C0K A;  5AXI A;  1BLQ A;  4GAO A;  1SNL A;  4YGA A;  2JOJ A;  2JT3 A;  1U5I B;  1XFY O;  4GBA A;  4Q04 A;  2WCE A;  1LA0 A;  2I2R E;  2M1K B;  1K90 D;  1B47 A;  2PMY A;  1NX3 A;  3O4Y A;  2LC5 A;  1DJG A;  3NSK A;  4N1F A;  2BBM A;  2ISD A;  4AQJ A;  1AP4 A;  1LVC D;  1UUS A;  1NCX A;  2JT0 A;  2KAY A;  1QJT A;  1EH2 A;  3PSR A;  1PSR A;  2HET A;  2A4J A;  5HYD A;  1DGV A;  2GV5 A;  2KFF A;  1F8H A;  3IF7 A;  4GGF A;  1OE9 B;  2EHB A;  1IRJ A;  1CFC A;  2K2F A;  2AMI A;  4YRU A;  1DGU A;  4PE1 A;  2M9G A;  1IWQ A;  1FPW A;  4HRE E;  1QX2 A;  3H4S E;  1YR5 A;  1SY9 A;  2CXJ A;  2PSR A;  1M31 A;  1R2U A;  2CCM A;  3JTD B;  5JJG A;  1IKU A;  1KFU L;  4WQ3 A;  2F8P A;  1OZS A;  1EG3 A;  1JF2 A;  3KHE A;  2JT8 A;  1ZMZ A;  4JWQ A;  1NSH A;  2LVJ A;  4NDD A;  3SIB A;  1KQV A;  1SBJ A;  1UHI A;  2MJW B;  3JTD C;  1D1O A;  1IQ3 A;  4MRY A;  2KDH A;  2M29 A;  1NYA A;  1J7O A;  4I5N B;  1F4Q A;  5ER4 X;  3CTN A;  1B7T Y;  2CT9 A;  3GK1 A;  1ODB A;  1C7V A;  1CM1 A;  1B9A A;  2TN4 A;  1F70 A;  3EK7 A;  1UUR A;  4D1E A;  3RLZ A;  2PRU A;  2JTZ A;  1QTX A;  1LXF C;  1BMO A;  4GGF C;  2LAP A;  5CSF A;  2BL0 B;  2FJU B;  1NX1 A;  4JPZ B;  1J1D A;  4C0J A;  1K9K A;  1B1G A;  2JRF A;  3TZ1 A;  2Q91 A;  2QPT A;  1N2D A;  4MRX A;  1TTX A;  5ER5 A;  3LCP C;  4CLN A;  3M0W A;  1CDN A;  1WRL A;  2JWW A;  1LKJ A;  1B8L A;  3I5G B;  1K9P A;  3VRO A;  3CLN A;  4MSP A;  2K0J A;  5I2Q A;  1SKT A;  1C7W A;  2P6B B;  5CSI A;  5KSZ A;  1FF1 A;  4YI9 A;  3WNX B;  2M7N A;  2LCP A;  3LLE A;  4C0L A;  1CMG A;  1XO5 A;  1SYM A;  3I5G C;  1QS7 A;  1KSO A;  1CDP A;  2JC2 A;  1KK7 Y;  1UP5 A;  1XVJ A;  2BE6 A;  1OOJ A;  2JUL A;  3AAJ A;  4ZCU A;  1F4O A;  4R1E A;  1J7P A;  2BCA A;  1LIN A;  1NCY A;  2F3Y A;  2E6W A;  3GK2 A;  2SCP A;  4HRH A;  4U8D A;  4DS7 A;  4YGE B;  2PVB A;  4MZL A;  4HSZ A;  1RFJ A;  2FOT A;  1U5I A;  5DKQ A;  1RK9 A;  3ICB A;  1OQP A;  2EC6 B;  3A4U B;  3OP0 A;  2D8N A;  3DF0 B;  3MSE B;  2LVV A;  1YUR A;  3WXA A;  2JQ6 A;  2L51 A;  3NSI A;  2MHH A;  1ZUZ A;  1EG4 A;  2L0P A;  5FYX A;  1UHJ A;  2LMV A;  1MUX A;  5DKR A;  5D69 A;  3AAK A;  3TDZ A;  2M3W A;  2M97 A;  2KI6 C;  2EC6 C;  1W7J B;  3FWC A;  2BCB A;  2PAL A;  2NCP A;  1MXL C;  2KAV A;  1NCZ A;  2LLU A;  1SPY A;  4CPV A;  1G8I A;  1TNX A;  1XFU O;  4N5X A;  1NIW A;  3SJS A;  3CR2 A;  1JF0 A;  1Y1U A;  4PCW A;  1YUS A;  1ZAC A;  2KQY A;  1SRA A;  1YRT B;  1DVI A;  1BOD A;  3EKJ A;  3LK0 A;  1J1E A;  2V53 A;  3BOW B;  1SCM B;  3I5I B;  4PE7 A;  1JFK A;  3AKA A;  4QJ3 B;  3WHU B;  4CFR A;  1DMO A;  1L7Z A;  1QAS A;  2JTT A;  3CR4 X;  5D7F A;  1S5G Y;  4M2P A;  1C07 A;  2KBM A;  2JNF A;  5IBW A;  3BUM B;  2Y1N A;  2OTG B;  3ZNI A;  3JVT B;  1DJZ A;  3I5I C;  1MWN A;  2KAX A;  3D0Y B;  3QRX A;  2M1U A;  4P2Y B;  5G08 A;  2NCO A;  1CLM A;  1XA5 