4OR9B

Crystal structure of human calcineurin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
ASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Homo sapiens
molecule tags Hydrolase/metal binding protein
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit be
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4or9B00
1M45A 1QVIZ 1TN4A 4N1FA 1RFJA 1F4OA 1B1GA 1JC2A 3LLEA 3O2PA 1FPWA 1J7RA 2JZIA 1JF2A 2F2OA 4GBAA 5KSZA 2D8NA 1SRAA 4FTGA 1SL9A 1XA5A 5CSFA 4PDZA 1XYDA 3CR5X 1CDNA 1K9KA 2M1UA 1BF5A 2LMUA 2OTGC 1J1EA 1S6JA 2COLB 2M49B 3D10A 2FJUB 1SR6B 4I5LB 4MRYA 2SASA 3WNXB 2CTNA 2KGRA 1UHKA 1KQMC 3JVTB 1IWQA 1KK8B 3SIBA 1WRZA 2M0RA 2JXLA 4GAOA 1NSHA 1TOPA 3TDIA 3EKJA 3CZTX 3CTNA 1PK0D 5CPVA 4YRUA 5KU1A 1IH0A 3EVRA 2K7BA 1UHIA 3OB2B 3PATA 5D69A 1M46A 1SKTA 5I2LA 1U5IA 1N65A 2KBMA 1QV1A 2BKHB 2NLNA 2AMIA 1KQMB 1LKJA 2KBIA 2K2FA 2MJWB 4NDCA 1IRJA 2I94A 4AQJA 1AP4A 1AJ4A 2OS8B 5HLOA 1RK9A 3VGOA 1A03A 5G08A 3AKBA 3WHUB 1XK4A 1GQMA 1J1DA 2PMYA 5I2OA 1H4BA 3GK4X 4XJKA 3VRPA 1FI5A 4NQGA 1BU3A 1PSBA 3CWGA 2LVJA 1WRKA 3DVJA 2ZNEA 2ZRSA 1M63B 1BJFA 1X02A 5D7FA 2OPOA 2L0PA 2ZKMX 2KYCA 1SYMA 4MEWA 4MSPA 2JT0A 2QACA 4AQIA 1CMGA 2NXQA 1ALWA 2A4JA 3C1VA 1KFXL 1M31A 3PM8A 1C7VA 3DD4A 3DVKA 1K9PA 3EK8A 2L5XB 4WRIA 2BCXA 1K96A 1NCZA 3O4YA 1DJGA 1KFXS 5ER5A 1NX1A 1B7TZ 2LNKA 1S26D 4PE7A 4QJ5B 1BODA 4WQ2A 4GPLB 2K7DA 4XJKB 3KF9A 4WQ3A 2MHHA 1UHJA 2L50A 2LVIA 3I5IC 1ALVA 3I5HC 5DKRA 4XYNA 5AERA 4FQOA 3DVMA 2GGMA 1OQPA 1FW4A 2O5GA 1Y6WA 3CGAA 2L4IA 2LUXA 3IF7A 2JT3A 4TNCA 1DJZA 1ZUZA 1QJTA 1S5GY 1G4YR 2CCMA 1SW8A 2F3YA 1YX7A 1MXLC 2F8PA 3NSIA 1DF0B 1Y1XA 4DUQA 2F33A 1K2HA 3LL8B 1Q80A 2EHBA 4NDBA 1SMGA 1CLMA 1DVIA 2VRGA 3RM1A 3AAJA 1TNWA 4ORBB 1SL8A 1M39A 1EG3A 2JTZA 2WOSA 3I5FB 1S3PA 2KOTA 3SG7A 1KSOA 2NCOA 1JSAA 3TDZA 5AXIA 2JU0A 1KWOC 4MVFA 4GGFC 3OHMB 2BBMA 1DTLA 3PN7B 1V1FA 1MR8A 2Q4UA 4C0KA 1S6IA 3QRXA 4DRWA 2NCPA 5JJGA 1F55A 1QTXA 1RROA 1B8LA 1XFZO 2JOJA 5CSJA 1N2DA 3IQQA 1XFXO 3TZ1A 2EC6C 4YGBB 1F70A 1CNPA 1B7TY 1J55A 4PE1A 5FYXA 1XK4C 2LM5A 4YGCB 2KFHA 1Y1AA 1B47A 1QLSA 4DS7A 1JWDA 1MHOA 1CFFA 1CMFA 1K90D 1QXPA 2MRDA 1KK8C 1BMOA 2TN4A 1CKKA 1QX2A 3K21A 3RLZA 1JFJA 4CFQA 1DGUA 1XFUO 1TIZA 2ZN8A 1CM4A 2JWWA 4QJ3B 1SCVA 3DVEA 4PCWA 5F6TA 1E8AA 2LLSA 1BR4B 2RGIA 2JT8A 4PHKA 1TNQA 2ZFDA 1YVHA 4M2OA 5BPJA 1HQVA 1YRUB 1Y1UA 1DF0A 2K7OA 2E30A 1NCXA 2JPTA 1WLZA 4MZJA 3VRQA 2B1UA 4A4BA 1A2XA 4JQ0D 2ZNDA 1IQ5A 2KI4C 1DJWA 1TNXA 1F8HA 1EXRA 1J7QA 2BE6A 1OMRA 1QX5B 1CLBA 3I5FC 2Y1NA 1JUOA 2PVBA 4PHJA 2I18A 3D0YB 3NSKA 1UHNA 1W7IB 2HPSA 1U5IB 3DF0A 1XFWO 1NCYA 1NX0A 2EGDA 2IS9A 2KI6D 3LCPC 4IL1A 2BL0B 1SPYA 5ER4X 1NP8A 4D1EA 1DJHA 2LCPA 1NWDA 2JNXA 2FCDA 1TCFA 1WRLA 4CLNA 3O6BA 1K93D 1W7JB 1KFUS 4OVNF 1IKUA 1RWYA 3GOFA 4CIDA 2JC2A 2LMVA 2SCPA 1EH2A 1S1EA 2KHNA 3GK2A 2LUCA 1C7WA 3BUWB 1S5GZ 2F3ZA 3O78A 1XVJA 1QIWA 2WCFA 2LMTA 1RTP1 3TS5C 1CTRA 2ZRTA 2CNPA 2G2BA 5I2QA 1HT9A 4OV2A 2K7CA 3SJSA 4CPVA 1NX3A 2Y1MA 1YVLA 2KI4B 1A29A 1XFVO 3ZNIA 2CXJA 3NSOA 3LK1A 5J3XA 2LLTA 3CLNA 4OCIA 1PVBA 1QV0A 1SY9A 4M2QA 4HREE 3I5HB 1YRTB 2L2EA 2MBXA 1VRKA 3VROA 4MRXA 1F4QA 1PVAA 1FBVA 1QASA 1OE9B 3LK0A 2M29A 4I5KA 2HQWA 3TUYB 2DOQA 3KHEA 1K8UA 2KI6C 2H61A 3OB1B 2I7AA 2R2IA 4ORCB 2OTGB 5HKZA 1YUSA 4GUKA 1JFKA 3ZWHA 1AUIB 2LP2A 2JULA 3PLFB 3MSEB 4GFTA 1IG5A 2F2PA 3AAKA 1MWNA 1ZMZA 4UPGA 3BUMB 1YURA 3PSRA 3KPXA 3FWBA 1SR6C 1TRFA 1K9UA 2Y4QA 4MLWA 3PALA 1NUBA 3EKHA 3EVUA 5JOLA 4ORAB 1TNPA 3PFVA 1AK8A 1GGWA 3DF0B 1R6PA 1DJIA 4OR9B 1IGVA 1OOJA 1UHHA 1V1GA 5CSNA 1FI6A 4MZLA 2CBLA 2LC5A 4ETOA 5KTYA 1NX2A 1XFYO 3WXAA 1PSRA 1YUUA 2KDHA 1YX8A 2L98A 1J7OA 1BT6A 3JTDC 4R1EA 2EC6B 1B4CA 3BOWA 4I5NB 4YGEB 1PALA 2WCBA 2M9GA 1CDPA 4GGNA 1DJXA 1ODBA 3TUYC 1UP5A 3BUXB 3FS7A 1BOCA 1B8CA 1KK7Z 3VRNA 4PALA 1D1OA 1XO5A 3NSLA 2K2AA 2BE4A 1OMVA 2BL0C 3SIAA 3SG3A 2KYFA 1LXFC 2MLEC 3SG2A 2O60A 1AHRA 3A8RA 3SG6A 1F54A 1A75B 3FWCA 4HSZA 5TNCA 2G9BA 1A4PA 2FOTA 2WC8A 3D0YA 2HQ8A 1CFCA 3TS5B 4YI9A 1OZSA 1PRWA 1EJ3A 3EVVA 3VRRA 2KQYA 1L2OC 2NZ0A 1TTXA 1KCYA 2LVKA 4PE4A 2WCEA 3EK4A 1JF0A 1CFDA 4NDDA 1RECA 3SG4A 5B8IB 3OP0A 2H2KA 4YGAA 2BKIB 2KGBC 3M0WA 3I5IB 2PRUA 2M97A 2FCEA 4HRHA 1L2OB 2KAXA 5AEQA 2ISDA 1KQVA 2CT9A 2JNFA 2JXCA 2KAVA 2LHIA 5AFPA 1MF8B 2ZN9A 4HRGA 1CDMA 3BQ3A 1F71A 1MXEA 2PALA 1UWOA 2K8MB 5I8NA 1CFPA 4YGDB 3FIAA 1TCOB 2V53A 3BXKA 2GV5A 2JRFA 3KEVA 1QX7A 4Q04A 4YI8A 1BR1B 1IJ6A 1K95A 3JVTC 3OX6A 4N1GA 4C0LA 1MUXA 4GNKB 1OZOA 1MQ1A 1GGZA 4MN0A 4QJ4B 2KAYA 2LANA 1BLQA 2M1KB 5PALA 1OSAA 2LP3A 1SNLA 1YTZC 1CDLA 1LA0A 3KO0A 3JTDB 1B9AA 4PHMA 4ZCUA 2LV7A 1UURA 1DGVA 1QVIY 2KNEA 2PASA 1BG1A 4OKHA 1WDCB 1ZACA 4DIRA 5CSIA 1KSMA 1AVSA 2I2RE 4BY5A 5AANA 4CFRA 2M3WA 2OS8C 4L9MA 4C0JA 3BYAA 3E3RA 2LE9B 1J7PA 1DMOA 1N0YA 4BY4A 4AOMA 1S6CA 2WNDA 4A4CA 1KFUL 1RJVA 1KK7Y 1EL4A 2GGZA 4ZCVA 2M7LA 1Y0VH 3A4UB 1KWOB 1WLMA 5HYDA 3HX4A 2M7NA 4PHNA 1NYAA 1SCMC 4USLA 2LVVA 2L51A 2M8UA 1OMDA 1LINA 2JQ6A 3BOWB 3CS1A 3WHTB 1WDCC 3F45A 1EG4A 2BCAA 1DJYA 1K94A 2JTTA 2KSPA 4U8DA 2QPTA 2LLUA 2H61C 2K61A 2LHLA 3I5GC 4PE0A 3EK7A 1CB1A 1QIVA 2Q91A 2AUCA 5HKWA 1IJ5A 3TDUA 4F0ZB 4MBEA 1QS7A 3BUOB 4ICBA 3CR4X 1B8RA 3HCMA 2HETA 5K89A 1C07A 2HF5A 1SCMB 1WY9A 3H4SE 1UUSA 1NIWA 3SG5A 1YR5A 1PULA 2PSRA 1SL7A 3NXAA 4P2YB 1QATA 4MZKA 1G33A 1R2UA 4GGFA 2Y5IA 2KQ6A 3OX5A 3I5GB 2MLFC 1QLKA 1L7ZA 5IBWA 1SK6D 2BCBA 1ZFSA 1AJ5A 5HKYA 1YUTA 1JBAA 5DKNA 1G8IA 2BECA 4N5XA 1CM1A 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 5GQQC 2WORA 3ICBA 1FF1A 4DCKA 2MA2A 1H8BA 3PN7C 4E68A 1SBJA 1ZOTB 1S36A 2AAOA 4YBHB 2P6BB 4P5OE 5HLVA 3IQOA 1LA3A 4M2PA 2BBNA 2K0JA 1GJYA 2E6WA 1CLLA 1NPQA 2MAZA 1DT7B 2L4HA 4JWQA 1A75A 1LVCD 3AKAA 4I5JA 5DKQA 2KFFA 2LAPA 2KFGA
