2L50A

Solution structure of apo s100a16
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A16
total genus 36
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l50A00
1KFUS 5CSIA 4OV2A 3BOWA 1TNQA 2BBMA 3QRXA 4PE7A 2A4JA 1B7TY 1QX5B 1TCOB 2E6WA 2L4IA 1N0YA 3OX6A 1XFXO 2JU0A 2Q91A 4GNKB 4JWQA 4PDZA 2FJUB 1OMRA 1Q80A 4A4BA 2JNXA 2L51A 3I5IB 2JT0A 3AKBA 1KQMB 2QACA 5JJGA 3PN7B 1ZFSA 2MLFC 3SIAA 1Y0VH 1GGZA 2KGBC 1NP8A 3FWCA 4I5NB 5HLVA 2AMIA 1G4YR 3VRPA 3PATA 2O5GA 3A8RA 1WRLA 1M31A 2FCEA 3A4UB 4YBHB 1FF1A 1CLMA 2ZNDA 4I5JA 1IKUA 4TNCA 1QV0A 2KAYA 1CMGA 2M7NA 1OOJA 1JUOA 4MEWA 2HQWA 2PALA 1PSBA 2JT3A 3WHUB 2I18A 2Y1NA 1A75A 3CR4X 2KBMA 4PHNA 3SG2A 2LVJA 4CLNA 1D1OA 3PN7C 2KQ6A 3VRNA 2JC2A 1PVAA 2KI6C 1CNPA 1F71A 5DKNA 2IS9A 1PALA 3KO0A 1OZOA 1B4CA 4XYNA 2LLUA 4GGNA 4E68A 1MF8B 3E3RA 5K89A 1AP4A 2JT8A 2D8NA 4N5XA 2F3YA 1C07A 4OR9B 1F8HA 3PSRA 3SG4A 1BMOA 5HLOA 1MXLC 4QJ3B 1B7TZ 2LVIA 1RROA 3I5FB 2PRUA 1CFCA 5ER5A 1TIZA 1GGWA 5AXIA 2EGDA 1ODBA 1VRKA 2SCPA 2PASA 3H4SE 2JXLA 1DJHA 2AAOA 5TNCA 3RM1A 3BUWB 1CFDA 3OB2B 3C1VA 5CSJA 1NUBA 2HPSA 3DF0A 3HX4A 2K7DA 1FW4A 1TN4A 1SY9A 3OP0A 4HRHA 1R2UA 1TCFA 3EVUA 2KBIA 1SNLA 5AFPA 3KPXA 1WY9A 1F70A 2ISDA 1CDPA 1F4OA 1NIWA 2F8PA 4ORAB 4FQOA 4MLWA 4PALA 1SL7A 2ZRTA 4GFTA 2CTNA 1DGUA 5DKQA 4MRXA 2BKIB 1K90D 1TRFA 3RLZA 1AJ5A 3CGAA 2MBXA 3EKHA 1IRJA 1AJ4A 1A03A 2M7LA 1AVSA 2FCDA 1WRZA 1XFYO 2M0RA 5I8NA 1DJIA 1EJ3A 1MWNA 4JPZB 3SG5A 1XFVO 4CFRA 1J7QA 2JZIA 2BE6A 1CDNA 4BY5A 3EVVA 1QATA 1DJWA 1MUXA 2NZ0A 1CFFA 1SK6D 2M9GA 2KHNA 2KFHA 1MQ1A 1NX2A 2L50A 3AKAA 1YRTB 2L5XB 4USLA 1M46A 4L9MA 2JRFA 1TNXA 4YGBB 5KU1A 1XA5A 1QVIY 1U5IB 2MLEC 4ORBB 4CIDA 1ZUZA 2BCBA 3BOWB 3JTDB 1IQ5A 2SASA 2F2PA 2BBNA 1R6PA 2BECA 4PE0A 1H8BA 1DF0B 1YTZC 2G9BA 1W7JB 4P5OE 4XJKB 3NSOA 4C0LA 3JVTB 4ORCB 3KHEA 1EG4A 2H61C 2QPTA 4QJ4B 1YUTA 1V1FA 1PRWA 1KFXS 2LCPA 2HF5A 2JULA 2KAVA 2LP2A 2F33A 3LK1A 1NX3A 2O60A 3K21A 2LC5A 1J7PA 2LVKA 2Y4QA 2F3ZA 3DD4A 1WLZA 1PK0D 1NCXA 1V1GA 1RECA 1A2XA 1DMOA 1Y1AA 4MZJA 1J1DA 1DT7B 2Y5IA 1S3PA 4MZLA 3TUYC 1E8AA 1KSMA 1PSRA 2WCBA 4NDBA 2K7CA 1QTXA 4NDDA 1QX2A 1N65A 1K8UA 1PVBA 1MR8A 2K7OA 2LUXA 5HKYA 1G8IA 2PVBA 3CWGA 4WRIA 1JWDA 3DVMA 5CSNA 1CDLA 2HQ8A 1HT9A 4AQIA 1K9KA 1HQVA 1B47A 2LE9B 1OZSA 1BODA 1EL4A 2CCMA 1NX0A 2K0JA 2LLTA 2VRGA 1CMFA 4F0ZB 5I2QA 1DTLA 1NSHA 1S6JA 1B8RA 2OS8B 4M2OA 1NYAA 2ZKMX 2LLSA 3CR5X 1KK8B 1MXEA 2BKHB 3CLNA 3GK1A 4MRYA 3TDZA 4YRUA 1F54A 3EK4A 1SMGA 2Y1MA 4N1GA 4ETOA 2BCXA 1UWOA 1RJVA 1TOPA 3LCPC 3IQQA 3TDIA 3SIBA 1OQPA 1A75B 2ZFDA 1KQVA 1BT6A 3PALA 3O78A 3WXAA 1K93D 1SL9A 1QLKA 2K8MB 1G33A 2MA2A 2RGIA 1JBAA 1B8CA 3I5FC 4M2PA 1NWDA 1LVCD 1XO5A 4CFQA 5GQQC 3EK7A 1A4PA 1DJGA 2WCEA 1XYDA 1JSAA 4AQJA 2NXQA 5F6TA 3IQOA 3PM8A 3LK0A 1CKKA 1TNPA 2G2BA 2OPOA 3DVEA 3SG3A 5I2OA 2M49B 3OHMB 1ZOTB 3M0WA 4C0JA 2NCOA 2P6BB 1YUSA 1N2DA 1NCYA 3FS7A 1YRUB 3EVRA 5DKRA 2WNDA 2WOSA 5PALA 2CXJA 3CS1A 2WCFA 4YGAA 3BUNB 1M39A 1CM1A 1M45A 1L7ZA 3O2PA 1YR5A 1BU3A 1ZACA 2ZNEA 1S36A 3KEVA 3I5HB 3CTNA 1XFWO 4PHMA 4GPLB 1FI6A 4M2QA 3TDUA 2AUCA 2JOJA 1X02A 1Y1UA 2B1UA 1KK7Y 1UHNA 3ZWHA 1S5GY 1KSOA 2LVVA 2M29A 3VGOA 2R2IA 2KI4C 2Q4UA 4I5KA 3TUYB 3OX5A 3SJSA 2GGZA 3O4YA 2KAXA 2K2AA 2EC6C 4YGEB 4MBEA 1KFXL 4U8DA 1QVIZ 1LKJA 1S1EA 3VRRA 1UURA 4DIRA 2WC8A 3WNXB 3D10A 4OKHA 2KNEA 2LMVA 5ER4X 4OVNF 1SKTA 1KQMC 2LNKA 1J7RA 3BUMB 2KI4B 3LLEA 1YURA 2KSPA 2OS8C 1CB1A 1LA0A 3PFVA 3IF7A 3D0YA 3OB1B 2CBLA 2H61A 2PMYA 1DVIA 1QLSA 3BQ3A 1BR4B 4GUKA 4XJKA 2JWWA 4JQ0D 3EK8A 3I5GB 1H4BA 2I94A 1IJ5A 3BUOB 2KI6D 1S6IA 1RFJA 1J7OA 4N1FA 1K94A 1EG3A 3DVJA 4MN0A 1IGVA 2KDHA 2KFGA 5D69A 1QIWA 3PLFB 1LXFC 1JFKA 3CZTX 2CNPA 2GV5A 4DS7A 1BJFA 3KF9A 1KFUL 3DF0B 3CR2A 1YVLA 4GBAA 4WQ2A 2K61A 2M1UA 1IG5A 2LM5A 2L4HA 5IBWA 1Y1XA 4MVFA 1BR1B 2LMUA 1K2HA 3FWBA 1QIVA 1MHOA 2LUCA 4YGCB 4HRGA 3TS5B 1S26D 1CLLA 2WORA 3VROA 2LAPA 1QJTA 2I7AA 1TNWA 4ICBA 1TTXA 1YX7A 5HKWA 1IQ3A 4GAOA 1KK8C 1GQMA 3ZNIA 1B8LA 5BPJA 3BXKA 4IL1A 1S5GZ 2HETA 3MSEB 3TS5C 2PSRA 4DCKA 5KTYA 1RWYA 1FBVA 2LMTA 1SBJA 3O6BA 1C7VA 4D1EA 2KYCA 1WLMA 1XK4C 4MZKA 3BUXB 1WDCB 2V53A 4WQ3A 1AK8A 1J55A 1U5IA 1XVJA 2BCAA 1FPWA 2ZN9A 4DUQA 2NCPA 3F45A 4DRWA 1AHRA 5AERA 1SW8A 1CM4A 1BOCA 1YX8A 5KSZA 2JPTA 1W7IB 1DGVA 2M3WA 3WHTB 1UHHA 1YVHA 1K9UA 1XFUO 2FOTA 1M63B 2K7BA 3GOFA 4BY4A 1WDCC 2JTTA 2BL0B 2ZN8A 2E30A 4I5LB 4NDCA 1BF5A 2KOTA 1OMDA 1FI5A 2KYFA 1OMVA 2LP3A 2DOQA 1B9AA 1ALWA 5JOLA 1KK7Z 1Y6WA 1PULA 2MRDA 4GGFA 4MSPA 4QJ5B 1LINA 1JFJA 3FIAA 4FTGA 1SPYA 1OSAA 4PE1A 1K96A 3I5IC 5CPVA 1CDMA 1CTRA 1IWQA 1KCYA 5CSFA 5I2LA 5AEQA 1NCZA 2L98A 2BL0C 1C7WA 3I5GC 3I5HC 4NQGA 4P2YB 4A4CA 1BLQA 1NX1A 3LL8B 5HKZA 4CPVA 1SRAA 1UUSA 1CFPA 3HCMA 1K9PA 2LHLA 5D7FA 5G08A 4ZCVA 4R1EA 4YI9A 1SR6B 1L2OC 4OCIA 1SYMA 3D0YB 1GJYA 3JTDC 1DF0A 1JC2A 4UPGA 2LV7A 3ICBA 4PCWA 4PHJA 4C0KA 2EC6B 4HSZA 2EHBA 1LA3A 1QXPA 2MJWB 3NXAA 3NSKA 1SCVA 2M1KB 3BYAA 3NSLA 4PHKA 1IH0A 1DJZA 3VRQA 1KWOC 1CLBA 1DJYA 3GK4X 3SG6A 1XK4A 2KGRA 2M97A 2JNFA 1AUIB 1K95A 2JTZA 2OTGC 5HYDA 2KFFA 2BE4A 2KQYA 3AAKA 1S6CA 1YUUA 2NLNA 2ZRSA 4PE4A 1NPQA 1JF0A 1WRKA 1L2OB 4ZCUA 2JXCA 1SR6C 2GGMA 2JQ6A 1UHIA 1OE9B 1RTP1 2L2EA 1SCMC 1RK9A 1KWOB 1UHJA 1DJXA 4GGFC 2MHHA 3NSIA 1J1EA 3DVKA 2L0PA 1JF2A 2TN4A 2LANA 1QV1A 2COLB 5B8IB 1ZMZA 5J3XA 1UP5A 3GK2A 4Q04A 1XFZO 3SG7A 1QASA 2LHIA 1F55A 4YGDB 3TZ1A 2MAZA 1BG1A 5AANA 2I2RE 1EXRA 1B1GA 2CT9A 1EH2A 4HREE 3EKJA 4AOMA 1IJ6A 1ALVA 3JVTC 1A29A 1QS7A 1QX7A 1SCMB 1UHKA 5FYXA 2K2FA 1F4QA 2OTGB 2M8UA 2F2OA 1SL8A 3AAJA 4YI8A 2H2KA