A;  1DJW A;  3VGO A;  5HLO A;  4DIR A;  3D10 A;  2LP2 A;  1AJ5 A;  3O2P A;  3PAL A;  5HKW A;  2OTG C;  1YUT A;  2OPO A;  2O5G A;  1N65 A;  4CFQ A;  2WOR A;  2ZFD A;  1TCO B;  1M46 A;  3FWB A;  1SMG A;  1KWO B;  4PHN A;  4I5J A;  1A29 A;  1XFZ O;  1IG5 A;  1BJF A;  3KEV A;  4GNK B;  4OVN F;  1CLL A;  1TNW A;  1CFD A;  3DVE A;  2F3Z A;  5CSN A;  1G33 A;  2AUC A;  1H4B A;  5JOL A;  1KWO C;  1ALW A;  1ALV A;  1WLZ A;  4OV2 A;  2I7A A;  2O60 A;  2BBN A;  1M39 A;  2K7B A;  4DCK A;  3DD4 A;  1MR8 A;  5AEQ A;  2PAS A;  4A4B A;  1MF8 B;  3SG5 A;  1AHR A;  2K8M B;  2KGR A;  2ZRS A;  3BUX B;  3SG7 A;  1XK4 A;  2CTN A;  1JFJ A;  1FW4 A;  1K94 A;  1HT9 A;  1F71 A;  5F6T A;  4IL1 A;  2WC8 A;  4F0Z B;  3I5H B;  1KK7 Z;  1YRU B;  2L2E A;  1M63 B;  1PK0 D;  2K2A A;  1KFX S;  1NUB A;  2JU0 A;  1UHH A;  4AOM A;  5GQQ C;  1TOP A;  1OSA A;  1XFX O;  3NXA A;  2MLE C;  1QXP A;  2BL0 C;  2LNK A;  3I5H C;  3EKH A;  2WOS A;  4XJK B;  1EL4 A;  1JSA A;  1K93 D;  3DF0 A;  3LL8 B;  2KHN A;  1MQ1 A;  2L50 A;  3F45 A;  1F54 A;  3CR5 X;  4YGB B;  1SR6 B;  2B1U A;  3EVV A;  1K8U A;  1A75 B;  1V1G A;  3BUN B;  1QLK A;  2HQ8 A;  4ORB B;  1YVH A;  2BE4 A;  1S6J A;  4I5L B;  1IGV A;  2L5X B;  1CM4 A;  1ZFS A;  1QIV A;  1XFV O;  1CDL A;  1CLB A;  2KBI A;  3EVU A;  1SR6 C;  1S6I A;  2H61 A;  3GK4 X;  4GGN A;  2H2K A;  2NLN A;  1UHK A;  1CDM A;  2KQ6 A;  2ZKM X;  1XK4 C;  2IS9 A;  2NZ0 A;  1WDC B;  2DOQ A;  2LVK A;  3TS5 B;  1S1E A;  2SAS A;  1NWD A;  1Y1A A;  2LP3 A;  3OB2 B;  5KTY A;  1SW8 A;  2LHI A;  3BOW A;  4PDZ A;  3TUY B;  3VRQ A;  1KK8 B;  1DJH A;  1JBA A;  1JC2 A;  3O78 A;  4DRW A;  1SK6 D;  1WDC C;  3E3R A;  1DF0 B;  3TS5 C;  2K61 A;  1FI5 A;  2NXQ A;  1V1F A;  4M2Q A;  3GOF A;  3TUY C;  1NPQ A;  1Y0V H;  2BCX A;  2Q4U A;  3D0Y A;  1YTZ C;  1TIZ A;  2LE9 B;  3PFV A;  1GQM A;  1CB1 A;  1A2X A;  3BYA A;  3DVM A;  1BG1 A;  1HQV A;  1B8C A;  2KI4 B;  1S26 D;  1K2H A;  2F2O A;  1WRZ A;  2ZN8 A;  2E30 A;  3BUO B;  1WY9 A;  1VRK A;  1DJY A;  2BKI B;  1CKK A;  5DKN A;  1AUI B;  1AVS A;  1QIW A;  3BXK A;  4BY4 A;  1YVL A;  2WND A;  1Y1X A;  2ZRT A;  1FBV A;  3VRN A;  3PLF B;  1KFU S;  1QVI Y;  2LHL A;  1BF5 A;  1NX2 A;  2H61 C;  4OKH A;  1BT6 A;  1MHO A;  2KGB C;  3SG6 A;  3OX6 A;  1MXE A;  4NDC A;  2L4I A;  4WRI A;  3CZT X;  4MVF A;  1CFF A;  2LM5 A;  4AQI A;  2Y4Q A;  4E68 A;  2LMU A;  1SCM C;  3PAT A;  3HX4 A;  1Q80 A;  4MBE A;  2MAZ A;  4M2O A;  2WCF A;  2ZN9 A;  2BEC A;  5CPV A;  5I2O A;  2KNE A;  5AAN A;  2LLS A;  1L2O B;  4YGC B; 
#chains in the Genus database with same CATH topology