chains in the Genus database with same CATH superfamily
1M45A 1OOIX 1QVIZ 1TN4A 4N1FA 1RFJA 2WCJA 1F4OA 1B1GA 1JC2A 3LLEA 3O2PA 1FPWA 1J7RA 2JZIA 1JF2A 1DQEA 2F2OA 4GBAA 5KSZA 2D8NA 1SRAA 3B7AA 4FTGA 1SL9A 1XA5A 3S0DA 5CSFA 4PDZA 1XYDA 3CR5X 5I94A 1K9KA 2M1UA 1BF5A 2LMUA 2OTGC 1CDNA 3DZTA 1J1EA 1S6JA 2COLB 2M49B 3D10A 2FJUB 1SR6B 3CZ0A 4I5LB 2SASA 4MRYA 3WNXB 2CTNA 2KGRA 1UHKA 1KQMC 3JVTB 1OOGA 1IWQA 1KK8B 3SIBA 1WRZA 2M0RA 2JXLA 4GAOA 1NSHA 1TOPA 5D3OA 3TDIA 3D73A 3CZTX 3CTNA 1PK0D 3EKJA 5CPVA 4YRUA 5KU1A 1IH0A 3EVRA 2K7BA 1UHIA 3OB2B 3PATA 5D69A 1M46A 1SKTA 5I2LA 1U5IA 1N65A 2KBMA 1QV1A 2BKHB 2NLNA 2AMIA 2PYQA 3D74A 1KQMB 1LKJA 2KBIA 2K2FA 2MJWB 4NDCA 1IRJA 2I94A 4AQJA 1AP4A 1AJ4A 2OS8B 5HLOA 1RK9A 3VGOA 1A03A 5G08A 3AKBA 3WHUB 1XK4A 2GTEA 1IIOA 1GQMA 1J1DA 2L2CA 2PMYA 2JPOA 5DICA 5I2OA 1H4BA 3GK4X 4XJKA 3VRPA 1FI5A 4NQGA 1BU3A 3BJHA 1PSBA 3CWGA 2LVJA 1WRKA 2KPHA 3DVJA 3FE9A 2ZNEA 2ZRSA 1M63B 1BJFA 4OZDA 1X02A 5D7FA 2OPOA 2L0PA 2ZKMX 2KYCA 3D77A 1SYMA 4MEWA 4MSPA 1Z4HA 2JT0A 2QACA 4AQIA 1CMGA 2NXQA 2BNXA 1ALWA 2A4JA 3C1VA 1KFXL 1M31A 3PM8A 1C7VA 3DD4A 3DVKA 1K9PA 3EK8A 2L5XB 4WRIA 2BCXA 1K96A 1NCZA 3O4YA 1DJGA 3R1PA 1KFXS 5ER5A 3N7HA 1NX1A 1B7TZ 2LNKA 1S26D 4PE7A 4QJ5B 3L47A 1BODA 2WC5A 4GPLB 2K7DA 3FE8A 3R72A 4WQ2A 4XJKB 3KF9A 4WQ3A 4PT1A 3SS4A 2MHHA 1UHJA 2L50A 2LVIA 3I5IC 1ALVA 1QWVA 3I5HC 4XYNA 5DKRA 5AERA 4FQOA 3DVMA 2GGMA 1OQPA 1FW4A 2O5GA 1Y6WA 3CGAA 2L4IA 2LUXA 3IF7A 2JT3A 4TNCA 1DJZA 1ZUZA 1QJTA 1S5GY 1G4YR 2CCMA 1SW8A 2F3YA 1YX7A 1TUJA 1DEKA 1MXLC 2F8PA 3NSIA 1DF0B 1Y1XA 4DUQA 3D75A 2F33A 3D76A 1K2HA 3LL8B 1Q80A 2EHBA 3BFBA 4NDBA 1SMGA 1CLMA 1DVIA 2VRGA 3RM1A 3AAJA 1TNWA 4ORBB 1SL8A 1M39A 1EG3A 2JTZA 2WOSA 3I5FB 1S3PA 2KOTA 3SG7A 1KSOA 2NCOA 1JSAA 3TDZA 5AXIA 2JU0A 1KWOC 2ERBA 4MVFA 4GGFC 3OHMB 1GM0A 2BBMA 1DTLA 3PN7B 1V1FA 1MR8A 2Q4UA 2WCHA 1S6IA 3QRXA 4C0KA 2NCPA 1TWOA 4DRWA 5JJGA 1F55A 1QTXA 1RROA 1B8LA 1XFZO 2JOJA 5CSJA 1N2DA 3IQQA 1XFXO 3TZ1A 2EC6C 4YGBB 1F70A 1CNPA 1W9ZA 1B7TY 1J55A 3B87A 4PE1A 5FYXA 4F7FA 1XK4C 2LM5A 4YGCB 1C3ZA 2KFHA 1Y1AA 1B47A 1QLSA 4DS7A 1JWDA 2KLDA 1MHOA 3K1EA 1CFFA 3L4AA 1CMFA 1K90D 1DC1A 1QXPA 2MRDA 2YGUA 1KK8C 1BMOA 2TN4A 1CKKA 1QX2A 3K21A 5FI7A 2QEVA 3RLZA 1JFJA 4JD9A 4CFQA 2QDIA 1DGUA 1XFUO 1TIZA 2ZN8A 3NGVA 1CM4A 2JWWA 4QJ3B 1SCVA 3DVEA 3IVTA 4PCWA 1E8AA 5F6TA 1Z2CB 2LLSA 3D78A 1BR4B 2RGIA 2JT8A 4PHKA 1TNQA 2ZFDA 1YVHA 3S0GA 4M2OA 5BPJA 1HQVA 1YRUB 3R1OA 1Y1UA 1DF0A 2K7OA 2E30A 3PM2A 1NCXA 2JPTA 1WLZA 1DELA 4MZJA 3VRQA 2B1UA 2K60A 1A2XA 4JQ0D 4A4BA 2BAPA 2ZNDA 1IQ5A 2KI4C 1OOFA 1DJWA 3EG5B 1TNXA 3UO9A 1F8HA 2QEHA 1EXRA 1J7QA 2QEOA 2BE6A 1OMRA 1QX5B 1CLBA 3I5FC 2Y1NA 1JUOA 2PVBA 4PHJA 2P70A 2I18A 3D0YB 3NSKA 1UHNA 1W7IB 2HPSA 1U5IB 3DF0A 1XFWO 1NCYA 1NX0A 2EGDA 2IS9A 2KI6D 3LCPC 2FJYA 4IL1A 2BL0B 1SPYA 3BFAA 5ER4X 1NP8A 2QEBA 1DJHA 2LCPA 3SS3A 1NWDA 4D1EA 2JNXA 3VB1A 2FCDA 3B88A 1TCFA 1WRLA 4CLNA 3O6BA 1K93D 3CABA 1W7JB 1KFUS 4OVNF 1IKUA 1RWYA 3GOFA 4CIDA 2JC2A 2LMVA 2SCPA 1EH2A 1S1EA 2KHNA 3GK2A 2LUCA 1C7WA 3BUWB 1S5GZ 2F3ZA 3O78A 1LS8A 1XVJA 1QIWA 2WCFA 2LMTA 1RTP1 3TS5C 1CTRA 2ZRTA 2CNPA 2G2BA 5I2QA 1HT9A 4OV2A 2K7CA 3OBVA 3SJSA 4CPVA 1NX3A 2Y1MA 2WC6A 1YVLA 2KI4B 1A29A 1XFVO 3ZNIA 2CXJA 3NSOA 3LK1A 5J3XA 2LLTA 3CLNA 4OCIA 1PVBA 5FI6A 1QV0A 1SY9A 4M2QA 4HREE 3I5HB 1YRTB 2L2EA 2MBXA 1VRKA 3VROA 3B86A 1SSEB 1F4QA 1PVAA 4MRXA 1FBVA 1QASA 1OE9B 3BFHA 2M29A 3B6XA 2HQWA 3LK0A 2DOQA 4I5KA 3KHEA 3TUYB 1K8UA 2KI6C 2H61A 3OB1B 2I7AA 2R2IA 4ORCB 2OTGB 5HKZA 1YUSA 4GUKA 1JFKA 2P71A 3ZWHA 2L5YA 1AUIB 5EL2A 3S0EA 2LP2A 3UNWA 3O4XA 2JULA 3PLFB 3MSEB 3CDNA 4GFTA 1IG5A 2F2PA 3AAKA 1MWNA 1ZMZA 4UPGA 3BUMB 1YURA 2WCKA 3KPXA 3FWBA 1SR6C 1TRFA 2H8VA 3PSRA 1K9UA 2Y4QA 4INXA 4MLWA 3PALA 1NUBA 3EKHA 3EVUA 5JOLA 4ORAB 1TNPA 3PFVA 1AK8A 1GGWA 3DF0B 3S0BA 1R6PA 1DJIA 4OR9B 1IGVA 3CZ1A 1OOJA 1UHHA 1V1GA 5CSNA 1FI6A 4MZLA 2CBLA 2LC5A 4ETOA 5FI2A 5KTYA 1NX2A 1XFYO 3WXAA 1PSRA 1YUUA 2KDHA 1YX8A 2L98A 3SS5A 1J7OA 1BT6A 3JTDC 4R1EA 2EC6B 1B4CA 3L4LA 3BOWA 4I5NB 4YGEB 1PALA 5HL1A 2WCBA 2M9GA 1CDPA 4GGNA 1DJXA 1ODBA 3TUYC 1UP5A 2KLEA 3BUXB 3FS7A 1BOCA 1B8CA 1KK7Z 3VRNA 4PALA 2WCLA 1D1OA 1XO5A 3NSLA 4IJ7A 2K2AA 2BE4A 1OMVA 2BL0C 3SIAA 3SG3A 2KYFA 1LXFC 2MLEC 3SG2A 2O60A 1AHRA 3A8RA 3NHIA 3SG6A 1F54A 1A75B 3FWCA 4HSZA 5TNCA 2G9BA 1A4PA 2FOTA 2WC8A 3QMEA 3D0YA 2HQ8A 1CFCA 3V2LA 3TS5B 3R1VA 4YI9A 1OZSA 1PRWA 1EJ3A 3EVVA 3VRRA 2KQYA 1L2OC 2NZ0A 1TTXA 1KCYA 2LVKA 4PE4A 2WCEA 3EK4A 1JF0A 4KYNA 1CFDA 4NDDA 1RECA 3SG4A 5B8IB 3OP0A 2H2KA 4YGAA 2BKIB 2KGBC 3M0WA 3I5IB 2PRUA 2M97A 2FCEA 4HRHA 1L2OB 2KAXA 5AEQA 2ISDA 1KQVA 2CT9A 2JNFA 2JXCA 2KAVA 2LHIA 5AFPA 1MF8B 2ZN9A 4HRGA 1CDMA 3BQ3A 4JKTA 1F71A 1MXEA 2PALA 1UWOA 2K8MB 5I8NA 1CFPA 4YGDB 3FIAA 1TCOB 2V53A 3BXKA 2GV5A 2JRFA 3KEVA 1QX7A 4Q04A 4YI8A 4FQTA 1BR1B 1IJ6A 1K95A 3JVTC 3OX6A 4N1GA 4C0LA 3OGNA 3RZSA 1MUXA 4GNKB 1OZOA 1MQ1A 1GGZA 4MN0A 4QJ4B 2KAYA 2LANA 1BLQA 2M1KB 5PALA 1OSAA 2LP3A 1SNLA 1YTZC 3DY9A 1CDLA 1LA0A 3PJIA 1T14A 3KO0A 3JTDB 1B9AA 4PHMA 4ZCUA 2LV7A 1UURA 1DGVA 1QVIY 2KNEA 2PASA 1BG1A 4OKHA 1WDCB 