chains in the Genus database with same CATH superfamily
1KFUS 5CSIA 4OV2A 3BOWA 1TNQA 2BBMA 3QRXA 4INXA 4PE7A 3SS5A 2A4JA 1B7TY 1QX5B 1TCOB 2E6WA 2L4IA 1N0YA 3OX6A 1XFXO 2JU0A 2Q91A 4GNKB 4JWQA 4F7FA 4PDZA 2FJUB 1OMRA 1Q80A 4A4BA 2JNXA 2L51A 3I5IB 2JT0A 3AKBA 1KQMB 2QACA 5JJGA 3PN7B 1ZFSA 2MLFC 3SIAA 1Y0VH 1GGZA 2KGBC 1NP8A 3FWCA 4I5NB 5HLVA 2AMIA 1G4YR 3L4AA 3VRPA 3PATA 2O5GA 3NGVA 3A8RA 1WRLA 3UO9A 1M31A 2FCEA 3A4UB 4YBHB 1FF1A 1CLMA 2ZNDA 4I5JA 1IKUA 4TNCA 1QV0A 2KAYA 1CMGA 2M7NA 3Q8IA 1OOJA 1JUOA 4MEWA 2HQWA 2PALA 1PSBA 2JT3A 3SS3A 3WHUB 1W9ZA 2I18A 2Y1NA 1A75A 3CR4X 2KBMA 4PHNA 3SG2A 2LVJA 4CLNA 1D1OA 3PN7C 2KQ6A 3VRNA 2JC2A 1PVAA 2KI6C 3B87A 1CNPA 1F71A 5DKNA 2IS9A 1PALA 3KO0A 1OZOA 1B4CA 4XYNA 2LLUA 4GGNA 4E68A 1MF8B 3E3RA 5K89A 1AP4A 2JT8A 2D8NA 4N5XA 2F3YA 1C07A 1DEKA 4OR9B 1F8HA 3PSRA 3SG4A 1BMOA 5HLOA 2ERBA 1MXLC 4QJ3B 1B7TZ 2LVIA 1RROA 3CDNA 3I5FB 2PRUA 1CFCA 5ER5A 1TIZA 1GGWA 5AXIA 2EGDA 1ODBA 1VRKA 2SCPA 2PASA 3H4SE 2JXLA 1DJHA 2AAOA 5TNCA 3RM1A 3BUWB 1CFDA 3OB2B 5HL1A 3C1VA 3NHIA 3BFHA 3R1VA 5CSJA 1NUBA 2HPSA 3DF0A 3HX4A 2K7DA 1FW4A 1TN4A 1SY9A 3OP0A 4HRHA 1R2UA 1TCFA 3EVUA 4IJ7A 2KBIA 1SNLA 5AFPA 3KPXA 1WY9A 1F70A 2ISDA 1CDPA 1F4OA 1NIWA 2F8PA 4ORAB 3CZ1A 4FQOA 4MLWA 4PALA 1SL7A 3CABA 2ZRTA 4GFTA 2CTNA 1DGUA 5DKQA 4MRXA 2BKIB 1K90D 1TRFA 3RLZA 1AJ5A 3CGAA 2MBXA 3EKHA 1IRJA 1AJ4A 1A03A 2M7LA 1AVSA 2FCDA 1WRZA 1XFYO 2M0RA 5I8NA 1DJIA 1EJ3A 1MWNA 4JPZB 3SG5A 1XFVO 4CFRA 1J7QA 2JZIA 2BE6A 1CDNA 4BY5A 3EVVA 1QATA 4PT1A 1DJWA 1MUXA 2NZ0A 1CFFA 1SK6D 2M9GA 2KHNA 3BFAA 2KFHA 1MQ1A 1NX2A 1TUJA 2L50A 3AKAA 1YRTB 2L5XB 4USLA 1M46A 4L9MA 2JRFA 1TNXA 4YGBB 5KU1A 1XA5A 1QVIY 1U5IB 2MLEC 4ORBB 4CIDA 1ZUZA 1SSEB 2BCBA 2BAPA 3BOWB 5EL2A 3JTDB 1IQ5A 3FE9A 2SASA 2F2PA 1OOIX 2BBNA 1R6PA 2WCHA 2BECA 3R1OA 4PE0A 3D78A 1GM0A 1H8BA 1DF0B 1YTZC 2G9BA 1W7JB 3D76A 4P5OE 4XJKB 3NSOA 4C0LA 3JVTB 4ORCB 1DC1A 3KHEA 1EG4A 2H61C 2QPTA 3QMEA 4QJ4B 1YUTA 1C3ZA 1V1FA 1PRWA 3CZ2A 1KFXS 2LCPA 3K1EA 2WC6A 2HF5A 2JULA 2KAVA 2LP2A 2F33A 3LK1A 1NX3A 2O60A 3K21A 2LC5A 1J7PA 5I94A 2LVKA 2Y4QA 2F3ZA 3DD4A 1WLZA 1PK0D 1NCXA 1V1GA 1RECA 2JPOA 1A2XA 1QWVA 1DMOA 1Y1AA 4MZJA 1J1DA 1DT7B 2Y5IA 3BFBA 1S3PA 2WC5A 4MZLA 3TUYC 3OGNA 1E8AA 1KSMA 1PSRA 2WCBA 4NDBA 2PQLA 2K7CA 3N7HA 1QTXA 3O4XA 4NDDA 1QX2A 1N65A 1K8UA 1PVBA 1MR8A 2K7OA 2LUXA 1OW4A 1G8IA 2PVBA 3CWGA 3D75A 5HKYA 3VB1A 4WRIA 1JWDA 3DVMA 5CSNA 1CDLA 2HQ8A 1HT9A 4AQIA 1K9KA 1HQVA 1B47A 2LE9B 1OZSA 1BODA 1EL4A 2CCMA 1NX0A 2K0JA 2LLTA 2VRGA 1CMFA 4F0ZB 5I2QA 3CYZA 1DTLA 1NSHA 1S6JA 1B8RA 2OS8B 3D77A 4M2OA 1NYAA 2ZKMX 2LLSA 3CR5X 1KK8B 1MXEA 2BKHB 3CLNA 3GK1A 4MRYA 3TDZA 4YRUA 1F54A 3EK4A 5FI6A 1SMGA 2Y1MA 4N1GA 4ETOA 2BCXA 2QEHA 3NHTA 3RZSA 1UWOA 5DICA 1RJVA 1TOPA 3LCPC 3IQQA 3TDIA 3SIBA 1OQPA 1T14A 1A75B 3SS4A 2ZFDA 1KQVA 1BT6A 3PALA 3O78A 3WXAA 1K93D 1SL9A 1QLKA 2K8MB 1G33A 2MA2A 2RGIA 1JBAA 1B8CA 3I5FC 4M2PA 3DYEA 1NWDA 1LVCD 1XO5A 4CFQA 5GQQC 1Z2CB 3EK7A 1A4PA 1DJGA 2WCEA 1XYDA 1JSAA 4AQJA 2NXQA 5F6TA 3IQOA 3PM8A 3LK0A 2H8VA 1TNPA 1CKKA 2G2BA 2OPOA 3DVEA 3SG3A 1TUZA 5I2OA 2M49B 3OHMB 1ZOTB 3M0WA 4C0JA 2NCOA 2P6BB 1YUSA 1N2DA 1NCYA 3FS7A 1YRUB 2BNXA 3EVRA 5DKRA 2WNDA 2WOSA 5PALA 2CXJA 3CS1A 2WCFA 4YGAA 3OBVA 3BUNB 1M39A 1CM1A 1M45A 1L7ZA 2PYQA 3O2PA 2WCKA 1YR5A 1BU3A 2GTEA 1LS8A 1ZACA 2ZNEA 1S36A 3KEVA 3I5HB 3CTNA 1XFWO 4PHMA 3R72A 3FE6A 4GPLB 1FI6A 4M2QA 3TDUA 2AUCA 2JOJA 1X02A 1Y1UA 2B1UA 1KK7Y 1UHNA 3ZWHA 1S5GY 1KSOA 2LVVA 2M29A 3VGOA 2R2IA 2KI4C 4INWA 3EG5B 2Q4UA 4I5KA 3TUYB 3OX5A 3SJSA 2GGZA 3O4YA 2KAXA 2K2AA 2EC6C 4YGEB 4MBEA 1KFXL 4U8DA 1QVIZ 1LKJA 1S1EA 3VRRA 3PM2A 1UURA 4KYNA 1XFRA 4DIRA 2WC8A 3WNXB 3D10A 4OKHA 2WCMA 2KNEA 2LMVA 5ER4X 2FJYA 4OVNF 1SKTA 1KQMC 2LNKA 1J7RA 3BUMB 2KI4B 3LLEA 1YURA 2KSPA 2OS8C 1CB1A 1LA0A 1P28A 3IF7A 3D0YA 3L47A 3OB1B 3PFVA 2CBLA 2H61A 3S0BA 2PMYA 1DVIA 1QLSA 3BQ3A 1BR4B 4GUKA 4XJKA 2QEVA 2JWWA 4JQ0D 3EK8A 3I5GB 1H4BA 2I94A 2QEOA 1IJ5A 3BUOB 2KI6D 1S6IA 3S0FA 1RFJA 1J7OA 4N1FA 1K94A 1EG3A 3DVJA 4MN0A 1IGVA 2KDHA 2KFGA 5D69A 1QIWA 3PLFB 1LXFC 1JFKA 3CZTX 2CNPA 2GV5A 4DS7A 1BJFA 3KF9A 1KFUL 2L2CA 1TWOA 3DF0B 3CR2A 1YVLA 4GBAA 4WQ2A 2K61A 2M1UA 3FE8A 1IG5A 2LM5A 1OOFA 2L4HA 5IBWA 1C3YA 1Y1XA 4MVFA 1BR1B 2LMUA 1K2HA 3FWBA 1QIVA 3IVTA 1MHOA 2LUCA 2QDIA 4YGCB 3D73A 4HRGA 3TS5B 1S26D 1CLLA 2WORA 3VROA 1ORGA 2LAPA 1QJTA 1DQEA 3L4LA 2I7AA 2K60A 1TNWA 3BJHA 4ICBA 1TTXA 1YX7A 5HKWA 1IQ3A 4GAOA 1KK8C 1GQMA 3ZNIA 1B8LA 3S0DA 2KPHA 5BPJA 3BXKA 4IL1A 1S5GZ 4JD9A 2HETA 3MSEB 3TS5C 2PSRA 4DCKA 5KTYA 1RWYA 1FBVA 2LMTA 1SBJA 3O6BA 1C7VA 4D1EA 2KYCA 1WLMA 1XK4C 4MZKA 3BUXB 1WDCB 2V53A 4WQ3A 1AK8A 1J55A 1U5IA 1XVJA 2BCAA 1FPWA 2ZN9A 4DUQA 2NCPA 3B6XA 1OOHA 3F45A 4DRWA 1AHRA 5AERA 1SW8A 1CM4A 1BOCA 1YX8A 5KSZA 2JPTA 1W7IB 1DGVA 2M3WA 3WHTB 1UHHA 1YVHA 1K9UA 1XFUO 2FOTA 1M63B 2K7BA 1OOGA 3GOFA 4BY4A 1WDCC 2JTTA 2BL0B 2ZN8A 2E30A 4I5LB 4NDCA 4FQTA 1BF5A 2KOTA 1OMDA 2P71A 5FI7A 2KYFA 1OMVA 2LP3A 1FI5A 2DOQA 1B9AA 1ALWA 4JKTA 4OZDA 1KK7Z 1Y6WA 1PULA 2MRDA 4GGFA 4MSPA 3DZTA 1LINA 5JOLA 4QJ5B 1JFJA 3FIAA 4FTGA 1SPYA 1OSAA 2P70A 4PE1A 1K96A 3I5IC 5CPVA 1CDMA 1CTRA 1IWQA 1KCYA 5CSFA 3B88A 5I2LA 5AEQA 