 2HF5 A;  1K95 A;  5AFP A;  1IQ5 A;  3JVT C;  3NSO A;  1B7T Z;  4MLW A;  3WHT B;  1NP8 A;  1CNP A;  2KYC A;  3FS7 A;  2FCE A;  4GUK A;  4HRG A;  2JPT A;  4MZJ A;  5CSJ A;  2WC6 A;  4TNC A;  5K89 A;  3SS5 A;  2KSP A;  2KI6 D;  2M0R A;  1S6C A;  1L2O C;  2L4H A;  2JXC A;  5HKZ A;  5HKY A;  2M8U A;  1PVB A;  1J55 A;  4NQG A;  3TDI A;  1QV0 A;  1QX5 B;  1S36 A;  3DVK A;  3C1V A;  4P5O E;  5TNC A;  4L9M A;  5I8N A;  2M49 B;  2ZNE A;  1BR1 B;  1OMV A;  1B4C A;  4BY5 A;  3IQO A;  3K21 A;  4OZD A;  4XJK A;  1IH0 A;  3OHM B;  1OMD A;  1BU3 A;  1Y6W A;  1FI6 A;  5EL2 A;  4ZCV A;  1H8B A;  1E8A A;  2I94 A;  1YX8 A;  1A75 A;  4QJ4 B;  1PUL A;  1XYD A;  1IJ6 A;  2MLF C;  3CGA A;  1TCF A;  1TNQ A;  4DUQ A;  2KYF A;  4GPL B;  5BPJ A;  3NSL A;  5AER A;  2G9B A;  1M45 A;  3CAB A;  1DT7 B;  2MRD A;  4INW A;  3SG4 A;  3S0A A;  4PHM A;  4GFT A;  1DC1 A;  2VRG A;  2MBX A;  1CMF A;  3L47 A;  5D3O A;  3I5F B;  4YBH B;  1PAL A;  3KF9 A;  3EVR A;  1GGW A;  1DTL A;  2CBL A;  2GGZ A;  4MZK A;  4PAL A;  4YGD B;  2LV7 A;  5J3X A;  1CTR A;  1F55 A;  1Z4H A;  2Y5I A;  2F33 A;  3PN7 B;  3D76 A;  1G4Y R;  4MEW A;  2LUC A;  3SIA A;  1SCV A;  2JXL A;  2LAN A;  4FTG A;  2F2P A;  1A4P A;  1OMR A;  1K96 A;  1QV1 A;  3I5F C;  3SG3 A;  1CFP A;  2EGD A;  4N1G A;  1R6P A;  3VRP A;  3A8R A;  3EK8 A;  3FE8 A;  4JQ0 D;  1ORG A;  1OW4 A;  3B7A A;  3OB1 B;  3S0F A;  1DF0 A;  2R2I A;  5HLV A;  4QJ5 B;  1AK8 A;  1BOC A;  1RJV A;  3PN7 C;  1W7I B;  3CS1 A;  2OS8 B;  1YX7 A;  2KFG A;  1XFW O;  3L4L A;  4UPG A;  3FIA A;  2MA2 A;  1DJX A;  3VRR A;  3R1V A;  1WLM A;  2BAP A;  1EJ3 A;  2Y1M A;  1WRK A;  2H8V A;  2HPS A;  1KSM A;  3LK1 A;  3AKB A;  4PE4 A;  4YI8 A;  2WCB A;  2BKH B;  3D73 A;  4WQ2 A;  4MN0 A;  1TUZ A;  2OS8 C;  3ZWH A;  1RWY A;  5KU1 A;  1JUO A;  4ICB A;  2K7O A;  2G2B A;  3NHI A;  2WCK A;  1IJ5 A;  1TN4 A;  1J7Q A;  5PAL A;  2FCD A;  1JWD A;  1QVI Z;  1N0Y A;  2L98 A;  1KCY A;  2AAO A;  1S5G Z;  1SL9 A;  1QX7 A;  4NDB A;  1DQE A;  2CNP A;  2KFH A;  1RTP 1;  4OCI A;  3IQQ A;  1RRO A;  1KFX L;  1KK8 C;  4PE0 A;  4A4C A;  3KO0 A;  1AJ4 A;  1B8R A;  2RGI A;  2K7D A;  1OOH A;  1QAT A;  4PHJ A;  1REC A;  3CWG A;  4PT1 A;  2LLT A;  2LVI A;  4ORC B;  4USL A;  2GGM A;  1GGZ A;  1PVA A;  1QLS A;  2M7L A;  4XYN A;  1X02 A;  1SL7 A;  1ZOT B;  1NX0 A;  1KQM B;  3CZ1 A;  1BR4 B;  1TUJ A;  4I5K A;  4ETO A;  1J7R A;  2JNX A;  2QAC A;  1EXR A;  1UWO A;  3BFH A;  1DJI A;  2JZI A;  1TRF A;  1TNP A;  2KI4 C;  2HQW A;  5I2L A;  3SG2 A;  2KOT A;  2ZND A;  3BQ3 A;  3OX5 A;  4FQO A;  4PHK A;  1SL8 A;  2YGU A;  1A03 A;  3DZT A;  2KLE A;  2LMT A;  1GJY A;  1K9U A;  1KQM C;  1S3P A;  3KPX A;  1LA3 A;  1OZO A;  2I18 A;  1PRW A;  4OR9 B;  1UHN A;  4ORA B;  3TDU A;  1P28 A;  4CID A;  3BFB A;  3O6B A;  2P71 A;  2K7C A;  3RM1 A;  3BUW B;  1YUU A;  3DVJ A;  2LUX A;  2COL B;  1PSB A;  1QWV A;  3EK4 A;  3HCM A;  3PM8 A;  5B8I B;  4C0K A;  5AXI A;  1BLQ A;  4GAO A;  1SNL A;  4YGA A;  2JOJ A;  2JT3 A;  1U5I B;  1XFY O;  4GBA A;  4Q04 A;  3S0G A;  2WCE A;  1LA0 A;  2I2R E;  2M1K B;  1K90 