4OR9B

Crystal structure of human calcineurin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
b'ASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit be
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Homo sapiens
molecule tags Hydrolase/metal binding protein
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4or9B00
4I5KA 2KI4C 2JULA 1WDCC 4YGBB 1B4CA 2L2EA 4UPGA 1QX7A 3VGOA 4YGDB 3TS5B 1SBJA 3I5FB 1M45A 5AXIA 1YUSA 2E30A 1MF8B 1TOPA 2JT0A 3TUYB 2M29A 5ER5A 1C07A 4PHJA 3TDZA 5AERA 3VRNA 5FYXA 3SG2A 3WHUB 2KBIA 5K89A 4IL1A 2L4HA 1DVIA 1OSAA 4OKHA 4CPVA 3AAJA 2CNPA 2LUCA 4ICBA 1RWYA 1SPYA 1QV0A 1H4BA 1UHNA 1QIVA 4PDZA 2KBMA 1UUSA 1XFYO 2LVJA 1KFXS 2LVKA 1EG3A 1W7JB 1S36A 2NCPA 4A4BA 2JOJA 1AJ5A 3FWBA 3SIAA 3PSRA 4FTGA 3KEVA 5F6TA 1J1EA 2BCAA 1BLQA 2D8NA 1NX0A 2BBMA 5HKYA 4M2OA 4GUKA 1YVHA 2K0JA 4WQ2A 1V1GA 1XYDA 3AKBA 2PASA 5KTYA 4YBHB 1CDNA 5HLOA 1QLSA 1QTXA 2KYCA 4ORAB 3DVJA 1YUTA 1L2OB 2ZRSA 3VROA 2CT9A 1XA5A 1RTP1 3BQ3A 3TDIA 1A4PA 3NSKA 1DGUA 1NSHA 1SL9A 2PMYA 3BUNB 1DJIA 1IG5A 4ETOA 1IQ3A 3I5GB 1N65A 4Q04A 3FS7A 4XYNA 2JTTA 1F70A 3DD4A 2LMTA 1UHHA 3BUXB 1NCYA 2Y4QA 4E68A 1CLMA 5I2OA 3EK4A 1CFFA 1A03A 4QJ4B 1AUIB 3PLFB 3I5HC 4GPLB 5J3XA 1F4QA 2G9BA 3SG6A 1GGWA 5DKNA 4XJKB 1CLLA 3BOWB 2F33A 2WCFA 3CR2A 1B7TY 3A4UB 1QVIY 5B8IB 1S6JA 1ZFSA 3BXKA 2RGIA 2COLB 1OMVA 2F3YA 4I5LB 1M63B 4NDBA 1XK4C 2NLNA 2LLUA 2K2FA 1DF0B 1XK4A 4GGNA 2LC5A 1K93D 1LA3A 5I2QA 1LXFC 2KFFA 3JTDB 3LK0A 1DT7B 4MLWA 1M46A 2LLSA 1BR1B 2LCPA 5IBWA 1GGZA 3OP0A 4AQIA 1DTLA 4OVNF 2H61C 2KYFA 1QXPA 3DF0A 4DS7A 2H61A 1G4YR 1KSMA 2F3ZA 4OV2A 1SL8A 4PHMA 3VRQA 2JC2A 3ICBA 2MJWB 1B8LA 2WCEA 1J7PA 2JZIA 3H4SE 2OS8C 1UWOA 3GOFA 1YTZC 3HX4A 1LVCD 2LMUA 3PATA 1JFJA 4MRXA 1OOJA 3RM1A 1VRKA 1KK7Z 1YX8A 2K2AA 1QS7A 1EJ3A 2FCDA 1YX7A 1TNXA 1QX5B 1LINA 1SCMC 3PN7B 1B1GA 3M0WA 2JT3A 5HYDA 1WDCB 5PALA 3JVTC 1NYAA 2BL0C 2KDHA 1NX1A 3BUOB 2PVBA 3DVMA 1SKTA 1K95A 2Q91A 3EKJA 3CWGA 4U8DA 1UHKA 2HF5A 1OZSA 3O6BA 1MXLC 4MZLA 2M97A 1N0YA 5CSJA 2EC6C 1KQMB 4YI8A 4MBEA 4TNCA 1BT6A 1MWNA 1G33A 1S6CA 1TCFA 2JT8A 3GK2A 4N1FA 1SK6D 2ZKMX 4GBAA 3PM8A 1RROA 1TNWA 2LHLA 2AUCA 2OTGC 2Y5IA 3I5IB 5G08A 2I2RE 3ZWHA 2GGZA 3WNXB 4I5JA 1YURA 2HQ8A 1K9UA 1EXRA 4M2PA 5CSFA 2ISDA 1K9KA 1ODBA 1IJ5A 2L4IA 4AOMA 2JTZA 1JC2A 1GQMA 4MRYA 1EL4A 2JU0A 3BYAA 4PE7A 4DCKA 3HCMA 3CR4X 1NPQA 3GK4X 4N1GA 1WRKA 4YRUA 1R2UA 4PALA 1TN4A 1WLZA 4CFRA 3VRPA 4ORBB 3SG3A 4N5XA 2L0PA 1UURA 3TS5C 3I5FC 2G2BA 1U5IB 3OB2B 1WLMA 3IQQA 4PE1A 2SASA 1KQVA 1B8CA 1MHOA 3KO0A 4PE0A 3TUYC 1SR6B 2M7NA 1JFKA 2PRUA 3PFVA 2WORA 2GGMA 1D1OA 2LVIA 2LLTA 1JF2A 2H2KA 1SRAA 1FBVA 2ZRTA 1K90D 4L9MA 4ZCUA 3EVRA 1FPWA 1CMFA 2KFGA 2BECA 5AEQA 1F54A 1KK7Y 1SL7A 2M7LA 2GV5A 2HETA 2LAPA 2NCOA 4YGAA 5HKWA 3BUMB 1WY9A 4WQ3A 1KWOC 2L98A 4JWQA 4GAOA 2LUXA 3WXAA 2AAOA 1CDPA 1RJVA 1K8UA 5ER4X 1FW4A 4BY4A 1K9PA 1S26D 2WOSA 3DVEA 2M1UA 4PHKA 3NXAA 1BG1A 1NX2A 2CBLA 1TTXA 1KCYA 3OX6A 4DIRA 3TDUA 2EGDA 3CZTX 3D0YB 5JOLA 1L2OC 3PALA 1CKKA 1KK8C 2Y1MA 4DUQA 1JF0A 4R1EA 3LLEA 5DKQA 2LV7A 1N2DA 1QV1A 4ZCVA 2ZN9A 3K21A 1HQVA 2KOTA 2ZFDA 3I5GC 3LK1A 1OQPA 3WHTB 1DJXA 3OX5A 2MAZA 1ALWA 3EK7A 1GJYA 1NP8A 2KFHA 2NZ0A 3IF7A 1E8AA 1MUXA 1J7RA 4OR9B 1RK9A 1AP4A 2E6WA 1PULA 1Y1UA 1F55A 1YRTB 1FF1A 1XFXO 1PK0D 3SG4A 3EK8A 3O4YA 4JQ0D 1CMGA 4MSPA 2L50A 1YRUB 2I7AA 1BU3A 1PVBA 4GGFC 1S5GZ 1W7IB 3CGAA 4MZKA 1XO5A 4NQGA 2FCEA 4M2QA 1CM4A 4GGFA 5JJGA 2JWWA 1NCZA 1DMOA 3FWCA 1SY9A 2M9GA 4XJKA 3BOWA 3F45A 1AJ4A 1ALVA 5HKZA 1S6IA 4P5OE 5D69A 3EVVA 2M8UA 2BCBA 2F2PA 1MR8A 2EC6B 2KAVA 1A29A 1Y0VH 2KI4B 3JTDC 1DF0A 4I5NB 2PSRA 3NSIA 4YGEB 1IRJA 1S1EA 2EHBA 2BBNA 1DJWA 1ZMZA 2R2IA 1F4OA 4AQJA 1J7OA 4MN0A 2K7DA 1BMOA 2CXJA 3KHEA 1LKJA 1XFUO 1WRLA 3O2PA 2LE9B 5CPVA 1NIWA 4YGCB 4ORCB 2O5GA 2V53A 5KSZA 1JSAA 2IS9A 2F2OA 2TN4A 2WCBA 1B8RA 4C0KA 1YVLA 2KNEA 3QRXA 2K61A 3SG7A 2L51A 2QACA 1NWDA 1SW8A 1TIZA 1EG4A 1DGVA 2BKHB 1G8IA 1CLBA 2M3WA 1IKUA 1HT9A 1SYMA 3A8RA 1IH0A 2LP2A 1K2HA 2WNDA 2KSPA 2MRDA 4FQOA 1K96A 2JNXA 2KGRA 2P6BB 1X02A 4HRHA 1A2XA 2HPSA 2M49B 4YI9A 2BE4A 1QATA 4C0JA 1XVJA 1XFZO 1JWDA 4GFTA 2KQ6A 3IQOA 3KPXA 1DJZA 2HQWA 3RLZA 3VRRA 1Y6WA 4D1EA 2LHIA 1KQMC 1A75B 1YUUA 4JPZB 1KFUL 1QJTA 5BPJA 1TCOB 3OB1B 2O60A 1CFPA 1SNLA 2AMIA 1PRWA 2ZNEA 4CLNA 2QPTA 2WC8A 3C1VA 3I5IC 1KWOB 1OMDA 1CNPA 1S5GY 2K7BA 2L5XB 1CDLA 2KAYA 4OCIA 1WRZA 1BJFA 1IWQA 1QASA 3GK1A 2K8MB 4PE4A 1Y1XA 2JNFA 1NCXA 3I5HB 1FI5A 3LCPC 2JXCA 3LL8B 1M31A 1IQ5A 1CFDA 4DRWA 4CFQA 1TNPA 3SG5A 3FIAA 1F71A 4PCWA 4USLA 5GQQC 4P2YB 1M39A 3ZNIA 1KK8B 1B9AA 1L7ZA 2CCMA 2KI6C 1CM1A 1V1FA 1A75A 2K7OA 4A4CA 1DJGA 2M1KB 1UP5A 1JBAA 1UHIA 2BE6A 1Q80A 4MZJA 1U5IA 1SR6C 2BKIB 3SJSA 2I18A 1BOCA 3DF0B 3O78A 4BY5A 1OE9B 4MVFA 5I2LA 1DJHA 3AAKA 5KU1A 2JXLA 1J1DA 2Q4UA 1PALA 1UHJA 4NDDA 1DJYA 1BF5A 2MBXA 2MLFC 3MSEB 4C0LA 2LMVA 1ZOTB 1ZUZA 2JQ6A 1AVSA 1RFJA 1QIWA 2PALA 2F8PA 4F0ZB 1FI6A 1KFXL 2OS8B 5AANA 5HLVA 4HRGA 1SCVA 2KQYA 4QJ3B 2JPTA 1YR5A 1K94A 1NX3A 3CTNA 1NUBA 2NXQA 3KF9A 3SIBA 2FOTA 1C7VA 1AK8A 1J7QA 3EKHA 4WRIA 2BCXA 2MA2A 5D7FA 5DKRA 1SCMB 2LNKA 2KHNA 5CSIA 3CLNA 3EVUA 1QX2A 5CSNA 3JVTB 2BL0B 5AFPA 2M0RA 2Y1NA 5I8NA 1CDMA 1QLKA 4PHNA 2KI6D 2ZNDA 1F8HA 2FJUB 5TNCA 1RECA 1J55A 1BODA 1XFVO 3D0YA 2KAXA 2LVVA 1H8BA 1CTRA 1AHRA 4GNKB 1ZACA 1XFWO 4CIDA 1R6PA 3DVKA 2VRGA 1OMRA 1EH2A 2CTNA 2LM5A 3BUWB 1LA0A 1TRFA 1C7WA 1KSOA 3AKAA 3D10A 3E3RA 1KFUS 3CS1A 2DOQA 3NSLA 2I94A 2LP3A 2B1UA 2K7CA 2OTGB 3CR5X 1PSRA 1BR4B 3NSOA 4HSZA 1CB1A 1IGVA 2JRFA 1TNQA 3OHMB 4HREE 4NDCA 1CFCA 1JUOA 1SMGA 1MQ1A 1OZOA 4QJ5B 2MLEC 1IJ6A 2OPOA 4MEWA 2SCPA 3TZ1A 2A4JA 1PVAA 1PSBA 1Y1AA 1B7TZ 1QVIZ 1MXEA 2KGBC 2MHHA 1B47A 1S3PA 2ZN8A 3PN7C 2LANA