1NCZA 2L98A 2BL0C 1C7WA 3I5GC 3I5HC 4NQGA 4P2YB 4A4CA 3PJIA 1BLQA 1NX1A 3LL8B 5HKZA 4CPVA 1SRAA 1UUSA 1Z4HA 1CFPA 3HCMA 1K9PA 2LHLA 5D7FA 5G08A 4ZCVA 4R1EA 2QEBA 3S0GA 4YI9A 1SR6B 1L2OC 4OCIA 1SYMA 3D0YB 1GJYA 1IIOA 3JTDC 1DF0A 1JC2A 4UPGA 2LV7A 3ICBA 4PCWA 4PHJA 4C0KA 2EC6B 4HSZA 2EHBA 1LA3A 1QXPA 2MJWB 3NXAA 3NSKA 1SCVA 2M1KB 3BYAA 3NSLA 4PHKA 1IH0A 1DJZA 3VRQA 1KWOC 1CLBA 1DJYA 2KLDA 3GK4X 3SG6A 1XK4A 2KGRA 2M97A 2JNFA 1AUIB 1K95A 2JTZA 2OTGC 3D74A 5HYDA 2KFFA 2BE4A 2KQYA 3AAKA 1S6CA 1YUUA 2NLNA 2ZRSA 4PE4A 1NPQA 1JF0A 1WRKA 1L2OB 4ZCUA 2JXCA 1SR6C 2GGMA 2JQ6A 3DXLA 1UHIA 1OE9B 1RTP1 2L2EA 1SCMC 1RK9A 1KWOB 1UHJA 1DJXA 2WCLA 4GGFC 2MHHA 3NSIA 1J1EA 3V2LA 3DVKA 2L0PA 1JF2A 2TN4A 2LANA 2YGUA 1QV1A 2COLB 5B8IB 3R1PA 1ZMZA 5J3XA 1UP5A 3GK2A 3UNWA 4Q04A 1XFZO 3S0AA 3SG7A 1QASA 2LHIA 1F55A 4YGDB 2L5YA 3TZ1A 2MAZA 1BG1A 5FI2A 5AANA 2I2RE 1EXRA 1B1GA 2CT9A 3B7AA 5D3OA 4HREE 1EH2A 3EKJA 4AOMA 1IJ6A 1ALVA 3JVTC 1A29A 1QS7A 1QX7A 1SCMB 1UHKA 3CZ0A 5FYXA 2K2FA 3S0EA 1F4QA 2KLEA 2OTGB 2M8UA 2F2OA 1SL8A 3AAJA 2WCJA 4YI8A 1DELA 2H2KA 3B86A 3DY9A
chains in the Genus database with same CATH topology
1KFUS 5CSIA 4OV2A 3BOWA 1TNQA 2BBMA 3QRXA 4PE7A 2A4JA 1B7TY 1QX5B 1TCOB 2E6WA 2L4IA 1N0YA 3OX6A 1XFXO 2JU0A 2Q91A 4GNKB 4JWQA 4PDZA 2FJUB 1OMRA 1Q80A 4A4BA 2JNXA 2L51A 3I5IB 2JT0A 3AKBA 1KQMB 2QACA 5JJGA 3PN7B 1ZFSA 2MLFC 3SIAA 1Y0VH 1GGZA 2KGBC 1NP8A 3FWCA 4I5NB 5HLVA 2AMIA 1G4YR 3VRPA 3PATA 2O5GA 3A8RA 1WRLA 1M31A 2FCEA 3A4UB 4YBHB 1FF1A 1CLMA 2ZNDA 4I5JA 1IKUA 4TNCA 1QV0A 2KAYA 1CMGA 2M7NA 1OOJA 1JUOA 4MEWA 2HQWA 2PALA 1PSBA 2JT3A 3WHUB 2I18A 2Y1NA 1A75A 3CR4X 2KBMA 4PHNA 3SG2A 2LVJA 4CLNA 1D1OA 3PN7C 2KQ6A 3VRNA 2JC2A 1PVAA 2KI6C 1CNPA 1F71A 5DKNA 2IS9A 1PALA 3KO0A 1OZOA 1B4CA 4XYNA 2LLUA 4GGNA 4E68A 1MF8B 3E3RA 5K89A 1AP4A 2JT8A 2D8NA 4N5XA 2F3YA 1C07A 4OR9B 1F8HA 3PSRA 3SG4A 1BMOA 5HLOA 1MXLC 4QJ3B 1B7TZ 2LVIA 1RROA 3I5FB 2PRUA 1CFCA 5ER5A 1TIZA 1GGWA 5AXIA 2EGDA 1ODBA 1VRKA 2SCPA 2PASA 3H4SE 2JXLA 1DJHA 2AAOA 5TNCA 3RM1A 3BUWB 1CFDA 3OB2B 3C1VA 5CSJA 1NUBA 2HPSA 3DF0A 3HX4A 2K7DA 1FW4A 1TN4A 1SY9A 3OP0A 4HRHA 1R2UA 1TCFA 3EVUA 2KBIA 1SNLA 5AFPA 3KPXA 1WY9A 1F70A 2ISDA 1CDPA 1F4OA 1NIWA 2F8PA 4ORAB 4FQOA 4MLWA 4PALA 1SL7A 2ZRTA 4GFTA 2CTNA 1DGUA 5DKQA 4MRXA 2BKIB 1K90D 1TRFA 3RLZA 1AJ5A 3CGAA 2MBXA 3EKHA 1IRJA 1AJ4A 1A03A 2M7LA 1AVSA 2FCDA 1WRZA 1XFYO 2M0RA 5I8NA 1DJIA 1EJ3A 1MWNA 4JPZB 3SG5A 1XFVO 4CFRA 1J7QA 2JZIA 2BE6A 1CDNA 4BY5A 3EVVA 1QATA 1DJWA 1MUXA 2NZ0A 1CFFA 1SK6D 2M9GA 2KHNA 2KFHA 1MQ1A 1NX2A 2L50A 3AKAA 1YRTB 2L5XB 4USLA 1M46A 4L9MA 2JRFA 1TNXA 4YGBB 5KU1A 1XA5A 1QVIY 1U5IB 2MLEC 4ORBB 4CIDA 1ZUZA 2BCBA 3BOWB 3JTDB 1IQ5A 2SASA 2F2PA 2BBNA 1R6PA 2BECA 4PE0A 1H8BA 1DF0B 1YTZC 2G9BA 1W7JB 4P5OE 4XJKB 3NSOA 4C0LA 3JVTB 4ORCB 3KHEA 1EG4A 2H61C 2QPTA 4QJ4B 1YUTA 1V1FA 1PRWA 1KFXS 2LCPA 2HF5A 2JULA 2KAVA 2LP2A 2F33A 3LK1A 1NX3A 2O60A 3K21A 2LC5A 1J7PA 2LVKA 2Y4QA 2F3ZA 3DD4A 1WLZA 1PK0D 1NCXA 1V1GA 1RECA 1A2XA 1DMOA 1Y1AA 4MZJA 1J1DA 1DT7B 2Y5IA 1S3PA 4MZLA 3TUYC 1E8AA 1KSMA 1PSRA 2WCBA 4NDBA 2K7CA 1QTXA 4NDDA 1QX2A 1N65A 1K8UA 1PVBA 1MR8A 2K7OA 2LUXA 5HKYA 1G8IA 2PVBA 3CWGA 4WRIA 1JWDA 3DVMA 5CSNA 1CDLA 2HQ8A 1HT9A 4AQIA 1K9KA 1HQVA 1B47A 2LE9B 1OZSA 1BODA 1EL4A 2CCMA 1NX0A 2K0JA 2LLTA 2VRGA 1CMFA 4F0ZB 5I2QA 1DTLA 1NSHA 1S6JA 1B8RA 2OS8B 4M2OA 1NYAA 2ZKMX 2LLSA 3CR5X 1KK8B 1MXEA 2BKHB 3CLNA 3GK1A 4MRYA 3TDZA 4YRUA 1F54A 3EK4A 1SMGA 2Y1MA 4N1GA 4ETOA 2BCXA 1UWOA 1RJVA 1TOPA 3LCPC 3IQQA 3TDIA 3SIBA 1OQPA 1A75B 2ZFDA 1KQVA 1BT6A 3PALA 3O78A 3WXAA 1K93D 1SL9A 1QLKA 2K8MB 1G33A 2MA2A 2RGIA 1JBAA 1B8CA 3I5FC 4M2PA 1NWDA 1LVCD 1XO5A 4CFQA 5GQQC 3EK7A 1A4PA 1DJGA 2WCEA 1XYDA 1JSAA 4AQJA 2NXQA 5F6TA 3IQOA 3PM8A 3LK0A 1CKKA 1TNPA 2G2BA 2OPOA 3DVEA 3SG3A 5I2OA 2M49B 3OHMB 1ZOTB 3M0WA 4C0JA 2NCOA 2P6BB 1YUSA 1N2DA 1NCYA 3FS7A 1YRUB 3EVRA 5DKRA 2WNDA 2WOSA 5PALA 2CXJA 3CS1A 2WCFA 4YGAA 3BUNB 1M39A 1CM1A 1M45A 1L7ZA 3O2PA 1YR5A 1BU3A 1ZACA 2ZNEA 1S36A 3KEVA 3I5HB 3CTNA 1XFWO 4PHMA 4GPLB 1FI6A 4M2QA 3TDUA 2AUCA 2JOJA 1X02A 1Y1UA 2B1UA 1KK7Y 1UHNA 3ZWHA 1S5GY 1KSOA 2LVVA 2M29A 3VGOA 2R2IA 2KI4C 2Q4UA 4I5KA 3TUYB 3OX5A 3SJSA 2GGZA 3O4YA 2KAXA 2K2AA 2EC6C 4YGEB 4MBEA 1KFXL 4U8DA 1QVIZ 1LKJA 1S1EA 3VRRA 1UURA 4DIRA 2WC8A 3WNXB 3D10A 4OKHA 2KNEA 2LMVA 5ER4X 4OVNF 1SKTA 1KQMC 2LNKA 1J7RA 3BUMB 2KI4B 3LLEA 1YURA 2KSPA 2OS8C 1CB1A 1LA0A 3PFVA 3IF7A 3D0YA 3OB1B 2CBLA 2H61A 2PMYA 1DVIA 1QLSA 3BQ3A 1BR4B 4GUKA 4XJKA 2JWWA 4JQ0D 3EK8A 3I5GB 1H4BA 2I94A 1IJ5A 3BUOB 2KI6D 1S6IA 1RFJA 1J7OA 4N1FA 1K94A 1EG3A 3DVJA 4MN0A 1IGVA 2KDHA 2KFGA 5D69A 1QIWA 3PLFB 1LXFC 1JFKA 3CZTX 2CNPA 2GV5A 4DS7A 1BJFA 3KF9A 1KFUL 3DF0B 3CR2A 1YVLA 4GBAA 4WQ2A 2K61A 2M1UA 1IG5A 2LM5A 2L4HA 5IBWA 1Y1XA 4MVFA 1BR1B 2LMUA 1K2HA 3FWBA 1QIVA 1MHOA 2LUCA 4YGCB 4HRGA 3TS5B 1S26D 1CLLA 2WORA 3VROA 2LAPA 1QJTA 2I7AA 1TNWA 4ICBA 1TTXA 1YX7A 5HKWA 1IQ3A 4GAOA 1KK8C 1GQMA 3ZNIA 1B8LA 5BPJA 3BXKA 4IL1A 1S5GZ 2HETA 3MSEB 3TS5C 2PSRA 4DCKA 5KTYA 1RWYA 1FBVA 2LMTA 1SBJA 3O6BA 1C7VA 4D1EA 2KYCA 1WLMA 1XK4C 4MZKA 3BUXB 1WDCB 2V53A 4WQ3A 1AK8A 1J55A 1U5IA 1XVJA 2BCAA 1FPWA 2ZN9A 4DUQA 2NCPA 3F45A 4DRWA 1AHRA 5AERA 1SW8A 1CM4A 1BOCA 1YX8A 5KSZA 2JPTA 1W7IB 1DGVA 2M3WA 3WHTB 1UHHA 1YVHA 1K9UA 1XFUO 2FOTA 1M63B 2K7BA 3GOFA 4BY4A 1WDCC 2JTTA 2BL0B 2ZN8A 2E30A 4I5LB 4NDCA 1BF5A 