4OR9B

Crystal structure of human calcineurin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
ASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit be
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Homo sapiens
molecule tags Hydrolase/metal binding protein
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4or9B00
2K61A 1KQMB 1GJYA 3TS5C 1UHNA 4USLA 4QJ5B 3ICBA 1KK7Y 1MXEA 3TUYB 4ORAB 1NP8A 2BE4A 2PALA 1BG1A 1KFXS 1QV0A 2KAXA 2L4IA 2LMTA 2QACA 1YRUB 3M0WA 1QV1A 1S1EA 3BYAA 1H8BA 1NX2A 1S36A 5CPVA 2E30A 3ZWHA 4MLWA 4N5XA 4WRIA 2HQWA 3WHTB 5AERA 4M2PA 2WCBA 5CSFA 1UHHA 1RWYA 2P6BB 1XFXO 4C0JA 1S3PA 3DD4A 3CR4X 2CXJA 2NCOA 1A29A 4ETOA 4UPGA 5DKQA 2DOQA 2M9GA 3F45A 2K2AA 1K93D 4I5LB 1L2OC 1XYDA 1B9AA 5HKWA 1XO5A 2JT8A 1NX1A 4YI8A 3LK1A 5I8NA 1CLLA 1K9PA 4GBAA 1NYAA 1SRAA 1XFWO 2KGRA 4WQ2A 2ZRTA 4NDDA 2B1UA 2I18A 1W7JB 3SG7A 1Y0VH 2VRGA 2SASA 1NWDA 2GGZA 4ORCB 2Y1MA 5CSJA 2KDHA 2M97A 1B7TY 3IQQA 2LVIA 2L51A 4JQ0D 4YI9A 3KHEA 4YRUA 1LKJA 1K90D 1ZACA 2BKIB 1KWOC 1F70A 4GPLB 3RLZA 1SCVA 3H4SE 3QRXA 1F4QA 1G33A 1PSBA 4PALA 2OS8B 2LHLA 1WLZA 1Y1XA 2H61C 1EG3A 1K94A 2LLUA 1J7PA 4I5NB 3SIAA 1OZOA 2GGMA 1KCYA 2BL0B 4A4BA 4I5KA 3FWCA 4YGAA 1XK4C 2ZNEA 1IJ5A 2MLEC 1UHJA 4GFTA 3PN7C 1BLQA 3AKBA 5J3XA 1TCFA 3VRNA 1DTLA 1JC2A 2KFHA 3LK0A 4AQJA 1K2HA 2LC5A 1UHKA 4MRXA 3VROA 3IQOA 1KSOA 5AXIA 2AAOA 2PVBA 3D10A 2CT9A 3I5HB 1B4CA 1SPYA 4YGEB 3I5IC 2F3YA 1UURA 3CGAA 4YGCB 3SG4A 1CDPA 1KSMA 1ODBA 2CCMA 2JTTA 2LLTA 1IKUA 4BY5A 1XA5A 1SR6B 1MXLC 1WDCC 2EC6C 3EKHA 1ZMZA 2K8MB 4GAOA 1TN4A 3O78A 1QX5B 1WRLA 1BT6A 1EJ3A 2NCPA 3JTDC 1HT9A 4E68A 5KTYA 2KBIA 3I5GC 1PALA 2LAPA 2PMYA 5G08A 2V53A 1BR4B 1YURA 2ZFDA 2K7CA 1N65A 5CSIA 3SG2A 2JC2A 3OP0A 1JUOA 2L0PA 3CLNA 1LINA 4XJKB 1IQ3A 2FJUB 2KFGA 1DJWA 1YVHA 3HCMA 3D0YB 1IGVA 2JQ6A 4DRWA 2NZ0A 2ZN8A 2FCEA 1AP4A 4MVFA 4XJKA 2ZN9A 1JF2A 2Q4UA 1SYMA 3EVRA 4OVNF 5B8IB 1MR8A 3D0YA 1M46A 3TZ1A 1BJFA 3DVEA 2JXLA 1CFPA 1QLSA 1BU3A 4M2OA 1KK8C 2CBLA 1TNPA 1MHOA 2G9BA 5KSZA 1M31A 1SCMB 4XYNA 4MN0A 1WY9A 2JNFA 1B8CA 3AAJA 3KEVA 4GGNA 3WHUB 1ALWA 2LP2A 4BY4A 1JFKA 3GK4X 5HKZA 3FS7A 2L4HA 2F3ZA 3TDUA 2AMIA 4C0LA 3GK1A 3OHMB 3EK8A 2KQ6A 1Y1UA 1YTZC 3PFVA 1XFVO 1AJ5A 1TNQA 3CR2A 3A8RA 1TIZA 3I5FB 2WC8A 3JVTB 1K9KA 1GGZA 1WLMA 1YRTB 4OCIA 2HQ8A 4GGFA 2O60A 1OMRA 2K7OA 3NSIA 2JT3A 1GGWA 1RJVA 3E3RA 1SL7A 5BPJA 3I5GB 1QVIZ 2A4JA 4NQGA 2SCPA 2M1UA 1QX7A 1OE9B 1V1GA 1N2DA 1CLMA 1S6CA 1R2UA 3C1VA 1U5IB 2BE6A 1TNXA 2LUCA 3AKAA 3FIAA 3KF9A 5FYXA 1SBJA 1K96A 4C0KA 1WRZA 1SY9A 1AHRA 2WORA 3EK4A 3OB1B 4WQ3A 5D69A 1CKKA 2NXQA 4QJ3B 4M2QA 3LCPC 1R6PA 1UWOA 2BCAA 1U5IA 2HETA 1QJTA 1DMOA 2KQYA 1SMGA 2MAZA 1S5GZ 4FTGA 1CMGA 3BUOB 3TS5B 1TRFA 5I2OA 2NLNA 2JU0A 1J1DA 2ZRSA 2KAYA 1YR5A 1PVBA 1MF8B 1KFXL 5HLOA 1QASA 1N0YA 1G8IA 1NCYA 3EKJA 1C7WA 1FI6A 1TCOB 4IL1A 4YBHB 1YX7A 1A4PA 2KBMA 4P5OE 3SIBA 1XFYO 4P2YB 4PE0A 1MWNA 1X02A 2KFFA 3WXAA 1JSAA 1HQVA 2LVVA 2GV5A 1K9UA 1IJ6A 2JNXA 1SL8A 2D8NA 4MZKA 5HYDA 1KFUS 2JZIA 4NDCA 1NCZA 1M39A 2F2PA 2KI4C 3PALA 2OPOA 1BOCA 3VRRA 1AVSA 1W7IB 1MUXA 3PATA 3DVJA 4PHNA 1DJYA 2M7LA 2KYCA 4YGDB 1IQ5A 1RTP1 1KQMC 5HLVA 1K8UA 1IH0A 2Q91A 2MJWB 3HX4A 3VRQA 1F54A 1BR1B 1L2OB 1SKTA 1AK8A 4HREE 4R1EA 1KK7Z 3TUYC 1OSAA 1SK6D 1H4BA 1QIWA 2KYFA 3GK2A 1EXRA 2OTGC 3SJSA 1CMFA 4CFQA 4DUQA 1QIVA 1CDMA 1CTRA 2Y1NA 1PK0D 2PASA 1M45A 4N1FA 2LV7A 4JPZB 2M3WA 1TOPA 2M29A 1G4YR 1QXPA 5IBWA 1OMVA 5PALA 1F55A 1IG5A 5GQQC 1DGVA 2JT0A 4GNKB 1KWOB 1S26D 1DJXA 1ZOTB 2BCBA 2WCEA 1M63B 5ER5A 4PE1A 2KAVA 1FI5A 1TTXA 2M7NA 3TDZA 4HRGA 3O6BA 1YUUA 1V1FA 2I2RE 1A75B 2F2OA 1IRJA 2K7BA 2F33A 3LL8B 3PM8A 1KQVA 4DCKA 2M8UA 1B8LA 3DF0B 2JWWA 4D1EA 2BBMA 3BUWB 2JTZA 2BBNA 3FWBA 2H61A 1DJZA 3PN7B 4MEWA 2LVJA 2KHNA 1GQMA 4PDZA 4CPVA 1JFJA 2WOSA 5TNCA 1A75A 3CR5X 3A4UB 3DVKA 2JXCA 2LHIA 2M49B 4N1GA 1XK4A 3DF0A 3EVUA 1J7RA 3WNXB 1YVLA 2KI4B 1B7TZ 3I5IB 4I5JA 4OR9B 1YUTA 4PCWA 3O4YA 1F4OA 2JRFA 2LCPA 3BUXB 4DS7A 3GOFA 5KU1A 1OMDA 1NPQA 1WDCB 1Y6WA 2EC6B 3MSEB 1L7ZA 4HSZA 2OS8C 3NSLA 4OKHA 2HPSA 4FQOA 2LANA 2OTGB 2F8PA 2Y5IA 3JTDB 2M0RA 4DIRA 2BL0C 5DKRA 5JJGA 2KI6C 1D1OA 2KNEA 4MZLA 2O5GA 5AANA 2MA2A 4MRYA 1NIWA 2BCXA 4CLNA 2L98A 2I7AA 2LLSA 1XFZO 4MSPA 1IWQA 1XFUO 1MQ1A 3OB2B 3IF7A 3EK7A 1A2XA 2I94A 4U8DA 2KGBC 3KPXA 3O2PA 3I5HC 2Y4QA 2BECA 1CFDA 2FCDA 5AEQA 5K89A 1QLKA 2LM5A 1EG4A 1F71A 1CDLA 3BXKA 1SR6C 5I2QA 3RM1A 1SNLA 1A03A 2WNDA 1AUIB 2EGDA 3CWGA 2COLB 5D7FA 1RECA 1C7VA 1FBVA 4CIDA 1CDNA 5F6TA 1Q80A 4L9MA 1C07A 1KK8B 2K7DA 1Y1AA 1QATA 4PHMA 4NDBA 2JPTA 1RFJA 2K2FA 2MBXA 5ER4X 1RK9A 3NSOA 1PULA 1ZUZA 2MLFC 3NSKA 2PRUA 1NUBA 4Q04A 3OX6A 2KOTA 1QTXA 3VGOA 3EVVA 1BMOA 1JBAA 1QX2A 1NX3A 3DVMA 3NXAA 1CB1A 4A4CA 1FF1A 1OOJA 1OZSA 3CS1A 1UP5A 2ISDA 1QS7A 2CTNA 2L50A 1SW8A 2G2BA 1S6IA 1B8RA 2KSPA 1CFCA 1DF0B 3LLEA 1XVJA 1DJIA 4TNCA 1CM1A 1NX0A 1UHIA 1DJGA 2LE9B 1PSRA 2LMUA 4PE7A 1F8HA 1QVIY 1TNWA 1ZFSA 5HKYA 1LA3A 3TDIA 2BKHB 2ZKMX 3CTNA 4HRHA 4ORBB 2LVKA 4JWQA 3SG6A 1DF0A 3BQ3A 4CFRA 1SCMC 4PE4A 2KI6D 3BOWB 1J55A 2H2KA 1LA0A 2MRDA 1DGUA 1J1EA 1FW4A 3AAKA 1OQPA 2EHBA 4GGFC 5JOLA 4ZCUA 1E8AA 5I2LA 3CZTX 1CLBA 1EH2A 2LMVA 2ZNDA 2CNPA 4F0ZB 1K95A 2AUCA 1SL9A 3BOWA 3ZNIA 1B47A 1PVAA 1YX8A 1CFFA 3SG3A 2K0JA 3I5FC 3JVTC 1S5GY 2HF5A 1JWDA 1DT7B 1J7QA 2WCFA 2MHHA 4PHJA 4ZCVA 1BF5A 2LUXA 2RGIA 5AFPA 1NSHA 1YUSA 1VRKA 1WRKA 3BUMB 3KO0A 5CSNA 4ICBA 1B1GA 4OV2A 1CNPA 1BODA 1ALVA 1PRWA 4AOMA 1EL4A 4PHKA 1UUSA 3OX5A 1S6JA 4YGBB 2L2EA 1DJHA 2QPTA 2FOTA 2IS9A 1AJ4A 3K21A 1CM4A 1FPWA 2L5XB 2M1KB 4QJ4B 1LXFC 4MBEA 5DKNA 1LVCD 3SG5A 2JOJA 3PSRA 2LP3A 1KFUL 3PLFB 4GUKA 1RROA 2PSRA 2LNKA 2JULA 3VRPA 4AQIA 1DVIA 4MZJA 1J7OA 2E6WA 1JF0A 1NCXA 2R2IA 3BUNB 2TN4A