chains in the Genus database with same CATH superfamily
4I5KA 2KI4C 2JULA 1WDCC 4YGBB 1B4CA 2ERBA 2L2EA 4UPGA 1QX7A 3VGOA 4YGDB 3TS5B 1SBJA 3I5FB 1M45A 5AXIA 1YUSA 2E30A 1MF8B 1TOPA 2JT0A 3TUYB 2M29A 5ER5A 1C07A 2PYQA 4PHJA 1Z2CB 3TDZA 1ORGA 5AERA 3VRNA 5FYXA 3SG2A 3WHUB 2KBIA 5K89A 4IL1A 2L4HA 1DVIA 1OSAA 2WCKA 4OKHA 4CPVA 3AAJA 2CNPA 2KLEA 2LUCA 4ICBA 1RWYA 1SPYA 1QV0A 1H4BA 1UHNA 1QIVA 4PDZA 2KBMA 1UUSA 1XFYO 1TWOA 2LVJA 1KFXS 2LVKA 1EG3A 1W7JB 1S36A 2NCPA 4A4BA 2JOJA 1AJ5A 3FWBA 3SIAA 3PSRA 4FTGA 3KEVA 5F6TA 1J1EA 2PQLA 2BCAA 1BLQA 2D8NA 1NX0A 2BBMA 5HKYA 4M2OA 4GUKA 1YVHA 3O4XA 2K0JA 2JPOA 4WQ2A 1V1GA 1XYDA 3AKBA 2PASA 5KTYA 4YBHB 1CDNA 5HLOA 1QLSA 1QTXA 2KYCA 4ORAB 3DVJA 1YUTA 1L2OB 2WCLA 2ZRSA 2CT9A 3VROA 1XA5A 1RTP1 3BQ3A 3TDIA 1A4PA 3NSKA 1DGUA 1NSHA 1AP4A 1SL9A 2PMYA 3BUNB 3Q8IA 1DJIA 1IIOA 1IG5A 4ETOA 1IQ3A 3I5GB 1N65A 4Q04A 3FS7A 1OOFA 4XYNA 3CZ1A 2JTTA 3NGVA 1F70A 3DYEA 3DD4A 2LMTA 1UHHA 3BUXB 1NCYA 2Y4QA 4E68A 1CLMA 3D76A 5I2OA 3EK4A 1CFFA 1A03A 4QJ4B 2QEHA 3NHIA 1AUIB 3PLFB 3I5HC 4GPLB 5J3XA 1F4QA 2G9BA 3R1OA 3SG6A 5DKNA 1GGWA 4XJKB 1CLLA 3BOWB 2F33A 2WCFA 3CR2A 1B7TY 3A4UB 1QVIY 5B8IB 1DEKA 1S6JA 1ZFSA 3BXKA 4PT1A 3SS3A 3IVTA 2RGIA 3SS5A 2COLB 1OMVA 2F3YA 4I5LB 1M63B 4NDBA 1XK4C 2NLNA 2LLUA 2K2FA 1DF0B 1XK4A 4GGNA 2LC5A 1K93D 1LA3A 5I2QA 1LXFC 2KFFA 3JTDB 3LK0A 1DT7B 1QWVA 4MLWA 3CZ0A 1M46A 2LLSA 1BR1B 2LCPA 5IBWA 1GGZA 3OP0A 3DZTA 4AQIA 1DTLA 4JKTA 2H61C 2KYFA 1QXPA 4OVNF 3DF0A 4DS7A 2H61A 1G4YR 1KSMA 2F3ZA 4OV2A 1SL8A 4JD9A 4PHMA 3VRQA 2JC2A 3ICBA 2MJWB 3VB1A 1B8LA 2WCEA 2BNXA 1J7PA 2JZIA 3H4SE 3S0AA 2L5YA 2OS8C 1UWOA 3GOFA 3K1EA 1YTZC 3HX4A 1LVCD 2LMUA 3PATA 4KYNA 1JFJA 4MRXA 1OOJA 3RM1A 1VRKA 1KK7Z 1YX8A 3D77A 2K2AA 1QS7A 3D75A 1EJ3A 2FCDA 1YX7A 1TNXA 2K60A 1QX5B 1LINA 1SCMC 3PN7B 1B1GA 3M0WA 2JT3A 5HYDA 1WDCB 5PALA 3JVTC 1NYAA 2BL0C 2KDHA 1NX1A 3BUOB 2PVBA 3DVMA 1SKTA 1K95A 2Q91A 2WCMA 3EKJA 3CWGA 4U8DA 1UHKA 2HF5A 1OZSA 3O6BA 1MXLC 4MZLA 2M97A 1N0YA 5CSJA 2EC6C 1KQMB 4YI8A 4MBEA 4TNCA 1BT6A 1MWNA 1G33A 1S6CA 1TCFA 2JT8A 3GK2A 4N1FA 1SK6D 1LS8A 2ZKMX 4GBAA 3V2LA 3PM8A 1RROA 2L2CA 1TNWA 2LHLA 2AUCA 2OTGC 2Y5IA 3I5IB 5G08A 3CDNA 3D78A 2I2RE 3ZWHA 2GGZA 3WNXB 4I5JA 1YURA 2HQ8A 1K9UA 1EXRA 1TUJA 4M2PA 5CSFA 2ISDA 1K9KA 1ODBA 1IJ5A 2L4IA 4AOMA 2JTZA 2H8VA 2WCJA 1JC2A 1GQMA 4MRYA 1EL4A 2JU0A 3BYAA 4PE7A 4DCKA 3HCMA 1W9ZA 3CR4X 1NPQA 3GK4X 4N1GA 1WRKA 3BFHA 3S0FA 4YRUA 1R2UA 3RZSA 4PALA 1TN4A 1WLZA 1DQEA 4CFRA 3VRPA 4ORBB 3SG3A 4N5XA 2L0PA 1UURA 3TS5C 3I5FC 2G2BA 1U5IB 3OB2B 1WLMA 3IQQA 4PE1A 2SASA 1KQVA 1OW4A 1B8CA 1MHOA 3KO0A 4PE0A 5EL2A 1SR6B 2M7NA 4FQTA 3TUYC 1JFKA 3R1VA 2PRUA 3PFVA 2WORA 2GGMA 1D1OA 2LVIA 3SS4A 2LLTA 1JF2A 2H2KA 3L4AA 1SRAA 1FBVA 2ZRTA 1K90D 4L9MA 3B7AA 4ZCUA 3EVRA 1FPWA 1CMFA 2KFGA 2BECA 5AEQA 1F54A 1KK7Y 1SL7A 2M7LA 3B88A 2GV5A 2HETA 2LAPA 2NCOA 4YGAA 5HKWA 3BUMB 1TUZA 1WY9A 4WQ3A 2QDIA 1KWOC 2L98A 4JWQA 4GAOA 2LUXA 3WXAA 2AAOA 1SSEB 1CDPA 1RJVA 1K8UA 5ER4X 1FW4A 4BY4A 1K9PA 3R72A 1S26D 2WOSA 3DVEA 2M1UA 4PHKA 3NXAA 1BG1A 1NX2A 2CBLA 3L47A 1TTXA 1GM0A 3BFAA 1KCYA 3OX6A 4DIRA 3TDUA 4INXA 2EGDA 3CZTX 3D0YB 5FI2A 5JOLA 1L2OC 3PALA 3PJIA 1CKKA 1KK8C 2Y1MA 4DUQA 3CABA 1JF0A 4R1EA 3LLEA 5DKQA 2LV7A 1N2DA 3BFBA 1QV1A 4ZCVA 2ZN9A 3K21A 1HQVA 2KOTA 2ZFDA 3I5GC 3LK1A 1OQPA 3WHTB 1OOIX 1DJXA 3EG5B 3OX5A 2MAZA 1ALWA 2QEOA 3EK7A 1GJYA 1NP8A 2KFHA 2NZ0A 3IF7A 1E8AA 1MUXA 1J7RA 4OR9B 1RK9A 5D3OA 5FI6A 2E6WA 1PULA 1Y1UA 3FE9A 1YRTB 1F55A 1XFXO 1FF1A 1PK0D 3SG4A 2BAPA 3EK8A 3O4YA 4JQ0D 1CMGA 4MSPA 2L50A 1YRUB 2I7AA 1BU3A 1PVBA 4GGFC 1S5GZ 1W7IB 3CGAA 4MZKA 1XO5A 4NQGA 2FCEA 4M2QA 1CM4A 2YGUA 3D73A 4GGFA 5JJGA 2JWWA 1NCZA 1DMOA 3FWCA 1SY9A 2M9GA 4XJKA 3BOWA 3F45A 1AJ4A 3S0EA 1ALVA 4OZDA 5HKZA 3UNWA 1S6IA 4P5OE 5D69A 3EVVA 2M8UA 2BCBA 2F2PA 1MR8A 2EC6B 2KAVA 1A29A 1Y0VH 2KI4B 3JTDC 1DF0A 4I5NB 2PSRA 3NSIA 4YGEB 1IRJA 1S1EA 2EHBA 2BBNA 1DJWA 1ZMZA 2R2IA 1F4OA 4AQJA 1J7OA 4MN0A 2K7DA 1BMOA 2CXJA 3KHEA 1LKJA 1XFUO 1WRLA 3O2PA 2LE9B 5CPVA 3B86A 1NIWA 4YGCB 4ORCB 1T14A 2O5GA 2V53A 5KSZA 1JSAA 2IS9A 2F2OA 2TN4A 2WCBA 1B8RA 4C0KA 2WCHA 4IJ7A 1YVLA 2KNEA 3QRXA 2K61A 3SG7A 2L51A 2QACA 1NWDA 1SW8A 1TIZA 3PM2A 1EG4A 3OBVA 1DGVA 2BKHB 1G8IA 3QMEA 1CLBA 2M3WA 1IKUA 1HT9A 1SYMA 3A8RA 1IH0A 2LP2A 1K2HA 2WNDA 2KSPA 2MRDA 4FQOA 1K96A 2JNXA 2KGRA 2P6BB 1X02A 4HRHA 1A2XA 2HPSA 2M49B 2P71A 4YI9A 5DICA 3S0GA 5FI7A 2P70A 2BE4A 1QATA 3FE6A 4C0JA 1XVJA 1XFZO 3DXLA 1JWDA 4GFTA 2KQ6A 3IQOA 3L4LA 3B6XA 3KPXA 1DJZA 2HQWA 3RLZA 3VRRA 1Y6WA 4D1EA 1DC1A 2LHIA 1KQMC 1A75B 1YUUA 4JPZB 1KFUL 1QJTA 3S0BA 5BPJA 1TCOB 3OB1B 2O60A 1C3YA 1CFPA 1SNLA 2AMIA 1PRWA 2ZNEA 4CLNA 2QPTA 2WC8A 3C1VA 3I5IC 1KWOB 2WC5A 1OMDA 3OGNA 1CNPA 1S5GY 2K7BA 2L5XB 1CDLA 2KAYA 4OCIA 1WRZA 1BJFA 1IWQA 1QASA 3GK1A 2K8MB 1C3ZA 4PE4A 1Y1XA 2JNFA 1OOHA 1NCXA 3I5HB 1FI5A 3LCPC 2JXCA 3LL8B 1M31A 1IQ5A 1CFDA 4DRWA 3CYZA 4CFQA 1TNPA 3SG5A 3FIAA 1F71A 4PCWA 3N7HA 4USLA 5GQQC 4P2YB 1M39A 3ZNIA 1KK8B 1B9AA 1L7ZA 2CCMA 2KI6C 1CM1A 1V1FA 2QEVA 1A75A 1P28A 2K7OA 