D;  3QME A;  1B47 A;  2PMY A;  1NX3 A;  3O4Y A;  2LC5 A;  1DJG A;  3NSK A;  4N1F A;  2BBM A;  2ISD A;  4AQJ A;  1AP4 A;  1LVC D;  1UUS A;  1NCX A;  2JT0 A;  2KAY A;  1QJT A;  4IJ7 A;  3PSR A;  1EH2 A;  1PSR A;  2HET A;  2A4J A;  3NGV A;  5HYD A;  1DGV A;  2GV5 A;  2KFF A;  1F8H A;  3IF7 A;  4GGF A;  1OE9 B;  2EHB A;  1IRJ A;  3CZ0 A;  1CFC A;  2K2F A;  2AMI A;  3B6X A;  4YRU A;  1DGU A;  4PE1 A;  2M9G A;  1IWQ A;  1FPW A;  4HRE E;  1QX2 A;  3DY9 A;  3H4S E;  1YR5 A;  1SY9 A;  2CXJ A;  2PSR A;  1M31 A;  1R2U A;  2CCM A;  3JTD B;  3S0E A;  5JJG A;  1IKU A;  1KFU L;  4F7F A;  4WQ3 A;  1TWO A;  2F8P A;  1OZS A;  1EG3 A;  1JF2 A;  3CZ2 A;  3KHE A;  2JT8 A;  1ZMZ A;  2WCJ A;  4JWQ A;  1NSH A;  2LVJ A;  4NDD A;  3SIB A;  3B86 A;  1SBJ A;  1KQV A;  1UHI A;  2MJW B;  3JTD C;  1D1O A;  1IQ3 A;  4MRY A;  2KDH A;  2M29 A;  1NYA A;  1J7O A;  4I5N B;  1F4Q A;  2KPH A;  5ER4 X;  3CTN A;  3RZS A;  1B7T Y;  2CT9 A;  3BFA A;  1ODB A;  3GK1 A;  1C7V A;  1CM1 A;  1B9A A;  2TN4 A;  1F70 A;  1T14 A;  1UUR A;  3EK7 A;  2L2C A;  4D1E A;  3RLZ A;  3BJH A;  2PRU A;  2JTZ A;  5FI6 A;  1QTX A;  3CYZ A;  1LXF C;  1BMO A;  4GGF C;  2LAP A;  5CSF A;  2BL0 B;  2FJU B;  1NX1 A;  4JPZ B;  1J1D A;  4C0J A;  1K9K A;  1B1G A;  2JRF A;  3TZ1 A;  2Q91 A;  2QPT A;  1N2D A;  4MRX A;  1TTX A;  5ER5 A;  3D77 A;  3LCP C;  4CLN A;  3M0W A;  1CDN A;  1WRL A;  2JWW A;  1LKJ A;  1B8L A;  3I5G B;  5I94 A;  1K9P A;  4JKT A;  3VRO A;  3CLN A;  4MSP A;  2K0J A;  5I2Q A;  1SKT A;  1C7W A;  2P6B B;  5CSI A;  5KSZ A;  1FF1 A;  4YI9 A;  3WNX B;  2M7N A;  2LCP A;  3LLE A;  3O4X A;  4C0L A;  1CMG A;  1XO5 A;  1OOF A;  1SYM A;  3I5G C;  1QS7 A;  1KSO A;  2KLD A;  1CDP A;  2JC2 A;  3OBV A;  1KK7 Y;  1UP5 A;  1XVJ A;  2BE6 A;  1OOJ A;  2JUL A;  3AAJ A;  4ZCU A;  1F4O A;  4R1E A;  3B88 A;  1J7P A;  1OOG A;  2BCA A;  1LIN A;  1NCY A;  2F3Y A;  3SS4 A;  3CDN A;  2E6W A;  3GK2 A;  2SCP A;  4HRH A;  4U8D A;  3PM2 A;  4DS7 A;  4YGE B;  2PVB A;  4MZL A;  4HSZ A;  1RFJ A;  3PJI A;  2FOT A;  1U5I A;  5DKQ A;  1RK9 A;  3B87 A;  3ICB A;  1OQP A;  2EC6 B;  2QEB A;  3VB1 A;  3A4U B;  3OP0 A;  2D8N A;  3DF0 B;  3MSE B;  2LVV A;  1YUR A;  3V2L A;  3OGN A;  3WXA A;  2JQ6 A;  2L51 A;  3NSI A;  2MHH A;  1ZUZ A;  1EG4 A;  2L0P A;  3D74 A;  5FYX A;  1UHJ A;  2LMV A;  1MUX A;  4INX A;  5D69 A;  3AAK A;  5DKR A;  2M3W A;  2M97 A;  3TDZ A;  2KI6 C;  1LS8 A;  2EC6 C;  1W7J B;  3FWC A;  2BCB A;  2PAL A;  3R72 A;  2NCP A;  2ERB A;  1MXL C;  2KAV A;  1NCZ A;  2LLU A;  1SPY A;  4CPV A;  1G8I A;  1TNX A;  1XFU O;  4N5X A;  1NIW A;  3K1E A;  3CR2 A;  1JF0 A;  1Y1U A;  4PCW A;  5DIC A;  1XFR A;  3SJS A;  1YUS A;  3N7H A;  1ZAC A;  2KQY A;  1SRA A;  3D75 A;  1YRT B;  1DVI A;  1W9Z A;  1BOD A;  3EKJ A;  3LK0 A;  1J1E A;  2V53 A;  3BOW B;  1SCM B;  3DYE A;  3I5I B;  1JFK A;  