2KOTA 1OMDA 1FI5A 2KYFA 1OMVA 2LP3A 2DOQA 1B9AA 1ALWA 5JOLA 1KK7Z 1Y6WA 1PULA 2MRDA 4GGFA 4MSPA 4QJ5B 1LINA 1JFJA 3FIAA 4FTGA 1SPYA 1OSAA 4PE1A 1K96A 3I5IC 5CPVA 1CDMA 1CTRA 1IWQA 1KCYA 5CSFA 5I2LA 5AEQA 1NCZA 2L98A 2BL0C 1C7WA 3I5GC 3I5HC 4NQGA 4P2YB 4A4CA 1BLQA 1NX1A 3LL8B 5HKZA 4CPVA 1SRAA 1UUSA 1CFPA 3HCMA 1K9PA 2LHLA 5D7FA 5G08A 4ZCVA 4R1EA 4YI9A 1SR6B 1L2OC 4OCIA 1SYMA 3D0YB 1GJYA 3JTDC 1DF0A 1JC2A 4UPGA 2LV7A 3ICBA 4PCWA 4PHJA 4C0KA 2EC6B 4HSZA 2EHBA 1LA3A 1QXPA 2MJWB 3NXAA 3NSKA 1SCVA 2M1KB 3BYAA 3NSLA 4PHKA 1IH0A 1DJZA 3VRQA 1KWOC 1CLBA 1DJYA 3GK4X 3SG6A 1XK4A 2KGRA 2M97A 2JNFA 1AUIB 1K95A 2JTZA 2OTGC 5HYDA 2KFFA 2BE4A 2KQYA 3AAKA 1S6CA 1YUUA 2NLNA 2ZRSA 4PE4A 1NPQA 1JF0A 1WRKA 1L2OB 4ZCUA 2JXCA 1SR6C 2GGMA 2JQ6A 1UHIA 1OE9B 1RTP1 2L2EA 1SCMC 1RK9A 1KWOB 1UHJA 1DJXA 4GGFC 2MHHA 3NSIA 1J1EA 3DVKA 2L0PA 1JF2A 2TN4A 2LANA 1QV1A 2COLB 5B8IB 1ZMZA 5J3XA 1UP5A 3GK2A 4Q04A 1XFZO 3SG7A 1QASA 2LHIA 1F55A 4YGDB 3TZ1A 2MAZA 1BG1A 5AANA 2I2RE 1EXRA 1B1GA 2CT9A 1EH2A 4HREE 3EKJA 4AOMA 1IJ6A 1ALVA 3JVTC 1A29A 1QS7A 1QX7A 1SCMB 1UHKA 5FYXA 2K2FA 1F4QA 2OTGB 2M8UA 2F2OA 1SL8A 3AAJA 4YI8A 2H2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU S;  5CSI A;  4OV2 A;  3BOW A;  1TNQ A;  2BBM A;  3QRX A;  4PE7 A;  2A4J A;  1B7T Y;  1QX5 B;  1TCO B;  2E6W A;  2L4I A;  1N0Y A;  3OX6 A;  1XFX O;  2JU0 A;  2Q91 A;  4GNK B;  4JWQ A;  4PDZ A;  2FJU B;  1OMR A;  1Q80 A;  4A4B A;  2JNX A;  2L51 A;  3I5I B;  2JT0 A;  3AKB A;  1KQM B;  2QAC A;  5JJG A;  3PN7 B;  1ZFS A;  2MLF C;  3SIA A;  1Y0V H;  1GGZ A;  2KGB C;  1NP8 A;  3FWC A;  4I5N B;  5HLV A;  2AMI A;  1G4Y R;  3VRP A;  3PAT A;  2O5G A;  3A8R A;  1WRL A;  1M31 A;  2FCE A;  3A4U B;  4YBH B;  1FF1 A;  1CLM A;  2ZND A;  4I5J A;  1IKU A;  4TNC A;  1QV0 A;  2KAY A;  1CMG A;  2M7N A;  1OOJ A;  1JUO A;  4MEW A;  2HQW A;  2PAL A;  1PSB A;  2JT3 A;  3WHU B;  2I18 A;  2Y1N A;  1A75 A;  3CR4 X;  2KBM A;  4PHN A;  3SG2 A;  2LVJ A;  4CLN A;  1D1O A;  3PN7 C;  2KQ6 A;  3VRN A;  2JC2 A;  1PVA A;  2KI6 C;  1CNP A;  1F71 A;  5DKN A;  2IS9 A;  1PAL A;  3KO0 A;  1OZO A;  1B4C A;  4XYN A;  2LLU A;  4GGN A;  4E68 A;  1MF8 B;  3E3R A;  5K89 A;  1AP4 A;  2JT8 A;  2D8N A;  4N5X A;  2F3Y A;  1C07 A;  4OR9 B;  1F8H A;  3PSR A;  3SG4 A;  1BMO A;  5HLO A;  1MXL C;  4QJ3 B;  1B7T Z;  2LVI A;  1RRO A;  3I5F B;  2PRU A;  1CFC A;  5ER5 A;  1TIZ A;  1GGW A;  5AXI A;  2EGD A;  1ODB A;  1VRK A;  2SCP A;  2PAS A;  3H4S E;  2JXL A;  1DJH A;  2AAO A;  5TNC A;  3RM1 A;  3BUW B;  1CFD A;  3OB2 B;  3C1V A;  5CSJ A;  1NUB A;  2HPS A;  3DF0 A;  3HX4 A;  2K7D A;  1FW4 A;  1TN4 A;  1SY9 A;  3OP0 A;  4HRH A;  1R2U A;  1TCF A;  3EVU A;  2KBI A;  1SNL A;  5AFP A;  3KPX A;  1WY9 A;  1F70 A;  2ISD A;  1CDP A;  1F4O A;  1NIW A;  2F8P A;  4ORA B;  4FQO A;  4MLW A;  4PAL A;  1SL7 A;  2ZRT A;  4GFT A;  2CTN A;  1DGU A;  5DKQ A;  4MRX A;  2BKI B;  1K90 D;  1TRF A;  3RLZ A;  1AJ5 A;  3CGA A;  2MBX A;  3EKH A;  1IRJ A;  1AJ4 A;  1A03 A;  2M7L A;  1AVS A;  2FCD A;  1WRZ A;  1XFY O;  2M0R A;  5I8N A;  1DJI A;  1EJ3 A;  1MWN A;  4JPZ B;  3SG5 A;  1XFV O;  4CFR A;  1J7Q A;  2JZI A;  2BE6 A;  1CDN A;  4BY5 A;  3EVV A;  1QAT A;  1DJW A;  1MUX A;  2NZ0 A;  1CFF A;  1SK6 D;  2M9G A;  2KHN A;  2KFH A;  1MQ1 A;  1NX2 A;  2L50 A;  3AKA A;  1YRT B;  2L5X B;  4USL A;  1M46 A;  4L9M A;  2JRF A;  1TNX A;  4YGB B;  5KU1 A;  1XA5 A;  1QVI Y;  1U5I B;  2MLE C;  4ORB B;  4CID A;  1ZUZ A;  2BCB A;  3BOW B;  3JTD B;  1IQ5 A;  2SAS A;  2F2P A;  2BBN A;  1R6P A;  2BEC A;  4PE0 A;  1H8B A;  1DF0 B;  1YTZ C;  2G9B A;  1W7J B;  4P5O E;  4XJK B;  3NSO A;  4C0L A;  3JVT B;  4ORC B;  3KHE A;  1EG4 A;  2H61 C;  2QPT A;  4QJ4 B;  1YUT A;  1V1F A;  1PRW A;  1KFX S;  2LCP A;  2HF5 A;  2JUL A;  2KAV A;  2LP2 A;  2F33 A;  3LK1 A;  1NX3 A;  2O60 A;  3K21 A;  2LC5 A;  1J7P A;  2LVK A;  2Y4Q A;  2F3Z A;  3DD4 A;  1WLZ A;  1PK0 D;  1NCX A;  1V1G A;  1REC A;  1A2X A;  1DMO A;  1Y1A A;  4MZJ A;  1J1D A;  1DT7 B;  2Y5I A;  1S3P A;  4MZL A;  3TUY C;  1E8A A;  1KSM A;  1PSR A;  2WCB A;  4NDB A;  2K7C A;  1QTX A;  4NDD A;  1QX2 A;  1N65 A;  1K8U A;  1PVB A;  1MR8 A;  2K7O A;  2LUX A;  5HKY A;  1G8I A;  2PVB A;  3CWG A;  4WRI A;  1JWD A;  3DVM A;  5CSN A;  1CDL A;  2HQ8 A;  1HT9 A;  4AQI A;  1K9K A;  1HQV A;  1B47 A;  2LE9 B;  1OZS A;  1BOD A;  1EL4 A;  2CCM A;  1NX0 A;  2K0J A;  2LLT A;  2VRG A;  1CMF A;  4F0Z B;  5I2Q A;  1DTL A;  1NSH A;  1S6J A;  1B8R A;  2OS8 B;  4M2O A;  1NYA A;  2ZKM X;  2LLS A;  3CR5 X;  1KK8 B;  1MXE A;  2BKH B;  3CLN A;  3GK1 A;  4MRY A;  3TDZ A;  4YRU A;  1F54 A;  3EK4 A;  1SMG A;  2Y1M A;  4N1G A;  4ETO A;  2BCX A;  1UWO A;  1RJV A;  1TOP A;  3LCP C;  3IQQ A;  3TDI A;  3SIB A;  1OQP A;  1A75 B;  2ZFD A;  1KQV A;  1BT6 A;  3PAL A;  3O78 A;  3WXA A;  1K93 D;  1SL9 A;  1QLK A;  2K8M B;  1G33 A;  2MA2 A;  2RGI A;  1JBA A;  1B8C A;  3I5F C;  4M2P A;  1NWD A;  1LVC D;  1XO5 A;  4CFQ A;  5GQQ C;  3EK7 A;  1A4P A;  1DJG A;  2WCE A;  1XYD A;  1JSA A;  4AQJ A;  2NXQ A;  5F6T A;  3IQO A;  3PM8 A;  3LK0 A;  1CKK A;  1TNP A;  2G2B A;  2OPO A;  3DVE A;  3SG3 A;  5I2O A;  2M49 B;  3OHM B;  1ZOT B;  3M0W A;  4C0J A;  2NCO A;  2P6B B;  1YUS A;  1N2D A;  1NCY A;  3FS7 A;  1YRU B;  3EVR A;  5DKR A;  2WND A;  2WOS A;  5PAL A;  2CXJ A;  3CS1 A;  2WCF A;  