1ZACA 4DIRA 5CSIA 1KSMA 1AVSA 2I2RE 4BY5A 5AANA 4CFRA 2M3WA 2OS8C 4L9MA 4C0JA 3BYAA 3E3RA 2LE9B 1J7PA 1DMOA 1N0YA 4BY4A 4AOMA 1S6CA 2WNDA 4A4CA 1KFUL 1RJVA 1KK7Y 1EL4A 2GGZA 4ZCVA 2M7LA 1Y0VH 3A4UB 1KWOB 1WLMA 3CZ2A 5HYDA 3HX4A 2M7NA 4PHNA 1NYAA 1SCMC 3S0AA 4USLA 2LVVA 2L51A 2M8UA 1OMDA 1LINA 2JQ6A 3BOWB 3CS1A 3WHTB 1WDCC 3F45A 1EG4A 2BCAA 1DJYA 1K94A 1OW4A 2JTTA 2KSPA 4U8DA 1P28A 1C3YA 2QPTA 2LLUA 2H61C 3S0FA 2K61A 2LHLA 3I5GC 4PE0A 3EK7A 1CB1A 1QIVA 2Q91A 2AUCA 5HKWA 1IJ5A 3TDUA 4F0ZB 4MBEA 1QS7A 3BUOB 1OOHA 4ICBA 3CR4X 1B8RA 3HCMA 2HETA 5K89A 1C07A 2HF5A 1SCMB 1WY9A 3H4SE 1UUSA 1NIWA 3SG5A 1YR5A 1PULA 2PSRA 1SL7A 3NXAA 4P2YB 1QATA 4MZKA 1G33A 3DYEA 1R2UA 4GGFA 2Y5IA 2KQ6A 3DXLA 3OX5A 3I5GB 2WCMA 2MLFC 1QLKA 1L7ZA 5IBWA 3Q8IA 1SK6D 2BCBA 1ZFSA 1AJ5A 5HKYA 1YUTA 1JBAA 5DKNA 1G8IA 2BECA 4N5XA 1CM1A 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 5GQQC 2WORA 3ICBA 1FF1A 4DCKA 2MA2A 1H8BA 3PN7C 4E68A 3FE6A 1SBJA 1ZOTB 1S36A 1ORGA 2AAOA 4YBHB 2P6BB 4P5OE 5HLVA 3IQOA 1LA3A 2PQLA 3NHTA 2BBNA 2K0JA 1GJYA 1TUZA 1CLLA 1NPQA 2E6WA 2MAZA 4M2PA 1DT7B 1XFRA 4INWA 2L4HA 4JWQA 3CYZA 1A75A 1LVCD 3AKAA 4I5JA 5DKQA 2KFFA 2LAPA 2KFGA
chains in the Genus database with same CATH topology
1M45A 1QVIZ 1TN4A 4N1FA 1RFJA 1F4OA 1B1GA 1JC2A 3LLEA 3O2PA 1FPWA 1J7RA 2JZIA 1JF2A 2F2OA 4GBAA 5KSZA 2D8NA 1SRAA 4FTGA 1SL9A 1XA5A 5CSFA 4PDZA 1XYDA 3CR5X 1CDNA 1K9KA 2M1UA 1BF5A 2LMUA 2OTGC 1J1EA 1S6JA 2COLB 2M49B 3D10A 2FJUB 1SR6B 4I5LB 4MRYA 2SASA 3WNXB 2CTNA 2KGRA 1UHKA 1KQMC 3JVTB 1IWQA 1KK8B 3SIBA 1WRZA 2M0RA 2JXLA 4GAOA 1NSHA 1TOPA 3TDIA 3EKJA 3CZTX 3CTNA 1PK0D 5CPVA 4YRUA 5KU1A 1IH0A 3EVRA 2K7BA 1UHIA 3OB2B 3PATA 5D69A 1M46A 1SKTA 5I2LA 1U5IA 1N65A 2KBMA 1QV1A 2BKHB 2NLNA 2AMIA 1KQMB 1LKJA 2KBIA 2K2FA 2MJWB 4NDCA 1IRJA 2I94A 4AQJA 1AP4A 1AJ4A 2OS8B 5HLOA 1RK9A 3VGOA 1A03A 5G08A 3AKBA 3WHUB 1XK4A 1GQMA 1J1DA 2PMYA 5I2OA 1H4BA 3GK4X 4XJKA 3VRPA 1FI5A 4NQGA 1BU3A 1PSBA 3CWGA 2LVJA 1WRKA 3DVJA 2ZNEA 2ZRSA 1M63B 1BJFA 1X02A 5D7FA 2OPOA 2L0PA 2ZKMX 2KYCA 1SYMA 4MEWA 4MSPA 2JT0A 2QACA 4AQIA 1CMGA 2NXQA 1ALWA 2A4JA 3C1VA 1KFXL 1M31A 3PM8A 1C7VA 3DD4A 3DVKA 1K9PA 3EK8A 2L5XB 4WRIA 2BCXA 1K96A 1NCZA 3O4YA 1DJGA 1KFXS 5ER5A 1NX1A 1B7TZ 2LNKA 1S26D 4PE7A 4QJ5B 1BODA 4WQ2A 4GPLB 2K7DA 4XJKB 3KF9A 4WQ3A 2MHHA 1UHJA 2L50A 2LVIA 3I5IC 1ALVA 3I5HC 5DKRA 4XYNA 5AERA 4FQOA 3DVMA 2GGMA 1OQPA 1FW4A 2O5GA 1Y6WA 3CGAA 2L4IA 2LUXA 3IF7A 2JT3A 4TNCA 1DJZA 1ZUZA 1QJTA 1S5GY 1G4YR 2CCMA 1SW8A 2F3YA 1YX7A 1MXLC 2F8PA 3NSIA 1DF0B 1Y1XA 4DUQA 2F33A 1K2HA 3LL8B 1Q80A 2EHBA 4NDBA 1SMGA 1CLMA 1DVIA 2VRGA 3RM1A 3AAJA 1TNWA 4ORBB 1SL8A 1M39A 1EG3A 2JTZA 2WOSA 3I5FB 1S3PA 2KOTA 3SG7A 1KSOA 2NCOA 1JSAA 3TDZA 5AXIA 2JU0A 1KWOC 4MVFA 4GGFC 3OHMB 2BBMA 1DTLA 3PN7B 1V1FA 1MR8A 2Q4UA 4C0KA 1S6IA 3QRXA 4DRWA 2NCPA 5JJGA 1F55A 1QTXA 1RROA 1B8LA 1XFZO 2JOJA 5CSJA 1N2DA 3IQQA 1XFXO 3TZ1A 2EC6C 4YGBB 1F70A 1CNPA 1B7TY 1J55A 4PE1A 5FYXA 1XK4C 2LM5A 4YGCB 2KFHA 1Y1AA 1B47A 1QLSA 4DS7A 1JWDA 1MHOA 1CFFA 1CMFA 1K90D 1QXPA 2MRDA 1KK8C 1BMOA 2TN4A 1CKKA 1QX2A 3K21A 3RLZA 1JFJA 4CFQA 1DGUA 1XFUO 1TIZA 2ZN8A 1CM4A 2JWWA 4QJ3B 1SCVA 3DVEA 4PCWA 5F6TA 1E8AA 2LLSA 1BR4B 2RGIA 2JT8A 4PHKA 1TNQA 2ZFDA 1YVHA 4M2OA 5BPJA 1HQVA 1YRUB 1Y1UA 1DF0A 2K7OA 2E30A 1NCXA 2JPTA 1WLZA 4MZJA 3VRQA 2B1UA 4A4BA 1A2XA 4JQ0D 2ZNDA 1IQ5A 2KI4C 1DJWA 1TNXA 1F8HA 1EXRA 1J7QA 2BE6A 1OMRA 1QX5B 1CLBA 3I5FC 2Y1NA 1JUOA 2PVBA 4PHJA 2I18A 3D0YB 3NSKA 1UHNA 1W7IB 2HPSA 1U5IB 3DF0A 1XFWO 1NCYA 1NX0A 2EGDA 2IS9A 2KI6D 3LCPC 4IL1A 2BL0B 1SPYA 5ER4X 1NP8A 4D1EA 1DJHA 2LCPA 1NWDA 2JNXA 2FCDA 1TCFA 1WRLA 4CLNA 3O6BA 1K93D 1W7JB 1KFUS 4OVNF 1IKUA 1RWYA 3GOFA 4CIDA 2JC2A 2LMVA 2SCPA 1EH2A 1S1EA 2KHNA 3GK2A 2LUCA 1C7WA 3BUWB 1S5GZ 2F3ZA 3O78A 1XVJA 1QIWA 2WCFA 2LMTA 1RTP1 3TS5C 1CTRA 2ZRTA 2CNPA 2G2BA 5I2QA 1HT9A 4OV2A 2K7CA 3SJSA 4CPVA 1NX3A 2Y1MA 1YVLA 2KI4B 1A29A 1XFVO 3ZNIA 2CXJA 3NSOA 3LK1A 5J3XA 2LLTA 3CLNA 4OCIA 1PVBA 1QV0A 1SY9A 4M2QA 4HREE 3I5HB 1YRTB 2L2EA 2MBXA 1VRKA 3VROA 4MRXA 1F4QA 1PVAA 1FBVA 1QASA 1OE9B 3LK0A 2M29A 4I5KA 2HQWA 3TUYB 2DOQA 3KHEA 1K8UA 2KI6C 2H61A 3OB1B 2I7AA 2R2IA 4ORCB 2OTGB 5HKZA 1YUSA 4GUKA 1JFKA 3ZWHA 1AUIB 2LP2A 2JULA 3PLFB 3MSEB 4GFTA 1IG5A 2F2PA 3AAKA 1MWNA 1ZMZA 4UPGA 3BUMB 1YURA 3PSRA 3KPXA 3FWBA 1SR6C 1TRFA 1K9UA 2Y4QA 4MLWA 3PALA 1NUBA 3EKHA 3EVUA 5JOLA 4ORAB 1TNPA 3PFVA 1AK8A 1GGWA 3DF0B 1R6PA 1DJIA 4OR9B 1IGVA 1OOJA 1UHHA 1V1GA 5CSNA 1FI6A 4MZLA 2CBLA 2LC5A 4ETOA 5KTYA 1NX2A 1XFYO 3WXAA 1PSRA 1YUUA 2KDHA 1YX8A 2L98A 1J7OA 1BT6A 3JTDC 4R1EA 2EC6B 1B4CA 3BOWA 4I5NB 4YGEB 1PALA 2WCBA 2M9GA 1CDPA 4GGNA 1DJXA 1ODBA 3TUYC 1UP5A 3BUXB 3FS7A 1BOCA 1B8CA 1KK7Z 3VRNA 4PALA 1D1OA 1XO5A 3NSLA 2K2AA 2BE4A 1OMVA 2BL0C 3SIAA 3SG3A 2KYFA 1LXFC 2MLEC 3SG2A 2O60A 1AHRA 3A8RA 3SG6A 1F54A 1A75B 3FWCA 4HSZA 5TNCA 2G9BA 1A4PA 2FOTA 2WC8A 3D0YA 2HQ8A 1CFCA 3TS5B 4YI9A 1OZSA 1PRWA 1EJ3A 3EVVA 3VRRA 2KQYA 1L2OC 2NZ0A 1TTXA 1KCYA 2LVKA 4PE4A 2WCEA 3EK4A 1JF0A 1CFDA 4NDDA 1RECA 3SG4A 5B8IB 3OP0A 2H2KA 4YGAA 2BKIB 2KGBC 3M0WA 3I5IB 2PRUA 2M97A 2FCEA 4HRHA 1L2OB 2KAXA 5AEQA 2ISDA 1KQVA 2CT9A 2JNFA 2JXCA 2KAVA 2LHIA 5AFPA 1MF8B 2ZN9A 4HRGA 1CDMA 3BQ3A 1F71A 1MXEA 2PALA 1UWOA 2K8MB 5I8NA 1CFPA 4YGDB 3FIAA 1TCOB 2V53A 3BXKA 2GV5A 2JRFA 3KEVA 1QX7A 4Q04A 4YI8A 1BR1B 1IJ6A 1K95A 3JVTC 3OX6A 4N1GA 4C0LA 1MUXA 4GNKB 1OZOA 1MQ1A 1GGZA 4MN0A 4QJ4B 2KAYA 2LANA 1BLQA 2M1KB 