3AKA A;  4PE7 A;  4QJ3 B;  3WHU B;  4CFR A;  1DMO A;  1L7Z A;  1QAS A;  2JTT A;  3CR4 X;  5D7F A;  3S0D A;  1S5G Y;  4M2P A;  1C07 A;  2KBM A;  2WCL A;  2JNF A;  2PQL A;  3BUM B;  5IBW A;  2Y1N A;  2OTG B;  3ZNI A;  4JD9 A;  3JVT B;  1DJZ A;  2L5Y A;  3I5I C;  1MWN A;  2KAX A;  3D0Y B;  3QRX A;  2M1U A;  4P2Y B;  5G08 A;  2NCO A;  2QDI A;  1CLM A;  1XA5 A;  1DJW A;  4FQT A;  3VGO A;  5HLO A;  2QEV A;  4DIR A;  3D10 A;  2LP2 A;  1AJ5 A;  3O2P A;  3PAL A;  5HKW A;  2OTG C;  2WCM A;  1YUT A;  2OPO A;  2O5G A;  1N65 A;  4CFQ A;  2WOR A;  2ZFD A;  1TCO B;  1M46 A;  3L4A A;  3FWB A;  1SMG A;  1KWO B;  3Q8I A;  1DEK A;  4PHN A;  1OOI X;  4I5J A;  1A29 A;  1XFZ O;  1IG5 A;  1BJF A;  3KEV A;  4GNK B;  4OVN F;  1CLL A;  1TNW A;  1CFD A;  3DVE A;  2F3Z A;  5CSN A;  1G33 A;  2AUC A;  1H4B A;  5JOL A;  1SSE B;  2QEO A;  1KWO C;  1IIO A;  1ALW A;  1ALV A;  1WLZ A;  2JPO A;  2I7A A;  2O60 A;  3R1O A;  4OV2 A;  1C3Y A;  2BBN A;  1M39 A;  2K7B A;  4DCK A;  3DD4 A;  1MR8 A;  5AEQ A;  2PAS A;  4A4B A;  1MF8 B;  3SG5 A;  1AHR A;  2K8M B;  2KGR A;  2ZRS A;  3BUX B;  3SG7 A;  1XK4 A;  2CTN A;  1JFJ A;  1FW4 A;  1K94 A;  1HT9 A;  1F71 A;  5F6T A;  4IL1 A;  2P70 A;  2WC8 A;  4F0Z B;  3I5H B;  1KK7 Z;  1YRU B;  2L2E A;  1M63 B;  1PK0 D;  2FJY A;  2K2A A;  2QEH A;  3D78 A;  1KFX S;  1NUB A;  3EG5 B;  5FI2 A;  2JU0 A;  1UHH A;  3R1P A;  3UO9 A;  4AOM A;  5GQQ C;  1TOP A;  1OSA A;  1XFX O;  3NXA A;  2MLE C;  1QXP A;  2BL0 C;  2LNK A;  3I5H C;  3EKH A;  2WOS A;  4XJK B;  1EL4 A;  1JSA A;  1K93 D;  3DF0 A;  3LL8 B;  2KHN A;  1MQ1 A;  2L50 A;  3F45 A;  1F54 A;  3CR5 X;  4YGB B;  1SR6 B;  2B1U A;  3EVV A;  1K8U A;  1A75 B;  1V1G A;  3BUN B;  1QLK A;  2HQ8 A;  4ORB B;  1YVH A;  2PYQ A;  2BE4 A;  1S6J A;  4I5L B;  1IGV A;  2L5X B;  1CM4 A;  3DXL A;  3FE9 A;  1ZFS A;  1QIV A;  1XFV O;  1CDL A;  1CLB A;  2KBI A;  2GTE A;  1SR6 C;  3EVU A;  1S6I A;  2H61 A;  3GK4 X;  4GGN A;  2H2K A;  2NLN A;  1UHK A;  1CDM A;  2KQ6 A;  2ZKM X;  1XK4 C;  2IS9 A;  2NZ0 A;  1WDC B;  2DOQ A;  2LVK A;  3TS5 B;  1S1E A;  2SAS A;  1NWD A;  1Y1A A;  2LP3 A;  3OB2 B;  5KTY A;  1SW8 A;  2LHI A;  3BOW A;  4PDZ A;  3TUY B;  3VRQ A;  1KK8 B;  1DJH A;  1JBA A;  1JC2 A;  3O78 A;  2BNX A;  4DRW A;  5HL1 A;  1SK6 D;  5FI7 A;  1DEL A;  1WDC C;  3E3R A;  1DF0 B;  3TS5 C;  2K61 A;  1FI5 A;  2NXQ A;  1V1F A;  4M2Q A;  3GOF A;  3NHT A;  3TUY C;  1NPQ A;  1Y0V H;  2BCX A;  2Q4U A;  3D0Y A;  1YTZ C;  1TIZ A;  2LE9 B;  3PFV A;  1GQM A;  1CB1 A;  1A2X A;  3BYA A;  3DVM A;  3IVT A;  1BG1 A;  1HQV A;  1B8C A;  2KI4 B;  1S26 D;  4KYN A;  1K2H A;  2F2O A;  1WRZ A;  2ZN8 A;  2E30 A;  3BUO B;  1WY9 A;  1VRK A;  1DJY A;  2BKI B;  1CKK A;  5DKN A;  1AUI B;  1AVS A;  1QIW A;  3BXK A;  4BY4 A;  1YVL A;  2WND A;  1Y1X A;  2ZRT A;  1FBV A;  3VRN A;  3PLF B;  1KFU S;  1QVI