4YGA A;  3BUN B;  1M39 A;  1CM1 A;  1M45 A;  1L7Z A;  3O2P A;  1YR5 A;  1BU3 A;  1ZAC A;  2ZNE A;  1S36 A;  3KEV A;  3I5H B;  3CTN A;  1XFW O;  4PHM A;  4GPL B;  1FI6 A;  4M2Q A;  3TDU A;  2AUC A;  2JOJ A;  1X02 A;  1Y1U A;  2B1U A;  1KK7 Y;  1UHN A;  3ZWH A;  1S5G Y;  1KSO A;  2LVV A;  2M29 A;  3VGO A;  2R2I A;  2KI4 C;  2Q4U A;  4I5K A;  3TUY B;  3OX5 A;  3SJS A;  2GGZ A;  3O4Y A;  2KAX A;  2K2A A;  2EC6 C;  4YGE B;  4MBE A;  1KFX L;  4U8D A;  1QVI Z;  1LKJ A;  1S1E A;  3VRR A;  1UUR A;  4DIR A;  2WC8 A;  3WNX B;  3D10 A;  4OKH A;  2KNE A;  2LMV A;  5ER4 X;  4OVN F;  1SKT A;  1KQM C;  2LNK A;  1J7R A;  3BUM B;  2KI4 B;  3LLE A;  1YUR A;  2KSP A;  2OS8 C;  1CB1 A;  1LA0 A;  3PFV A;  3IF7 A;  3D0Y A;  3OB1 B;  2CBL A;  2H61 A;  2PMY A;  1DVI A;  1QLS A;  3BQ3 A;  1BR4 B;  4GUK A;  4XJK A;  2JWW A;  4JQ0 D;  3EK8 A;  3I5G B;  1H4B A;  2I94 A;  1IJ5 A;  3BUO B;  2KI6 D;  1S6I A;  1RFJ A;  1J7O A;  4N1F A;  1K94 A;  1EG3 A;  3DVJ A;  4MN0 A;  1IGV A;  2KDH A;  2KFG A;  5D69 A;  1QIW A;  3PLF B;  1LXF C;  1JFK A;  3CZT X;  2CNP A;  2GV5 A;  4DS7 A;  1BJF A;  3KF9 A;  1KFU L;  3DF0 B;  3CR2 A;  1YVL A;  4GBA A;  4WQ2 A;  2K61 A;  2M1U A;  1IG5 A;  2LM5 A;  2L4H A;  5IBW A;  1Y1X A;  4MVF A;  1BR1 B;  2LMU A;  1K2H A;  3FWB A;  1QIV A;  1MHO A;  2LUC A;  4YGC B;  4HRG A;  3TS5 B;  1S26 D;  1CLL A;  2WOR A;  3VRO A;  2LAP A;  1QJT A;  2I7A A;  1TNW A;  4ICB A;  1TTX A;  1YX7 A;  5HKW A;  1IQ3 A;  4GAO A;  1KK8 C;  1GQM A;  3ZNI A;  1B8L A;  5BPJ A;  3BXK A;  4IL1 A;  1S5G Z;  2HET A;  3MSE B;  3TS5 C;  2PSR A;  4DCK A;  5KTY A;  1RWY A;  1FBV A;  2LMT A;  1SBJ A;  3O6B A;  1C7V A;  4D1E A;  2KYC A;  1WLM A;  1XK4 C;  4MZK A;  3BUX B;  1WDC B;  2V53 A;  4WQ3 A;  1AK8 A;  1J55 A;  1U5I A;  1XVJ A;  2BCA A;  1FPW A;  2ZN9 A;  4DUQ A;  2NCP A;  3F45 A;  4DRW A;  1AHR A;  5AER A;  1SW8 A;  1CM4 A;  1BOC A;  1YX8 A;  5KSZ A;  2JPT A;  1W7I B;  1DGV A;  2M3W A;  3WHT B;  1UHH A;  1YVH A;  1K9U A;  1XFU O;  2FOT A;  1M63 B;  2K7B A;  3GOF A;  4BY4 A;  1WDC C;  2JTT A;  2BL0 B;  2ZN8 A;  2E30 A;  4I5L B;  4NDC A;  1BF5 A;  2KOT A;  1OMD A;  1FI5 A;  2KYF A;  1OMV A;  2LP3 A;  2DOQ A;  1B9A A;  1ALW A;  5JOL A;  1KK7 Z;  1Y6W A;  1PUL A;  2MRD A;  4GGF A;  4MSP A;  4QJ5 B;  1LIN A;  1JFJ A;  3FIA A;  4FTG A;  1SPY A;  1OSA A;  4PE1 A;  1K96 A;  3I5I C;  5CPV A;  1CDM A;  1CTR A;  1IWQ A;  1KCY A;  5CSF A;  5I2L A;  5AEQ A;  1NCZ A;  2L98 A;  2BL0 C;  1C7W A;  3I5G C;  3I5H C;  4NQG A;  4P2Y B;  4A4C A;  1BLQ A;  1NX1 A;  3LL8 B;  5HKZ A;  4CPV A;  1SRA A;  1UUS A;  1CFP A;  3HCM A;  1K9P A;  2LHL A;  5D7F A;  5G08 A;  4ZCV A;  4R1E A;  4YI9 A;  1SR6 B;  1L2O C;  4OCI A;  1SYM A;  3D0Y B;  1GJY A;  3JTD C;  1DF0 A;  1JC2 A;  4UPG A;  2LV7 A;  3ICB A;  4PCW A;  4PHJ A;  4C0K A;  2EC6 B;  4HSZ A;  2EHB A;  1LA3 A;  1QXP A;  2MJW B;  3NXA A;  3NSK A;  1SCV A;  2M1K B;  3BYA A;  3NSL A;  4PHK A;  1IH0 A;  1DJZ A;  3VRQ A;  1KWO C;  1CLB A;  1DJY A;  3GK4 X;  3SG6 A;  1XK4 A;  2KGR A;  2M97 A;  2JNF A;  1AUI B;  1K95 A;  2JTZ A;  2OTG C;  5HYD A;  2KFF A;  2BE4 A;  2KQY A;  3AAK A;  1S6C A;  1YUU A;  2NLN A;  2ZRS A;  4PE4 A;  1NPQ A;  1JF0 A;  1WRK A;  1L2O B;  4ZCU A;  2JXC A;  1SR6 C;  2GGM A;  2JQ6 A;  1UHI A;  1OE9 B;  1RTP 1;  2L2E A;  1SCM C;  1RK9 A;  1KWO B;  1UHJ A;  1DJX A;  4GGF C;  2MHH A;  3NSI A;  1J1E A;  3DVK A;  2L0P A;  1JF2 A;  2TN4 A;  2LAN A;  1QV1 A;  2COL B;  5B8I B;  1ZMZ A;  5J3X A;  1UP5 A;  3GK2 A;  4Q04 A;  1XFZ O;  3SG7 A;  1QAS A;  2LHI A;  1F55 A;  4YGD B;  3TZ1 A;  2MAZ A;  1BG1 A;  5AAN A;  2I2R E;  1EXR A;  1B1G A;  2CT9 A;  1EH2 A;  4HRE E;  3EKJ A;  4AOM A;  1IJ6 A;  1ALV A;  3JVT C;  1A29 A;  1QS7 A;  1QX7 A;  1SCM B;  1UHK A;  5FYX A;  2K2F A;  1F4Q A;  2OTG B;  2M8U A;  2F2O A;  1SL8 A;  3AAJ A;  4YI8 A;  2H2K A; 
#chains in the Genus database with same CATH topology
 1KFU S;  5CSI A;  4OV2 A;  3BOW A;  1TNQ A;  2BBM A;  3QRX A;  4INX A;  4PE7 A;  3SS5 A;  2A4J A;  1B7T Y;  1QX5 B;  1TCO B;  2E6W A;  2L4I A;  1N0Y A;  3OX6 A;  1XFX O;  2JU0 A;  2Q91 A;  4GNK B;  4JWQ A;  4F7F A;  4PDZ A;  2FJU B;  1OMR A;  1Q80 A;  4A4B A;  2JNX A;  2L51 A;  3I5I B;  2JT0 A;  3AKB A;  1KQM B;  2QAC A;  5JJG A;  3PN7 B;  1ZFS A;  2MLF C;  3SIA A;  1Y0V H;  1GGZ A;  2KGB C;  1NP8 A;  3FWC A;  4I5N B;  5HLV A;  2AMI A;  1G4Y R;  3L4A A;  3VRP A;  3PAT A;  2O5G A;  3NGV A;  3A8R A;  1WRL A;  3UO9 A;  1M31 A;  2FCE A;  3A4U B;  4YBH B;  1FF1 A;  1CLM A;  2ZND A;  4I5J A;  1IKU A;  4TNC A;  1QV0 A;  2KAY A;  1CMG A;  2M7N A;  3Q8I A;  1OOJ A;  1JUO A;  4MEW A;  2HQW A;  2PAL A;  1PSB A;  2JT3 A;  3SS3 A;  3WHU B;  1W9Z A;  2I18 A;  2Y1N A;  1A75 A;  3CR4 X;  2KBM A;  4PHN A;  3SG2 A;  2LVJ A;  4CLN A;  1D1O A;  3PN7 C;  2KQ6 A;  3VRN A;  2JC2 A;  1PVA A;  2KI6 C;  3B87 A;  1CNP A;  1F71 A;  5DKN A;  2IS9 A;  1PAL A;  3KO0 A;  1OZO A;  1B4C A;  4XYN A;  2LLU A;  4GGN A;  4E68 A;  1MF8 B;  3E3R A;  5K89 A;  1AP4 A;  2JT8 A;  2D8N A;  4N5X A;  2F3Y A;  1C07 A;  1DEK A;  4OR9 B;  1F8H A;  3PSR A;  3SG4 A;  1BMO A;  5HLO A;  2ERB A;  1MXL C;  4QJ3 B;  1B7T Z;  2LVI A;  1RRO A;  3CDN A;  3I5F B;  2PRU A;  1CFC A;  5ER5 A;  1TIZ A;  1GGW A;  5AXI A;  2EGD A;  1ODB A;  1VRK A;  2SCP A;  2PAS A;  3H4S E;  2JXL A;  