5PALA 1OSAA 2LP3A 1SNLA 1YTZC 1CDLA 1LA0A 3KO0A 3JTDB 1B9AA 4PHMA 4ZCUA 2LV7A 1UURA 1DGVA 1QVIY 2KNEA 2PASA 1BG1A 4OKHA 1WDCB 1ZACA 4DIRA 5CSIA 1KSMA 1AVSA 2I2RE 4BY5A 5AANA 4CFRA 2M3WA 2OS8C 4L9MA 4C0JA 3BYAA 3E3RA 2LE9B 1J7PA 1DMOA 1N0YA 4BY4A 4AOMA 1S6CA 2WNDA 4A4CA 1KFUL 1RJVA 1KK7Y 1EL4A 2GGZA 4ZCVA 2M7LA 1Y0VH 3A4UB 1KWOB 1WLMA 5HYDA 3HX4A 2M7NA 4PHNA 1NYAA 1SCMC 4USLA 2LVVA 2L51A 2M8UA 1OMDA 1LINA 2JQ6A 3BOWB 3CS1A 3WHTB 1WDCC 3F45A 1EG4A 2BCAA 1DJYA 1K94A 2JTTA 2KSPA 4U8DA 2QPTA 2LLUA 2H61C 2K61A 2LHLA 3I5GC 4PE0A 3EK7A 1CB1A 1QIVA 2Q91A 2AUCA 5HKWA 1IJ5A 3TDUA 4F0ZB 4MBEA 1QS7A 3BUOB 4ICBA 3CR4X 1B8RA 3HCMA 2HETA 5K89A 1C07A 2HF5A 1SCMB 1WY9A 3H4SE 1UUSA 1NIWA 3SG5A 1YR5A 1PULA 2PSRA 1SL7A 3NXAA 4P2YB 1QATA 4MZKA 1G33A 1R2UA 4GGFA 2Y5IA 2KQ6A 3OX5A 3I5GB 2MLFC 1QLKA 1L7ZA 5IBWA 1SK6D 2BCBA 1ZFSA 1AJ5A 5HKYA 1YUTA 1JBAA 5DKNA 1G8IA 2BECA 4N5XA 1CM1A 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 5GQQC 2WORA 3ICBA 1FF1A 4DCKA 2MA2A 1H8BA 3PN7C 4E68A 1SBJA 1ZOTB 1S36A 2AAOA 4YBHB 2P6BB 4P5OE 5HLVA 3IQOA 1LA3A 4M2PA 2BBNA 2K0JA 1GJYA 2E6WA 1CLLA 1NPQA 2MAZA 1DT7B 2L4HA 4JWQA 1A75A 1LVCD 3AKAA 4I5JA 5DKQA 2KFFA 2LAPA 2KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M45 A;  1QVI Z;  1TN4 A;  4N1F A;  1RFJ A;  1F4O A;  1B1G A;  1JC2 A;  3LLE A;  3O2P A;  1FPW A;  1J7R A;  2JZI A;  1JF2 A;  2F2O A;  4GBA A;  5KSZ A;  2D8N A;  1SRA A;  4FTG A;  1SL9 A;  1XA5 A;  5CSF A;  4PDZ A;  1XYD A;  3CR5 X;  1CDN A;  1K9K A;  2M1U A;  1BF5 A;  2LMU A;  2OTG C;  1J1E A;  1S6J A;  2COL B;  2M49 B;  3D10 A;  2FJU B;  1SR6 B;  4I5L B;  4MRY A;  2SAS A;  3WNX B;  2CTN A;  2KGR A;  1UHK A;  1KQM C;  3JVT B;  1IWQ A;  1KK8 B;  3SIB A;  1WRZ A;  2M0R A;  2JXL A;  4GAO A;  1NSH A;  1TOP A;  3TDI A;  3EKJ A;  3CZT X;  3CTN A;  1PK0 D;  5CPV A;  4YRU A;  5KU1 A;  1IH0 A;  3EVR A;  2K7B A;  1UHI A;  3OB2 B;  3PAT A;  5D69 A;  1M46 A;  1SKT A;  5I2L A;  1U5I A;  1N65 A;  2KBM A;  1QV1 A;  2BKH B;  2NLN A;  2AMI A;  1KQM B;  1LKJ A;  2KBI A;  2K2F A;  2MJW B;  4NDC A;  1IRJ A;  2I94 A;  4AQJ A;  1AP4 A;  1AJ4 A;  2OS8 B;  5HLO A;  1RK9 A;  3VGO A;  1A03 A;  5G08 A;  3AKB A;  3WHU B;  1XK4 A;  1GQM A;  1J1D A;  2PMY A;  5I2O A;  1H4B A;  3GK4 X;  4XJK A;  3VRP A;  1FI5 A;  4NQG A;  1BU3 A;  1PSB A;  3CWG A;  2LVJ A;  1WRK A;  3DVJ A;  2ZNE A;  2ZRS A;  1M63 B;  1BJF A;  1X02 A;  5D7F A;  2OPO A;  2L0P A;  2ZKM X;  2KYC A;  1SYM A;  4MEW A;  4MSP A;  2JT0 A;  2QAC A;  4AQI A;  1CMG A;  2NXQ A;  1ALW A;  2A4J A;  3C1V A;  1KFX L;  1M31 A;  3PM8 A;  1C7V A;  3DD4 A;  3DVK A;  1K9P A;  3EK8 A;  2L5X B;  4WRI A;  2BCX A;  1K96 A;  1NCZ A;  3O4Y A;  1DJG A;  1KFX S;  5ER5 A;  1NX1 A;  1B7T Z;  2LNK A;  1S26 D;  4PE7 A;  4QJ5 B;  1BOD A;  4WQ2 A;  4GPL B;  2K7D A;  4XJK B;  3KF9 A;  4WQ3 A;  2MHH A;  1UHJ A;  2L50 A;  2LVI A;  3I5I C;  1ALV A;  3I5H C;  5DKR A;  4XYN A;  5AER A;  4FQO A;  3DVM A;  2GGM A;  1OQP A;  1FW4 A;  2O5G A;  1Y6W A;  3CGA A;  2L4I A;  2LUX A;  3IF7 A;  2JT3 A;  4TNC A;  1DJZ A;  1ZUZ A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1SW8 A;  2F3Y A;  1YX7 A;  1MXL C;  2F8P A;  3NSI A;  1DF0 B;  1Y1X A;  4DUQ A;  2F33 A;  1K2H A;  3LL8 B;  1Q80 A;  2EHB A;  4NDB A;  1SMG A;  1CLM A;  1DVI A;  2VRG A;  3RM1 A;  3AAJ A;  1TNW A;  4ORB B;  1SL8 A;  1M39 A;  1EG3 A;  2JTZ A;  2WOS A;  3I5F B;  1S3P A;  2KOT A;  3SG7 A;  1KSO A;  2NCO A;  1JSA A;  3TDZ A;  5AXI A;  2JU0 A;  1KWO C;  4MVF A;  4GGF C;  3OHM B;  2BBM A;  1DTL A;  3PN7 B;  1V1F A;  1MR8 A;  2Q4U A;  4C0K A;  1S6I A;  3QRX A;  4DRW A;  2NCP A;  5JJG A;  1F55 A;  1QTX A;  1RRO A;  1B8L A;  1XFZ O;  2JOJ A;  5CSJ A;  1N2D A;  3IQQ A;  1XFX O;  3TZ1 A;  2EC6 C;  4YGB B;  1F70 A;  1CNP A;  1B7T Y;  1J55 A;  4PE1 A;  5FYX A;  1XK4 C;  2LM5 A;  4YGC B;  2KFH A;  1Y1A A;  1B47 A;  1QLS A;  4DS7 A;  1JWD A;  1MHO A;  1CFF A;  1CMF A;  1K90 D;  1QXP A;  2MRD A;  1KK8 C;  1BMO A;  2TN4 A;  1CKK A;  1QX2 A;  3K21 A;  3RLZ A;  1JFJ A;  4CFQ A;  1DGU A;  1XFU O;  1TIZ A;  2ZN8 A;  1CM4 A;  2JWW A;  4QJ3 B;  1SCV A;  3DVE A;  4PCW A;  5F6T A;  1E8A A;  2LLS A;  1BR4 B;  2RGI A;  2JT8 A;  4PHK A;  1TNQ A;  2ZFD A;  1YVH A;  4M2O A;  5BPJ A;  1HQV A;  1YRU B;  1Y1U A;  1DF0 A;  2K7O A;  2E30 A;  1NCX A;  2JPT A;  1WLZ A;  4MZJ A;  3VRQ A;  2B1U A;  4A4B A;  1A2X A;  4JQ0 D;  2ZND A;  1IQ5 A;  2KI4 C;  1DJW A;  1TNX A;  1F8H A;  1EXR A;  1J7Q A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  3I5F C;  2Y1N A;  1JUO A;  2PVB A;  4PHJ A;  2I18 A;  3D0Y B;  3NSK A;  1UHN A;  1W7I B;  2HPS A;  1U5I B;  3DF0 A;  1XFW O;  1NCY A;  1NX0 A;  2EGD A;  2IS9 A;  2KI6 D;  3LCP C;  4IL1 A;  2BL0 B;  1SPY A;  5ER4 X;  1NP8 A;  4D1E A;  1DJH A;  2LCP A;  1NWD A;  2JNX A;  2FCD A;  1TCF A;  1WRL A;  4CLN A;  3O6B A;  1K93 D;  1W7J B;  1KFU S;  4OVN F;  1IKU A;  1RWY A;  3GOF A;  4CID A;  2JC2 A;  2LMV A;  2SCP A;  1EH2 A;  1S1E A;  2KHN A;  3GK2 A;  2LUC A;  1C7W A;  3BUW B;  1S5G Z;  2F3Z A;  3O78 A;  1XVJ A;  1QIW A;  2WCF A;  2LMT A;  1RTP 1;  3TS5 C;  1CTR A;  2ZRT A;  2CNP A;  2G2B A;  5I2Q A;  1HT9 A;  4OV2 A;  2K7C A;  3SJS A;  4CPV A;  1NX3 A;  2Y1M A;  1YVL A;  2KI4 B;  1A29 A;  1XFV O;  3ZNI A;  2CXJ A;  3NSO A;  3LK1 A;  5J3X A;  2LLT A;  3CLN A;  4OCI A;  1PVB A;  1QV0 A;  1SY9 A;  4M2Q A;  4HRE E;  3I5H