4A4CA 1DJGA 4F7FA 2M1KB 2QEBA 1UP5A 1JBAA 1UHIA 2BE6A 1Q80A 4MZJA 1U5IA 1SR6C 2BKIB 3BJHA 2I18A 3SJSA 3DF0B 1BOCA 3O78A 4BY5A 1OE9B 4MVFA 5I2LA 1DJHA 3AAKA 5KU1A 2JXLA 1J1DA 2Q4UA 1PALA 1UHJA 4NDDA 1DJYA 1BF5A 2MBXA 2MLFC 3MSEB 4C0LA 2LMVA 1ZOTB 1ZUZA 2JQ6A 2WC6A 1AVSA 1RFJA 1QIWA 2PALA 2F8PA 4F0ZB 1FI6A 1KFXL 2OS8B 5AANA 5HLVA 4HRGA 1SCVA 2KQYA 4QJ3B 2JPTA 1YR5A 1K94A 3DY9A 1NX3A 3CTNA 1NUBA 2NXQA 3KF9A 3SIBA 5I94A 2FOTA 1C7VA 1AK8A 1J7QA 3EKHA 4WRIA 2BCXA 2MA2A 5D7FA 1OOGA 5DKRA 1SCMB 2LNKA 2KHNA 5CSIA 1Z4HA 3CLNA 3EVUA 3R1PA 1QX2A 5CSNA 3JVTB 2BL0B 5AFPA 2M0RA 2Y1NA 5I8NA 1CDMA 1QLKA 4PHNA 3B87A 2KI6D 2ZNDA 1F8HA 2FJUB 5TNCA 2GTEA 1RECA 3UO9A 1J55A 1BODA 1XFVO 3D0YA 2KAXA 3NHTA 2LVVA 1H8BA 1CTRA 1AHRA 4GNKB 1ZACA 1DELA 3S0DA 1XFWO 4CIDA 1R6PA 3DVKA 2VRGA 1OMRA 1EH2A 2CTNA 2FJYA 2LM5A 3BUWB 1LA0A 1TRFA 1C7WA 1KSOA 3AKAA 3D10A 3E3RA 1KFUS 3CS1A 2DOQA 2KLDA 3NSLA 2I94A 1XFRA 2LP3A 2B1UA 2K7CA 2OTGB 3CR5X 3FE8A 1PSRA 1BR4B 3NSOA 3CZ2A 4HSZA 1CB1A 1IGVA 2JRFA 1TNQA 3OHMB 4HREE 4INWA 4NDCA 1CFCA 1JUOA 1SMGA 1MQ1A 1OZOA 4QJ5B 2MLEC 3PN7C 1IJ6A 2OPOA 4MEWA 2SCPA 3TZ1A 2A4JA 1PVAA 1PSBA 1Y1AA 1B7TZ 3D74A 1QVIZ 1MXEA 2KGBC 2MHHA 5HL1A 1B47A 1S3PA 2ZN8A 2KPHA 2LANA
chains in the Genus database with same CATH topology
4I5KA 2KI4C 2JULA 1WDCC 4YGBB 1B4CA 2L2EA 4UPGA 1QX7A 3VGOA 4YGDB 3TS5B 1SBJA 3I5FB 1M45A 5AXIA 1YUSA 2E30A 1MF8B 1TOPA 2JT0A 3TUYB 2M29A 5ER5A 1C07A 4PHJA 3TDZA 5AERA 3VRNA 5FYXA 3SG2A 3WHUB 2KBIA 5K89A 4IL1A 2L4HA 1DVIA 1OSAA 4OKHA 4CPVA 3AAJA 2CNPA 2LUCA 4ICBA 1RWYA 1SPYA 1QV0A 1H4BA 1UHNA 1QIVA 4PDZA 2KBMA 1UUSA 1XFYO 2LVJA 1KFXS 2LVKA 1EG3A 1W7JB 1S36A 2NCPA 4A4BA 2JOJA 1AJ5A 3FWBA 3SIAA 3PSRA 4FTGA 3KEVA 5F6TA 1J1EA 2BCAA 1BLQA 2D8NA 1NX0A 2BBMA 5HKYA 4M2OA 4GUKA 1YVHA 2K0JA 4WQ2A 1V1GA 1XYDA 3AKBA 2PASA 5KTYA 4YBHB 1CDNA 5HLOA 1QLSA 1QTXA 2KYCA 4ORAB 3DVJA 1YUTA 1L2OB 2ZRSA 3VROA 2CT9A 1XA5A 1RTP1 3BQ3A 3TDIA 1A4PA 3NSKA 1DGUA 1NSHA 1SL9A 2PMYA 3BUNB 1DJIA 1IG5A 4ETOA 1IQ3A 3I5GB 1N65A 4Q04A 3FS7A 4XYNA 2JTTA 1F70A 3DD4A 2LMTA 1UHHA 3BUXB 1NCYA 2Y4QA 4E68A 1CLMA 5I2OA 3EK4A 1CFFA 1A03A 4QJ4B 1AUIB 3PLFB 3I5HC 4GPLB 5J3XA 1F4QA 2G9BA 3SG6A 1GGWA 5DKNA 4XJKB 1CLLA 3BOWB 2F33A 2WCFA 3CR2A 1B7TY 3A4UB 1QVIY 5B8IB 1S6JA 1ZFSA 3BXKA 2RGIA 2COLB 1OMVA 2F3YA 4I5LB 1M63B 4NDBA 1XK4C 2NLNA 2LLUA 2K2FA 1DF0B 1XK4A 4GGNA 2LC5A 1K93D 1LA3A 5I2QA 1LXFC 2KFFA 3JTDB 3LK0A 1DT7B 4MLWA 1M46A 2LLSA 1BR1B 2LCPA 5IBWA 1GGZA 3OP0A 4AQIA 1DTLA 4OVNF 2H61C 2KYFA 1QXPA 3DF0A 4DS7A 2H61A 1G4YR 1KSMA 2F3ZA 4OV2A 1SL8A 4PHMA 3VRQA 2JC2A 3ICBA 2MJWB 1B8LA 2WCEA 1J7PA 2JZIA 3H4SE 2OS8C 1UWOA 3GOFA 1YTZC 3HX4A 1LVCD 2LMUA 3PATA 1JFJA 4MRXA 1OOJA 3RM1A 1VRKA 1KK7Z 1YX8A 2K2AA 1QS7A 1EJ3A 2FCDA 1YX7A 1TNXA 1QX5B 1LINA 1SCMC 3PN7B 1B1GA 3M0WA 2JT3A 5HYDA 1WDCB 5PALA 3JVTC 1NYAA 2BL0C 2KDHA 1NX1A 3BUOB 2PVBA 3DVMA 1SKTA 1K95A 2Q91A 3EKJA 3CWGA 4U8DA 1UHKA 2HF5A 1OZSA 3O6BA 1MXLC 4MZLA 2M97A 1N0YA 5CSJA 2EC6C 1KQMB 4YI8A 4MBEA 4TNCA 1BT6A 1MWNA 1G33A 1S6CA 1TCFA 2JT8A 3GK2A 4N1FA 1SK6D 2ZKMX 4GBAA 3PM8A 1RROA 1TNWA 2LHLA 2AUCA 2OTGC 2Y5IA 3I5IB 5G08A 2I2RE 3ZWHA 2GGZA 3WNXB 4I5JA 1YURA 2HQ8A 1K9UA 1EXRA 4M2PA 5CSFA 2ISDA 1K9KA 1ODBA 1IJ5A 2L4IA 4AOMA 2JTZA 1JC2A 1GQMA 4MRYA 1EL4A 2JU0A 3BYAA 4PE7A 4DCKA 3HCMA 3CR4X 1NPQA 3GK4X 4N1GA 1WRKA 4YRUA 1R2UA 4PALA 1TN4A 1WLZA 4CFRA 3VRPA 4ORBB 3SG3A 4N5XA 2L0PA 1UURA 3TS5C 3I5FC 2G2BA 1U5IB 3OB2B 1WLMA 3IQQA 4PE1A 2SASA 1KQVA 1B8CA 1MHOA 3KO0A 4PE0A 3TUYC 1SR6B 2M7NA 1JFKA 2PRUA 3PFVA 2WORA 2GGMA 1D1OA 2LVIA 2LLTA 1JF2A 2H2KA 1SRAA 1FBVA 2ZRTA 1K90D 4L9MA 4ZCUA 3EVRA 1FPWA 1CMFA 2KFGA 2BECA 5AEQA 1F54A 1KK7Y 1SL7A 2M7LA 2GV5A 2HETA 2LAPA 2NCOA 4YGAA 5HKWA 3BUMB 1WY9A 4WQ3A 1KWOC 2L98A 4JWQA 4GAOA 2LUXA 3WXAA 2AAOA 1CDPA 1RJVA 1K8UA 5ER4X 1FW4A 4BY4A 1K9PA 1S26D 2WOSA 3DVEA 2M1UA 4PHKA 3NXAA 1BG1A 1NX2A 2CBLA 1TTXA 1KCYA 3OX6A 4DIRA 3TDUA 2EGDA 3CZTX 3D0YB 5JOLA 1L2OC 3PALA 1CKKA 1KK8C 2Y1MA 4DUQA 1JF0A 4R1EA 3LLEA 5DKQA 2LV7A 1N2DA 1QV1A 4ZCVA 2ZN9A 3K21A 1HQVA 2KOTA 2ZFDA 3I5GC 3LK1A 1OQPA 3WHTB 1DJXA 3OX5A 2MAZA 1ALWA 3EK7A 1GJYA 1NP8A 2KFHA 2NZ0A 3IF7A 1E8AA 1MUXA 1J7RA 4OR9B 1RK9A 1AP4A 2E6WA 1PULA 1Y1UA 1F55A 1YRTB 1FF1A 1XFXO 1PK0D 3SG4A 3EK8A 3O4YA 4JQ0D 1CMGA 4MSPA 2L50A 1YRUB 2I7AA 1BU3A 1PVBA 4GGFC 1S5GZ 1W7IB 3CGAA 4MZKA 1XO5A 4NQGA 2FCEA 4M2QA 1CM4A 4GGFA 5JJGA 2JWWA 1NCZA 1DMOA 3FWCA 1SY9A 2M9GA 4XJKA 3BOWA 3F45A 1AJ4A 1ALVA 5HKZA 1S6IA 4P5OE 5D69A 3EVVA 2M8UA 2BCBA 2F2PA 1MR8A 2EC6B 2KAVA 1A29A 1Y0VH 2KI4B 3JTDC 1DF0A 4I5NB 2PSRA 3NSIA 4YGEB 1IRJA 1S1EA 2EHBA 2BBNA 1DJWA 1ZMZA 2R2IA 1F4OA 4AQJA 1J7OA 4MN0A 2K7DA 1BMOA 2CXJA 3KHEA 1LKJA 1XFUO 1WRLA 3O2PA 2LE9B 5CPVA 1NIWA 4YGCB 4ORCB 2O5GA 2V53A 5KSZA 1JSAA 2IS9A 2F2OA 2TN4A 2WCBA 1B8RA 4C0KA 1YVLA 2KNEA 3QRXA 2K61A 3SG7A 2L51A 2QACA 1NWDA 1SW8A 1TIZA 1EG4A 1DGVA 2BKHB 1G8IA 1CLBA 2M3WA 1IKUA 1HT9A 1SYMA 3A8RA 1IH0A 2LP2A 1K2HA 2WNDA 2KSPA 2MRDA 4FQOA 1K96A 2JNXA 2KGRA 2P6BB 1X02A 4HRHA 1A2XA 2HPSA 2M49B 4YI9A 2BE4A 1QATA 4C0JA 1XVJA 1XFZO 1JWDA 4GFTA 2KQ6A 3IQOA 3KPXA 1DJZA 2HQWA 3RLZA 3VRRA 1Y6WA 4D1EA 2LHIA 1KQMC 1A75B 1YUUA 4JPZB 1KFUL 1QJTA 5BPJA 1TCOB 3OB1B 2O60A 1CFPA 1SNLA 2AMIA 1PRWA 2ZNEA 4CLNA 2QPTA 2WC8A 3C1VA 3I5IC 1KWOB 1OMDA 1CNPA 1S5GY 2K7BA 2L5XB 1CDLA 2KAYA 4OCIA 1WRZA 1BJFA 1IWQA 1QASA 3GK1A 2K8MB 4PE4A 1Y1XA 2JNFA 1NCXA 