chains in the Genus database with same CATH superfamily
2K61A 1KQMB 1GJYA 3TS5C 1UHNA 4USLA 1DQEA 4QJ5B 3ICBA 1KK7Y 1MXEA 3TUYB 4ORAB 1NP8A 2WCHA 2BE4A 2PALA 1BG1A 1KFXS 1QV0A 2KAXA 5FI7A 2L4IA 2LMTA 2QACA 1W9ZA 1YRUB 1QV1A 1S1EA 3BYAA 3M0WA 1H8BA 1NX2A 1S36A 2P70A 5CPVA 1DC1A 3DY9A 2E30A 3BFBA 3ZWHA 4MLWA 3B7AA 4N5XA 2HQWA 4WRIA 3WHTB 5AERA 4M2PA 2WCBA 5CSFA 1UHHA 1RWYA 2P6BB 1XFXO 4C0JA 1S3PA 3S0DA 3DD4A 3CR4X 2CXJA 2NCOA 1A29A 4ETOA 4UPGA 5DKQA 3D74A 2DOQA 2M9GA 3F45A 2K2AA 1K93D 4I5LB 1L2OC 1XYDA 1B9AA 5HKWA 1XO5A 2JT8A 1NX1A 4YI8A 2QDIA 3LK1A 5I8NA 1CLLA 1K9PA 4GBAA 1NYAA 1SRAA 1XFWO 2KGRA 3OBVA 4WQ2A 2ZRTA 4NDDA 2B1UA 2I18A 1W7JB 3SG7A 1Y0VH 2VRGA 2SASA 1NWDA 2GGZA 4ORCB 2Y1MA 5CSJA 2BNXA 2KDHA 2M97A 1B7TY 4JKTA 3IQQA 2LVIA 2L51A 4JQ0D 3N7HA 4YI9A 3KHEA 4YRUA 1LKJA 1K90D 1ZACA 2BKIB 1KWOC 3O4XA 1F70A 4GPLB 3RLZA 1SCVA 3H4SE 3QRXA 1F4QA 1G33A 1PSBA 4PALA 2OS8B 2LHLA 1WLZA 1Y1XA 2H61C 1EG3A 1K94A 1SSEB 2LLUA 3B87A 1J7PA 4I5NB 3SIAA 1OZOA 2GGMA 1KCYA 2BL0B 3NHIA 4A4BA 4I5KA 3FWCA 4YGAA 1XK4C 2ZNEA 3DXLA 1IJ5A 2MLEC 1UHJA 4GFTA 3PN7C 1BLQA 3AKBA 5J3XA 1TCFA 3VRNA 1DTLA 1JC2A 2KFHA 3LK0A 4AQJA 1K2HA 2K60A 2LC5A 1UHKA 4MRXA 3VROA 3IQOA 1KSOA 5EL2A 2AAOA 2PVBA 3D10A 2CT9A 3I5HB 5AXIA 1B4CA 1SPYA 4YGEB 3RZSA 3I5IC 2F3YA 1UURA 3CGAA 4YGCB 3SG4A 1CDPA 1KSMA 1ODBA 2CCMA 2JTTA 2LLTA 1IKUA 4BY5A 1XA5A 1SR6B 1MXLC 1WDCC 2EC6C 3EKHA 4PT1A 1ZMZA 2K8MB 3D77A 4GAOA 1TN4A 3O78A 1QX5B 1WRLA 3CZ2A 1BT6A 1EJ3A 1C3YA 2NCPA 3JTDC 1HT9A 4E68A 5KTYA 2KBIA 3I5GC 2WCMA 1PALA 2LAPA 2PMYA 5G08A 2V53A 1BR4B 1YURA 1P28A 2ZFDA 2K7CA 1N65A 5CSIA 3SG2A 2JC2A 3OP0A 4INXA 1JUOA 2L0PA 3CLNA 1LINA 4XJKB 1IQ3A 2FJUB 2KFGA 3FE8A 1DJWA 1YVHA 3HCMA 3D0YB 1IGVA 2WCLA 2JQ6A 4DRWA 2NZ0A 2ZN8A 2FCEA 1AP4A 4MVFA 4XJKA 2ZN9A 1JF2A 2Q4UA 5FI6A 1SYMA 1TUJA 3EVRA 4OVNF 5B8IB 1MR8A 3D0YA 3V2LA 1M46A 3TZ1A 3BFAA 1BJFA 3DVEA 2JXLA 1CFPA 1QLSA 1BU3A 4M2OA 5D3OA 1KK8C 2CBLA 3L4LA 1TNPA 1MHOA 2G9BA 5KSZA 1M31A 1SCMB 4XYNA 4MN0A 1WY9A 2JNFA 1B8CA 3AAJA 3KEVA 3CZ1A 4GGNA 3WHUB 4F7FA 1ALWA 2LP2A 4BY4A 1JFKA 3GK4X 5HKZA 3FE6A 3FS7A 2L4HA 2F3ZA 3TDUA 3L47A 2AMIA 4C0LA 3GK1A 3OHMB 3DYEA 3EK8A 2L2CA 1Z2CB 2KQ6A 1Y1UA 1YTZC 3PFVA 1QWVA 1AJ5A 1XFVO 1TNQA 3CR2A 2QEHA 1TIZA 2QEVA 2WC8A 3A8RA 3I5FB 1K9KA 1GGZA 3B6XA 3JVTB 1WLMA 1YRTB 4OCIA 2HQ8A 4GGFA 2O60A 1OMRA 2K7OA 3NSIA 2JT3A 3R1VA 1RJVA 1GGWA 3E3RA 1SL7A 5BPJA 5FI2A 3I5GB 2BAPA 1QVIZ 2A4JA 4NQGA 3S0FA 2SCPA 2M1UA 2PQLA 1TWOA 1QX7A 1OE9B 1V1GA 1N2DA 5I94A 1CLMA 1S6CA 4OZDA 1R2UA 3C1VA 3K1EA 1U5IB 2BE6A 1TNXA 2LUCA 3AKAA 3FIAA 3KF9A 5FYXA 1SBJA 1K96A 4C0KA 1WRZA 1OOFA 1SY9A 1AHRA 2WORA 3EK4A 3OB1B 4WQ3A 5D69A 1XFRA 2NXQA 4QJ3B 1CKKA 4M2QA 3LCPC 1R6PA 1UWOA 2BCAA 1U5IA 2HETA 1QJTA 1DMOA 2KQYA 1SMGA 2MAZA 1S5GZ 4FTGA 1CMGA 3BUOB 3TS5B 1TRFA 2KLEA 5I2OA 2NLNA 2JU0A 1J1DA 2ZRSA 2KAYA 1YR5A 1PVBA 1MF8B 1KFXL 5HLOA 1QASA 1N0YA 1G8IA 1NCYA 3EKJA 1C7WA 1FI6A 1TCOB 3B86A 4IL1A 4YBHB 1YX7A 1A4PA 2KBMA 4P5OE 3SIBA 1XFYO 1OOIX 4P2YB 4PE0A 1MWNA 1X02A 2KFFA 3WXAA 1JSAA 1DELA 1HQVA 2LVVA 2GV5A 1K9UA 1IJ6A 2JNXA 1SL8A 2D8NA 4MZKA 5HYDA 1KFUS 2QEBA 2JZIA 4NDCA 1NCZA 1M39A 2F2PA 2KI4C 3PALA 2OPOA 1BOCA 3VRRA 1AVSA 1W7IB 1MUXA 3PATA 3DVJA 4PHNA 1DJYA 2M7LA 2KYCA 1GM0A 4YGDB 1IQ5A 1RTP1 1IIOA 1KQMC 5HLVA 1K8UA 1IH0A 2Q91A 2MJWB 3HX4A 3VRQA 2KLDA 1Z4HA 1F54A 1BR1B 1L2OB 1SKTA 1AK8A 4HREE 4R1EA 1KK7Z 4JD9A 3TUYC 1OSAA 1SK6D 1H4BA 1QIWA 2KYFA 3GK2A 1C3ZA 1EXRA 2OTGC 3Q8IA 3SJSA 4INWA 1CMFA 4CFQA 4DUQA 1QIVA 1CDMA 1CTRA 2Y1NA 1PK0D 1TUZA 2PASA 2QEOA 3L4AA 1M45A 4N1FA 2LV7A 4JPZB 2M3WA 1TOPA 2M29A 2KPHA 1G4YR 3EG5B 1QXPA 5IBWA 1OMVA 5PALA 1F55A 1IG5A 5GQQC 1DGVA 2JT0A 4GNKB 1KWOB 1S26D 1DJXA 1ZOTB 2BCBA 1OOHA 2WCEA 3VB1A 1M63B 3SS5A 2WC5A 5ER5A 4PE1A 2KAVA 1FI5A 1TTXA 2M7NA 3TDZA 4HRGA 3O6BA 1YUUA 1V1FA 2I2RE 3R72A 1A75B 2F2OA 1IRJA 2K7BA 2F33A 3LL8B 3PM8A 1KQVA 4DCKA 2M8UA 1B8LA 3DF0B 2JWWA 2L5YA 2BBMA 4D1EA 3BUWB 2JTZA 3SS4A 2BBNA 3FWBA 2H61A 1DJZA 3PN7B 4MEWA 2LVJA 2KHNA 1GQMA 4PDZA 4CPVA 1JFJA 2WOSA 5TNCA 1A75A 3CR5X 3A4UB 3DVKA 3IVTA 2JXCA 2LHIA 2M49B 4N1GA 1XK4A 2PYQA 3DF0A 1J7RA 3EVUA 1YVLA 3WNXB 2KI4B 1B7TZ 3I5IB 3OGNA 3CYZA 4I5JA 4OR9B 1YUTA 4PCWA 3O4YA 1F4OA 2JRFA 2LCPA 3BUXB 4DS7A 3GOFA 3S0GA 5KU1A 1OMDA 1NPQA 1WDCB 1Y6WA 2EC6B 2ERBA 1L7ZA 3MSEB 4HSZA 2FJYA 2OS8C 3PM2A 1DEKA 3NSLA 4OKHA 2HPSA 4FQOA 2LANA 2OTGB 2F8PA 1T14A 2Y5IA 2M0RA 3JTDB 4DIRA 2BL0C 5HL1A 5DKRA 5JJGA 2KI6C 1D1OA 2KNEA 4MZLA 2O5GA 5AANA 2MA2A 4MRYA 1NIWA 2BCXA 4CLNA 2L98A 2I7AA 2LLSA 1XFZO 3DZTA 4MSPA 5DICA 1IWQA 1XFUO 1MQ1A 1OOGA 3BJHA 3OB2B 2YGUA 3EK7A 3IF7A 1A2XA 2I94A 4U8DA 2KGBC 3KPXA 3O2PA 3R1OA 3I5HC 2Y4QA 2BECA 1CFDA 2FCDA 5AEQA 5K89A 1QLKA 3CDNA 2LM5A 1EG4A 1F71A 1CDLA 3BXKA 1SR6C 5I2QA 3RM1A 1SNLA 1A03A 2WNDA 1AUIB 2EGDA 3CWGA 3QMEA 4IJ7A 2COLB 5D7FA 1RECA 3S0AA 1C7VA 3R1PA 1FBVA 4CIDA 1CDNA 5F6TA 1Q80A 2H8VA 4L9MA 1C07A 1KK8B 2K7DA 1Y1AA 1QATA 4PHMA 4NDBA 2JPTA 1RFJA 2K2FA 2MBXA 5ER4X 1RK9A 3NSOA 1ORGA 1PULA 1ZUZA 2MLFC 3D76A 2PRUA 3NSKA 1NUBA 3NHTA 4Q04A 