B;  1YRT B;  2L2E A;  2MBX A;  1VRK A;  3VRO A;  4MRX A;  1F4Q A;  1PVA A;  1FBV A;  1QAS A;  1OE9 B;  3LK0 A;  2M29 A;  4I5K A;  2HQW A;  3TUY B;  2DOQ A;  3KHE A;  1K8U A;  2KI6 C;  2H61 A;  3OB1 B;  2I7A A;  2R2I A;  4ORC B;  2OTG B;  5HKZ A;  1YUS A;  4GUK A;  1JFK A;  3ZWH A;  1AUI B;  2LP2 A;  2JUL A;  3PLF B;  3MSE B;  4GFT A;  1IG5 A;  2F2P A;  3AAK A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  1YUR A;  3PSR A;  3KPX A;  3FWB A;  1SR6 C;  1TRF A;  1K9U A;  2Y4Q A;  4MLW A;  3PAL A;  1NUB A;  3EKH A;  3EVU A;  5JOL A;  4ORA B;  1TNP A;  3PFV A;  1AK8 A;  1GGW A;  3DF0 B;  1R6P A;  1DJI A;  4OR9 B;  1IGV A;  1OOJ A;  1UHH A;  1V1G A;  5CSN A;  1FI6 A;  4MZL A;  2CBL A;  2LC5 A;  4ETO A;  5KTY A;  1NX2 A;  1XFY O;  3WXA A;  1PSR A;  1YUU A;  2KDH A;  1YX8 A;  2L98 A;  1J7O A;  1BT6 A;  3JTD C;  4R1E A;  2EC6 B;  1B4C A;  3BOW A;  4I5N B;  4YGE B;  1PAL A;  2WCB A;  2M9G A;  1CDP A;  4GGN A;  1DJX A;  1ODB A;  3TUY C;  1UP5 A;  3BUX B;  3FS7 A;  1BOC A;  1B8C A;  1KK7 Z;  3VRN A;  4PAL A;  1D1O A;  1XO5 A;  3NSL A;  2K2A A;  2BE4 A;  1OMV A;  2BL0 C;  3SIA A;  3SG3 A;  2KYF A;  1LXF C;  2MLE C;  3SG2 A;  2O60 A;  1AHR A;  3A8R A;  3SG6 A;  1F54 A;  1A75 B;  3FWC A;  4HSZ A;  5TNC A;  2G9B A;  1A4P A;  2FOT A;  2WC8 A;  3D0Y A;  2HQ8 A;  1CFC A;  3TS5 B;  4YI9 A;  1OZS A;  1PRW A;  1EJ3 A;  3EVV A;  3VRR A;  2KQY A;  1L2O C;  2NZ0 A;  1TTX A;  1KCY A;  2LVK A;  4PE4 A;  2WCE A;  3EK4 A;  1JF0 A;  1CFD A;  4NDD A;  1REC A;  3SG4 A;  5B8I B;  3OP0 A;  2H2K A;  4YGA A;  2BKI B;  2KGB C;  3M0W A;  3I5I B;  2PRU A;  2M97 A;  2FCE A;  4HRH A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  1KQV A;  2CT9 A;  2JNF A;  2JXC A;  2KAV A;  2LHI A;  5AFP A;  1MF8 B;  2ZN9 A;  4HRG A;  1CDM A;  3BQ3 A;  1F71 A;  1MXE A;  2PAL A;  1UWO A;  2K8M B;  5I8N A;  1CFP A;  4YGD B;  3FIA A;  1TCO B;  2V53 A;  3BXK A;  2GV5 A;  2JRF A;  3KEV A;  1QX7 A;  4Q04 A;  4YI8 A;  1BR1 B;  1IJ6 A;  1K95 A;  3JVT C;  3OX6 A;  4N1G A;  4C0L A;  1MUX A;  4GNK B;  1OZO A;  1MQ1 A;  1GGZ A;  4MN0 A;  4QJ4 B;  2KAY A;  2LAN A;  1BLQ A;  2M1K B;  5PAL A;  1OSA A;  2LP3 A;  1SNL A;  1YTZ C;  1CDL A;  1LA0 A;  3KO0 A;  3JTD B;  1B9A A;  4PHM A;  4ZCU A;  2LV7 A;  1UUR A;  1DGV A;  1QVI Y;  2KNE A;  2PAS A;  1BG1 A;  4OKH A;  1WDC B;  1ZAC A;  4DIR A;  5CSI A;  1KSM A;  1AVS A;  2I2R E;  4BY5 A;  5AAN A;  4CFR A;  2M3W A;  2OS8 C;  4L9M A;  4C0J A;  3BYA A;  3E3R A;  2LE9 B;  1J7P A;  1DMO A;  1N0Y A;  4BY4 A;  4AOM A;  1S6C A;  2WND A;  4A4C A;  1KFU L;  1RJV A;  1KK7 Y;  1EL4 A;  2GGZ A;  4ZCV A;  2M7L A;  1Y0V H;  3A4U B;  1KWO B;  1WLM A;  5HYD A;  3HX4 A;  2M7N A;  4PHN A;  1NYA A;  1SCM C;  4USL A;  2LVV A;  2L51 A;  2M8U A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  3CS1 A;  3WHT B;  1WDC C;  3F45 A;  1EG4 A;  2BCA A;  1DJY A;  1K94 A;  2JTT A;  2KSP A;  4U8D A;  2QPT A;  2LLU A;  2H61 C;  2K61 A;  2LHL A;  3I5G C;  4PE0 A;  3EK7 A;  1CB1 A;  1QIV A;  2Q91 A;  2AUC A;  5HKW A;  1IJ5 A;  3TDU A;  4F0Z B;  4MBE A;  1QS7 A;  3BUO B;  4ICB A;  3CR4 X;  1B8R A;  3HCM A;  2HET A;  5K89 A;  1C07 A;  2HF5 A;  1SCM B;  1WY9 A;  3H4S E;  1UUS A;  1NIW A;  3SG5 A;  1YR5 A;  1PUL A;  2PSR A;  1SL7 A;  3NXA A;  4P2Y B;  1QAT A;  4MZK A;  1G33 A;  1R2U A;  4GGF A;  2Y5I A;  2KQ6 A;  3OX5 A;  3I5G B;  2MLF C;  1QLK A;  1L7Z A;  5IBW A;  1SK6 D;  2BCB A;  1ZFS A;  1AJ5 A;  5HKY A;  1YUT A;  1JBA A;  5DKN A;  1G8I A;  2BEC A;  4N5X A;  1CM1 A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  5GQQ C;  2WOR A;  3ICB A;  1FF1 A;  4DCK A;  2MA2 A;  1H8B A;  3PN7 C;  4E68 A;  1SBJ A;  1ZOT B;  1S36 A;  2AAO A;  4YBH B;  2P6B B;  4P5O E;  5HLV A;  3IQO A;  1LA3 A;  4M2P A;  2BBN A;  2K0J A;  1GJY A;  2E6W A;  1CLL A;  1NPQ A;  2MAZ A;  1DT7 B;  2L4H A;  4JWQ A;  1A75 A;  1LVC D;  3AKA A;  4I5J A;  5DKQ A;  2KFF A;  2LAP A;  2KFG A; 
#chains in the Genus database with same CATH topology
 1M45 A;  1OOI X;  1QVI Z;  1TN4 A;  4N1F A;  1RFJ A;  2WCJ A;  1F4O A;  1B1G A;  1JC2 A;  3LLE A;  3O2P A;  1FPW A;  1J7R A;  2JZI A;  1JF2 A;  1DQE A;  2F2O A;  4GBA A;  5KSZ A;  2D8N A;  1SRA A;  3B7A A;  4FTG A;  1SL9 A;  1XA5 A;  3S0D A;  5CSF A;  4PDZ A;  1XYD A;  3CR5 X;  5I94 A;  1K9K A;  2M1U A;  1BF5 A;  2LMU A;  2OTG C;  1CDN A;  3DZT A;  1J1E A;  1S6J A;  2COL B;  2M49 B;  3D10 A;  2FJU B;  1SR6 B;  3CZ0 A;  4I5L B;  2SAS A;  4MRY A;  3WNX B;  2CTN A;  2KGR A;  1UHK A;  1KQM C;  3JVT B;  1OOG A;  1IWQ A;  1KK8 B;  3SIB A;  1WRZ A;  2M0R A;  2JXL A;  4GAO A;  1NSH A;  1TOP A;  5D3O A;  3TDI A;  3D73 A;  3CZT X;  3CTN A;  1PK0 D;  3EKJ A;  5CPV A;  4YRU A;  5KU1 A;  1IH0 A;  3EVR A;  2K7B A;  1UHI A;  3OB2 B;  3PAT A;  5D69 A;  1M46 A;  1SKT A;  5I2L A;  1U5I A;  1N65 A;  2KBM A;  1QV1 A;  2BKH B;  2NLN A;  2AMI A;  2PYQ A;  3D74 A;  1KQM B;  1LKJ A;  2KBI A;  2K2F A;  2MJW B;  4NDC A;  1IRJ A;  2I94 A;  4AQJ A;  1AP4 A;  1AJ4 A;  2OS8 B;  5HLO A;  1RK9 A;  3VGO A;  1A03 A;  5G08 A;  3AKB A;  3WHU B;  1XK4 A;  2GTE A;  1IIO A;  1GQM A;  1J1D A;  2L2C A;  2PMY A;  2JPO A;  5DIC A;  5I2O A;  1H4B A;  3GK4 X;  4XJK A;  3VRP A;  1FI5 A;  4NQG A;  1BU3 A;  3BJH A;  1PSB A;  3CWG A;  2LVJ A;  1WRK A;  2KPH A;  3DVJ A;  3FE9 A;  2ZNE A;  2ZRS A;  1M63 B;  1BJF A;  4OZD A;  1X02 A;  5D7F A;  2OPO A;  