3I5HB 1FI5A 3LCPC 2JXCA 3LL8B 1M31A 1IQ5A 1CFDA 4DRWA 4CFQA 1TNPA 3SG5A 3FIAA 1F71A 4PCWA 4USLA 5GQQC 4P2YB 1M39A 3ZNIA 1KK8B 1B9AA 1L7ZA 2CCMA 2KI6C 1CM1A 1V1FA 1A75A 2K7OA 4A4CA 1DJGA 2M1KB 1UP5A 1JBAA 1UHIA 2BE6A 1Q80A 4MZJA 1U5IA 1SR6C 2BKIB 3SJSA 2I18A 1BOCA 3DF0B 3O78A 4BY5A 1OE9B 4MVFA 5I2LA 1DJHA 3AAKA 5KU1A 2JXLA 1J1DA 2Q4UA 1PALA 1UHJA 4NDDA 1DJYA 1BF5A 2MBXA 2MLFC 3MSEB 4C0LA 2LMVA 1ZOTB 1ZUZA 2JQ6A 1AVSA 1RFJA 1QIWA 2PALA 2F8PA 4F0ZB 1FI6A 1KFXL 2OS8B 5AANA 5HLVA 4HRGA 1SCVA 2KQYA 4QJ3B 2JPTA 1YR5A 1K94A 1NX3A 3CTNA 1NUBA 2NXQA 3KF9A 3SIBA 2FOTA 1C7VA 1AK8A 1J7QA 3EKHA 4WRIA 2BCXA 2MA2A 5D7FA 5DKRA 1SCMB 2LNKA 2KHNA 5CSIA 3CLNA 3EVUA 1QX2A 5CSNA 3JVTB 2BL0B 5AFPA 2M0RA 2Y1NA 5I8NA 1CDMA 1QLKA 4PHNA 2KI6D 2ZNDA 1F8HA 2FJUB 5TNCA 1RECA 1J55A 1BODA 1XFVO 3D0YA 2KAXA 2LVVA 1H8BA 1CTRA 1AHRA 4GNKB 1ZACA 1XFWO 4CIDA 1R6PA 3DVKA 2VRGA 1OMRA 1EH2A 2CTNA 2LM5A 3BUWB 1LA0A 1TRFA 1C7WA 1KSOA 3AKAA 3D10A 3E3RA 1KFUS 3CS1A 2DOQA 3NSLA 2I94A 2LP3A 2B1UA 2K7CA 2OTGB 3CR5X 1PSRA 1BR4B 3NSOA 4HSZA 1CB1A 1IGVA 2JRFA 1TNQA 3OHMB 4HREE 4NDCA 1CFCA 1JUOA 1SMGA 1MQ1A 1OZOA 4QJ5B 2MLEC 1IJ6A 2OPOA 4MEWA 2SCPA 3TZ1A 2A4JA 1PVAA 1PSBA 1Y1AA 1B7TZ 1QVIZ 1MXEA 2KGBC 2MHHA 1B47A 1S3PA 2ZN8A 3PN7C 2LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  2KI4 C;  2JUL A;  1WDC C;  4YGB B;  1B4C A;  2L2E A;  4UPG A;  1QX7 A;  3VGO A;  4YGD B;  3TS5 B;  1SBJ A;  3I5F B;  1M45 A;  5AXI A;  1YUS A;  2E30 A;  1MF8 B;  1TOP A;  2JT0 A;  3TUY B;  2M29 A;  5ER5 A;  1C07 A;  4PHJ A;  3TDZ A;  5AER A;  3VRN A;  5FYX A;  3SG2 A;  3WHU B;  2KBI A;  5K89 A;  4IL1 A;  2L4H A;  1DVI A;  1OSA A;  4OKH A;  4CPV A;  3AAJ A;  2CNP A;  2LUC A;  4ICB A;  1RWY A;  1SPY A;  1QV0 A;  1H4B A;  1UHN A;  1QIV A;  4PDZ A;  2KBM A;  1UUS A;  1XFY O;  2LVJ A;  1KFX S;  2LVK A;  1EG3 A;  1W7J B;  1S36 A;  2NCP A;  4A4B A;  2JOJ A;  1AJ5 A;  3FWB A;  3SIA A;  3PSR A;  4FTG A;  3KEV A;  5F6T A;  1J1E A;  2BCA A;  1BLQ A;  2D8N A;  1NX0 A;  2BBM A;  5HKY A;  4M2O A;  4GUK A;  1YVH A;  2K0J A;  4WQ2 A;  1V1G A;  1XYD A;  3AKB A;  2PAS A;  5KTY A;  4YBH B;  1CDN A;  5HLO A;  1QLS A;  1QTX A;  2KYC A;  4ORA B;  3DVJ A;  1YUT A;  1L2O B;  2ZRS A;  3VRO A;  2CT9 A;  1XA5 A;  1RTP 1;  3BQ3 A;  3TDI A;  1A4P A;  3NSK A;  1DGU A;  1NSH A;  1SL9 A;  2PMY A;  3BUN B;  1DJI A;  1IG5 A;  4ETO A;  1IQ3 A;  3I5G B;  1N65 A;  4Q04 A;  3FS7 A;  4XYN A;  2JTT A;  1F70 A;  3DD4 A;  2LMT A;  1UHH A;  3BUX B;  1NCY A;  2Y4Q A;  4E68 A;  1CLM A;  5I2O A;  3EK4 A;  1CFF A;  1A03 A;  4QJ4 B;  1AUI B;  3PLF B;  3I5H C;  4GPL B;  5J3X A;  1F4Q A;  2G9B A;  3SG6 A;  1GGW A;  5DKN A;  4XJK B;  1CLL A;  3BOW B;  2F33 A;  2WCF A;  3CR2 A;  1B7T Y;  3A4U B;  1QVI Y;  5B8I B;  1S6J A;  1ZFS A;  3BXK A;  2RGI A;  2COL B;  1OMV A;  2F3Y A;  4I5L B;  1M63 B;  4NDB A;  1XK4 C;  2NLN A;  2LLU A;  2K2F A;  1DF0 B;  1XK4 A;  4GGN A;  2LC5 A;  1K93 D;  1LA3 A;  5I2Q A;  1LXF C;  2KFF A;  3JTD B;  3LK0 A;  1DT7 B;  4MLW A;  1M46 A;  2LLS A;  1BR1 B;  2LCP A;  5IBW A;  1GGZ A;  3OP0 A;  4AQI A;  1DTL A;  4OVN F;  2H61 C;  2KYF A;  1QXP A;  3DF0 A;  4DS7 A;  2H61 A;  1G4Y R;  1KSM A;  2F3Z A;  4OV2 A;  1SL8 A;  4PHM A;  3VRQ A;  2JC2 A;  3ICB A;  2MJW B;  1B8L A;  2WCE A;  1J7P A;  2JZI A;  3H4S E;  2OS8 C;  1UWO A;  3GOF A;  1YTZ C;  3HX4 A;  1LVC D;  2LMU A;  3PAT A;  1JFJ A;  4MRX A;  1OOJ A;  3RM1 A;  1VRK A;  1KK7 Z;  1YX8 A;  2K2A A;  1QS7 A;  1EJ3 A;  2FCD A;  1YX7 A;  1TNX A;  1QX5 B;  1LIN A;  1SCM C;  3PN7 B;  1B1G A;  3M0W A;  2JT3 A;  5HYD A;  1WDC B;  5PAL A;  3JVT C;  1NYA A;  2BL0 C;  2KDH A;  1NX1 A;  3BUO B;  2PVB A;  3DVM A;  1SKT A;  1K95 A;  2Q91 A;  3EKJ A;  3CWG A;  4U8D A;  1UHK A;  2HF5 A;  1OZS A;  3O6B A;  1MXL C;  4MZL A;  2M97 A;  1N0Y A;  5CSJ A;  2EC6 C;  1KQM B;  4YI8 A;  4MBE A;  4TNC A;  1BT6 A;  1MWN A;  1G33 A;  1S6C A;  1TCF A;  2JT8 A;  3GK2 A;  4N1F A;  1SK6 D;  2ZKM X;  4GBA A;  3PM8 A;  1RRO A;  1TNW A;  2LHL A;  2AUC A;  2OTG C;  2Y5I A;  3I5I B;  5G08 A;  2I2R E;  3ZWH A;  2GGZ A;  3WNX B;  4I5J A;  1YUR A;  2HQ8 A;  1K9U A;  1EXR A;  4M2P A;  5CSF A;  2ISD A;  1K9K A;  1ODB A;  1IJ5 A;  2L4I A;  4AOM A;  2JTZ A;  1JC2 A;  1GQM A;  4MRY A;  1EL4 A;  2JU0 A;  3BYA A;  4PE7 A;  4DCK A;  3HCM A;  3CR4 X;  1NPQ A;  3GK4 X;  4N1G A;  1WRK A;  4YRU A;  1R2U A;  4PAL A;  1TN4 A;  1WLZ A;  4CFR A;  3VRP A;  4ORB B;  3SG3 A;  4N5X A;  2L0P A;  1UUR A;  3TS5 C;  3I5F C;  2G2B A;  1U5I B;  3OB2 B;  1WLM A;  3IQQ A;  4PE1 A;  2SAS A;  1KQV A;  1B8C A;  1MHO A;  3KO0 A;  4PE0 A;  3TUY C;  1SR6 B;  2M7N A;  1JFK A;  2PRU A;  3PFV A;  2WOR A;  2GGM A;  1D1O A;  2LVI A;  2LLT A;  1JF2 A;  2H2K A;  1SRA A;  1FBV A;  2ZRT A;  1K90 D;  4L9M A;  4ZCU A;  3EVR A;  1FPW A;  1CMF A;  2KFG A;  2BEC A;  5AEQ A;  1F54 A;  1KK7 Y;  1SL7 A;  2M7L A;  2GV5 A;  2HET A;  2LAP A;  2NCO A;  4YGA A;  5HKW A;  3BUM B;  1WY9 A;  4WQ3 A;  1KWO C;  2L98 A;  4JWQ A;  4GAO A;  2LUX A;  3WXA A;  2AAO A;  1CDP A;  1RJV A;  1K8U A;  5ER4 X;  1FW4 A;  4BY4 A;  1K9P A;  1S26 D;  2WOS A;  3DVE A;  2M1U A;  4PHK A;  3NXA A;  1BG1 A;  1NX2 A;  2CBL A;  1TTX A;  1KCY A;  3OX6 A;  4DIR A;  3TDU A;  2EGD A;  3CZT X;  3D0Y B;  5JOL A;  1L2O C;  3PAL A;  1CKK A;  1KK8 C;  2Y1M A;  4DUQ A;  1JF0 A;  4R1E A;  3LLE A;  