3OX6A 2KOTA 1QTXA 3VGOA 3EVVA 1BMOA 1JBAA 1QX2A 1NX3A 3D73A 3DVMA 3NXAA 4FQTA 1CB1A 4A4CA 3BFHA 1FF1A 1OOJA 1OZSA 2GTEA 1UP5A 3CS1A 2ISDA 1QS7A 3SS3A 2CTNA 2L50A 1SW8A 2G2BA 3PJIA 1S6IA 1B8RA 2KSPA 1CFCA 1DF0B 2WCJA 3LLEA 1XVJA 1DJIA 4TNCA 1CM1A 1NX0A 1UHIA 1DJGA 2LE9B 3UO9A 1PSRA 2LMUA 4PE7A 1F8HA 1QVIY 1TNWA 1ZFSA 5HKYA 1LA3A 3TDIA 2BKHB 2ZKMX 3CTNA 4HRHA 4ORBB 2LVKA 4JWQA 2WCKA 3SG6A 1DF0A 3BQ3A 4CFRA 1SCMC 4PE4A 2KI6D 3BOWB 1J55A 2H2KA 1LA0A 2MRDA 1DGUA 1J1EA 1FW4A 3B88A 3AAKA 3S0EA 1OQPA 3CABA 2EHBA 4GGFC 5JOLA 4ZCUA 1E8AA 3UNWA 5I2LA 3CZTX 1CLBA 1EH2A 2LMVA 2ZNDA 2CNPA 4F0ZB 1K95A 2AUCA 1SL9A 3BOWA 3ZNIA 1B47A 1PVAA 1YX8A 2JPOA 1CFFA 3SG3A 2K0JA 3I5FC 3JVTC 1S5GY 2HF5A 1JWDA 1DT7B 1OW4A 2WCFA 1J7QA 2MHHA 2WC6A 4PHJA 1LS8A 4ZCVA 1BF5A 3NGVA 2LUXA 2RGIA 5AFPA 1NSHA 1YUSA 1VRKA 1WRKA 3BUMB 3KO0A 5CSNA 4ICBA 1B1GA 4OV2A 1CNPA 1BODA 1ALVA 1PRWA 4AOMA 1EL4A 4PHKA 1UUSA 3CZ0A 1S6JA 3OX5A 4YGBB 2L2EA 1DJHA 2QPTA 3D78A 3S0BA 2FOTA 2IS9A 1AJ4A 3K21A 1CM4A 1FPWA 4KYNA 2L5XB 2M1KB 4QJ4B 1LXFC 3FE9A 4MBEA 5DKNA 1LVCD 3SG5A 2JOJA 2P71A 3PSRA 2LP3A 1KFUL 3PLFB 4GUKA 1RROA 2PSRA 2LNKA 2JULA 3VRPA 4AQIA 1DVIA 3D75A 4MZJA 1J7OA 2E6WA 1JF0A 1NCXA 2R2IA 3BUNB 2TN4A
chains in the Genus database with same CATH topology
2K61A 1KQMB 1GJYA 3TS5C 1UHNA 4USLA 4QJ5B 3ICBA 1KK7Y 1MXEA 3TUYB 4ORAB 1NP8A 2BE4A 2PALA 1BG1A 1KFXS 1QV0A 2KAXA 2L4IA 2LMTA 2QACA 1YRUB 3M0WA 1QV1A 1S1EA 3BYAA 1H8BA 1NX2A 1S36A 5CPVA 2E30A 3ZWHA 4MLWA 4N5XA 4WRIA 2HQWA 3WHTB 5AERA 4M2PA 2WCBA 5CSFA 1UHHA 1RWYA 2P6BB 1XFXO 4C0JA 1S3PA 3DD4A 3CR4X 2CXJA 2NCOA 1A29A 4ETOA 4UPGA 5DKQA 2DOQA 2M9GA 3F45A 2K2AA 1K93D 4I5LB 1L2OC 1XYDA 1B9AA 5HKWA 1XO5A 2JT8A 1NX1A 4YI8A 3LK1A 5I8NA 1CLLA 1K9PA 4GBAA 1NYAA 1SRAA 1XFWO 2KGRA 4WQ2A 2ZRTA 4NDDA 2B1UA 2I18A 1W7JB 3SG7A 1Y0VH 2VRGA 2SASA 1NWDA 2GGZA 4ORCB 2Y1MA 5CSJA 2KDHA 2M97A 1B7TY 3IQQA 2LVIA 2L51A 4JQ0D 4YI9A 3KHEA 4YRUA 1LKJA 1K90D 1ZACA 2BKIB 1KWOC 1F70A 4GPLB 3RLZA 1SCVA 3H4SE 3QRXA 1F4QA 1G33A 1PSBA 4PALA 2OS8B 2LHLA 1WLZA 1Y1XA 2H61C 1EG3A 1K94A 2LLUA 1J7PA 4I5NB 3SIAA 1OZOA 2GGMA 1KCYA 2BL0B 4A4BA 4I5KA 3FWCA 4YGAA 1XK4C 2ZNEA 1IJ5A 2MLEC 1UHJA 4GFTA 3PN7C 1BLQA 3AKBA 5J3XA 1TCFA 3VRNA 1DTLA 1JC2A 2KFHA 3LK0A 4AQJA 1K2HA 2LC5A 1UHKA 4MRXA 3VROA 3IQOA 1KSOA 5AXIA 2AAOA 2PVBA 3D10A 2CT9A 3I5HB 1B4CA 1SPYA 4YGEB 3I5IC 2F3YA 1UURA 3CGAA 4YGCB 3SG4A 1CDPA 1KSMA 1ODBA 2CCMA 2JTTA 2LLTA 1IKUA 4BY5A 1XA5A 1SR6B 1MXLC 1WDCC 2EC6C 3EKHA 1ZMZA 2K8MB 4GAOA 1TN4A 3O78A 1QX5B 1WRLA 1BT6A 1EJ3A 2NCPA 3JTDC 1HT9A 4E68A 5KTYA 2KBIA 3I5GC 1PALA 2LAPA 2PMYA 5G08A 2V53A 1BR4B 1YURA 2ZFDA 2K7CA 1N65A 5CSIA 3SG2A 2JC2A 3OP0A 1JUOA 2L0PA 3CLNA 1LINA 4XJKB 1IQ3A 2FJUB 2KFGA 1DJWA 1YVHA 3HCMA 3D0YB 1IGVA 2JQ6A 4DRWA 2NZ0A 2ZN8A 2FCEA 1AP4A 4MVFA 4XJKA 2ZN9A 1JF2A 2Q4UA 1SYMA 3EVRA 4OVNF 5B8IB 1MR8A 3D0YA 1M46A 3TZ1A 1BJFA 3DVEA 2JXLA 1CFPA 1QLSA 1BU3A 4M2OA 1KK8C 2CBLA 1TNPA 1MHOA 2G9BA 5KSZA 1M31A 1SCMB 4XYNA 4MN0A 1WY9A 2JNFA 1B8CA 3AAJA 3KEVA 4GGNA 3WHUB 1ALWA 2LP2A 4BY4A 1JFKA 3GK4X 5HKZA 3FS7A 2L4HA 2F3ZA 3TDUA 2AMIA 4C0LA 3GK1A 3OHMB 3EK8A 2KQ6A 1Y1UA 1YTZC 3PFVA 1XFVO 1AJ5A 1TNQA 3CR2A 3A8RA 1TIZA 3I5FB 2WC8A 3JVTB 1K9KA 1GGZA 1WLMA 1YRTB 4OCIA 2HQ8A 4GGFA 2O60A 1OMRA 2K7OA 3NSIA 2JT3A 1GGWA 1RJVA 3E3RA 1SL7A 5BPJA 3I5GB 1QVIZ 2A4JA 4NQGA 2SCPA 2M1UA 1QX7A 1OE9B 1V1GA 1N2DA 1CLMA 1S6CA 1R2UA 3C1VA 1U5IB 2BE6A 1TNXA 2LUCA 3AKAA 3FIAA 3KF9A 5FYXA 1SBJA 1K96A 4C0KA 1WRZA 1SY9A 1AHRA 2WORA 3EK4A 3OB1B 4WQ3A 5D69A 1CKKA 2NXQA 4QJ3B 4M2QA 3LCPC 1R6PA 1UWOA 2BCAA 1U5IA 2HETA 1QJTA 1DMOA 2KQYA 1SMGA 2MAZA 1S5GZ 4FTGA 1CMGA 3BUOB 3TS5B 1TRFA 5I2OA 2NLNA 2JU0A 1J1DA 2ZRSA 2KAYA 1YR5A 1PVBA 1MF8B 1KFXL 5HLOA 1QASA 1N0YA 1G8IA 1NCYA 3EKJA 1C7WA 1FI6A 1TCOB 4IL1A 4YBHB 1YX7A 1A4PA 2KBMA 4P5OE 3SIBA 1XFYO 4P2YB 4PE0A 1MWNA 1X02A 2KFFA 3WXAA 1JSAA 1HQVA 2LVVA 2GV5A 1K9UA 1IJ6A 2JNXA 1SL8A 2D8NA 4MZKA 5HYDA 1KFUS 2JZIA 4NDCA 1NCZA 1M39A 2F2PA 2KI4C 3PALA 2OPOA 1BOCA 3VRRA 1AVSA 1W7IB 1MUXA 3PATA 3DVJA 4PHNA 1DJYA 2M7LA 2KYCA 4YGDB 1IQ5A 1RTP1 1KQMC 5HLVA 1K8UA 1IH0A 2Q91A 2MJWB 3HX4A 3VRQA 1F54A 1BR1B 1L2OB 1SKTA 1AK8A 4HREE 4R1EA 1KK7Z 3TUYC 1OSAA 1SK6D 1H4BA 1QIWA 2KYFA 3GK2A 1EXRA 2OTGC 3SJSA 1CMFA 4CFQA 4DUQA 1QIVA 1CDMA 1CTRA 2Y1NA 1PK0D 2PASA 1M45A 4N1FA 2LV7A 4JPZB 2M3WA 1TOPA 2M29A 1G4YR 1QXPA 5IBWA 1OMVA 5PALA 1F55A 1IG5A 5GQQC 1DGVA 2JT0A 4GNKB 1KWOB 1S26D 1DJXA 1ZOTB 2BCBA 2WCEA 1M63B 5ER5A 4PE1A 2KAVA 1FI5A 1TTXA 2M7NA 3TDZA 4HRGA 3O6BA 1YUUA 1V1FA 2I2RE 1A75B 2F2OA 1IRJA 2K7BA 2F33A 3LL8B 3PM8A 1KQVA 4DCKA 2M8UA 1B8LA 3DF0B 2JWWA 4D1EA 2BBMA 3BUWB 2JTZA 2BBNA 3FWBA 2H61A 1DJZA 3PN7B 4MEWA 2LVJA 2KHNA 1GQMA 4PDZA 4CPVA 1JFJA 2WOSA 5TNCA 1A75A 3CR5X 3A4UB 3DVKA 2JXCA 2LHIA 2M49B 4N1GA 1XK4A 3DF0A 3EVUA 1J7RA 3WNXB 1YVLA 2KI4B 1B7TZ 3I5IB 4I5JA 4OR9B 1YUTA 4PCWA 3O4YA 1F4OA 2JRFA 2LCPA 3BUXB 4DS7A 3GOFA 5KU1A 1OMDA 1NPQA 1WDCB 1Y6WA 2EC6B 3MSEB 1L7ZA 4HSZA 2OS8C 3NSLA 4OKHA 2HPSA 4FQOA 2LANA 2OTGB 2F8PA 2Y5IA 3JTDB 2M0RA 4DIRA 2BL0C 5DKRA 5JJGA 2KI6C 1D1OA 2KNEA 4MZLA 2O5GA 5AANA 2MA2A 4MRYA 1NIWA 2BCXA 4CLNA 2L98A 2I7AA 2LLSA 1XFZO 4MSPA 1IWQA 1XFUO 1MQ1A 3OB2B 3IF7A 3EK7A 1A2XA 2I94A 4U8DA 2KGBC 3KPXA 3O2PA 3I5HC 2Y4QA 2BECA 1CFDA 2FCDA 5AEQA 5K89A 1QLKA 2LM5A 1EG4A 1F71A 1CDLA 3BXKA 1SR6C 5I2QA 3RM1A 1SNLA 1A03A 2WNDA 1AUIB 2EGDA 3CWGA 2COLB 5D7FA 1RECA 1C7VA 1FBVA 4CIDA 1CDNA 5F6TA 1Q80A 4L9MA 1C07A 1KK8B 2K7DA 1Y1AA 1QATA 4PHMA 4NDBA 2JPTA 1RFJA 2K2FA 2MBXA 5ER4X 1RK9A 3NSOA 1PULA 1ZUZA 2MLFC 3NSKA 2PRUA 1NUBA 4Q04A 3OX6A 2KOTA 1QTXA 3VGOA 3EVVA 1BMOA 1JBAA 1QX2A 1NX3A 3DVMA 3NXAA 1CB1A 4A4CA 1FF1A 1OOJA 1OZSA 3CS1A 1UP5A 2ISDA 1QS7A 2CTNA 2L50A 1SW8A 2G2BA 1S6IA 1B8RA 2KSPA 1CFCA 1DF0B 3LLEA 1XVJA 1DJIA 4TNCA 1CM1A 1NX0A 1UHIA 1DJGA 2LE9B 1PSRA 2LMUA 4PE7A 1F8HA 1QVIY 1TNWA 1ZFSA 5HKYA 1LA3A 3TDIA 2BKHB 2ZKMX 3CTNA 4HRHA 4ORBB 2LVKA 4JWQA 3SG6A 1DF0A 3BQ3A 4CFRA 1SCMC 4PE4A 2KI6D 3BOWB 1J55A 2H2KA 1LA0A 2MRDA 1DGUA 1J1EA 1FW4A 3AAKA 1OQPA 2EHBA 4GGFC 5JOLA 4ZCUA 1E8AA 5I2LA 3CZTX 1CLBA 1EH2A 2LMVA 2ZNDA 2CNPA 4F0ZB 1K95A 2AUCA 1SL9A 3BOWA 3ZNIA 1B47A 1PVAA 1YX8A 1CFFA 3SG3A 2K0JA 3I5FC 3JVTC 1S5GY 2HF5A 1JWDA 1DT7B 1J7QA 2WCFA 2MHHA 4PHJA 4ZCVA 1BF5A 2LUXA 2RGIA 5AFPA 1NSHA 1YUSA 1VRKA 1WRKA 3BUMB 3KO0A 5CSNA 4ICBA 1B1GA 4OV2A 1CNPA 1BODA 1ALVA 1PRWA 4AOMA 1EL4A 4PHKA 1UUSA 3OX5A 1S6JA 4YGBB 2L2EA 1DJHA 2QPTA 2FOTA 2IS9A 1AJ4A 3K21A 1CM4A 1FPWA 2L5XB 2M1KB 4QJ4B 1LXFC 4MBEA 5DKNA 1LVCD 3SG5A 2JOJA 3PSRA 2LP3A 1KFUL 3PLFB 4GUKA 1RROA 2PSRA 2LNKA 2JULA 3VRPA 4AQIA 1DVIA 4MZJA 1J7OA 2E6WA 1JF0A 1NCXA 2R2IA 3BUNB 2TN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K61 A;  1KQM B;  1GJY A;  3TS5 C;  1UHN A;  4USL A;  4QJ5 B;  3ICB A;  1KK7 Y;  1MXE A;  3TUY B;  4ORA B;  1NP8 A;  2BE4 A;  2PAL A;  1BG1 A;  1KFX S;  1QV0 A;  2KAX A;  2L4I A;  2LMT A;  2QAC A;  1YRU B;  3M0W A;  1QV1 A;  1S1E A;  3BYA A;  1H8B A;  1NX2 A;  1S36 A;  5CPV A;  2E30 A;  3ZWH A;  4MLW A;  4N5X A;  4WRI A;  2HQW A;  3WHT B;  5AER A;  4M2P A;  2WCB A;  5CSF A;  1UHH A;  1RWY A;  2P6B B;  1XFX O;  4C0J A;  1S3P A;  3DD4 A;  3CR4 X;  2CXJ A;  2NCO A;  1A29 A;  4ETO A;  4UPG A;  5DKQ A;  2DOQ A;  2M9G A;  3F45 A;  2K2A A;  1K93 D;  4I5L B;  1L2O C;  1XYD A;  1B9A A;  5HKW A;  1XO5 A;  2JT8 A;  1NX1 A;  4YI8 A;  3LK1 A;  5I8N A;  1CLL A;  1K9P A;  4GBA A;  1NYA A;  1SRA A;  1XFW O;  2KGR A;  4WQ2 A;  2ZRT A;  4NDD A;  2B1U A;  2I18 A;  1W7J B;  3SG7 A;  1Y0V H;  2VRG A;  2SAS A;  1NWD A;  2GGZ A;  4ORC B;  2Y1M A;  5CSJ A;  2KDH A;  2M97 A;  1B7T Y;  3IQQ A;  2LVI A;  2L51 A;  4JQ0 D;  4YI9 A;  3KHE A;  4YRU A;  1LKJ A;  1K90 D;  1ZAC A;  2BKI B;  1KWO C;  1F70 A;  4GPL B;  3RLZ A;  1SCV A;  3H4S E;  3QRX A;  1F4Q A;  1G33 A;  1PSB A;  4PAL A;  2OS8 B;  2LHL A;  1WLZ A;  1Y1X A;  2H61 C;  1EG3 A;  1K94 A;  2LLU A;  1J7P A;  4I5N B;  3SIA A;  1OZO A;  2GGM A;  1KCY A;  2BL0 B;  4A4B A;  4I5K A;  3FWC A;  4YGA A;  1XK4 C;  2ZNE A;  1IJ5 A;  2MLE C;  1UHJ A;  4GFT A;  3PN7 C;  1BLQ A;  3AKB A;  5J3X A;  1TCF A;  3VRN A;  1DTL A;  1JC2 A;  2KFH A;  3LK0 A;  4AQJ A;  1K2H A;  2LC5 A;  1UHK A;  4MRX A;  3VRO A;  3IQO A;  1KSO A;  5AXI A;  2AAO A;  2PVB A;  3D10 A;  2CT9 A;  3I5H B;  1B4C A;  1SPY A;  4YGE B;  3I5I C;  2F3Y A;  1UUR A;  3CGA A;  4YGC B;  3SG4 A;  1CDP A;  1KSM A;  1ODB A;  2CCM A;  2JTT A;  2LLT A;  1IKU A;  4BY5 A;  1XA5 A;  1SR6 B;  1MXL C;  1WDC C;  2EC6 C;  3EKH A;  1ZMZ A;  2K8M B;  4GAO A;  1TN4 A;  3O78 A;  1QX5 B;  1WRL A;  1BT6 A;  1EJ3 A;  2NCP A;  3JTD C;  1HT9 A;  4E68 A;  5KTY A;  2KBI A;  3I5G C;  1PAL A;  2LAP A;  2PMY A;  5G08 A;  2V53 A;  1BR4 B;  1YUR A;  2ZFD A;  2K7C A;  1N65 A;  5CSI A;  3SG2 A;  2JC2 A;  3OP0 A;  1JUO A;  2L0P A;  3CLN A;  1LIN A;  4XJK B;  1IQ3 A;  2FJU B;  2KFG A;  1DJW A;  1YVH A;  3HCM A;  3D0Y B;  1IGV A;  2JQ6 A;  4DRW A;  2NZ0 A;  2ZN8 A;  2FCE A;  1AP4 A;  4MVF A;  4XJK A;  2ZN9 A;  1JF2 A;  2Q4U A;  1SYM A;  3EVR A;  4OVN F;  5B8I B;  1MR8 A;  3D0Y A;  1M46 A;  3TZ1 A;  1BJF A;  3DVE A;  2JXL A;  1CFP A;  1QLS A;  1BU3 A;  4M2O A;  1KK8 C;  2CBL A;  1TNP A;  1MHO A;  2G9B A;  5KSZ A;  1M31 A;  1SCM B;  4XYN A;  4MN0 A;  1WY9 A;  2JNF A;  1B8C A;  3AAJ A;  3KEV A;  4GGN A;  3WHU B;  1ALW A;  2LP2 A;  4BY4 A;  1JFK A;  3GK4 X;  5HKZ A;  3FS7 A;  2L4H A;  2F3Z A;  3TDU A;  2AMI A;  4C0L A;  3GK1 A;  3OHM B;  3EK8 A;  2KQ6 A;  1Y1U A;  1YTZ C;  3PFV A;  1XFV O;  1AJ5 A;  1TNQ A;  3CR2 A;  3A8R A;  1TIZ A;  3I5F B;  2WC8 A;  3JVT B;  1K9K A;  1GGZ A;  1WLM A;  1YRT B;  4OCI A;  2HQ8 A;  4GGF A;  2O60 A;  1OMR A;  2K7O A;  3NSI A;  2JT3 A;  1GGW A;  1RJV A;  3E3R A;  1SL7 A;  5BPJ A;  3I5G B;  1QVI Z;  2A4J A;  4NQG A;  2SCP A;  2M1U A;  1QX7 A;  1OE9 B;  1V1G A;  1N2D A;  1CLM A;  1S6C A;  1R2U A;  3C1V A;  1U5I B;  2BE6 A;  1TNX A;  2LUC A;  3AKA A;  3FIA A;  3KF9 A;  5FYX A;  1SBJ A;  1K96 A;  4C0K A;  1WRZ A;  1SY9 A;  1AHR A;  2WOR A;  3EK4 A;  3OB1 B;  4WQ3 A;  5D69 A;  1CKK A;  2NXQ A;  4QJ3 B;  4M2Q A;  3LCP C;  1R6P A;  1UWO A;  2BCA A;  1U5I A;  2HET A;  1QJT A;  1DMO A;  2KQY A;  1SMG A;  2MAZ A;  1S5G Z;  4FTG A;  1CMG A;  3BUO B;  3TS5 B;  1TRF A;  5I2O A;  2NLN A;  2JU0 A;  1J1D A;  2ZRS A;  2KAY A;  1YR5 A;  1PVB A;  1MF8 B;  1KFX L;  5HLO A;  1QAS A;  1N0Y A;  1G8I A;  1NCY A;  3EKJ A;  1C7W A;  1FI6 A;  1TCO B;  4IL1 A;  4YBH B;  1YX7 A;  1A4P A;  2KBM A;  4P5O E;  3SIB A;  1XFY O;  4P2Y B;  4PE0 A;  1MWN A;  1X02 A;  2KFF A;  3WXA A;  1JSA A;  1HQV A;  2LVV A;  2GV5 A;  1K9U A;  1IJ6 A;  2JNX A;  1SL8 A;  2D8N A;  4MZK A;  5HYD A;  1KFU S;  2JZI A;  4NDC A;  1NCZ A;  1M39 A;  2F2P A;  2KI4 C;  3PAL A;  2OPO A;  