2L0P A;  2ZKM X;  2KYC A;  3D77 A;  1SYM A;  4MEW A;  4MSP A;  1Z4H A;  2JT0 A;  2QAC A;  4AQI A;  1CMG A;  2NXQ A;  2BNX A;  1ALW A;  2A4J A;  3C1V A;  1KFX L;  1M31 A;  3PM8 A;  1C7V A;  3DD4 A;  3DVK A;  1K9P A;  3EK8 A;  2L5X B;  4WRI A;  2BCX A;  1K96 A;  1NCZ A;  3O4Y A;  1DJG A;  3R1P A;  1KFX S;  5ER5 A;  3N7H A;  1NX1 A;  1B7T Z;  2LNK A;  1S26 D;  4PE7 A;  4QJ5 B;  3L47 A;  1BOD A;  2WC5 A;  4GPL B;  2K7D A;  3FE8 A;  3R72 A;  4WQ2 A;  4XJK B;  3KF9 A;  4WQ3 A;  4PT1 A;  3SS4 A;  2MHH A;  1UHJ A;  2L50 A;  2LVI A;  3I5I C;  1ALV A;  1QWV A;  3I5H C;  4XYN A;  5DKR A;  5AER A;  4FQO A;  3DVM A;  2GGM A;  1OQP A;  1FW4 A;  2O5G A;  1Y6W A;  3CGA A;  2L4I A;  2LUX A;  3IF7 A;  2JT3 A;  4TNC A;  1DJZ A;  1ZUZ A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1SW8 A;  2F3Y A;  1YX7 A;  1TUJ A;  1DEK A;  1MXL C;  2F8P A;  3NSI A;  1DF0 B;  1Y1X A;  4DUQ A;  3D75 A;  2F33 A;  3D76 A;  1K2H A;  3LL8 B;  1Q80 A;  2EHB A;  3BFB A;  4NDB A;  1SMG A;  1CLM A;  1DVI A;  2VRG A;  3RM1 A;  3AAJ A;  1TNW A;  4ORB B;  1SL8 A;  1M39 A;  1EG3 A;  2JTZ A;  2WOS A;  3I5F B;  1S3P A;  2KOT A;  3SG7 A;  1KSO A;  2NCO A;  1JSA A;  3TDZ A;  5AXI A;  2JU0 A;  1KWO C;  2ERB A;  4MVF A;  4GGF C;  3OHM B;  1GM0 A;  2BBM A;  1DTL A;  3PN7 B;  1V1F A;  1MR8 A;  2Q4U A;  2WCH A;  1S6I A;  3QRX A;  4C0K A;  2NCP A;  1TWO A;  4DRW A;  5JJG A;  1F55 A;  1QTX A;  1RRO A;  1B8L A;  1XFZ O;  2JOJ A;  5CSJ A;  1N2D A;  3IQQ A;  1XFX O;  3TZ1 A;  2EC6 C;  4YGB B;  1F70 A;  1CNP A;  1W9Z A;  1B7T Y;  1J55 A;  3B87 A;  4PE1 A;  5FYX A;  4F7F A;  1XK4 C;  2LM5 A;  4YGC B;  1C3Z A;  2KFH A;  1Y1A A;  1B47 A;  1QLS A;  4DS7 A;  1JWD A;  2KLD A;  1MHO A;  3K1E A;  1CFF A;  3L4A A;  1CMF A;  1K90 D;  1DC1 A;  1QXP A;  2MRD A;  2YGU A;  1KK8 C;  1BMO A;  2TN4 A;  1CKK A;  1QX2 A;  3K21 A;  5FI7 A;  2QEV A;  3RLZ A;  1JFJ A;  4JD9 A;  4CFQ A;  2QDI A;  1DGU A;  1XFU O;  1TIZ A;  2ZN8 A;  3NGV A;  1CM4 A;  2JWW A;  4QJ3 B;  1SCV A;  3DVE A;  3IVT A;  4PCW A;  1E8A A;  5F6T A;  1Z2C B;  2LLS A;  3D78 A;  1BR4 B;  2RGI A;  2JT8 A;  4PHK A;  1TNQ A;  2ZFD A;  1YVH A;  3S0G A;  4M2O A;  5BPJ A;  1HQV A;  1YRU B;  3R1O A;  1Y1U A;  1DF0 A;  2K7O A;  2E30 A;  3PM2 A;  1NCX A;  2JPT A;  1WLZ A;  1DEL A;  4MZJ A;  3VRQ A;  2B1U A;  2K60 A;  1A2X A;  4JQ0 D;  4A4B A;  2BAP A;  2ZND A;  1IQ5 A;  2KI4 C;  1OOF A;  1DJW A;  3EG5 B;  1TNX A;  3UO9 A;  1F8H A;  2QEH A;  1EXR A;  1J7Q A;  2QEO A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  3I5F C;  2Y1N A;  1JUO A;  2PVB A;  4PHJ A;  2P70 A;  2I18 A;  3D0Y B;  3NSK A;  1UHN A;  1W7I B;  2HPS A;  1U5I B;  3DF0 A;  1XFW O;  1NCY A;  1NX0 A;  2EGD A;  2IS9 A;  2KI6 D;  3LCP C;  2FJY A;  4IL1 A;  2BL0 B;  1SPY A;  3BFA A;  5ER4 X;  1NP8 A;  2QEB A;  1DJH A;  2LCP A;  3SS3 A;  1NWD A;  4D1E A;  2JNX A;  3VB1 A;  2FCD A;  3B88 A;  1TCF A;  1WRL A;  4CLN A;  3O6B A;  1K93 D;  3CAB A;  1W7J B;  1KFU S;  4OVN F;  1IKU A;  1RWY A;  3GOF A;  4CID A;  2JC2 A;  2LMV A;  2SCP A;  1EH2 A;  1S1E A;  2KHN A;  3GK2 A;  2LUC A;  1C7W A;  3BUW B;  1S5G Z;  2F3Z A;  3O78 A;  1LS8 A;  1XVJ A;  1QIW A;  2WCF A;  2LMT A;  1RTP 1;  3TS5 C;  1CTR A;  2ZRT A;  2CNP A;  2G2B A;  5I2Q A;  1HT9 A;  4OV2 A;  2K7C A;  3OBV A;  3SJS A;  4CPV A;  1NX3 A;  2Y1M A;  2WC6 A;  1YVL A;  2KI4 B;  1A29 A;  1XFV O;  3ZNI A;  2CXJ A;  3NSO A;  3LK1 A;  5J3X A;  2LLT A;  3CLN A;  4OCI A;  1PVB A;  5FI6 A;  1QV0 A;  1SY9 A;  4M2Q A;  4HRE E;  3I5H B;  1YRT B;  2L2E A;  2MBX A;  1VRK A;  3VRO A;  3B86 A;  1SSE B;  1F4Q A;  1PVA A;  4MRX A;  1FBV A;  1QAS A;  1OE9 B;  3BFH A;  2M29 A;  3B6X A;  2HQW A;  3LK0 A;  2DOQ A;  4I5K A;  3KHE A;  3TUY B;  1K8U A;  2KI6 C;  2H61 A;  3OB1 B;  2I7A A;  2R2I A;  4ORC B;  2OTG B;  5HKZ A;  1YUS A;  4GUK A;  1JFK A;  2P71 A;  3ZWH A;  2L5Y A;  1AUI B;  5EL2 A;  3S0E A;  2LP2 A;  3UNW A;  3O4X A;  2JUL A;  3PLF B;  3MSE B;  3CDN A;  4GFT A;  1IG5 A;  2F2P A;  3AAK A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  1YUR A;  2WCK A;  3KPX A;  3FWB A;  1SR6 C;  1TRF A;  2H8V A;  3PSR A;  1K9U A;  2Y4Q A;  4INX A;  4MLW A;  3PAL A;  1NUB A;  3EKH A;  3EVU A;  5JOL A;  4ORA B;  1TNP A;  3PFV A;  1AK8 A;  1GGW A;  3DF0 B;  3S0B A;  1R6P A;  1DJI A;  4OR9 B;  1IGV A;  3CZ1 A;  1OOJ A;  1UHH A;  1V1G A;  5CSN A;  1FI6 A;  4MZL A;  2CBL A;  2LC5 A;  4ETO A;  5FI2 A;  5KTY A;  1NX2 A;  1XFY O;  3WXA A;  1PSR A;  1YUU A;  2KDH A;  1YX8 A;  2L98 A;  3SS5 A;  1J7O A;  1BT6 A;  3JTD C;  4R1E A;  2EC6 B;  1B4C A;  3L4L A;  3BOW A;  4I5N B;  4YGE B;  1PAL A;  5HL1 A;  2WCB A;  2M9G A;  1CDP A;  4GGN A;  1DJX A;  1ODB A;  3TUY C;  1UP5 A;  2KLE A;  3BUX B;  3FS7 A;  1BOC A;  1B8C A;  1KK7 Z;  3VRN A;  4PAL A;  2WCL A;  1D1O A;  1XO5 A;  3NSL A;  4IJ7 A;  2K2A A;  2BE4 A;  1OMV A;  2BL0 C;  3SIA A;  3SG3 A;  2KYF A;  1LXF C;  2MLE C;  3SG2 A;  2O60 A;  1AHR A;  3A8R A;  3NHI A;  3SG6 A;  1F54 A;  1A75 B;  3FWC A;  4HSZ A;  5TNC A;  2G9B A;  1A4P A;  2FOT A;  2WC8 A;  3QME A;  3D0Y A;  2HQ8 A;  1CFC A;  3V2L A;  3TS5 B;  3R1V A;  4YI9 A;  1OZS A;  1PRW A;  1EJ3 A;  3EVV A;  3VRR A;  2KQY A;  1L2O C;  2NZ0 A;  1TTX A;  1KCY A;  2LVK A;  4PE4 A;  2WCE A;  3EK4 A;  1JF0 A;  4KYN A;  1CFD A;  4NDD A;  1REC A;  3SG4 A;  5B8I B;  3OP0 A;  2H2K A;  4YGA A;  2BKI B;  2KGB C;  3M0W A;  