5DKQ A;  2LV7 A;  1N2D A;  1QV1 A;  4ZCV A;  2ZN9 A;  3K21 A;  1HQV A;  2KOT A;  2ZFD A;  3I5G C;  3LK1 A;  1OQP A;  3WHT B;  1DJX A;  3OX5 A;  2MAZ A;  1ALW A;  3EK7 A;  1GJY A;  1NP8 A;  2KFH A;  2NZ0 A;  3IF7 A;  1E8A A;  1MUX A;  1J7R A;  4OR9 B;  1RK9 A;  1AP4 A;  2E6W A;  1PUL A;  1Y1U A;  1F55 A;  1YRT B;  1FF1 A;  1XFX O;  1PK0 D;  3SG4 A;  3EK8 A;  3O4Y A;  4JQ0 D;  1CMG A;  4MSP A;  2L50 A;  1YRU B;  2I7A A;  1BU3 A;  1PVB A;  4GGF C;  1S5G Z;  1W7I B;  3CGA A;  4MZK A;  1XO5 A;  4NQG A;  2FCE A;  4M2Q A;  1CM4 A;  4GGF A;  5JJG A;  2JWW A;  1NCZ A;  1DMO A;  3FWC A;  1SY9 A;  2M9G A;  4XJK A;  3BOW A;  3F45 A;  1AJ4 A;  1ALV A;  5HKZ A;  1S6I A;  4P5O E;  5D69 A;  3EVV A;  2M8U A;  2BCB A;  2F2P A;  1MR8 A;  2EC6 B;  2KAV A;  1A29 A;  1Y0V H;  2KI4 B;  3JTD C;  1DF0 A;  4I5N B;  2PSR A;  3NSI A;  4YGE B;  1IRJ A;  1S1E A;  2EHB A;  2BBN A;  1DJW A;  1ZMZ A;  2R2I A;  1F4O A;  4AQJ A;  1J7O A;  4MN0 A;  2K7D A;  1BMO A;  2CXJ A;  3KHE A;  1LKJ A;  1XFU O;  1WRL A;  3O2P A;  2LE9 B;  5CPV A;  1NIW A;  4YGC B;  4ORC B;  2O5G A;  2V53 A;  5KSZ A;  1JSA A;  2IS9 A;  2F2O A;  2TN4 A;  2WCB A;  1B8R A;  4C0K A;  1YVL A;  2KNE A;  3QRX A;  2K61 A;  3SG7 A;  2L51 A;  2QAC A;  1NWD A;  1SW8 A;  1TIZ A;  1EG4 A;  1DGV A;  2BKH B;  1G8I A;  1CLB A;  2M3W A;  1IKU A;  1HT9 A;  1SYM A;  3A8R A;  1IH0 A;  2LP2 A;  1K2H A;  2WND A;  2KSP A;  2MRD A;  4FQO A;  1K96 A;  2JNX A;  2KGR A;  2P6B B;  1X02 A;  4HRH A;  1A2X A;  2HPS A;  2M49 B;  4YI9 A;  2BE4 A;  1QAT A;  4C0J A;  1XVJ A;  1XFZ O;  1JWD A;  4GFT A;  2KQ6 A;  3IQO A;  3KPX A;  1DJZ A;  2HQW A;  3RLZ A;  3VRR A;  1Y6W A;  4D1E A;  2LHI A;  1KQM C;  1A75 B;  1YUU A;  4JPZ B;  1KFU L;  1QJT A;  5BPJ A;  1TCO B;  3OB1 B;  2O60 A;  1CFP A;  1SNL A;  2AMI A;  1PRW A;  2ZNE A;  4CLN A;  2QPT A;  2WC8 A;  3C1V A;  3I5I C;  1KWO B;  1OMD A;  1CNP A;  1S5G Y;  2K7B A;  2L5X B;  1CDL A;  2KAY A;  4OCI A;  1WRZ A;  1BJF A;  1IWQ A;  1QAS A;  3GK1 A;  2K8M B;  4PE4 A;  1Y1X A;  2JNF A;  1NCX A;  3I5H B;  1FI5 A;  3LCP C;  2JXC A;  3LL8 B;  1M31 A;  1IQ5 A;  1CFD A;  4DRW A;  4CFQ A;  1TNP A;  3SG5 A;  3FIA A;  1F71 A;  4PCW A;  4USL A;  5GQQ C;  4P2Y B;  1M39 A;  3ZNI A;  1KK8 B;  1B9A A;  1L7Z A;  2CCM A;  2KI6 C;  1CM1 A;  1V1F A;  1A75 A;  2K7O A;  4A4C A;  1DJG A;  2M1K B;  1UP5 A;  1JBA A;  1UHI A;  2BE6 A;  1Q80 A;  4MZJ A;  1U5I A;  1SR6 C;  2BKI B;  3SJS A;  2I18 A;  1BOC A;  3DF0 B;  3O78 A;  4BY5 A;  1OE9 B;  4MVF A;  5I2L A;  1DJH A;  3AAK A;  5KU1 A;  2JXL A;  1J1D A;  2Q4U A;  1PAL A;  1UHJ A;  4NDD A;  1DJY A;  1BF5 A;  2MBX A;  2MLF C;  3MSE B;  4C0L A;  2LMV A;  1ZOT B;  1ZUZ A;  2JQ6 A;  1AVS A;  1RFJ A;  1QIW A;  2PAL A;  2F8P A;  4F0Z B;  1FI6 A;  1KFX L;  2OS8 B;  5AAN A;  5HLV A;  4HRG A;  1SCV A;  2KQY A;  4QJ3 B;  2JPT A;  1YR5 A;  1K94 A;  1NX3 A;  3CTN A;  1NUB A;  2NXQ A;  3KF9 A;  3SIB A;  2FOT A;  1C7V A;  1AK8 A;  1J7Q A;  3EKH A;  4WRI A;  2BCX A;  2MA2 A;  5D7F A;  5DKR A;  1SCM B;  2LNK A;  2KHN A;  5CSI A;  3CLN A;  3EVU A;  1QX2 A;  5CSN A;  3JVT B;  2BL0 B;  5AFP A;  2M0R A;  2Y1N A;  5I8N A;  1CDM A;  1QLK A;  4PHN A;  2KI6 D;  2ZND A;  1F8H A;  2FJU B;  5TNC A;  1REC A;  1J55 A;  1BOD A;  1XFV O;  3D0Y A;  2KAX A;  2LVV A;  1H8B A;  1CTR A;  1AHR A;  4GNK B;  1ZAC A;  1XFW O;  4CID A;  1R6P A;  3DVK A;  2VRG A;  1OMR A;  1EH2 A;  2CTN A;  2LM5 A;  3BUW B;  1LA0 A;  1TRF A;  1C7W A;  1KSO A;  3AKA A;  3D10 A;  3E3R A;  1KFU S;  3CS1 A;  2DOQ A;  3NSL A;  2I94 A;  2LP3 A;  2B1U A;  2K7C A;  2OTG B;  3CR5 X;  1PSR A;  1BR4 B;  3NSO A;  4HSZ A;  1CB1 A;  1IGV A;  2JRF A;  1TNQ A;  3OHM B;  4HRE E;  4NDC A;  1CFC A;  1JUO A;  1SMG A;  1MQ1 A;  1OZO A;  4QJ5 B;  2MLE C;  1IJ6 A;  2OPO A;  4MEW A;  2SCP A;  3TZ1 A;  2A4J A;  1PVA A;  1PSB A;  1Y1A A;  1B7T Z;  1QVI Z;  1MXE A;  2KGB C;  2MHH A;  1B47 A;  1S3P A;  2ZN8 A;  3PN7 C;  2LAN A; 
#chains in the Genus database with same CATH topology
 4I5K A;  2KI4 C;  2JUL A;  1WDC C;  4YGB B;  1B4C A;  2ERB A;  2L2E A;  4UPG A;  1QX7 A;  3VGO A;  4YGD B;  3TS5 B;  1SBJ A;  3I5F B;  1M45 A;  5AXI A;  1YUS A;  2E30 A;  1MF8 B;  1TOP A;  2JT0 A;  3TUY B;  2M29 A;  5ER5 A;  1C07 A;  2PYQ A;  4PHJ A;  1Z2C B;  3TDZ A;  1ORG A;  5AER A;  3VRN A;  5FYX A;  3SG2 A;  3WHU B;  2KBI A;  5K89 A;  4IL1 A;  2L4H A;  1DVI A;  1OSA A;  2WCK A;  4OKH A;  4CPV A;  3AAJ A;  2CNP A;  2KLE A;  2LUC A;  4ICB A;  1RWY A;  1SPY A;  1QV0 A;  1H4B A;  1UHN A;  1QIV A;  4PDZ A;  2KBM A;  1UUS A;  1XFY O;  1TWO A;  2LVJ A;  1KFX S;  2LVK A;  1EG3 A;  1W7J B;  1S36 A;  2NCP A;  4A4B A;  2JOJ A;  1AJ5 A;  3FWB A;  3SIA A;  3PSR A;  4FTG A;  3KEV A;  5F6T A;  1J1E A;  2PQL A;  2BCA A;  1BLQ A;  2D8N A;  1NX0 A;  2BBM A;  5HKY A;  4M2O A;  4GUK A;  1YVH A;  3O4X A;  2K0J A;  2JPO A;  4WQ2 A;  1V1G A;  1XYD A;  3AKB A;  2PAS A;  5KTY A;  4YBH B;  1CDN A;  5HLO A;  1QLS A;  1QTX A;  2KYC A;  4ORA B;  3DVJ A;  1YUT A;  1L2O B;  2WCL A;  2ZRS A;  2CT9 A;  3VRO A;  1XA5 A;  1RTP 1;  3BQ3 A;  3TDI A;  1A4P A;  3NSK A;  1DGU A;  1NSH A;  1AP4 A;  1SL9 A;  2PMY A;  3BUN B;  3Q8I A;  1DJI A;  1IIO A;  1IG5 A;  4ETO A;  1IQ3 A;  3I5G B;  1N65 A;  4Q04 A;  3FS7 A;  1OOF A;  4XYN A;  3CZ1 A;  2JTT A;  3NGV A;  1F70 A;  3DYE A;  3DD4 A;  2LMT A;  