1DJH A;  2AAO A;  5TNC A;  3RM1 A;  3BUW B;  1CFD A;  3OB2 B;  5HL1 A;  3C1V A;  3NHI A;  3BFH A;  3R1V A;  5CSJ A;  1NUB A;  2HPS A;  3DF0 A;  3HX4 A;  2K7D A;  1FW4 A;  1TN4 A;  1SY9 A;  3OP0 A;  4HRH A;  1R2U A;  1TCF A;  3EVU A;  4IJ7 A;  2KBI A;  1SNL A;  5AFP A;  3KPX A;  1WY9 A;  1F70 A;  2ISD A;  1CDP A;  1F4O A;  1NIW A;  2F8P A;  4ORA B;  3CZ1 A;  4FQO A;  4MLW A;  4PAL A;  1SL7 A;  3CAB A;  2ZRT A;  4GFT A;  2CTN A;  1DGU A;  5DKQ A;  4MRX A;  2BKI B;  1K90 D;  1TRF A;  3RLZ A;  1AJ5 A;  3CGA A;  2MBX A;  3EKH A;  1IRJ A;  1AJ4 A;  1A03 A;  2M7L A;  1AVS A;  2FCD A;  1WRZ A;  1XFY O;  2M0R A;  5I8N A;  1DJI A;  1EJ3 A;  1MWN A;  4JPZ B;  3SG5 A;  1XFV O;  4CFR A;  1J7Q A;  2JZI A;  2BE6 A;  1CDN A;  4BY5 A;  3EVV A;  1QAT A;  4PT1 A;  1DJW A;  1MUX A;  2NZ0 A;  1CFF A;  1SK6 D;  2M9G A;  2KHN A;  3BFA A;  2KFH A;  1MQ1 A;  1NX2 A;  1TUJ A;  2L50 A;  3AKA A;  1YRT B;  2L5X B;  4USL A;  1M46 A;  4L9M A;  2JRF A;  1TNX A;  4YGB B;  5KU1 A;  1XA5 A;  1QVI Y;  1U5I B;  2MLE C;  4ORB B;  4CID A;  1ZUZ A;  1SSE B;  2BCB A;  2BAP A;  3BOW B;  5EL2 A;  3JTD B;  1IQ5 A;  3FE9 A;  2SAS A;  2F2P A;  1OOI X;  2BBN A;  1R6P A;  2WCH A;  2BEC A;  3R1O A;  4PE0 A;  3D78 A;  1GM0 A;  1H8B A;  1DF0 B;  1YTZ C;  2G9B A;  1W7J B;  3D76 A;  4P5O E;  4XJK B;  3NSO A;  4C0L A;  3JVT B;  4ORC B;  1DC1 A;  3KHE A;  1EG4 A;  2H61 C;  2QPT A;  3QME A;  4QJ4 B;  1YUT A;  1C3Z A;  1V1F A;  1PRW A;  3CZ2 A;  1KFX S;  2LCP A;  3K1E A;  2WC6 A;  2HF5 A;  2JUL A;  2KAV A;  2LP2 A;  2F33 A;  3LK1 A;  1NX3 A;  2O60 A;  3K21 A;  2LC5 A;  1J7P A;  5I94 A;  2LVK A;  2Y4Q A;  2F3Z A;  3DD4 A;  1WLZ A;  1PK0 D;  1NCX A;  1V1G A;  1REC A;  2JPO A;  1A2X A;  1QWV A;  1DMO A;  1Y1A A;  4MZJ A;  1J1D A;  1DT7 B;  2Y5I A;  3BFB A;  1S3P A;  2WC5 A;  4MZL A;  3TUY C;  3OGN A;  1E8A A;  1KSM A;  1PSR A;  2WCB A;  4NDB A;  2PQL A;  2K7C A;  3N7H A;  1QTX A;  3O4X A;  4NDD A;  1QX2 A;  1N65 A;  1K8U A;  1PVB A;  1MR8 A;  2K7O A;  2LUX A;  1OW4 A;  1G8I A;  2PVB A;  3CWG A;  3D75 A;  5HKY A;  3VB1 A;  4WRI A;  1JWD A;  3DVM A;  5CSN A;  1CDL A;  2HQ8 A;  1HT9 A;  4AQI A;  1K9K A;  1HQV A;  1B47 A;  2LE9 B;  1OZS A;  1BOD A;  1EL4 A;  2CCM A;  1NX0 A;  2K0J A;  2LLT A;  2VRG A;  1CMF A;  4F0Z B;  5I2Q A;  3CYZ A;  1DTL A;  1NSH A;  1S6J A;  1B8R A;  2OS8 B;  3D77 A;  4M2O A;  1NYA A;  2ZKM X;  2LLS A;  3CR5 X;  1KK8 B;  1MXE A;  2BKH B;  3CLN A;  3GK1 A;  4MRY A;  3TDZ A;  4YRU A;  1F54 A;  3EK4 A;  5FI6 A;  1SMG A;  2Y1M A;  4N1G A;  4ETO A;  2BCX A;  2QEH A;  3NHT A;  3RZS A;  1UWO A;  5DIC A;  1RJV A;  1TOP A;  3LCP C;  3IQQ A;  3TDI A;  3SIB A;  1OQP A;  1T14 A;  1A75 B;  3SS4 A;  2ZFD A;  1KQV A;  1BT6 A;  3PAL A;  3O78 A;  3WXA A;  1K93 D;  1SL9 A;  1QLK A;  2K8M B;  1G33 A;  2MA2 A;  2RGI A;  1JBA A;  1B8C A;  3I5F C;  4M2P A;  3DYE A;  1NWD A;  1LVC D;  1XO5 A;  4CFQ A;  5GQQ C;  1Z2C B;  3EK7 A;  1A4P A;  1DJG A;  2WCE A;  1XYD A;  1JSA A;  4AQJ A;  2NXQ A;  5F6T A;  3IQO A;  3PM8 A;  3LK0 A;  2H8V A;  1TNP A;  1CKK A;  2G2B A;  2OPO A;  3DVE A;  3SG3 A;  1TUZ A;  5I2O A;  2M49 B;  3OHM B;  1ZOT B;  3M0W A;  4C0J A;  2NCO A;  2P6B B;  1YUS A;  1N2D A;  1NCY A;  3FS7 A;  1YRU B;  2BNX A;  3EVR A;  5DKR A;  2WND A;  2WOS A;  5PAL A;  2CXJ A;  3CS1 A;  2WCF A;  4YGA A;  3OBV A;  3BUN B;  1M39 A;  1CM1 A;  1M45 A;  1L7Z A;  2PYQ A;  3O2P A;  2WCK A;  1YR5 A;  1BU3 A;  2GTE A;  1LS8 A;  1ZAC A;  2ZNE A;  1S36 A;  3KEV A;  3I5H B;  3CTN A;  1XFW O;  4PHM A;  3R72 A;  3FE6 A;  4GPL B;  1FI6 A;  4M2Q A;  3TDU A;  2AUC A;  2JOJ A;  1X02 A;  1Y1U A;  2B1U A;  1KK7 Y;  1UHN A;  3ZWH A;  1S5G Y;  1KSO A;  2LVV A;  2M29 A;  3VGO A;  2R2I A;  2KI4 C;  4INW A;  3EG5 B;  2Q4U A;  4I5K A;  3TUY B;  3OX5 A;  3SJS A;  2GGZ A;  3O4Y A;  2KAX A;  2K2A A;  2EC6 C;  4YGE B;  4MBE A;  1KFX L;  4U8D A;  1QVI Z;  1LKJ A;  1S1E A;  3VRR A;  3PM2 A;  1UUR A;  4KYN A;  1XFR A;  4DIR A;  2WC8 A;  3WNX B;  3D10 A;  4OKH A;  2WCM A;  2KNE A;  2LMV A;  5ER4 X;  2FJY A;  4OVN F;  1SKT A;  1KQM C;  2LNK A;  1J7R A;  3BUM B;  2KI4 B;  3LLE A;  1YUR A;  2KSP A;  2OS8 C;  1CB1 A;  1LA0 A;  1P28 A;  3IF7 A;  3D0Y A;  3L47 A;  3OB1 B;  3PFV A;  2CBL A;  2H61 A;  3S0B A;  2PMY A;  1DVI A;  1QLS A;  3BQ3 A;  1BR4 B;  4GUK A;  4XJK A;  2QEV A;  2JWW A;  4JQ0 D;  3EK8 A;  3I5G B;  1H4B A;  2I94 A;  2QEO A;  1IJ5 A;  3BUO B;  2KI6 D;  1S6I A;  3S0F A;  1RFJ A;  1J7O A;  4N1F A;  1K94 A;  1EG3 A;  3DVJ A;  4MN0 A;  1IGV A;  2KDH A;  2KFG A;  5D69 A;  1QIW A;  3PLF B;  1LXF C;  1JFK A;  3CZT X;  2CNP A;  2GV5 A;  4DS7 A;  1BJF A;  3KF9 A;  1KFU L;  2L2C A;  1TWO A;  3DF0 B;  3CR2 A;  1YVL A;  4GBA A;  4WQ2 A;  2K61 A;  2M1U A;  3FE8 A;  1IG5 A;  2LM5 A;  1OOF A;  2L4H A;  5IBW A;  1C3Y A;  1Y1X A;  4MVF A;  1BR1 B;  2LMU A;  1K2H A;  3FWB A;  1QIV A;  3IVT A;  1MHO A;  2LUC A;  2QDI A;  4YGC B;  3D73 A;  4HRG A;  3TS5 B;  1S26 D;  1CLL A;  2WOR A;  3VRO A;  1ORG A;  2LAP A;  1QJT A;  1DQE A;  3L4L A;  2I7A A;  2K60 A;  1TNW A;  3BJH A;  4ICB A;  1TTX A;  1YX7 A;  5HKW A;  1IQ3 A;  4GAO A;  1KK8 C;  1GQM A;  3ZNI A;  1B8L A;  3S0D A;  2KPH A;  5BPJ A;  3BXK A;  4IL1 A;  1S5G Z;  4JD9 A;  2HET A;  3MSE B;  3TS5 C;  2PSR A;  4DCK A;  5KTY A;  1RWY A;  1FBV A;  2LMT A;  1SBJ A;  3O6B A;  1C7V A;  4D1E A;  2KYC A;  1WLM A;  1XK4 C;  4MZK A;  3BUX B;  1WDC B;  2V53 A;  4WQ3 A;  1AK8 A;  1J55 A;  1U5I A;  1XVJ A;  2BCA A;  1FPW A;  2ZN9 A;  4DUQ A;  2NCP A;  3B6X A;  1OOH A;  3F45 A;  4DRW A;  1AHR A;  5AER A;  1SW8 A;  1CM4 A;  1BOC A;  1YX8 A;  5KSZ A;  2JPT A;  1W7I B;  1DGV A;  2M3W A;  3WHT B;  1UHH A;  1YVH A;  1K9U A;  1XFU O;  2FOT A;  1M63 B;  2K7B A;  1OOG A;  3GOF A;  4BY4 A;  1WDC C;  2JTT A;  2BL0 B;  2ZN8 A;  2E30 A;  4I5L B;  4NDC A;  4FQT A;  1BF5 A;  2KOT A;  1OMD A;  2P71 A;  5FI7 A;  2KYF A;  1OMV A;  2LP3 A;  1FI5 A;  2DOQ A;  1B9A A;  1ALW A;  4JKT A;  4OZD A;  1KK7 Z;  1Y6W A;  1PUL A;  2MRD A;  4GGF A;  4MSP A;  3DZT A;  1LIN A;  5JOL A;  4QJ5 B;  1JFJ A;  3FIA A;  4FTG A;  1SPY A;  1OSA A;  2P70 A;  4PE1 A;  1K96 A;  3I5I C;  5CPV A;  1CDM A;  1CTR A;  1IWQ A;  1KCY A;  5CSF A;  3B88 A;  5I2L A;  5AEQ A;  1NCZ A;  2L98 A;  2BL0 C;  1C7W A;  3I5G C;  3I5H C;  4NQG A;  4P2Y B;  4A4C A;  3PJI A;  1BLQ A;  1NX1 A;  3LL8 B;  5HKZ A;  4CPV A;  1SRA A;  1UUS A;  1Z4H A;  1CFP A;  3HCM A;  1K9P A;  2LHL A;  5D7F A;  5G08 A;  4ZCV A;  4R1E A;  2QEB A;  3S0G A;  4YI9 A;  1SR6 B;  1L2O C;  4OCI A;  1SYM A;  3D0Y B;  1GJY A;  1IIO A;  3JTD C;  1DF0 A;  1JC2 A;  4UPG A;  2LV7 A;  3ICB A;  4PCW A;  4PHJ A;  4C0K A;  2EC6 B;  4HSZ A;  2EHB A;  1LA3 A;  1QXP A;  2MJW B;  3NXA A;  3NSK A;  1SCV A;  2M1K B;  3BYA A;  3NSL A;  4PHK A;  1IH0 A;  1DJZ A;  3VRQ A;  1KWO C;  1CLB A;  1DJY A;  2KLD A;  3GK4 X;  3SG6 A;  1XK4 A;  2KGR A;  2M97 A;  2JNF A;  1AUI B;  1K95 A;  2JTZ A;  2OTG C;  3D74 A;  5HYD A;  2KFF A;  2BE4 A;  2KQY A;  3AAK A;  1S6C A;  1YUU A;  2NLN A;  2ZRS A;  4PE4 A;  1NPQ A;  1JF0 A;  1WRK A;  1L2O B;  4ZCU A;  2JXC A;  1SR6 C;  2GGM A;  2JQ6 A;  3DXL A;  1UHI A;  1OE9 B;  1RTP 1;  2L2E A;  1SCM C;  1RK9 A;  1KWO B;  1UHJ A;  1DJX A;  2WCL A;  4GGF C;  2MHH A;  3NSI A;  1J1E A;  3V2L A;  3DVK A;  2L0P A;  1JF2 A;  2TN4 A;  2LAN A;  2YGU A;  1QV1 A;  2COL B;  5B8I B;  3R1P A;  1ZMZ A;  5J3X A;  1UP5 A;  3GK2 A;  3UNW A;  4Q04 A;  1XFZ O;  3S0A A;  3SG7 A;  1QAS A;  2LHI A;  1F55 A;  4YGD B;  2L5Y A;  3TZ1 A;  2MAZ A;  1BG1 A;  5FI2 A;  5AAN A;  2I2R E;  1EXR A;  1B1G A;  2CT9 A;  3B7A A;  5D3O A;  4HRE E;  1EH2 A;  3EKJ A;  4AOM A;  1IJ6 A;  1ALV A;  3JVT C;  1A29 A;  1QS7 A;  1QX7 A;  1SCM B;  1UHK A;  3CZ0 A;  5FYX A;  2K2F A;  3S0E A;  1F4Q A;  2KLE A;  2OTG B;  2M8U A;  2F2O A;  1SL8 A;  3AAJ A;  2WCJ A;  4YI8 A;  1DEL A;  2H2K A;  3B86 A;  3DY9 A; 
#chains in the Genus database with same CATH homology
 1KFU S;  5CSI A;  4OV2 A;  3BOW A;  1TNQ A;  2BBM A;  3QRX A;  4PE7 A;  2A4J A;  1B7T Y;  1QX5 B;  1TCO B;  2E6W A;  2L4I A;  1N0Y A;  3OX6 A;  1XFX O;  2JU0 A;  2Q91 A;  4GNK B;  4JWQ A;  4PDZ A;  2FJU B;  1OMR A;  1Q80 A;  4A4B A;  2JNX A;  2L51 A;  3I5I B;  2JT0 A;  3AKB A;  1KQM B;  2QAC A;  5JJG A;  3PN7 B;  1ZFS A;  2MLF C;  3SIA A;  1Y0V H;  1GGZ A;  2KGB C;  1NP8 A;  3FWC A;  4I5N B;  5HLV A;  2AMI A;  1G4Y R;  3VRP A;  3PAT A;  2O5G A;  3A8R A;  1WRL A;  1M31 A;  2FCE A;  3A4U B;  4YBH B;  1FF1 A;  1CLM A;  2ZND A;  4I5J A;  1IKU A;  4TNC A;  1QV0 A;  2KAY A;  1CMG A;  2M7N A;  1OOJ A;  1JUO A;  4MEW A;  2HQW A;  2PAL A;  1PSB A;  2JT3 A;  3WHU B;  2I18 A;  2Y1N A;  1A75 A;  3CR4 X;  2KBM A;  4PHN A;  3SG2 A;  2LVJ A;  4CLN A;  1D1O A;  3PN7 C;  2KQ6 A;  3VRN A;  2JC2 A;  1PVA A;  2KI6 C;  1CNP A;  1F71 A;  5DKN A;  2IS9 A;  1PAL A;  3KO0 A;  1OZO A;  1B4C A;  4XYN A;  2LLU A;  4GGN A;  4E68 A;  1MF8 B;  3E3R A;  5K89 A;  1AP4 A;  2JT8 A;  2D8N A;  4N5X A;  2F3Y A;  1C07 A;  4OR9 B;  1F8H A;  3PSR A;  3SG4 A;  1BMO A;  5HLO A;  1MXL C;  4QJ3 B;  1B7T Z;  2LVI A;  1RRO A;  3I5F B;  2PRU A;  1CFC A;  5ER5 A;  1TIZ A;  1GGW A;  5AXI A;  2EGD A;  1ODB A;  1VRK A;  2SCP A;  2PAS A;  3H4S E;  2JXL A;  1DJH A;  2AAO A;  5TNC A;  3RM1 A;  3BUW B;  1CFD A;  3OB2 B;  3C1V A;  5CSJ A;  1NUB A;  2HPS A;  3DF0 A;  3HX4 A;  2K7D A;  1FW4 A;  1TN4 A;  1SY9 A;  3OP0 A;  4HRH A;  1R2U A;  1TCF A;  3EVU A;  2KBI A;  1SNL A;  5AFP A;  3KPX A;  1WY9 A;  1F70 A;  2ISD A;  1CDP A;  1F4O A;  1NIW A;  2F8P A;  4ORA B;  4FQO A;  4MLW A;  4PAL A;  1SL7 A;  2ZRT A;  4GFT A;  2CTN A;  1DGU A;  5DKQ A;  4MRX A;  2BKI B;  1K90 D;  1TRF A;  3RLZ A;  1AJ5 A;  3CGA A;  2MBX A;  3EKH A;  1IRJ A;  1AJ4 A;  1A03 A;  2M7L A;  1AVS A;  2FCD A;  1WRZ A;  1XFY O;  2M0R A;  5I8N A;  1DJI A;  1EJ3 A;  1MWN A;  4JPZ B;  3SG5 A;  1XFV O;  4CFR A;  1J7Q A;  2JZI A;  2BE6 A;  1CDN A;  4BY5 A;  3EVV A;  1QAT A;  1DJW A;  1MUX A;  2NZ0 A;  1CFF A;  1SK6 D;  2M9G A;  2KHN A;  2KFH A;  1MQ1 A;  1NX2 A;  2L50 A;  3AKA A;  1YRT B;  2L5X B;  4USL A;  1M46 A;  4L9M A;  2JRF A;  1TNX A;  4YGB B;  5KU1 A;  1XA5 A;  1QVI Y;  1U5I B;  2MLE C;  4ORB B;  4CID A;  1ZUZ A;  2BCB A;  3BOW B;  3JTD B;  1IQ5 A;  2SAS A;  2F2P A;  2BBN A;  1R6P A;  2BEC A;  4PE0 A;  1H8B A;  1DF0 B;  1YTZ C;  2G9B A;  1W7J B;  4P5O E;  4XJK B;  3NSO A;  4C0L A;  3JVT B;  4ORC B;  3KHE A;  1EG4 A;  2H61 C;  2QPT A;  4QJ4 B;  1YUT A;  1V1F A;  1PRW A;  1KFX S;  2LCP A;  2HF5 A;  2JUL A;  2KAV A;  2LP2 A;  2F33 A;  3LK1 A;  1NX3 A;  2O60 A;  3K21 A;  2LC5 A;  1J7P A;  2LVK A;  2Y4Q A;  2F3Z A;  3DD4 A;  1WLZ A;  1PK0 D;  1NCX