1BOC A;  3VRR A;  1AVS A;  1W7I B;  1MUX A;  3PAT A;  3DVJ A;  4PHN A;  1DJY A;  2M7L A;  2KYC A;  4YGD B;  1IQ5 A;  1RTP 1;  1KQM C;  5HLV A;  1K8U A;  1IH0 A;  2Q91 A;  2MJW B;  3HX4 A;  3VRQ A;  1F54 A;  1BR1 B;  1L2O B;  1SKT A;  1AK8 A;  4HRE E;  4R1E A;  1KK7 Z;  3TUY C;  1OSA A;  1SK6 D;  1H4B A;  1QIW A;  2KYF A;  3GK2 A;  1EXR A;  2OTG C;  3SJS A;  1CMF A;  4CFQ A;  4DUQ A;  1QIV A;  1CDM A;  1CTR A;  2Y1N A;  1PK0 D;  2PAS A;  1M45 A;  4N1F A;  2LV7 A;  4JPZ B;  2M3W A;  1TOP A;  2M29 A;  1G4Y R;  1QXP A;  5IBW A;  1OMV A;  5PAL A;  1F55 A;  1IG5 A;  5GQQ C;  1DGV A;  2JT0 A;  4GNK B;  1KWO B;  1S26 D;  1DJX A;  1ZOT B;  2BCB A;  2WCE A;  1M63 B;  5ER5 A;  4PE1 A;  2KAV A;  1FI5 A;  1TTX A;  2M7N A;  3TDZ A;  4HRG A;  3O6B A;  1YUU A;  1V1F A;  2I2R E;  1A75 B;  2F2O A;  1IRJ A;  2K7B A;  2F33 A;  3LL8 B;  3PM8 A;  1KQV A;  4DCK A;  2M8U A;  1B8L A;  3DF0 B;  2JWW A;  4D1E A;  2BBM A;  3BUW B;  2JTZ A;  2BBN A;  3FWB A;  2H61 A;  1DJZ A;  3PN7 B;  4MEW A;  2LVJ A;  2KHN A;  1GQM A;  4PDZ A;  4CPV A;  1JFJ A;  2WOS A;  5TNC A;  1A75 A;  3CR5 X;  3A4U B;  3DVK A;  2JXC A;  2LHI A;  2M49 B;  4N1G A;  1XK4 A;  3DF0 A;  3EVU A;  1J7R A;  3WNX B;  1YVL A;  2KI4 B;  1B7T Z;  3I5I B;  4I5J A;  4OR9 B;  1YUT A;  4PCW A;  3O4Y A;  1F4O A;  2JRF A;  2LCP A;  3BUX B;  4DS7 A;  3GOF A;  5KU1 A;  1OMD A;  1NPQ A;  1WDC B;  1Y6W A;  2EC6 B;  3MSE B;  1L7Z A;  4HSZ A;  2OS8 C;  3NSL A;  4OKH A;  2HPS A;  4FQO A;  2LAN A;  2OTG B;  2F8P A;  2Y5I A;  3JTD B;  2M0R A;  4DIR A;  2BL0 C;  5DKR A;  5JJG A;  2KI6 C;  1D1O A;  2KNE A;  4MZL A;  2O5G A;  5AAN A;  2MA2 A;  4MRY A;  1NIW A;  2BCX A;  4CLN A;  2L98 A;  2I7A A;  2LLS A;  1XFZ O;  4MSP A;  1IWQ A;  1XFU O;  1MQ1 A;  3OB2 B;  3IF7 A;  3EK7 A;  1A2X A;  2I94 A;  4U8D A;  2KGB C;  3KPX A;  3O2P A;  3I5H C;  2Y4Q A;  2BEC A;  1CFD A;  2FCD A;  5AEQ A;  5K89 A;  1QLK A;  2LM5 A;  1EG4 A;  1F71 A;  1CDL A;  3BXK A;  1SR6 C;  5I2Q A;  3RM1 A;  1SNL A;  1A03 A;  2WND A;  1AUI B;  2EGD A;  3CWG A;  2COL B;  5D7F A;  1REC A;  1C7V A;  1FBV A;  4CID A;  1CDN A;  5F6T A;  1Q80 A;  4L9M A;  1C07 A;  1KK8 B;  2K7D A;  1Y1A A;  1QAT A;  4PHM A;  4NDB A;  2JPT A;  1RFJ A;  2K2F A;  2MBX A;  5ER4 X;  1RK9 A;  3NSO A;  1PUL A;  1ZUZ A;  2MLF C;  3NSK A;  2PRU A;  1NUB A;  4Q04 A;  3OX6 A;  2KOT A;  1QTX A;  3VGO A;  3EVV A;  1BMO A;  1JBA A;  1QX2 A;  1NX3 A;  3DVM A;  3NXA A;  1CB1 A;  4A4C A;  1FF1 A;  1OOJ A;  1OZS A;  3CS1 A;  1UP5 A;  2ISD A;  1QS7 A;  2CTN A;  2L50 A;  1SW8 A;  2G2B A;  1S6I A;  1B8R A;  2KSP A;  1CFC A;  1DF0 B;  3LLE A;  1XVJ A;  1DJI A;  4TNC A;  1CM1 A;  1NX0 A;  1UHI A;  1DJG A;  2LE9 B;  1PSR A;  2LMU A;  4PE7 A;  1F8H A;  1QVI Y;  1TNW A;  1ZFS A;  5HKY A;  1LA3 A;  3TDI A;  2BKH B;  2ZKM X;  3CTN A;  4HRH A;  4ORB B;  2LVK A;  4JWQ A;  3SG6 A;  1DF0 A;  3BQ3 A;  4CFR A;  1SCM C;  4PE4 A;  2KI6 D;  3BOW B;  1J55 A;  2H2K A;  1LA0 A;  2MRD A;  1DGU A;  1J1E A;  1FW4 A;  3AAK A;  1OQP A;  2EHB A;  4GGF C;  5JOL A;  4ZCU A;  1E8A A;  5I2L A;  3CZT X;  1CLB A;  1EH2 A;  2LMV A;  2ZND A;  2CNP A;  4F0Z B;  1K95 A;  2AUC A;  1SL9 A;  3BOW A;  3ZNI A;  1B47 A;  1PVA A;  1YX8 A;  1CFF A;  3SG3 A;  2K0J A;  3I5F C;  3JVT C;  1S5G Y;  2HF5 A;  1JWD A;  1DT7 B;  1J7Q A;  2WCF A;  2MHH A;  4PHJ A;  4ZCV A;  1BF5 A;  2LUX A;  2RGI A;  5AFP A;  1NSH A;  1YUS A;  1VRK A;  1WRK A;  3BUM B;  3KO0 A;  5CSN A;  4ICB A;  1B1G A;  4OV2 A;  1CNP A;  1BOD A;  1ALV A;  1PRW A;  4AOM A;  1EL4 A;  4PHK A;  1UUS A;  3OX5 A;  1S6J A;  4YGB B;  2L2E A;  1DJH A;  2QPT A;  2FOT A;  2IS9 A;  1AJ4 A;  3K21 A;  1CM4 A;  1FPW A;  2L5X B;  2M1K B;  4QJ4 B;  1LXF C;  4MBE A;  5DKN A;  1LVC D;  3SG5 A;  2JOJ A;  3PSR A;  2LP3 A;  1KFU L;  3PLF B;  4GUK A;  1RRO A;  2PSR A;  2LNK A;  2JUL A;  3VRP A;  4AQI A;  1DVI A;  4MZJ A;  1J7O A;  2E6W A;  1JF0 A;  1NCX A;  2R2I A;  3BUN B;  2TN4 A; 
#chains in the Genus database with same CATH topology
 2K61 A;  1KQM B;  1GJY A;  3TS5 C;  1UHN A;  4USL A;  1DQE A;  4QJ5 B;  3ICB A;  1KK7 Y;  1MXE A;  3TUY B;  4ORA B;  1NP8 A;  2WCH A;  2BE4 A;  2PAL A;  1BG1 A;  1KFX S;  1QV0 A;  2KAX A;  5FI7 A;  2L4I A;  2LMT A;  2QAC A;  1W9Z A;  1YRU B;  1QV1 A;  1S1E A;  3BYA A;  3M0W A;  1H8B A;  1NX2 A;  1S36 A;  2P70 A;  5CPV A;  1DC1 A;  3DY9 A;  2E30 A;  3BFB A;  3ZWH A;  4MLW A;  3B7A A;  4N5X A;  2HQW A;  4WRI A;  3WHT B;  5AER A;  4M2P A;  2WCB A;  5CSF A;  1UHH A;  1RWY A;  2P6B B;  1XFX O;  4C0J A;  1S3P A;  3S0D A;  3DD4 A;  3CR4 X;  2CXJ A;  2NCO A;  1A29 A;  4ETO A;  4UPG A;  5DKQ A;  3D74 A;  2DOQ A;  2M9G A;  3F45 A;  2K2A A;  1K93 D;  4I5L B;  1L2O C;  1XYD A;  1B9A A;  5HKW A;  1XO5 A;  2JT8 A;  1NX1 A;  4YI8 A;  2QDI A;  3LK1 A;  5I8N A;  1CLL A;  1K9P A;  4GBA A;  1NYA A;  1SRA A;  1XFW O;  2KGR A;  3OBV A;  4WQ2 A;  2ZRT A;  4NDD A;  2B1U A;  2I18 A;  1W7J B;  3SG7 A;  1Y0V H;  2VRG A;  2SAS A;  1NWD A;  2GGZ A;  4ORC B;  2Y1M A;  5CSJ A;  2BNX A;  2KDH A;  2M97 A;  1B7T Y;  4JKT A;  3IQQ A;  2LVI A;  2L51 A;  4JQ0 D;  3N7H A;  4YI9 A;  3KHE A;  4YRU A;  1LKJ A;  1K90 D;  1ZAC A;  2BKI B;  1KWO C;  3O4X A;  1F70 A;  4GPL B;  3RLZ A;  1SCV A;  3H4S E;  3QRX A;  1F4Q A;  1G33 A;  1PSB A;  4PAL A;  2OS8 B;  2LHL A;  1WLZ A;  1Y1X A;  2H61 C;  1EG3 A;  