1UHH A;  3BUX B;  1NCY A;  2Y4Q A;  4E68 A;  1CLM A;  3D76 A;  5I2O A;  3EK4 A;  1CFF A;  1A03 A;  4QJ4 B;  2QEH A;  3NHI A;  1AUI B;  3PLF B;  3I5H C;  4GPL B;  5J3X A;  1F4Q A;  2G9B A;  3R1O A;  3SG6 A;  5DKN A;  1GGW A;  4XJK B;  1CLL A;  3BOW B;  2F33 A;  2WCF A;  3CR2 A;  1B7T Y;  3A4U B;  1QVI Y;  5B8I B;  1DEK A;  1S6J A;  1ZFS A;  3BXK A;  4PT1 A;  3SS3 A;  3IVT A;  2RGI A;  3SS5 A;  2COL B;  1OMV A;  2F3Y A;  4I5L B;  1M63 B;  4NDB A;  1XK4 C;  2NLN A;  2LLU A;  2K2F A;  1DF0 B;  1XK4 A;  4GGN A;  2LC5 A;  1K93 D;  1LA3 A;  5I2Q A;  1LXF C;  2KFF A;  3JTD B;  3LK0 A;  1DT7 B;  1QWV A;  4MLW A;  3CZ0 A;  1M46 A;  2LLS A;  1BR1 B;  2LCP A;  5IBW A;  1GGZ A;  3OP0 A;  3DZT A;  4AQI A;  1DTL A;  4JKT A;  2H61 C;  2KYF A;  1QXP A;  4OVN F;  3DF0 A;  4DS7 A;  2H61 A;  1G4Y R;  1KSM A;  2F3Z A;  4OV2 A;  1SL8 A;  4JD9 A;  4PHM A;  3VRQ A;  2JC2 A;  3ICB A;  2MJW B;  3VB1 A;  1B8L A;  2WCE A;  2BNX A;  1J7P A;  2JZI A;  3H4S E;  3S0A A;  2L5Y A;  2OS8 C;  1UWO A;  3GOF A;  3K1E A;  1YTZ C;  3HX4 A;  1LVC D;  2LMU A;  3PAT A;  4KYN A;  1JFJ A;  4MRX A;  1OOJ A;  3RM1 A;  1VRK A;  1KK7 Z;  1YX8 A;  3D77 A;  2K2A A;  1QS7 A;  3D75 A;  1EJ3 A;  2FCD A;  1YX7 A;  1TNX A;  2K60 A;  1QX5 B;  1LIN A;  1SCM C;  3PN7 B;  1B1G A;  3M0W A;  2JT3 A;  5HYD A;  1WDC B;  5PAL A;  3JVT C;  1NYA A;  2BL0 C;  2KDH A;  1NX1 A;  3BUO B;  2PVB A;  3DVM A;  1SKT A;  1K95 A;  2Q91 A;  2WCM A;  3EKJ A;  3CWG A;  4U8D A;  1UHK A;  2HF5 A;  1OZS A;  3O6B A;  1MXL C;  4MZL A;  2M97 A;  1N0Y A;  5CSJ A;  2EC6 C;  1KQM B;  4YI8 A;  4MBE A;  4TNC A;  1BT6 A;  1MWN A;  1G33 A;  1S6C A;  1TCF A;  2JT8 A;  3GK2 A;  4N1F A;  1SK6 D;  1LS8 A;  2ZKM X;  4GBA A;  3V2L A;  3PM8 A;  1RRO A;  2L2C A;  1TNW A;  2LHL A;  2AUC A;  2OTG C;  2Y5I A;  3I5I B;  5G08 A;  3CDN A;  3D78 A;  2I2R E;  3ZWH A;  2GGZ A;  3WNX B;  4I5J A;  1YUR A;  2HQ8 A;  1K9U A;  1EXR A;  1TUJ A;  4M2P A;  5CSF A;  2ISD A;  1K9K A;  1ODB A;  1IJ5 A;  2L4I A;  4AOM A;  2JTZ A;  2H8V A;  2WCJ A;  1JC2 A;  1GQM A;  4MRY A;  1EL4 A;  2JU0 A;  3BYA A;  4PE7 A;  4DCK A;  3HCM A;  1W9Z A;  3CR4 X;  1NPQ A;  3GK4 X;  4N1G A;  1WRK A;  3BFH A;  3S0F A;  4YRU A;  1R2U A;  3RZS A;  4PAL A;  1TN4 A;  1WLZ A;  1DQE A;  4CFR A;  3VRP A;  4ORB B;  3SG3 A;  4N5X A;  2L0P A;  1UUR A;  3TS5 C;  3I5F C;  2G2B A;  1U5I B;  3OB2 B;  1WLM A;  3IQQ A;  4PE1 A;  2SAS A;  1KQV A;  1OW4 A;  1B8C A;  1MHO A;  3KO0 A;  4PE0 A;  5EL2 A;  1SR6 B;  2M7N A;  4FQT A;  3TUY C;  1JFK A;  3R1V A;  2PRU A;  3PFV A;  2WOR A;  2GGM A;  1D1O A;  2LVI A;  3SS4 A;  2LLT A;  1JF2 A;  2H2K A;  3L4A A;  1SRA A;  1FBV A;  2ZRT A;  1K90 D;  4L9M A;  3B7A A;  4ZCU A;  3EVR A;  1FPW A;  1CMF A;  2KFG A;  2BEC A;  5AEQ A;  1F54 A;  1KK7 Y;  1SL7 A;  2M7L A;  3B88 A;  2GV5 A;  2HET A;  2LAP A;  2NCO A;  4YGA A;  5HKW A;  3BUM B;  1TUZ A;  1WY9 A;  4WQ3 A;  2QDI A;  1KWO C;  2L98 A;  4JWQ A;  4GAO A;  2LUX A;  3WXA A;  2AAO A;  1SSE B;  1CDP A;  1RJV A;  1K8U A;  5ER4 X;  1FW4 A;  4BY4 A;  1K9P A;  3R72 A;  1S26 D;  2WOS A;  3DVE A;  2M1U A;  4PHK A;  3NXA A;  1BG1 A;  1NX2 A;  2CBL A;  3L47 A;  1TTX A;  1GM0 A;  3BFA A;  1KCY A;  3OX6 A;  4DIR A;  3TDU A;  4INX A;  2EGD A;  3CZT X;  3D0Y B;  5FI2 A;  5JOL A;  1L2O C;  3PAL A;  3PJI A;  1CKK A;  1KK8 C;  2Y1M A;  4DUQ A;  3CAB A;  1JF0 A;  4R1E A;  3LLE A;  5DKQ A;  2LV7 A;  1N2D A;  3BFB A;  1QV1 A;  4ZCV A;  2ZN9 A;  3K21 A;  1HQV A;  2KOT A;  2ZFD A;  3I5G C;  3LK1 A;  1OQP A;  3WHT B;  1OOI X;  1DJX A;  3EG5 B;  3OX5 A;  2MAZ A;  1ALW A;  2QEO A;  3EK7 A;  1GJY A;  1NP8 A;  2KFH A;  2NZ0 A;  3IF7 A;  1E8A A;  1MUX A;  1J7R A;  4OR9 B;  1RK9 A;  5D3O A;  5FI6 A;  2E6W A;  1PUL A;  1Y1U A;  3FE9 A;  1YRT B;  1F55 A;  1XFX O;  1FF1 A;  1PK0 D;  3SG4 A;  2BAP A;  3EK8 A;  3O4Y A;  4JQ0 D;  1CMG A;  4MSP A;  2L50 A;  1YRU B;  2I7A A;  1BU3 A;  1PVB A;  4GGF C;  1S5G Z;  1W7I B;  3CGA A;  4MZK A;  1XO5 A;  4NQG A;  2FCE A;  4M2Q A;  1CM4 A;  2YGU A;  3D73 A;  4GGF A;  5JJG A;  2JWW A;  1NCZ A;  1DMO A;  3FWC A;  1SY9 A;  2M9G A;  4XJK A;  3BOW A;  3F45 A;  1AJ4 A;  3S0E A;  1ALV A;  4OZD A;  5HKZ A;  3UNW A;  1S6I A;  4P5O E;  5D69 A;  3EVV A;  2M8U A;  2BCB A;  2F2P A;  1MR8 A;  2EC6 B;  2KAV A;  1A29 A;  1Y0V H;  2KI4 B;  3JTD C;  1DF0 A;  4I5N B;  2PSR A;  3NSI A;  4YGE B;  1IRJ A;  1S1E A;  2EHB A;  2BBN A;  1DJW A;  1ZMZ A;  2R2I A;  1F4O A;  4AQJ A;  1J7O A;  4MN0 A;  2K7D A;  1BMO A;  2CXJ A;  3KHE A;  1LKJ A;  1XFU O;  1WRL A;  3O2P A;  2LE9 B;  5CPV A;  3B86 A;  1NIW A;  4YGC B;  4ORC B;  1T14 A;  2O5G A;  2V53 A;  5KSZ A;  1JSA A;  2IS9 A;  2F2O A;  2TN4 A;  2WCB A;  1B8R A;  4C0K A;  2WCH A;  4IJ7 A;  1YVL A;  2KNE A;  3QRX A;  2K61 A;  3SG7 A;  2L51 A;  2QAC A;  1NWD A;  1SW8 A;  1TIZ A;  3PM2 A;  1EG4 A;  3OBV A;  1DGV A;  2BKH B;  1G8I A;  3QME A;  1CLB A;  2M3W A;  1IKU A;  1HT9 A;  1SYM A;  3A8R A;  1IH0 A;  2LP2 A;  1K2H A;  2WND A;  2KSP A;  2MRD A;  4FQO A;  1K96 A;  2JNX A;  2KGR A;  2P6B B;  1X02 A;  4HRH A;  1A2X A;  2HPS A;  2M49 B;  2P71 A;  4YI9 A;  5DIC A;  3S0G A;  5FI7 A;  2P70 A;  2BE4 A;  1QAT A;  3FE6 A;  4C0J A;  1XVJ A;  1XFZ O;  3DXL A;  1JWD A;  4GFT A;  2KQ6 A;  3IQO A;  3L4L A;  3B6X A;  3KPX A;  1DJZ A;  2HQW A;  3RLZ A;  3VRR A;  1Y6W A;  4D1E A;  1DC1 