A;  1V1G A;  1REC A;  1A2X A;  1DMO A;  1Y1A A;  4MZJ A;  1J1D A;  1DT7 B;  2Y5I A;  1S3P A;  4MZL A;  3TUY C;  1E8A A;  1KSM A;  1PSR A;  2WCB A;  4NDB A;  2K7C A;  1QTX A;  4NDD A;  1QX2 A;  1N65 A;  1K8U A;  1PVB A;  1MR8 A;  2K7O A;  2LUX A;  5HKY A;  1G8I A;  2PVB A;  3CWG A;  4WRI A;  1JWD A;  3DVM A;  5CSN A;  1CDL A;  2HQ8 A;  1HT9 A;  4AQI A;  1K9K A;  1HQV A;  1B47 A;  2LE9 B;  1OZS A;  1BOD A;  1EL4 A;  2CCM A;  1NX0 A;  2K0J A;  2LLT A;  2VRG A;  1CMF A;  4F0Z B;  5I2Q A;  1DTL A;  1NSH A;  1S6J A;  1B8R A;  2OS8 B;  4M2O A;  1NYA A;  2ZKM X;  2LLS A;  3CR5 X;  1KK8 B;  1MXE A;  2BKH B;  3CLN A;  3GK1 A;  4MRY A;  3TDZ A;  4YRU A;  1F54 A;  3EK4 A;  1SMG A;  2Y1M A;  4N1G A;  4ETO A;  2BCX A;  1UWO A;  1RJV A;  1TOP A;  3LCP C;  3IQQ A;  3TDI A;  3SIB A;  1OQP A;  1A75 B;  2ZFD A;  1KQV A;  1BT6 A;  3PAL A;  3O78 A;  3WXA A;  1K93 D;  1SL9 A;  1QLK A;  2K8M B;  1G33 A;  2MA2 A;  2RGI A;  1JBA A;  1B8C A;  3I5F C;  4M2P A;  1NWD A;  1LVC D;  1XO5 A;  4CFQ A;  5GQQ C;  3EK7 A;  1A4P A;  1DJG A;  2WCE A;  1XYD A;  1JSA A;  4AQJ A;  2NXQ A;  5F6T A;  3IQO A;  3PM8 A;  3LK0 A;  1CKK A;  1TNP A;  2G2B A;  2OPO A;  3DVE A;  3SG3 A;  5I2O A;  2M49 B;  3OHM B;  1ZOT B;  3M0W A;  4C0J A;  2NCO A;  2P6B B;  1YUS A;  1N2D A;  1NCY A;  3FS7 A;  1YRU B;  3EVR A;  5DKR A;  2WND A;  2WOS A;  5PAL A;  2CXJ A;  3CS1 A;  2WCF A;  4YGA A;  3BUN B;  1M39 A;  1CM1 A;  1M45 A;  1L7Z A;  3O2P A;  1YR5 A;  1BU3 A;  1ZAC A;  2ZNE A;  1S36 A;  3KEV A;  3I5H B;  3CTN A;  1XFW O;  4PHM A;  4GPL B;  1FI6 A;  4M2Q A;  3TDU A;  2AUC A;  2JOJ A;  1X02 A;  1Y1U A;  2B1U A;  1KK7 Y;  1UHN A;  3ZWH A;  1S5G Y;  1KSO A;  2LVV A;  2M29 A;  3VGO A;  2R2I A;  2KI4 C;  2Q4U A;  4I5K A;  3TUY B;  3OX5 A;  3SJS A;  2GGZ A;  3O4Y A;  2KAX A;  2K2A A;  2EC6 C;  4YGE B;  4MBE A;  1KFX L;  4U8D A;  1QVI Z;  1LKJ A;  1S1E A;  3VRR A;  1UUR A;  4DIR A;  2WC8 A;  3WNX B;  3D10 A;  4OKH A;  2KNE A;  2LMV A;  5ER4 X;  4OVN F;  1SKT A;  1KQM C;  2LNK A;  1J7R A;  3BUM B;  2KI4 B;  3LLE A;  1YUR A;  2KSP A;  2OS8 C;  1CB1 A;  1LA0 A;  3PFV A;  3IF7 A;  3D0Y A;  3OB1 B;  2CBL A;  2H61 A;  2PMY A;  1DVI A;  1QLS A;  3BQ3 A;  1BR4 B;  4GUK A;  4XJK A;  2JWW A;  4JQ0 D;  3EK8 A;  3I5G B;  1H4B A;  2I94 A;  1IJ5 A;  3BUO B;  2KI6 D;  1S6I A;  1RFJ A;  1J7O A;  4N1F A;  1K94 A;  1EG3 A;  3DVJ A;  4MN0 A;  1IGV A;  2KDH A;  2KFG A;  5D69 A;  1QIW A;  3PLF B;  1LXF C;  1JFK A;  3CZT X;  2CNP A;  2GV5 A;  4DS7 A;  1BJF A;  3KF9 A;  1KFU L;  3DF0 B;  3CR2 A;  1YVL A;  4GBA A;  4WQ2 A;  2K61 A;  2M1U A;  1IG5 A;  2LM5 A;  2L4H A;  5IBW A;  1Y1X A;  4MVF A;  1BR1 B;  2LMU A;  1K2H A;  3FWB A;  1QIV A;  1MHO A;  2LUC A;  4YGC B;  4HRG A;  3TS5 B;  1S26 D;  1CLL A;  2WOR A;  3VRO A;  2LAP A;  1QJT A;  2I7A A;  1TNW A;  4ICB A;  1TTX A;  1YX7 A;  5HKW A;  1IQ3 A;  4GAO A;  1KK8 C;  1GQM A;  3ZNI A;  1B8L A;  5BPJ A;  3BXK A;  4IL1 A;  1S5G Z;  2HET A;  3MSE B;  3TS5 C;  2PSR A;  4DCK A;  5KTY A;  1RWY A;  1FBV A;  2LMT A;  1SBJ A;  3O6B A;  1C7V A;  4D1E A;  2KYC A;  1WLM A;  1XK4 C;  4MZK A;  3BUX B;  1WDC B;  2V53 A;  4WQ3 A;  1AK8 A;  1J55 A;  1U5I A;  1XVJ A;  2BCA A;  1FPW A;  2ZN9 A;  4DUQ A;  2NCP A;  3F45 A;  4DRW A;  1AHR A;  5AER A;  1SW8 A;  1CM4 A;  1BOC A;  1YX8 A;  5KSZ A;  2JPT A;  1W7I B;  1DGV A;  2M3W A;  3WHT B;  1UHH A;  1YVH A;  1K9U A;  1XFU O;  2FOT A;  1M63 B;  2K7B A;  3GOF A;  4BY4 A;  1WDC C;  2JTT A;  2BL0 B;  2ZN8 A;  2E30 A;  4I5L B;  4NDC A;  1BF5 A;  2KOT A;  1OMD A;  1FI5 A;  2KYF A;  1OMV A;  2LP3 A;  2DOQ A;  1B9A A;  1ALW A;  5JOL A;  1KK7 Z;  1Y6W A;  1PUL A;  2MRD A;  4GGF A;  4MSP A;  4QJ5 B;  1LIN A;  1JFJ A;  3FIA A;  4FTG A;  1SPY A;  1OSA A;  4PE1 A;  1K96 A;  3I5I C;  5CPV A;  1CDM A;  1CTR A;  1IWQ A;  1KCY A;  5CSF A;  5I2L A;  5AEQ A;  1NCZ A;  2L98 A;  2BL0 C;  1C7W A;  3I5G C;  3I5H C;  4NQG A;  4P2Y B;  4A4C A;  1BLQ A;  1NX1 A;  3LL8 B;  5HKZ A;  4CPV A;  1SRA A;  1UUS A;  1CFP A;  3HCM A;  1K9P A;  2LHL A;  5D7F A;  5G08 A;  4ZCV A;  4R1E A;  4YI9 A;  1SR6 B;  1L2O C;  4OCI A;  1SYM A;  3D0Y B;  1GJY A;  3JTD C;  1DF0 A;  1JC2 A;  4UPG A;  2LV7 A;  3ICB A;  4PCW A;  4PHJ A;  4C0K A;  2EC6 B;  4HSZ A;  2EHB A;  1LA3 A;  1QXP A;  2MJW B;  3NXA A;  3NSK A;  1SCV A;  2M1K B;  3BYA A;  3NSL A;  4PHK A;  1IH0 A;  1DJZ A;  3VRQ A;  1KWO C;  1CLB A;  1DJY A;  3GK4 X;  3SG6 A;  1XK4 A;  2KGR A;  2M97 A;  2JNF A;  1AUI B;  1K95 A;  2JTZ A;  2OTG C;  5HYD A;  2KFF A;  2BE4 A;  2KQY A;  3AAK A;  1S6C A;  1YUU A;  2NLN A;  2ZRS A;  4PE4 A;  1NPQ A;  1JF0 A;  1WRK A;  1L2O B;  4ZCU A;  2JXC A;  1SR6 C;  2GGM A;  2JQ6 A;  1UHI A;  1OE9 B;  1RTP 1;  2L2E A;  1SCM C;  1RK9 A;  1KWO B;  1UHJ A;  1DJX A;  4GGF C;  2MHH A;  3NSI A;  1J1E A;  3DVK A;  2L0P A;  1JF2 A;  2TN4 A;  2LAN A;  1QV1 A;  2COL B;  5B8I B;  1ZMZ A;  5J3X A;  1UP5 A;  3GK2 A;  4Q04 A;  1XFZ O;  3SG7 A;  1QAS A;  2LHI A;  1F55 A;  4YGD B;  3TZ1 A;  2MAZ A;  1BG1 A;  5AAN A;  2I2R E;  1EXR A;  1B1G A;  2CT9 A;  1EH2 A;  4HRE E;  3EKJ A;  4AOM A;  1IJ6 A;  1ALV A;  3JVT C;  1A29 A;  1QS7 A;  1QX7 A;  1SCM B;  1UHK A;  5FYX A;  2K2F A;  1F4Q A;  2OTG B;  2M8U A;  2F2O A;  1SL8 A;  3AAJ A;  4YI8 A;  2H2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...