Y;  2LHL A;  1BF5 A;  1NX2 A;  2H61 C;  4OKH A;  1BT6 A;  1MHO A;  2KGB C;  3SG6 A;  3OX6 A;  1MXE A;  2WCH A;  4NDC A;  2L4I A;  4WRI A;  3CZT X;  4MVF A;  1CFF A;  2LM5 A;  3UNW A;  4AQI A;  2Y4Q A;  4E68 A;  2LMU A;  1SCM C;  3FE6 A;  3PAT A;  3HX4 A;  1Z2C B;  1Q80 A;  4MBE A;  2MAZ A;  2WC5 A;  4M2O A;  2WCF A;  2ZN9 A;  1GM0 A;  2BEC A;  3SS3 A;  5CPV A;  5I2O A;  1C3Z A;  2KNE A;  5AAN A;  2LLS A;  1L2O B;  3S0B A;  2K60 A;  4YGC B; 
#chains in the Genus database with same CATH homology
 2HF5 A;  1K95 A;  5AFP A;  1IQ5 A;  3JVT C;  3NSO A;  1B7T Z;  4MLW A;  3WHT B;  1NP8 A;  1CNP A;  2KYC A;  3FS7 A;  2FCE A;  4GUK A;  4HRG A;  2JPT A;  4MZJ A;  5CSJ A;  4TNC A;  5K89 A;  2KSP A;  2KI6 D;  2M0R A;  1S6C A;  1L2O C;  2L4H A;  2JXC A;  5HKZ A;  5HKY A;  2M8U A;  1PVB A;  1J55 A;  4NQG A;  3TDI A;  1QV0 A;  1QX5 B;  1S36 A;  3DVK A;  3C1V A;  4P5O E;  5TNC A;  4L9M A;  5I8N A;  2M49 B;  2ZNE A;  1BR1 B;  1OMV A;  1B4C A;  4BY5 A;  3IQO A;  3K21 A;  4XJK A;  1IH0 A;  3OHM B;  1OMD A;  1BU3 A;  1Y6W A;  1FI6 A;  4ZCV A;  1H8B A;  1E8A A;  2I94 A;  1YX8 A;  1A75 A;  4QJ4 B;  1PUL A;  1XYD A;  1IJ6 A;  2MLF C;  3CGA A;  1TCF A;  1TNQ A;  4DUQ A;  2KYF A;  4GPL B;  5BPJ A;  3NSL A;  5AER A;  2G9B A;  1M45 A;  1DT7 B;  2MRD A;  3SG4 A;  4PHM A;  4GFT A;  2VRG A;  2MBX A;  1CMF A;  3I5F B;  4YBH B;  1PAL A;  3KF9 A;  3EVR A;  1GGW A;  1DTL A;  2CBL A;  2GGZ A;  4MZK A;  4PAL A;  4YGD B;  2LV7 A;  5J3X A;  1CTR A;  1F55 A;  2Y5I A;  2F33 A;  3PN7 B;  1G4Y R;  4MEW A;  2LUC A;  3SIA A;  1SCV A;  2JXL A;  2LAN A;  4FTG A;  2F2P A;  1A4P A;  1OMR A;  1K96 A;  1QV1 A;  3I5F C;  3SG3 A;  1CFP A;  2EGD A;  4N1G A;  1R6P A;  3VRP A;  3A8R A;  3EK8 A;  4JQ0 D;  3OB1 B;  1DF0 A;  2R2I A;  5HLV A;  4QJ5 B;  1AK8 A;  1BOC A;  1RJV A;  3PN7 C;  1W7I B;  3CS1 A;  2OS8 B;  1YX7 A;  2KFG A;  1XFW O;  4UPG A;  3FIA A;  2MA2 A;  1DJX A;  3VRR A;  1WLM A;  1EJ3 A;  2Y1M A;  1WRK A;  2HPS A;  1KSM A;  3LK1 A;  3AKB A;  4PE4 A;  4YI8 A;  2WCB A;  2BKH B;  4WQ2 A;  4MN0 A;  2OS8 C;  3ZWH A;  1RWY A;  5KU1 A;  1JUO A;  4ICB A;  2K7O A;  2G2B A;  1IJ5 A;  1TN4 A;  1J7Q A;  5PAL A;  2FCD A;  1JWD A;  1QVI Z;  1N0Y A;  2L98 A;  1KCY A;  2AAO A;  1S5G Z;  1SL9 A;  1QX7 A;  4NDB A;  2CNP A;  2KFH A;  1RTP 1;  4OCI A;  3IQQ A;  1RRO A;  1KFX L;  1KK8 C;  4PE0 A;  4A4C A;  3KO0 A;  1AJ4 A;  1B8R A;  2RGI A;  2K7D A;  4PHJ A;  1QAT A;  1REC A;  3CWG A;  2LLT A;  2LVI A;  4ORC B;  4USL A;  2GGM A;  1GGZ A;  1PVA A;  1QLS A;  2M7L A;  4XYN A;  1X02 A;  1SL7 A;  1ZOT B;  1NX0 A;  1KQM B;  1BR4 B;  4I5K A;  4ETO A;  1J7R A;  2JNX A;  2QAC A;  1EXR A;  1UWO A;  1DJI A;  2JZI A;  1TRF A;  1TNP A;  2KI4 C;  2HQW A;  5I2L A;  3SG2 A;  2KOT A;  2ZND A;  3BQ3 A;  3OX5 A;  4FQO A;  4PHK A;  1SL8 A;  1A03 A;  2LMT A;  1GJY