A;  2LHI A;  1KQM C;  1A75 B;  1YUU A;  4JPZ B;  1KFU L;  1QJT A;  3S0B A;  5BPJ A;  1TCO B;  3OB1 B;  2O60 A;  1C3Y A;  1CFP A;  1SNL A;  2AMI A;  1PRW A;  2ZNE A;  4CLN A;  2QPT A;  2WC8 A;  3C1V A;  3I5I C;  1KWO B;  2WC5 A;  1OMD A;  3OGN A;  1CNP A;  1S5G Y;  2K7B A;  2L5X B;  1CDL A;  2KAY A;  4OCI A;  1WRZ A;  1BJF A;  1IWQ A;  1QAS A;  3GK1 A;  2K8M B;  1C3Z A;  4PE4 A;  1Y1X A;  2JNF A;  1OOH A;  1NCX A;  3I5H B;  1FI5 A;  3LCP C;  2JXC A;  3LL8 B;  1M31 A;  1IQ5 A;  1CFD A;  4DRW A;  3CYZ A;  4CFQ A;  1TNP A;  3SG5 A;  3FIA A;  1F71 A;  4PCW A;  3N7H A;  4USL A;  5GQQ C;  4P2Y B;  1M39 A;  3ZNI A;  1KK8 B;  1B9A A;  1L7Z A;  2CCM A;  2KI6 C;  1CM1 A;  1V1F A;  2QEV A;  1A75 A;  1P28 A;  2K7O A;  4A4C A;  1DJG A;  4F7F A;  2M1K B;  2QEB A;  1UP5 A;  1JBA A;  1UHI A;  2BE6 A;  1Q80 A;  4MZJ A;  1U5I A;  1SR6 C;  2BKI B;  3BJH A;  2I18 A;  3SJS A;  3DF0 B;  1BOC A;  3O78 A;  4BY5 A;  1OE9 B;  4MVF A;  5I2L A;  1DJH A;  3AAK A;  5KU1 A;  2JXL A;  1J1D A;  2Q4U A;  1PAL A;  1UHJ A;  4NDD A;  1DJY A;  1BF5 A;  2MBX A;  2MLF C;  3MSE B;  4C0L A;  2LMV A;  1ZOT B;  1ZUZ A;  2JQ6 A;  2WC6 A;  1AVS A;  1RFJ A;  1QIW A;  2PAL A;  2F8P A;  4F0Z B;  1FI6 A;  1KFX L;  2OS8 B;  5AAN A;  5HLV A;  4HRG A;  1SCV A;  2KQY A;  4QJ3 B;  2JPT A;  1YR5 A;  1K94 A;  3DY9 A;  1NX3 A;  3CTN A;  1NUB A;  2NXQ A;  3KF9 A;  3SIB A;  5I94 A;  2FOT A;  1C7V A;  1AK8 A;  1J7Q A;  3EKH A;  4WRI A;  2BCX A;  2MA2 A;  5D7F A;  1OOG A;  5DKR A;  1SCM B;  2LNK A;  2KHN A;  5CSI A;  1Z4H A;  3CLN A;  3EVU A;  3R1P A;  1QX2 A;  5CSN A;  3JVT B;  2BL0 B;  5AFP A;  2M0R A;  2Y1N A;  5I8N A;  1CDM A;  1QLK A;  4PHN A;  3B87 A;  2KI6 D;  2ZND A;  1F8H A;  2FJU B;  5TNC A;  2GTE A;  1REC A;  3UO9 A;  1J55 A;  1BOD A;  1XFV O;  3D0Y A;  2KAX A;  3NHT A;  2LVV A;  1H8B A;  1CTR A;  1AHR A;  4GNK B;  1ZAC A;  1DEL A;  3S0D A;  1XFW O;  4CID A;  1R6P A;  3DVK A;  2VRG A;  1OMR A;  1EH2 A;  2CTN A;  2FJY A;  2LM5 A;  3BUW B;  1LA0 A;  1TRF A;  1C7W A;  1KSO A;  3AKA A;  3D10 A;  3E3R A;  1KFU S;  3CS1 A;  2DOQ A;  2KLD A;  3NSL A;  2I94 A;  1XFR A;  2LP3 A;  2B1U A;  2K7C A;  2OTG B;  3CR5 X;  3FE8 A;  1PSR A;  1BR4 B;  3NSO A;  3CZ2 A;  4HSZ A;  1CB1 A;  1IGV A;  2JRF A;  1TNQ A;  3OHM B;  4HRE E;  4INW A;  4NDC A;  1CFC A;  1JUO A;  1SMG A;  1MQ1 A;  1OZO A;  4QJ5 B;  2MLE C;  3PN7 C;  1IJ6 A;  2OPO A;  4MEW A;  2SCP A;  3TZ1 A;  2A4J A;  1PVA A;  1PSB A;  1Y1A A;  1B7T Z;  3D74 A;  1QVI Z;  1MXE A;  2KGB C;  2MHH A;  5HL1 A;  1B47 A;  1S3P A;  2ZN8 A;  2KPH A;  2LAN A; 
#chains in the Genus database with same CATH homology
 4I5K A;  2KI4 C;  2JUL A;  1WDC C;  4YGB B;  1B4C A;  2L2E A;  4UPG A;  1QX7 A;  3VGO A;  4YGD B;  3TS5 B;  1SBJ A;  3I5F B;  1M45 A;  5AXI A;  1YUS A;  2E30 A;  1MF8 B;  1TOP A;  2JT0 A;  3TUY B;  2M29 A;  5ER5 A;  1C07 A;  4PHJ A;  3TDZ A;  5AER A;  3VRN A;  5FYX A;  3SG2 A;  3WHU B;  2KBI A;  5K89 A;  4IL1 A;  2L4H A;  1DVI A;  1OSA A;  4OKH A;  4CPV A;  3AAJ A;  2CNP A;  2LUC A;  4ICB A;  1RWY A;  1SPY A;  1QV0 A;  1H4B A;  1UHN A;  1QIV A;  4PDZ A;  2KBM A;  1UUS A;  1XFY O;  2LVJ A;  1KFX S;  2LVK A;  1EG3 A;  1W7J B;  1S36 A;  2NCP A;  4A4B A;  2JOJ A;  1AJ5 A;  3FWB A;  3SIA A;  3PSR A;  4FTG A;  3KEV A;  5F6T A;  1J1E A;  2BCA A;  1BLQ A;  2D8N A;  1NX0 A;  2BBM A;  5HKY A;  4M2O A;  4GUK A;  1YVH A;  2K0J A;  4WQ2 A;  1V1G A;  1XYD A;  3AKB A;  2PAS A;  5KTY A;  4YBH B;  1CDN A;  5HLO A;  1QLS A;  1QTX A;  2KYC A;  4ORA B;  3DVJ A;  1YUT A;  1L2O B;  2ZRS A;  3VRO A;  2CT9 A;  1XA5 A;  1RTP 1;  3BQ3 A;  3TDI A;  1A4P A;  3NSK A;  1DGU A;  1NSH A;  1SL9 A;  2PMY A;  3BUN B;  1DJI A;  1IG5 A;  4ETO A;  1IQ3 A;  3I5G B;  1N65 A;  4Q04 A;  3FS7 A;  4XYN A;  2JTT A;  1F70 A;  3DD4 A;  2LMT A;  1UHH A;  3BUX B;  1NCY A;  2Y4Q A;  4E68 A;  1CLM A;  5I2O A;  3EK4 A;  1CFF A;  1A03 A;  4QJ4 B;  1AUI B;  3PLF B;  3I5H C;  4GPL B;  5J3X A;  1F4Q A;  2G9B A;  3SG6 A;  1GGW A;  5DKN A;  4XJK B;  1CLL A;  3BOW B;  2F33 A;  2WCF A;  3CR2 A;  1B7T Y;  3A4U B;  1QVI Y;  5B8I B;  1S6J A;  1ZFS A;  3BXK A;  2RGI A;  2COL B;  1OMV A;  2F3Y A;  4I5L B;  1M63 B;  4NDB A;  1XK4 C;  2NLN A;  2LLU A;  2K2F A;  1DF0 B;  1XK4 A;  4GGN A;  2LC5 A;  1K93 D;  1LA3 A;  5I2Q A;  1LXF C;  2KFF A;  3JTD B;  3LK0 A;  1DT7 B;  4MLW A;  1M46 A;  2LLS A;  1BR1 B;  2LCP A;  5IBW A;  1GGZ A;  3OP0 A;  4AQI A;  1DTL A;  4OVN F;  2H61 C;  2KYF A;  1QXP A;  3DF0 A;  4DS7 A;  2H61 A;  1G4Y R;  1KSM A;  2F3Z A;  4OV2 A;  1SL8 A;  4PHM A;  3VRQ A;  2JC2 A;  3ICB A;  2MJW B;  1B8L A;  2WCE A;  1J7P A;  2JZI A;  3H4S E;  2OS8 C;  1UWO A;  3GOF A;  1YTZ C;  3HX4 A;  1LVC D;  2LMU A;  3PAT A;  1JFJ A;  4MRX A;  1OOJ A;  3RM1 A;  1VRK A;  1KK7 Z;  1YX8 A;  2K2A A;  1QS7 A;  1EJ3 A;  2FCD A;  1YX7 A;  1TNX A;  1QX5 B;  1LIN A;  1SCM C;  3PN7 B;  1B1G A;  3M0W A;  2JT3 A;  5HYD A;  1WDC B;  5PAL A;  3JVT C;  1NYA A;  2BL0 C;  2KDH A;  1NX1 A;  3BUO B;  2PVB A;  3DVM A;  1SKT A;  1K95 A;  2Q91 A;  3EKJ A;  3CWG A;  4U8D A;  1UHK A;  2HF5 A;  1OZS A;  3O6B A;  1MXL C;  4MZL A;  2M97 A;  1N0Y A;  5CSJ A;  2EC6 C;  1KQM B;  4YI8 A;  4MBE A;  4TNC A;  1BT6 A;  1MWN A;  1G33 A;  1S6C A;  1TCF A;  2JT8 A;  3GK2 A;  4N1F A;  1SK6 D;  2ZKM X;  4GBA A;  3PM8 A;  1RRO A;  1TNW A;  2LHL