3I5I B;  2PRU A;  2M97 A;  2FCE A;  4HRH A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  1KQV A;  2CT9 A;  2JNF A;  2JXC A;  2KAV A;  2LHI A;  5AFP A;  1MF8 B;  2ZN9 A;  4HRG A;  1CDM A;  3BQ3 A;  4JKT A;  1F71 A;  1MXE A;  2PAL A;  1UWO A;  2K8M B;  5I8N A;  1CFP A;  4YGD B;  3FIA A;  1TCO B;  2V53 A;  3BXK A;  2GV5 A;  2JRF A;  3KEV A;  1QX7 A;  4Q04 A;  4YI8 A;  4FQT A;  1BR1 B;  1IJ6 A;  1K95 A;  3JVT C;  3OX6 A;  4N1G A;  4C0L A;  3OGN A;  3RZS A;  1MUX A;  4GNK B;  1OZO A;  1MQ1 A;  1GGZ A;  4MN0 A;  4QJ4 B;  2KAY A;  2LAN A;  1BLQ A;  2M1K B;  5PAL A;  1OSA A;  2LP3 A;  1SNL A;  1YTZ C;  3DY9 A;  1CDL A;  1LA0 A;  3PJI A;  1T14 A;  3KO0 A;  3JTD B;  1B9A A;  4PHM A;  4ZCU A;  2LV7 A;  1UUR A;  1DGV A;  1QVI Y;  2KNE A;  2PAS A;  1BG1 A;  4OKH A;  1WDC B;  1ZAC A;  4DIR A;  5CSI A;  1KSM A;  1AVS A;  2I2R E;  4BY5 A;  5AAN A;  4CFR A;  2M3W A;  2OS8 C;  4L9M A;  4C0J A;  3BYA A;  3E3R A;  2LE9 B;  1J7P A;  1DMO A;  1N0Y A;  4BY4 A;  4AOM A;  1S6C A;  2WND A;  4A4C A;  1KFU L;  1RJV A;  1KK7 Y;  1EL4 A;  2GGZ A;  4ZCV A;  2M7L A;  1Y0V H;  3A4U B;  1KWO B;  1WLM A;  3CZ2 A;  5HYD A;  3HX4 A;  2M7N A;  4PHN A;  1NYA A;  1SCM C;  3S0A A;  4USL A;  2LVV A;  2L51 A;  2M8U A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  3CS1 A;  3WHT B;  1WDC C;  3F45 A;  1EG4 A;  2BCA A;  1DJY A;  1K94 A;  1OW4 A;  2JTT A;  2KSP A;  4U8D A;  1P28 A;  1C3Y A;  2QPT A;  2LLU A;  2H61 C;  3S0F A;  2K61 A;  2LHL A;  3I5G C;  4PE0 A;  3EK7 A;  1CB1 A;  1QIV A;  2Q91 A;  2AUC A;  5HKW A;  1IJ5 A;  3TDU A;  4F0Z B;  4MBE A;  1QS7 A;  3BUO B;  1OOH A;  4ICB A;  3CR4 X;  1B8R A;  3HCM A;  2HET A;  5K89 A;  1C07 A;  2HF5 A;  1SCM B;  1WY9 A;  3H4S E;  1UUS A;  1NIW A;  3SG5 A;  1YR5 A;  1PUL A;  2PSR A;  1SL7 A;  3NXA A;  4P2Y B;  1QAT A;  4MZK A;  1G33 A;  3DYE A;  1R2U A;  4GGF A;  2Y5I A;  2KQ6 A;  3DXL A;  3OX5 A;  3I5G B;  2WCM A;  2MLF C;  1QLK A;  1L7Z A;  5IBW A;  3Q8I A;  1SK6 D;  2BCB A;  1ZFS A;  1AJ5 A;  5HKY A;  1YUT A;  1JBA A;  5DKN A;  1G8I A;  2BEC A;  4N5X A;  1CM1 A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  5GQQ C;  2WOR A;  3ICB A;  1FF1 A;  4DCK A;  2MA2 A;  1H8B A;  3PN7 C;  4E68 A;  3FE6 A;  1SBJ A;  1ZOT B;  1S36 A;  1ORG A;  2AAO A;  4YBH B;  2P6B B;  4P5O E;  5HLV A;  3IQO A;  1LA3 A;  2PQL A;  3NHT A;  2BBN A;  2K0J A;  1GJY A;  1TUZ A;  1CLL A;  1NPQ A;  2E6W A;  2MAZ A;  4M2P A;  1DT7 B;  1XFR A;  4INW A;  2L4H A;  4JWQ A;  3CYZ A;  1A75 A;  1LVC D;  3AKA A;  4I5J A;  5DKQ A;  2KFF A;  2LAP A;  2KFG A; 
#chains in the Genus database with same CATH homology
 1M45 A;  1QVI Z;  1TN4 A;  4N1F A;  1RFJ A;  1F4O A;  1B1G A;  1JC2 A;  3LLE A;  3O2P A;  1FPW A;  1J7R A;  2JZI A;  1JF2 A;  2F2O A;  4GBA A;  5KSZ A;  2D8N A;  1SRA A;  4FTG A;  1SL9 A;  1XA5 A;  5CSF A;  4PDZ A;  1XYD A;  3CR5 X;  1CDN A;  1K9K A;  2M1U A;  1BF5 A;  2LMU A;  2OTG C;  1J1E A;  1S6J A;  2COL B;  2M49 B;  3D10 A;  2FJU B;  1SR6 B;  4I5L B;  4MRY A;  2SAS A;  3WNX B;  2CTN A;  2KGR A;  1UHK A;  1KQM C;  3JVT B;  1IWQ A;  1KK8 B;  3SIB A;  1WRZ A;  2M0R A;  2JXL A;  4GAO A;  1NSH A;  1TOP A;  3TDI A;  3EKJ A;  3CZT X;  3CTN A;  1PK0 D;  5CPV A;  4YRU A;  5KU1 A;  1IH0 A;  3EVR A;  2K7B A;  1UHI A;  3OB2 B;  3PAT A;  5D69 A;  1M46 A;  1SKT A;  5I2L A;  1U5I A;  1N65 A;  2KBM A;  1QV1 A;  2BKH B;  2NLN A;  2AMI A;  1KQM B;  1LKJ A;  2KBI A;  2K2F A;  2MJW B;  4NDC A;  1IRJ A;  2I94 A;  4AQJ A;  1AP4 A;  1AJ4 A;  2OS8 B;  5HLO A;  1RK9 A;  3VGO A;  1A03 A;  5G08 A;  3AKB A;  3WHU B;  1XK4 A;  1GQM A;  1J1D A;  2PMY A;  5I2O A;  1H4B A;  3GK4 X;  4XJK A;  3VRP A;  1FI5 A;  4NQG A;  1BU3 A;  1PSB A;  3CWG A;  2LVJ A;  1WRK A;  3DVJ A;  2ZNE A;  2ZRS A;  1M63 B;  1BJF A;  1X02 A;  5D7F A;  2OPO A;  2L0P A;  2ZKM X;  2KYC A;  1SYM A;  4MEW A;  4MSP A;  2JT0 A;  2QAC A;  4AQI A;  1CMG A;  2NXQ A;  1ALW A;  2A4J A;  3C1V A;  1KFX L;  1M31 A;  3PM8 A;  1C7V A;  3DD4 A;  3DVK A;  1K9P A;  3EK8 A;  2L5X B;  4WRI A;  2BCX A;  1K96 A;  1NCZ A;  3O4Y A;  1DJG A;  1KFX S;  5ER5 A;  1NX1 A;  1B7T Z;  2LNK A;  1S26 D;  4PE7 A;  4QJ5 B;  1BOD A;  4WQ2 A;  4GPL B;  2K7D A;  4XJK B;  3KF9 A;  4WQ3 A;  2MHH A;  1UHJ A;  2L50 A;  2LVI A;  3I5I C;  1ALV A;  3I5H C;  5DKR A;  4XYN A;  5AER A;  4FQO A;  3DVM A;  2GGM A;  1OQP A;  1FW4 A;  2O5G A;  1Y6W A;  3CGA A;  2L4I A;  2LUX A;  3IF7 A;  2JT3 A;  4TNC A;  1DJZ A;  1ZUZ A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1SW8 A;  2F3Y A;  1YX7 A;  1MXL C;  2F8P A;  3NSI A;  1DF0 B;  1Y1X A;  4DUQ A;  2F33 A;  1K2H A;  3LL8 B;  1Q80 A;  2EHB A;  4NDB A;  1SMG A;  1CLM A;  1DVI A;  2VRG A;  3RM1 A;  3AAJ A;  1TNW A;  4ORB B;  1SL8 A;  1M39 A;  1EG3 A;  2JTZ A;  2WOS A;  3I5F B;  1S3P A;  2KOT A;  3SG7 A;  1KSO A;  2NCO A;  1JSA A;  3TDZ A;  5AXI A;  2JU0 A;  1KWO C;  4MVF A;  4GGF C;  3OHM B;  2BBM A;  1DTL A;  3PN7 B;  1V1F A;  1MR8 A;  2Q4U A;  4C0K A;  1S6I A;  3QRX A;  4DRW A;  2NCP A;  5JJG A;  1F55 A;  1QTX A;  1RRO A;  1B8L A;  1XFZ O;  2JOJ A;  5CSJ A;  1N2D A;  3IQQ A;  1XFX O;  3TZ1 A;  2EC6 C;  4YGB B;  1F70 A;  1CNP A;  1B7T Y;  1J55 A;  4PE1 A;  5FYX A;  1XK4 C;  2LM5 A;  4YGC B;  2KFH A;  1Y1A A;  1B47 A;  1QLS A;  4DS7 A;  1JWD A;  1MHO A;  1CFF A;  1CMF A;  1K90 D;  1QXP A;  2MRD A;  1KK8 C;  1BMO A;  2TN4 A;  1CKK