A;  1K9U A;  1KQM C;  1S3P A;  3KPX A;  1LA3 A;  1OZO A;  2I18 A;  1PRW A;  4OR9 B;  1UHN A;  4ORA B;  3TDU A;  4CID A;  3O6B A;  2K7C A;  3RM1 A;  3BUW B;  1YUU A;  3DVJ A;  2LUX A;  2COL B;  1PSB A;  3EK4 A;  3HCM A;  3PM8 A;  5B8I B;  4C0K A;  5AXI A;  1BLQ A;  4GAO A;  1SNL A;  4YGA A;  2JOJ A;  2JT3 A;  1U5I B;  1XFY O;  4GBA A;  4Q04 A;  2WCE A;  1LA0 A;  2I2R E;  2M1K B;  1K90 D;  1B47 A;  2PMY A;  1NX3 A;  3O4Y A;  2LC5 A;  1DJG A;  3NSK A;  4N1F A;  2BBM A;  2ISD A;  4AQJ A;  1AP4 A;  1LVC D;  1UUS A;  1NCX A;  2JT0 A;  2KAY A;  1QJT A;  1EH2 A;  3PSR A;  1PSR A;  2HET A;  2A4J A;  5HYD A;  1DGV A;  2GV5 A;  2KFF A;  1F8H A;  3IF7 A;  4GGF A;  1OE9 B;  2EHB A;  1IRJ A;  1CFC A;  2K2F A;  2AMI A;  4YRU A;  1DGU A;  4PE1 A;  2M9G A;  1IWQ A;  1FPW A;  4HRE E;  1QX2 A;  3H4S E;  1YR5 A;  1SY9 A;  2CXJ A;  2PSR A;  1M31 A;  1R2U A;  2CCM A;  3JTD B;  5JJG A;  1IKU A;  1KFU L;  4WQ3 A;  2F8P A;  1OZS A;  1EG3 A;  1JF2 A;  3KHE A;  2JT8 A;  1ZMZ A;  4JWQ A;  1NSH A;  2LVJ A;  4NDD A;  3SIB A;  1KQV A;  1SBJ A;  1UHI A;  2MJW B;  3JTD C;  1D1O A;  1IQ3 A;  4MRY A;  2KDH A;  2M29 A;  1NYA A;  1J7O A;  4I5N B;  1F4Q A;  5ER4 X;  3CTN A;  1B7T Y;  2CT9 A;  3GK1 A;  1ODB A;  1C7V A;  1CM1 A;  1B9A A;  2TN4 A;  1F70 A;  3EK7 A;  1UUR A;  4D1E A;  3RLZ A;  2PRU A;  2JTZ A;  1QTX A;  1LXF C;  1BMO A;  4GGF C;  2LAP A;  5CSF A;  2BL0 B;  2FJU B;  1NX1 A;  4JPZ B;  1J1D A;  4C0J A;  1K9K A;  1B1G A;  2JRF A;  3TZ1 A;  2Q91 A;  2QPT A;  1N2D A;  4MRX A;  1TTX A;  5ER5 A;  3LCP C;  4CLN A;  3M0W A;  1CDN A;  1WRL A;  2JWW A;  1LKJ A;  1B8L A;  3I5G B;  1K9P A;  3VRO A;  3CLN A;  4MSP A;  2K0J A;  5I2Q A;  1SKT A;  1C7W A;  2P6B B;  5CSI A;  5KSZ A;  1FF1 A;  4YI9 A;  3WNX B;  2M7N A;  2LCP A;  3LLE A;  4C0L A;  1CMG A;  1XO5 A;  1SYM A;  3I5G C;  1QS7 A;  1KSO A;  1CDP A;  2JC2 A;  1KK7 Y;  1UP5 A;  1XVJ A;  2BE6 A;  1OOJ A;  2JUL A;  3AAJ A;  4ZCU A;  1F4O A;  4R1E A;  1J7P A;  2BCA A;  1LIN A;  1NCY A;  2F3Y A;  2E6W A;  3GK2 A;  2SCP A;  4HRH A;  4U8D A;  4DS7 A;  4YGE B;  2PVB A;  4MZL A;  4HSZ A;  1RFJ A;  2FOT A;  1U5I A;  5DKQ A;  1RK9 A;  3ICB A;  1OQP A;  2EC6 B;  3A4U B;  3OP0 A;  2D8N A;  3DF0 B;  3MSE B;  2LVV A;  1YUR A;  3WXA A;  2JQ6 A;  2L51 A;  3NSI A;  2MHH A;  1ZUZ A;  1EG4 A;  2L0P A;  5FYX A;  1UHJ A;  2LMV A;  1MUX A;  5DKR A;  5D69 A;  3AAK A;  3TDZ A;  2M3W A;  2M97 A;  2KI6 C;  2EC6 C;  1W7J B;  3FWC A;  2BCB A;  2PAL A;  2NCP A;  1MXL C;  2KAV A;  1NCZ A;  2LLU A;  1SPY A;  4CPV A;  1G8I A;  1TNX A;  1XFU O;  4N5X A;  1NIW A;  3SJS A;  3CR2 A;  1JF0 A;  1Y1U A;  4PCW A;  1YUS A;  1ZAC A;  2KQY A;  1SRA A;  1YRT B;  1DVI A;  1BOD A;  3EKJ A;  3LK0 A;  1J1E A;  2V53 A;  3BOW B;  1SCM B;  3I5I B;  4PE7 A;  1JFK A;  3AKA A;  4QJ3 B;  3WHU B;  4CFR A;  1DMO A;  1L7Z A;  