A;  2AUC A;  2OTG C;  2Y5I A;  3I5I B;  5G08 A;  2I2R E;  3ZWH A;  2GGZ A;  3WNX B;  4I5J A;  1YUR A;  2HQ8 A;  1K9U A;  1EXR A;  4M2P A;  5CSF A;  2ISD A;  1K9K A;  1ODB A;  1IJ5 A;  2L4I A;  4AOM A;  2JTZ A;  1JC2 A;  1GQM A;  4MRY A;  1EL4 A;  2JU0 A;  3BYA A;  4PE7 A;  4DCK A;  3HCM A;  3CR4 X;  1NPQ A;  3GK4 X;  4N1G A;  1WRK A;  4YRU A;  1R2U A;  4PAL A;  1TN4 A;  1WLZ A;  4CFR A;  3VRP A;  4ORB B;  3SG3 A;  4N5X A;  2L0P A;  1UUR A;  3TS5 C;  3I5F C;  2G2B A;  1U5I B;  3OB2 B;  1WLM A;  3IQQ A;  4PE1 A;  2SAS A;  1KQV A;  1B8C A;  1MHO A;  3KO0 A;  4PE0 A;  3TUY C;  1SR6 B;  2M7N A;  1JFK A;  2PRU A;  3PFV A;  2WOR A;  2GGM A;  1D1O A;  2LVI A;  2LLT A;  1JF2 A;  2H2K A;  1SRA A;  1FBV A;  2ZRT A;  1K90 D;  4L9M A;  4ZCU A;  3EVR A;  1FPW A;  1CMF A;  2KFG A;  2BEC A;  5AEQ A;  1F54 A;  1KK7 Y;  1SL7 A;  2M7L A;  2GV5 A;  2HET A;  2LAP A;  2NCO A;  4YGA A;  5HKW A;  3BUM B;  1WY9 A;  4WQ3 A;  1KWO C;  2L98 A;  4JWQ A;  4GAO A;  2LUX A;  3WXA A;  2AAO A;  1CDP A;  1RJV A;  1K8U A;  5ER4 X;  1FW4 A;  4BY4 A;  1K9P A;  1S26 D;  2WOS A;  3DVE A;  2M1U A;  4PHK A;  3NXA A;  1BG1 A;  1NX2 A;  2CBL A;  1TTX A;  1KCY A;  3OX6 A;  4DIR A;  3TDU A;  2EGD A;  3CZT X;  3D0Y B;  5JOL A;  1L2O C;  3PAL A;  1CKK A;  1KK8 C;  2Y1M A;  4DUQ A;  1JF0 A;  4R1E A;  3LLE A;  5DKQ A;  2LV7 A;  1N2D A;  1QV1 A;  4ZCV A;  2ZN9 A;  3K21 A;  1HQV A;  2KOT A;  2ZFD A;  3I5G C;  3LK1 A;  1OQP A;  3WHT B;  1DJX A;  3OX5 A;  2MAZ A;  1ALW A;  3EK7 A;  1GJY A;  1NP8 A;  2KFH A;  2NZ0 A;  3IF7 A;  1E8A A;  1MUX A;  1J7R A;  4OR9 B;  1RK9 A;  1AP4 A;  2E6W A;  1PUL A;  1Y1U A;  1F55 A;  1YRT B;  1FF1 A;  1XFX O;  1PK0 D;  3SG4 A;  3EK8 A;  3O4Y A;  4JQ0 D;  1CMG A;  4MSP A;  2L50 A;  1YRU B;  2I7A A;  1BU3 A;  1PVB A;  4GGF C;  1S5G Z;  1W7I B;  3CGA A;  4MZK A;  1XO5 A;  4NQG A;  2FCE A;  4M2Q A;  1CM4 A;  4GGF A;  5JJG A;  2JWW A;  1NCZ A;  1DMO A;  3FWC A;  1SY9 A;  2M9G A;  4XJK A;  3BOW A;  3F45 A;  1AJ4 A;  1ALV A;  5HKZ A;  1S6I A;  4P5O E;  5D69 A;  3EVV A;  2M8U A;  2BCB A;  2F2P A;  1MR8 A;  2EC6 B;  2KAV A;  1A29 A;  1Y0V H;  2KI4 B;  3JTD C;  1DF0 A;  4I5N B;  2PSR A;  3NSI A;  4YGE B;  1IRJ A;  1S1E A;  2EHB A;  2BBN A;  1DJW A;  1ZMZ A;  2R2I A;  1F4O A;  4AQJ A;  1J7O A;  4MN0 A;  2K7D A;  1BMO A;  2CXJ A;  3KHE A;  1LKJ A;  1XFU O;  1WRL A;  3O2P A;  2LE9 B;  5CPV A;  1NIW A;  4YGC B;  4ORC B;  2O5G A;  2V53 A;  5KSZ A;  1JSA A;  2IS9 A;  2F2O A;  2TN4 A;  2WCB A;  1B8R A;  4C0K A;  1YVL A;  2KNE A;  3QRX A;  2K61 A;  3SG7 A;  2L51 A;  2QAC A;  1NWD A;  1SW8 A;  1TIZ A;  1EG4 A;  1DGV A;  2BKH B;  1G8I A;  1CLB A;  2M3W A;  1IKU A;  1HT9 A;  1SYM A;  3A8R A;  1IH0 A;  2LP2 A;  1K2H A;  2WND A;  2KSP A;  2MRD A;  4FQO A;  1K96 A;  2JNX A;  2KGR A;  2P6B B;  1X02 A;  4HRH A;  1A2X A;  2HPS A;  2M49 B;  4YI9 A;  2BE4 A;  1QAT A;  4C0J A;  1XVJ A;  1XFZ O;  1JWD A;  4GFT A;  2KQ6 A;  3IQO A;  3KPX A;  1DJZ A;  2HQW A;  3RLZ A;  3VRR A;  1Y6W A;  4D1E A;  2LHI A;  1KQM C;  1A75 B;  1YUU A;  4JPZ B;  1KFU L;  1QJT A;  5BPJ A;  1TCO B;  3OB1 B;  2O60 A;  1CFP A;  1SNL A;  2AMI A;  1PRW A;  2ZNE A;  4CLN A;  2QPT A;  2WC8 A;  3C1V A;  3I5I C;  1KWO B;  1OMD A;  1CNP A;  1S5G Y;  2K7B A;  2L5X B;  1CDL A;  2KAY A;  4OCI A;  1WRZ A;  1BJF A;  1IWQ A;  1QAS A;  3GK1 A;  2K8M B;  4PE4 A;  1Y1X A;  2JNF A;  1NCX A;  3I5H B;  1FI5 A;  3LCP C;  2JXC A;  3LL8 B;  1M31 A;  1IQ5 A;  1CFD A;  4DRW A;  4CFQ A;  1TNP A;  3SG5 A;  3FIA A;  1F71 A;  4PCW A;  4USL A;  5GQQ C;  4P2Y B;  1M39 A;  3ZNI A;  1KK8 B;  1B9A A;  1L7Z A;  2CCM A;  2KI6 C;  1CM1 A;  1V1F A;  1A75 A;  2K7O A;  4A4C A;  1DJG A;  2M1K B;  1UP5 A;  1JBA A;  1UHI A;  2BE6 A;  1Q80 A;  4MZJ A;  1U5I A;  1SR6 C;  2BKI B;  3SJS A;  2I18 A;  1BOC A;  3DF0 B;  3O78 A;  4BY5 A;  1OE9 B;  4MVF A;  5I2L A;  1DJH A;  3AAK A;  5KU1 A;  2JXL A;  1J1D A;  2Q4U A;  1PAL A;  1UHJ A;  4NDD A;  1DJY A;  1BF5 A;  2MBX A;  2MLF C;  3MSE B;  4C0L A;  2LMV A;  1ZOT B;  1ZUZ A;  2JQ6 A;  1AVS A;  1RFJ A;  1QIW A;  2PAL A;  2F8P A;  4F0Z B;  1FI6 A;  1KFX L;  2OS8 B;  5AAN A;  5HLV A;  4HRG A;  1SCV A;  2KQY A;  4QJ3 B;  2JPT A;  1YR5 A;  1K94 A;  1NX3 A;  3CTN A;  1NUB A;  2NXQ A;  3KF9 A;  3SIB A;  2FOT A;  1C7V A;  1AK8 A;  1J7Q A;  3EKH A;  4WRI A;  2BCX A;  2MA2 A;  5D7F A;  5DKR A;  1SCM B;  2LNK A;  2KHN A;  5CSI A;  3CLN A;  3EVU A;  1QX2 A;  5CSN A;  3JVT B;  2BL0 B;  5AFP A;  2M0R A;  2Y1N A;  5I8N A;  1CDM A;  1QLK A;  4PHN A;  2KI6 D;  2ZND A;  1F8H A;  2FJU B;  5TNC A;  1REC A;  1J55 A;  1BOD A;  1XFV O;  3D0Y A;  2KAX A;  2LVV A;  1H8B A;  1CTR A;  1AHR A;  4GNK B;  1ZAC A;  1XFW O;  4CID A;  1R6P A;  3DVK A;  2VRG A;  1OMR A;  1EH2 A;  2CTN A;  2LM5 A;  3BUW B;  1LA0 A;  1TRF A;  1C7W A;  1KSO A;  3AKA A;  3D10 A;  3E3R A;  1KFU S;  3CS1 A;  2DOQ A;  3NSL A;  2I94 A;  2LP3 A;  2B1U A;  2K7C A;  2OTG B;  3CR5 X;  1PSR A;  1BR4 B;  3NSO A;  4HSZ A;  1CB1 A;  1IGV A;  2JRF A;  1TNQ A;  3OHM B;  4HRE E;  4NDC A;  1CFC A;  1JUO A;  1SMG A;  1MQ1 A;  1OZO A;  4QJ5 B;  2MLE C;  1IJ6 A;  2OPO A;  4MEW A;  2SCP A;  3TZ1 A;  2A4J A;  1PVA A;  1PSB A;  1Y1A A;  1B7T Z;  1QVI Z;  1MXE A;  2KGB C;  2MHH A;  1B47 A;  1S3P A;  2ZN8 A;  3PN7 C;  2LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...