1K94 A;  1SSE B;  2LLU A;  3B87 A;  1J7P A;  4I5N B;  3SIA A;  1OZO A;  2GGM A;  1KCY A;  2BL0 B;  3NHI A;  4A4B A;  4I5K A;  3FWC A;  4YGA A;  1XK4 C;  2ZNE A;  3DXL A;  1IJ5 A;  2MLE C;  1UHJ A;  4GFT A;  3PN7 C;  1BLQ A;  3AKB A;  5J3X A;  1TCF A;  3VRN A;  1DTL A;  1JC2 A;  2KFH A;  3LK0 A;  4AQJ A;  1K2H A;  2K60 A;  2LC5 A;  1UHK A;  4MRX A;  3VRO A;  3IQO A;  1KSO A;  5EL2 A;  2AAO A;  2PVB A;  3D10 A;  2CT9 A;  3I5H B;  5AXI A;  1B4C A;  1SPY A;  4YGE B;  3RZS A;  3I5I C;  2F3Y A;  1UUR A;  3CGA A;  4YGC B;  3SG4 A;  1CDP A;  1KSM A;  1ODB A;  2CCM A;  2JTT A;  2LLT A;  1IKU A;  4BY5 A;  1XA5 A;  1SR6 B;  1MXL C;  1WDC C;  2EC6 C;  3EKH A;  4PT1 A;  1ZMZ A;  2K8M B;  3D77 A;  4GAO A;  1TN4 A;  3O78 A;  1QX5 B;  1WRL A;  3CZ2 A;  1BT6 A;  1EJ3 A;  1C3Y A;  2NCP A;  3JTD C;  1HT9 A;  4E68 A;  5KTY A;  2KBI A;  3I5G C;  2WCM A;  1PAL A;  2LAP A;  2PMY A;  5G08 A;  2V53 A;  1BR4 B;  1YUR A;  1P28 A;  2ZFD A;  2K7C A;  1N65 A;  5CSI A;  3SG2 A;  2JC2 A;  3OP0 A;  4INX A;  1JUO A;  2L0P A;  3CLN A;  1LIN A;  4XJK B;  1IQ3 A;  2FJU B;  2KFG A;  3FE8 A;  1DJW A;  1YVH A;  3HCM A;  3D0Y B;  1IGV A;  2WCL A;  2JQ6 A;  4DRW A;  2NZ0 A;  2ZN8 A;  2FCE A;  1AP4 A;  4MVF A;  4XJK A;  2ZN9 A;  1JF2 A;  2Q4U A;  5FI6 A;  1SYM A;  1TUJ A;  3EVR A;  4OVN F;  5B8I B;  1MR8 A;  3D0Y A;  3V2L A;  1M46 A;  3TZ1 A;  3BFA A;  1BJF A;  3DVE A;  2JXL A;  1CFP A;  1QLS A;  1BU3 A;  4M2O A;  5D3O A;  1KK8 C;  2CBL A;  3L4L A;  1TNP A;  1MHO A;  2G9B A;  5KSZ A;  1M31 A;  1SCM B;  4XYN A;  4MN0 A;  1WY9 A;  2JNF A;  1B8C A;  3AAJ A;  3KEV A;  3CZ1 A;  4GGN A;  3WHU B;  4F7F A;  1ALW A;  2LP2 A;  4BY4 A;  1JFK A;  3GK4 X;  5HKZ A;  3FE6 A;  3FS7 A;  2L4H A;  2F3Z A;  3TDU A;  3L47 A;  2AMI A;  4C0L A;  3GK1 A;  3OHM B;  3DYE A;  3EK8 A;  2L2C A;  1Z2C B;  2KQ6 A;  1Y1U A;  1YTZ C;  3PFV A;  1QWV A;  1AJ5 A;  1XFV O;  1TNQ A;  3CR2 A;  2QEH A;  1TIZ A;  2QEV A;  2WC8 A;  3A8R A;  3I5F B;  1K9K A;  1GGZ A;  3B6X A;  3JVT B;  1WLM A;  1YRT B;  4OCI A;  2HQ8 A;  4GGF A;  2O60 A;  1OMR A;  2K7O A;  3NSI A;  2JT3 A;  3R1V A;  1RJV A;  1GGW A;  3E3R A;  1SL7 A;  5BPJ A;  5FI2 A;  3I5G B;  2BAP A;  1QVI Z;  2A4J A;  4NQG A;  3S0F A;  2SCP A;  2M1U A;  2PQL A;  1TWO A;  1QX7 A;  1OE9 B;  1V1G A;  1N2D A;  5I94 A;  1CLM A;  1S6C A;  4OZD A;  1R2U A;  3C1V A;  3K1E A;  1U5I B;  2BE6 A;  1TNX A;  2LUC A;  3AKA A;  3FIA A;  3KF9 A;  5FYX A;  1SBJ A;  1K96 A;  4C0K A;  1WRZ A;  1OOF A;  1SY9 A;  1AHR A;  2WOR A;  3EK4 A;  3OB1 B;  4WQ3 A;  5D69 A;  1XFR A;  2NXQ A;  4QJ3 B;  1CKK A;  4M2Q A;  3LCP C;  1R6P A;  1UWO A;  2BCA A;  1U5I A;  2HET A;  1QJT A;  1DMO A;  2KQY A;  1SMG A;  2MAZ A;  1S5G Z;  4FTG A;  1CMG A;  3BUO B;  3TS5 B;  1TRF A;  2KLE A;  5I2O A;  2NLN A;  2JU0 A;  1J1D A;  2ZRS A;  2KAY A;  1YR5 A;  1PVB A;  1MF8 B;  1KFX L;  5HLO A;  1QAS A;  1N0Y A;  1G8I A;  1NCY A;  3EKJ A;  1C7W A;  1FI6 A;  1TCO B;  3B86 A;  4IL1 A;  4YBH B;  1YX7 A;  1A4P A;  2KBM A;  4P5O E;  3SIB A;  1XFY O;  1OOI X;  4P2Y B;  4PE0 A;  1MWN A;  1X02 A;  2KFF A;  3WXA A;  1JSA A;  1DEL A;  1HQV A;  2LVV A;  2GV5 A;  1K9U A;  1IJ6 A;  2JNX A;  1SL8 A;  2D8N A;  4MZK A;  5HYD A;  1KFU S;  2QEB A;  2JZI A;  4NDC A;  1NCZ A;  1M39 A;  2F2P A;  2KI4 C;  3PAL A;  2OPO A;  1BOC A;  3VRR A;  1AVS A;  1W7I B;  1MUX A;  3PAT A;  3DVJ A;  4PHN A;  1DJY A;  2M7L A;  2KYC A;  1GM0 A;  4YGD B;  1IQ5 A;  1RTP 1;  1IIO A;  1KQM C;  5HLV A;  1K8U A;  1IH0 A;  2Q91 A;  2MJW B;  3HX4 A;  3VRQ A;  2KLD A;  1Z4H A;  1F54 A;  1BR1 B;  1L2O B;  1SKT A;  1AK8 A;  4HRE E;  4R1E A;  1KK7 Z;  4JD9 A;  3TUY C;  1OSA A;  1SK6 D;  1H4B A;  1QIW A;  2KYF A;  3GK2 A;  1C3Z A;  1EXR A;  2OTG C;  3Q8I A;  3SJS A;  4INW A;  1CMF A;  4CFQ A;  4DUQ A;  1QIV A;  1CDM A;  1CTR A;  2Y1N A;  1PK0 D;  1TUZ A;  2PAS A;  2QEO A;  3L4A A;  1M45 A;  4N1F A;  2LV7 A;  4JPZ B;  2M3W A;  1TOP A;  2M29 A;  2KPH A;  1G4Y R;  3EG5 B;  1QXP A;  5IBW A;  1OMV A;  5PAL A;  1F55 A;  1IG5 A;  5GQQ C;  1DGV A;  2JT0 A;  4GNK B;  1KWO B;  1S26 D;  1DJX A;  1ZOT B;  2BCB A;  1OOH A;  2WCE A;  3VB1 A;  1M63 B;  3SS5 A;  2WC5 A;  5ER5 A;  4PE1 A;  2KAV A;  1FI5 A;  1TTX A;  2M7N A;  3TDZ A;  4HRG A;  3O6B A;  1YUU A;  1V1F A;  2I2R E;  3R72 A;  1A75 B;  2F2O A;  1IRJ A;  2K7B A;  2F33 A;  3LL8 B;  3PM8 A;  1KQV A;  4DCK A;  2M8U A;  1B8L A;  3DF0 B;  2JWW A;  2L5Y A;  2BBM A;  4D1E A;  3BUW B;  2JTZ A;  3SS4 A;  2BBN A;  3FWB A;  2H61 A;  1DJZ A;  3PN7 B;  4MEW A;  2LVJ A;  2KHN A;  1GQM A;  4PDZ A;  4CPV A;  1JFJ A;  2WOS A;  5TNC A;  1A75 A;  3CR5 X;  3A4U B;  3DVK A;  3IVT A;  2JXC A;  2LHI A;  2M49 B;  4N1G A;  1XK4 A;  2PYQ A;  3DF0 A;  1J7R A;  3EVU A;  1YVL A;  3WNX B;  2KI4 B;  1B7T Z;  3I5I B;  3OGN A;  3CYZ A;  4I5J A;  4OR9 B;  1YUT A;  4PCW A;  3O4Y A;  1F4O A;  2JRF A;  2LCP A;  3BUX B;  4DS7 A;  3GOF A;  3S0G A;  5KU1 A;  1OMD A;  1NPQ A;  1WDC B;  1Y6W A;  2EC6 B;  2ERB A;  1L7Z A;  3MSE B;  4HSZ A;  2FJY A;  2OS8 C;  3PM2 A;  1DEK A;  3NSL A;  4OKH A;  2HPS A;  4FQO A;  2LAN A;  2OTG B;  2F8P A;  1T14 A;  2Y5I A;  2M0R A;  3JTD B;  4DIR A;  2BL0 C;  5HL1 A;  5DKR A;  5JJG A;  2KI6 C;  1D1O A;  2KNE A;  4MZL A;  2O5G A;  5AAN A;  2MA2 A;  4MRY A;  1NIW A;  2BCX A;  4CLN A;  2L98 A;  2I7A A;  2LLS A;  1XFZ O;  