A;  1QX2 A;  3K21 A;  3RLZ A;  1JFJ A;  4CFQ A;  1DGU A;  1XFU O;  1TIZ A;  2ZN8 A;  1CM4 A;  2JWW A;  4QJ3 B;  1SCV A;  3DVE A;  4PCW A;  5F6T A;  1E8A A;  2LLS A;  1BR4 B;  2RGI A;  2JT8 A;  4PHK A;  1TNQ A;  2ZFD A;  1YVH A;  4M2O A;  5BPJ A;  1HQV A;  1YRU B;  1Y1U A;  1DF0 A;  2K7O A;  2E30 A;  1NCX A;  2JPT A;  1WLZ A;  4MZJ A;  3VRQ A;  2B1U A;  4A4B A;  1A2X A;  4JQ0 D;  2ZND A;  1IQ5 A;  2KI4 C;  1DJW A;  1TNX A;  1F8H A;  1EXR A;  1J7Q A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  3I5F C;  2Y1N A;  1JUO A;  2PVB A;  4PHJ A;  2I18 A;  3D0Y B;  3NSK A;  1UHN A;  1W7I B;  2HPS A;  1U5I B;  3DF0 A;  1XFW O;  1NCY A;  1NX0 A;  2EGD A;  2IS9 A;  2KI6 D;  3LCP C;  4IL1 A;  2BL0 B;  1SPY A;  5ER4 X;  1NP8 A;  4D1E A;  1DJH A;  2LCP A;  1NWD A;  2JNX A;  2FCD A;  1TCF A;  1WRL A;  4CLN A;  3O6B A;  1K93 D;  1W7J B;  1KFU S;  4OVN F;  1IKU A;  1RWY A;  3GOF A;  4CID A;  2JC2 A;  2LMV A;  2SCP A;  1EH2 A;  1S1E A;  2KHN A;  3GK2 A;  2LUC A;  1C7W A;  3BUW B;  1S5G Z;  2F3Z A;  3O78 A;  1XVJ A;  1QIW A;  2WCF A;  2LMT A;  1RTP 1;  3TS5 C;  1CTR A;  2ZRT A;  2CNP A;  2G2B A;  5I2Q A;  1HT9 A;  4OV2 A;  2K7C A;  3SJS A;  4CPV A;  1NX3 A;  2Y1M A;  1YVL A;  2KI4 B;  1A29 A;  1XFV O;  3ZNI A;  2CXJ A;  3NSO A;  3LK1 A;  5J3X A;  2LLT A;  3CLN A;  4OCI A;  1PVB A;  1QV0 A;  1SY9 A;  4M2Q A;  4HRE E;  3I5H B;  1YRT B;  2L2E A;  2MBX A;  1VRK A;  3VRO A;  4MRX A;  1F4Q A;  1PVA A;  1FBV A;  1QAS A;  1OE9 B;  3LK0 A;  2M29 A;  4I5K A;  2HQW A;  3TUY B;  2DOQ A;  3KHE A;  1K8U A;  2KI6 C;  2H61 A;  3OB1 B;  2I7A A;  2R2I A;  4ORC B;  2OTG B;  5HKZ A;  1YUS A;  4GUK A;  1JFK A;  3ZWH A;  1AUI B;  2LP2 A;  2JUL A;  3PLF B;  3MSE B;  4GFT A;  1IG5 A;  2F2P A;  3AAK A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  1YUR A;  3PSR A;  3KPX A;  3FWB A;  1SR6 C;  1TRF A;  1K9U A;  2Y4Q A;  4MLW A;  3PAL A;  1NUB A;  3EKH A;  3EVU A;  5JOL A;  4ORA B;  1TNP A;  3PFV A;  1AK8 A;  1GGW A;  3DF0 B;  1R6P A;  1DJI A;  4OR9 B;  1IGV A;  1OOJ A;  1UHH A;  1V1G A;  5CSN A;  1FI6 A;  4MZL A;  2CBL A;  2LC5 A;  4ETO A;  5KTY A;  1NX2 A;  1XFY O;  3WXA A;  1PSR A;  1YUU A;  2KDH A;  1YX8 A;  2L98 A;  1J7O A;  1BT6 A;  3JTD C;  4R1E A;  2EC6 B;  1B4C A;  3BOW A;  4I5N B;  4YGE B;  1PAL A;  2WCB A;  2M9G A;  1CDP A;  4GGN A;  1DJX A;  1ODB A;  3TUY C;  1UP5 A;  3BUX B;  3FS7 A;  1BOC A;  1B8C A;  1KK7 Z;  3VRN A;  4PAL A;  1D1O A;  1XO5 A;  3NSL A;  2K2A A;  2BE4 A;  1OMV A;  2BL0 C;  3SIA A;  3SG3 A;  2KYF A;  1LXF C;  2MLE C;  3SG2 A;  2O60 A;  1AHR A;  3A8R A;  3SG6 A;  1F54 A;  1A75 B;  3FWC A;  4HSZ A;  5TNC A;  2G9B A;  1A4P A;  2FOT A;  2WC8 A;  3D0Y A;  2HQ8 A;  1CFC A;  3TS5 B;  4YI9 A;  1OZS A;  1PRW A;  1EJ3 A;  3EVV A;  3VRR A;  2KQY A;  1L2O C;  2NZ0 A;  1TTX A;  1KCY A;  2LVK A;  4PE4 A;  2WCE A;  3EK4 A;  1JF0 A;  1CFD A;  4NDD A;  1REC A;  3SG4 A;  5B8I B;  3OP0 A;  2H2K A;  4YGA A;  2BKI B;  2KGB C;  3M0W A;  3I5I B;  2PRU A;  2M97 A;  2FCE A;  4HRH A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  1KQV A;  2CT9 A;  2JNF A;  2JXC A;  2KAV A;  2LHI A;  5AFP A;  1MF8 B;  2ZN9 A;  4HRG A;  1CDM A;  3BQ3 A;  1F71 A;  1MXE A;  2PAL A;  1UWO A;  2K8M B;  5I8N A;  1CFP A;  4YGD B;  3FIA A;  1TCO B;  2V53 A;  3BXK A;  2GV5 A;  2JRF A;  3KEV A;  1QX7 A;  4Q04 A;  4YI8 A;  1BR1 B;  1IJ6 A;  1K95 A;  3JVT C;  3OX6 A;  4N1G A;  4C0L A;  1MUX A;  4GNK B;  1OZO A;  1MQ1 A;  1GGZ A;  4MN0 A;  4QJ4 B;  2KAY A;  2LAN A;  1BLQ A;  2M1K B;  5PAL A;  1OSA A;  2LP3 A;  1SNL A;  1YTZ C;  1CDL A;  1LA0 A;  3KO0 A;  3JTD B;  1B9A A;  4PHM A;  4ZCU A;  2LV7 A;  1UUR A;  1DGV A;  1QVI Y;  2KNE A;  2PAS A;  1BG1 A;  4OKH A;  1WDC B;  1ZAC A;  4DIR A;  5CSI A;  1KSM A;  1AVS A;  2I2R E;  4BY5 A;  5AAN A;  4CFR A;  2M3W A;  2OS8 C;  4L9M A;  4C0J A;  3BYA A;  3E3R A;  2LE9 B;  1J7P A;  1DMO A;  1N0Y A;  4BY4 A;  4AOM A;  1S6C A;  2WND A;  4A4C A;  1KFU L;  1RJV A;  1KK7 Y;  1EL4 A;  2GGZ A;  4ZCV A;  2M7L A;  1Y0V H;  3A4U B;  1KWO B;  1WLM A;  5HYD A;  3HX4 A;  2M7N A;  4PHN A;  1NYA A;  1SCM C;  4USL A;  2LVV A;  2L51 A;  2M8U A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  3CS1 A;  3WHT B;  1WDC C;  3F45 A;  1EG4 A;  2BCA A;  1DJY A;  1K94 A;  2JTT A;  2KSP A;  4U8D A;  2QPT A;  2LLU A;  2H61 C;  2K61 A;  2LHL A;  3I5G C;  4PE0 A;  3EK7 A;  1CB1 A;  1QIV A;  2Q91 A;  2AUC A;  5HKW A;  1IJ5 A;  3TDU A;  4F0Z B;  4MBE A;  1QS7 A;  3BUO B;  4ICB A;  3CR4 X;  1B8R A;  3HCM A;  2HET A;  5K89 A;  1C07 A;  2HF5 A;  1SCM B;  1WY9 A;  3H4S E;  1UUS A;  1NIW A;  3SG5 A;  1YR5 A;  1PUL A;  2PSR A;  1SL7 A;  3NXA A;  4P2Y B;  1QAT A;  4MZK A;  1G33 A;  1R2U A;  4GGF A;  2Y5I A;  2KQ6 A;  3OX5 A;  3I5G B;  2MLF C;  1QLK A;  1L7Z A;  5IBW A;  1SK6 D;  2BCB A;  1ZFS A;  1AJ5 A;  5HKY A;  1YUT A;  1JBA A;  5DKN A;  1G8I A;  2BEC A;  4N5X A;  1CM1 A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  5GQQ C;  2WOR A;  3ICB A;  1FF1 A;  4DCK A;  2MA2 A;  1H8B A;  3PN7 C;  4E68 A;  1SBJ A;  1ZOT B;  1S36 A;  2AAO A;  4YBH B;  2P6B B;  4P5O E;  5HLV A;  3IQO A;  1LA3 A;  4M2P A;  2BBN A;  2K0J A;  1GJY A;  2E6W A;  1CLL A;  1NPQ A;  2MAZ A;  1DT7 B;  2L4H A;  4JWQ A;  1A75 A;  1LVC D;  3AKA A;  4I5J A;  5DKQ A;  2KFF A;  2LAP A;  2KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...