1QAS A;  2JTT A;  3CR4 X;  5D7F A;  1S5G Y;  4M2P A;  1C07 A;  2KBM A;  2JNF A;  5IBW A;  3BUM B;  2Y1N A;  2OTG B;  3ZNI A;  3JVT B;  1DJZ A;  3I5I C;  1MWN A;  2KAX A;  3D0Y B;  3QRX A;  2M1U A;  4P2Y B;  5G08 A;  2NCO A;  1CLM A;  1XA5 A;  1DJW A;  3VGO A;  5HLO A;  4DIR A;  3D10 A;  2LP2 A;  1AJ5 A;  3O2P A;  3PAL A;  5HKW A;  2OTG C;  1YUT A;  2OPO A;  2O5G A;  1N65 A;  4CFQ A;  2WOR A;  2ZFD A;  1TCO B;  1M46 A;  3FWB A;  1SMG A;  1KWO B;  4PHN A;  4I5J A;  1A29 A;  1XFZ O;  1IG5 A;  1BJF A;  3KEV A;  4GNK B;  4OVN F;  1CLL A;  1TNW A;  1CFD A;  3DVE A;  2F3Z A;  5CSN A;  1G33 A;  2AUC A;  1H4B A;  5JOL A;  1KWO C;  1ALW A;  1ALV A;  1WLZ A;  4OV2 A;  2I7A A;  2O60 A;  2BBN A;  1M39 A;  2K7B A;  4DCK A;  3DD4 A;  1MR8 A;  5AEQ A;  2PAS A;  4A4B A;  1MF8 B;  3SG5 A;  1AHR A;  2K8M B;  2KGR A;  2ZRS A;  3BUX B;  3SG7 A;  1XK4 A;  2CTN A;  1JFJ A;  1FW4 A;  1K94 A;  1HT9 A;  1F71 A;  5F6T A;  4IL1 A;  2WC8 A;  4F0Z B;  3I5H B;  1KK7 Z;  1YRU B;  2L2E A;  1M63 B;  1PK0 D;  2K2A A;  1KFX S;  1NUB A;  2JU0 A;  1UHH A;  4AOM A;  5GQQ C;  1TOP A;  1OSA A;  1XFX O;  3NXA A;  2MLE C;  1QXP A;  2BL0 C;  2LNK A;  3I5H C;  3EKH A;  2WOS A;  4XJK B;  1EL4 A;  1JSA A;  1K93 D;  3DF0 A;  3LL8 B;  2KHN A;  1MQ1 A;  2L50 A;  3F45 A;  1F54 A;  3CR5 X;  4YGB B;  1SR6 B;  2B1U A;  3EVV A;  1K8U A;  1A75 B;  1V1G A;  3BUN B;  1QLK A;  2HQ8 A;  4ORB B;  1YVH A;  2BE4 A;  1S6J A;  4I5L B;  1IGV A;  2L5X B;  1CM4 A;  1ZFS A;  1QIV A;  1XFV O;  1CDL A;  1CLB A;  2KBI A;  3EVU A;  1SR6 C;  1S6I A;  2H61 A;  3GK4 X;  4GGN A;  2H2K A;  2NLN A;  1UHK A;  1CDM A;  2KQ6 A;  2ZKM X;  1XK4 C;  2IS9 A;  2NZ0 A;  1WDC B;  2DOQ A;  2LVK A;  3TS5 B;  1S1E A;  2SAS A;  1NWD A;  1Y1A A;  2LP3 A;  3OB2 B;  5KTY A;  1SW8 A;  2LHI A;  3BOW A;  4PDZ A;  3TUY B;  3VRQ A;  1KK8 B;  1DJH A;  1JBA A;  1JC2 A;  3O78 A;  4DRW A;  1SK6 D;  1WDC C;  3E3R A;  1DF0 B;  3TS5 C;  2K61 A;  1FI5 A;  2NXQ A;  1V1F A;  4M2Q A;  3GOF A;  3TUY C;  1NPQ A;  1Y0V H;  2BCX A;  2Q4U A;  3D0Y A;  1YTZ C;  1TIZ A;  2LE9 B;  3PFV A;  1GQM A;  1CB1 A;  1A2X A;  3BYA A;  3DVM A;  1BG1 A;  1HQV A;  1B8C A;  2KI4 B;  1S26 D;  1K2H A;  2F2O A;  1WRZ A;  2ZN8 A;  2E30 A;  3BUO B;  1WY9 A;  1VRK A;  1DJY A;  2BKI B;  1CKK A;  5DKN A;  1AUI B;  1AVS A;  1QIW A;  3BXK A;  4BY4 A;  1YVL A;  2WND A;  1Y1X A;  2ZRT A;  1FBV A;  3VRN A;  3PLF B;  1KFU S;  1QVI Y;  2LHL A;  1BF5 A;  1NX2 A;  2H61 C;  4OKH A;  1BT6 A;  1MHO A;  2KGB C;  3SG6 A;  3OX6 A;  1MXE A;  4NDC A;  2L4I A;  4WRI A;  3CZT X;  4MVF A;  1CFF A;  2LM5 A;  4AQI A;  2Y4Q A;  4E68 A;  2LMU A;  1SCM C;  3PAT A;  3HX4 A;  1Q80 A;  4MBE A;  2MAZ A;  4M2O A;  2WCF A;  2ZN9 A;  2BEC A;  5CPV A;  5I2O A;  2KNE A;  5AAN A;  2LLS A;  1L2O B;  4YGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...