3DZT A;  4MSP A;  5DIC A;  1IWQ A;  1XFU O;  1MQ1 A;  1OOG A;  3BJH A;  3OB2 B;  2YGU A;  3EK7 A;  3IF7 A;  1A2X A;  2I94 A;  4U8D A;  2KGB C;  3KPX A;  3O2P A;  3R1O A;  3I5H C;  2Y4Q A;  2BEC A;  1CFD A;  2FCD A;  5AEQ A;  5K89 A;  1QLK A;  3CDN A;  2LM5 A;  1EG4 A;  1F71 A;  1CDL A;  3BXK A;  1SR6 C;  5I2Q A;  3RM1 A;  1SNL A;  1A03 A;  2WND A;  1AUI B;  2EGD A;  3CWG A;  3QME A;  4IJ7 A;  2COL B;  5D7F A;  1REC A;  3S0A A;  1C7V A;  3R1P A;  1FBV A;  4CID A;  1CDN A;  5F6T A;  1Q80 A;  2H8V A;  4L9M A;  1C07 A;  1KK8 B;  2K7D A;  1Y1A A;  1QAT A;  4PHM A;  4NDB A;  2JPT A;  1RFJ A;  2K2F A;  2MBX A;  5ER4 X;  1RK9 A;  3NSO A;  1ORG A;  1PUL A;  1ZUZ A;  2MLF C;  3D76 A;  2PRU A;  3NSK A;  1NUB A;  3NHT A;  4Q04 A;  3OX6 A;  2KOT A;  1QTX A;  3VGO A;  3EVV A;  1BMO A;  1JBA A;  1QX2 A;  1NX3 A;  3D73 A;  3DVM A;  3NXA A;  4FQT A;  1CB1 A;  4A4C A;  3BFH A;  1FF1 A;  1OOJ A;  1OZS A;  2GTE A;  1UP5 A;  3CS1 A;  2ISD A;  1QS7 A;  3SS3 A;  2CTN A;  2L50 A;  1SW8 A;  2G2B A;  3PJI A;  1S6I A;  1B8R A;  2KSP A;  1CFC A;  1DF0 B;  2WCJ A;  3LLE A;  1XVJ A;  1DJI A;  4TNC A;  1CM1 A;  1NX0 A;  1UHI A;  1DJG A;  2LE9 B;  3UO9 A;  1PSR A;  2LMU A;  4PE7 A;  1F8H A;  1QVI Y;  1TNW A;  1ZFS A;  5HKY A;  1LA3 A;  3TDI A;  2BKH B;  2ZKM X;  3CTN A;  4HRH A;  4ORB B;  2LVK A;  4JWQ A;  2WCK A;  3SG6 A;  1DF0 A;  3BQ3 A;  4CFR A;  1SCM C;  4PE4 A;  2KI6 D;  3BOW B;  1J55 A;  2H2K A;  1LA0 A;  2MRD A;  1DGU A;  1J1E A;  1FW4 A;  3B88 A;  3AAK A;  3S0E A;  1OQP A;  3CAB A;  2EHB A;  4GGF C;  5JOL A;  4ZCU A;  1E8A A;  3UNW A;  5I2L A;  3CZT X;  1CLB A;  1EH2 A;  2LMV A;  2ZND A;  2CNP A;  4F0Z B;  1K95 A;  2AUC A;  1SL9 A;  3BOW A;  3ZNI A;  1B47 A;  1PVA A;  1YX8 A;  2JPO A;  1CFF A;  3SG3 A;  2K0J A;  3I5F C;  3JVT C;  1S5G Y;  2HF5 A;  1JWD A;  1DT7 B;  1OW4 A;  2WCF A;  1J7Q A;  2MHH A;  2WC6 A;  4PHJ A;  1LS8 A;  4ZCV A;  1BF5 A;  3NGV A;  2LUX A;  2RGI A;  5AFP A;  1NSH A;  1YUS A;  1VRK A;  1WRK A;  3BUM B;  3KO0 A;  5CSN A;  4ICB A;  1B1G A;  4OV2 A;  1CNP A;  1BOD A;  1ALV A;  1PRW A;  4AOM A;  1EL4 A;  4PHK A;  1UUS A;  3CZ0 A;  1S6J A;  3OX5 A;  4YGB B;  2L2E A;  1DJH A;  2QPT A;  3D78 A;  3S0B A;  2FOT A;  2IS9 A;  1AJ4 A;  3K21 A;  1CM4 A;  1FPW A;  4KYN A;  2L5X B;  2M1K B;  4QJ4 B;  1LXF C;  3FE9 A;  4MBE A;  5DKN A;  1LVC D;  3SG5 A;  2JOJ A;  2P71 A;  3PSR A;  2LP3 A;  1KFU L;  3PLF B;  4GUK A;  1RRO A;  2PSR A;  2LNK A;  2JUL A;  3VRP A;  4AQI A;  1DVI A;  3D75 A;  4MZJ A;  1J7O A;  2E6W A;  1JF0 A;  1NCX A;  2R2I A;  3BUN B;  2TN4 A; 
#chains in the Genus database with same CATH homology
 2K61 A;  1KQM B;  1GJY A;  3TS5 C;  1UHN A;  4USL A;  4QJ5 B;  3ICB A;  1KK7 Y;  1MXE A;  3TUY B;  4ORA B;  1NP8 A;  2BE4 A;  2PAL A;  1BG1 A;  1KFX S;  1QV0 A;  2KAX A;  2L4I A;  2LMT A;  2QAC A;  1YRU B;  3M0W A;  1QV1 A;  1S1E A;  3BYA A;  1H8B A;  1NX2 A;  1S36 A;  5CPV A;  2E30 A;  3ZWH A;  4MLW A;  4N5X A;  4WRI A;  2HQW A;  3WHT B;  5AER A;  4M2P A;  2WCB A;  5CSF A;  1UHH A;  1RWY A;  2P6B B;  1XFX O;  4C0J A;  1S3P A;  3DD4 A;  3CR4 X;  2CXJ A;  2NCO A;  1A29 A;  4ETO A;  4UPG A;  5DKQ A;  2DOQ A;  2M9G A;  3F45 A;  2K2A A;  1K93 D;  4I5L B;  1L2O C;  1XYD A;  1B9A A;  5HKW A;  1XO5 A;  2JT8 A;  1NX1 A;  4YI8 A;  3LK1 A;  5I8N A;  1CLL A;  1K9P A;  4GBA A;  1NYA A;  1SRA A;  1XFW O;  2KGR A;  4WQ2 A;  2ZRT A;  4NDD A;  2B1U A;  2I18 A;  1W7J B;  3SG7 A;  1Y0V H;  2VRG A;  2SAS A;  1NWD A;  2GGZ A;  4ORC B;  2Y1M A;  5CSJ A;  2KDH A;  2M97 A;  1B7T Y;  3IQQ A;  2LVI A;  2L51 A;  4JQ0 D;  4YI9 A;  3KHE A;  4YRU A;  1LKJ A;  1K90 D;  1ZAC A;  2BKI B;  1KWO C;  1F70 A;  4GPL B;  3RLZ A;  1SCV A;  3H4S E;  3QRX A;  1F4Q A;  1G33 A;  1PSB A;  4PAL A;  2OS8 B;  2LHL A;  1WLZ A;  1Y1X A;  2H61 C;  1EG3 A;  1K94 A;  2LLU A;  1J7P A;  4I5N B;  3SIA A;  1OZO A;  2GGM A;  1KCY A;  2BL0 B;  4A4B A;  4I5K A;  3FWC A;  4YGA A;  1XK4 C;  2ZNE A;  1IJ5 A;  2MLE C;  1UHJ A;  4GFT A;  3PN7 C;  1BLQ A;  3AKB A;  5J3X A;  1TCF A;  3VRN A;  1DTL A;  1JC2 A;  2KFH A;  3LK0 A;  4AQJ A;  1K2H A;  2LC5 A;  1UHK A;  4MRX A;  3VRO A;  3IQO A;  1KSO A;  5AXI A;  2AAO A;  2PVB A;  3D10 A;  2CT9 A;  3I5H B;  1B4C A;  1SPY A;  4YGE B;  3I5I C;  2F3Y A;  1UUR A;  3CGA A;  4YGC B;  3SG4 A;  1CDP A;  1KSM A;  1ODB A;  2CCM A;  2JTT A;  2LLT A;  1IKU A;  4BY5 A;  1XA5 A;  1SR6 B;  1MXL C;  1WDC C;  2EC6 C;  3EKH A;  1ZMZ A;  2K8M B;  4GAO A;  1TN4 A;  3O78 A;  1QX5 B;  1WRL A;  1BT6 A;  1EJ3 A;  2NCP A;  3JTD C;  1HT9 A;  4E68 A;  5KTY A;  2KBI A;  3I5G C;  1PAL A;  2LAP A;  2PMY A;  5G08 A;  2V53 A;  1BR4 B;  1YUR A;  2ZFD A;  2K7C A;  1N65 A;  5CSI A;  3SG2 A;  2JC2 A;  3OP0 A;  1JUO A;  2L0P A;  3CLN A;  1LIN A;  4XJK B;  1IQ3 A;  2FJU B;  2KFG A;  1DJW A;  1YVH A;  3HCM A;  3D0Y B;  1IGV A;  2JQ6 A;  4DRW A;  2NZ0 A;  2ZN8 A;  2FCE A;  1AP4 A;  4MVF A;  4XJK A;  2ZN9 A;  1JF2 A;  2Q4U A;  1SYM A;  3EVR A;  4OVN F;  5B8I B;  1MR8 A;  3D0Y A;  1M46 A;  3TZ1 A;  1BJF A;  3DVE A;  2JXL A;  1CFP A;  1QLS A;  1BU3 A;  4M2O A;  1KK8 C;  2CBL A;  1TNP A;  1MHO A;  2G9B A;  5KSZ A;  1M31 A;  1SCM B;  4XYN A;  4MN0 A;  1WY9 A;  2JNF A;  1B8C A;  3AAJ A;  3KEV A;  4GGN A;  3WHU B;  1ALW A;  2LP2 A;  4BY4 A;  1JFK A;  3GK4 X;  5HKZ A;  3FS7 A;  2L4H A;  2F3Z A;  3TDU A;  2AMI A;  4C0L A;  3GK1 A;  3OHM B;  3EK8 A;  2KQ6 A;  1Y1U A;  1YTZ C;  3PFV A;  1XFV O;  1AJ5 A;  1TNQ A;  3CR2 A;  3A8R A;  1TIZ A;  3I5F B;  2WC8 A;  3JVT B;  1K9K A;  1GGZ A;  1WLM A;  1YRT B;  4OCI A;  2HQ8 A;  4GGF A;  2O60 A;  1OMR A;  2K7O A;  3NSI A;  2JT3 A;  1GGW A;  1RJV A;  3E3R A;  1SL7 A;  5BPJ A;  3I5G B;  1QVI Z;  2A4J A;  4NQG A;  2SCP A;  2M1U A;  1QX7 A;  1OE9 B;  1V1G A;  1N2D A;  1CLM A;  1S6C A;  1R2U A;  3C1V A;  1U5I B;  2BE6 A;  1TNX A;  2LUC A;  3AKA A;  3FIA A;  3KF9 A;  5FYX A;  1SBJ A;  1K96 A;  4C0K A;  1WRZ A;  1SY9 A;  1AHR A;  2WOR A;  3EK4 A;  3OB1 B;  4WQ3 A;  5D69 A;  1CKK A;  2NXQ A;  4QJ3 B;  4M2Q A;  3LCP C;  1R6P A;  1UWO A;  2BCA A;  1U5I A;  2HET A;  1QJT A;  1DMO A;  2KQY A;  1SMG A;  2MAZ A;  1S5G Z;  4FTG A;  1CMG A;  3BUO B;  3TS5 B;  1TRF A;  5I2O A;  2NLN A;  2JU0 A;  1J1D A;  2ZRS A;  2KAY A;  1YR5 A;  1PVB A;  1MF8 B;  1KFX L;  5HLO A;  1QAS A;  1N0Y A;  1G8I A;  1NCY A;  3EKJ A;  1C7W A;  1FI6 A;  1TCO B;  4IL1 A;  4YBH B;  1YX7 A;  1A4P A;  2KBM A;  4P5O E;  3SIB A;  1XFY O;  4P2Y B;  4PE0 A;  1MWN A;  1X02 A;  2KFF A;  3WXA A;  1JSA A;  1HQV A;  2LVV A;  2GV5 A;  1K9U A;  1IJ6 A;  2JNX A;  1SL8 A;  2D8N A;  4MZK A;  5HYD A;  1KFU S;  2JZI A;  4NDC A;  1NCZ A;  1M39 A;  2F2P A;  2KI4 C;  3PAL A;  2OPO A;  1BOC A;  3VRR A;  1AVS A;  1W7I B;  1MUX A;  3PAT A;  3DVJ A;  4PHN A;  1DJY A;  2M7L A;  2KYC A;  4YGD B;  1IQ5 A;  1RTP 1;  1KQM C;  5HLV A;  1K8U A;  1IH0 A;  2Q91 A;  2MJW B;  3HX4 A;  3VRQ A;  1F54 A;  1BR1 B;  1L2O B;  1SKT A;  1AK8 A;  4HRE E;  4R1E A;  1KK7 Z;  3TUY C;  1OSA A;  1SK6 D;  1H4B A;  1QIW A;  2KYF A;  3GK2 A;  1EXR A;  2OTG C;  3SJS A;  1CMF A;  4CFQ A;  4DUQ A;  1QIV A;  1CDM A;  1CTR A;  2Y1N A;  1PK0 D;  2PAS A;  1M45 A;  4N1F A;  2LV7 A;  4JPZ B;  2M3W A;  1TOP A;  2M29 A;  1G4Y R;  1QXP A;  5IBW A;  1OMV A;  5PAL A;  1F55 A;  1IG5 A;  5GQQ C;  1DGV A;  2JT0 A;  4GNK B;  1KWO B;  1S26 D;  1DJX A;  1ZOT B;  2BCB A;  2WCE A;  1M63 B;  5ER5 A;  4PE1 A;  2KAV A;  1FI5 A;  1TTX A;  2M7N A;  3TDZ A;  4HRG A;  3O6B A;  1YUU A;  1V1F A;  2I2R E;  1A75 B;  2F2O A;  1IRJ A;  2K7B A;  2F33 A;  3LL8 B;  3PM8 A;  1KQV A;  4DCK A;  2M8U A;  1B8L A;  3DF0 B;  2JWW A;  4D1E A;  2BBM A;  3BUW B;  2JTZ A;  2BBN A;  3FWB A;  2H61 A;  1DJZ A;  3PN7 B;  4MEW A;  2LVJ A;  2KHN A;  1GQM A;  4PDZ A;  4CPV A;  1JFJ A;  2WOS A;  5TNC A;  1A75 A;  3CR5 X;  3A4U B;  3DVK A;  2JXC A;  2LHI A;  2M49 B;  4N1G A;  1XK4 A;  3DF0 A;  3EVU A;  1J7R A;  3WNX B;  1YVL A;  2KI4 B;  1B7T Z;  3I5I B;  4I5J A;  4OR9 B;  1YUT A;  4PCW A;  3O4Y A;  1F4O A;  2JRF A;  2LCP A;  3BUX B;  4DS7 A;  3GOF A;  5KU1 A;  1OMD A;  1NPQ A;  1WDC B;  1Y6W A;  2EC6 B;  3MSE B;  1L7Z A;  4HSZ A;  2OS8 C;  3NSL A;  4OKH A;  2HPS A;  4FQO A;  2LAN A;  2OTG B;  2F8P A;  2Y5I A;  3JTD B;  2M0R A;  4DIR A;  2BL0 C;  5DKR A;  5JJG A;  2KI6 C;  1D1O A;  2KNE A;  4MZL A;  2O5G A;  5AAN A;  2MA2 A;  4MRY A;  1NIW A;  2BCX A;  4CLN A;  2L98 A;  2I7A A;  2LLS A;  1XFZ O;  4MSP A;  1IWQ A;  1XFU O;  1MQ1 A;  3OB2 B;  3IF7 A;  3EK7 A;  1A2X A;  2I94 A;  4U8D A;  2KGB C;  3KPX A;  3O2P A;  3I5H C;  2Y4Q A;  2BEC A;  1CFD A;  2FCD A;  5AEQ A;  5K89 A;  1QLK A;  2LM5 A;  1EG4 A;  1F71 A;  1CDL A;  3BXK A;  1SR6 C;  5I2Q A;  3RM1 A;  1SNL A;  1A03 A;  2WND A;  1AUI B;  2EGD A;  3CWG A;  2COL B;  5D7F A;  1REC A;  1C7V A;  1FBV A;  4CID A;  1CDN A;  5F6T A;  1Q80 A;  4L9M A;  1C07 A;  1KK8 B;  2K7D A;  1Y1A A;  1QAT A;  4PHM A;  4NDB A;  2JPT A;  1RFJ A;  2K2F A;  2MBX A;  5ER4 X;  1RK9 A;  3NSO A;  1PUL A;  1ZUZ A;  2MLF C;  3NSK A;  2PRU A;  1NUB A;  4Q04 A;  3OX6 A;  2KOT A;  1QTX A;  3VGO A;  3EVV A;  1BMO A;  1JBA A;  1QX2 A;  1NX3 A;  3DVM A;  3NXA A;  1CB1 A;  4A4C A;  1FF1 A;  1OOJ A;  1OZS A;  3CS1 A;  1UP5 A;  2ISD A;  1QS7 A;  2CTN A;  2L50 A;  1SW8 A;  2G2B A;  1S6I A;  1B8R A;  2KSP A;  1CFC A;  1DF0 B;  3LLE A;  1XVJ A;  1DJI A;  4TNC A;  1CM1 A;  1NX0 A;  1UHI A;  1DJG A;  2LE9 B;  1PSR A;  2LMU A;  4PE7 A;  1F8H A;  1QVI Y;  1TNW A;  1ZFS A;  5HKY A;  1LA3 A;  3TDI A;  2BKH B;  2ZKM X;  3CTN A;  4HRH A;  4ORB B;  2LVK A;  4JWQ A;  3SG6 A;  1DF0 A;  3BQ3 A;  4CFR A;  1SCM C;  4PE4 A;  2KI6 D;  3BOW B;  1J55 A;  2H2K A;  1LA0 A;  2MRD A;  1DGU A;  1J1E A;  1FW4 A;  3AAK A;  1OQP A;  2EHB A;  4GGF C;  5JOL A;  4ZCU A;  1E8A A;  5I2L A;  3CZT X;  1CLB A;  1EH2 A;  2LMV A;  2ZND A;  2CNP A;  4F0Z B;  1K95 A;  2AUC A;  1SL9 A;  3BOW A;  3ZNI A;  1B47 A;  1PVA A;  1YX8 A;  1CFF A;  3SG3 A;  2K0J A;  3I5F C;  3JVT C;  1S5G Y;  2HF5 A;  1JWD A;  1DT7 B;  1J7Q A;  2WCF A;  2MHH A;  4PHJ A;  4ZCV A;  1BF5 A;  2LUX A;  2RGI A;  5AFP A;  1NSH A;  1YUS A;  1VRK A;  1WRK A;  3BUM B;  3KO0 A;  5CSN A;  4ICB A;  1B1G A;  4OV2 A;  1CNP A;  1BOD A;  1ALV A;  1PRW A;  4AOM A;  1EL4 A;  4PHK A;  1UUS A;  3OX5 A;  1S6J A;  4YGB B;  2L2E A;  1DJH A;  2QPT A;  2FOT A;  2IS9 A;  1AJ4 A;  3K21 A;  1CM4 A;  1FPW A;  2L5X B;  2M1K B;  4QJ4 B;  1LXF C;  4MBE A;  5DKN A;  1LVC D;  3SG5 A;  2JOJ A;  3PSR A;  2LP3 A;  1KFU L;  3PLF B;  4GUK A;  1RRO A;  2PSR A;  2LNK A;  2JUL A;  3VRP A;  4AQI A;  1DVI A;  4MZJ A;  1J7O A;  2E6W A;  1JF0 A;  1NCX A;  2R2I A;  3BUN B;  2TN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...