2L50A

Solution structure of apo s100a16
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l50A00
1SW8A 3FWCA 4A4CA 1NYAA 1JBAA 1EG4A 1F70A 2JXCA 2DOQA 1LXFC 1A75B 3IF7A 1AJ4A 1SMGA 5KU1A 3TUYB 1KQVA 2GGZA 1DGVA 2JQ6A 1LINA 1CLBA 1TN4A 2G2BA 4MZKA 2Q91A 1KCYA 5TNCA 1QX2A 2KSPA 2L4HA 1XFWO 2L98A 1OMRA 1SR6B 1QXPA 2KQ6A 4MRYA 4ORBB 3NSLA 1L7ZA 1NCYA 2AMIA 2MBXA 3BUMB 2IS9A 2M1KB 1DGUA 1JFKA 1TRFA 1A4PA 3LK0A 2ZN9A 1ALVA 3OX6A 4M2OA 1XFVO 1B47A 2JT8A 1KFUL 2KAXA 4GGNA 1HT9A 3RLZA 5F6TA 1KQMC 1SL7A 1QIWA 1CFFA 1NX2A 1IH0A 5CSJA 4YGBB 1F55A 5PALA 4UPGA 2WNDA 1EL4A 1XFUO 2LUCA 2QPTA 4YBHB 2BKIB 3PLFB 2MLEC 1BLQA 2ZN8A 3DF0A 1ZACA 3OB2B 4NDCA 1V1GA 3EVVA 3HCMA 3VROA 1QASA 2WCBA 1PALA 1IQ3A 4IL1A 1XK4C 2L51A 3NSIA 2KI4B 2M1UA 1TCOB 2M0RA 5GQQC 4GGFA 1SL9A 2OS8C 2BKHB 1F54A 2EGDA 4I5LB 3DVMA 1NPQA 1MXEA 2WCEA 2I2RE 5AEQA 3I5FC 4WRIA 1FF1A 4MVFA 1M39A 3BUXB 1L2OB 1Y1UA 1QS7A 1AJ5A 1G4YR 4CIDA 5HKYA 1CKKA 2PMYA 1RROA 4D1EA 2LE9B 1NIWA 2LC5A 3I5HC 5AERA 3D10A 2I18A 2HETA 2LHIA 1MUXA 1Y0VH 1X02A 1XO5A 4NQGA 5DKNA 2K7BA 4I5NB 1AUIB 1QJTA 1W7JB 2O5GA 3EVRA 3RM1A 1ZFSA 1RK9A 5I8NA 1DJGA 5I2OA 4PE0A 4PCWA 1NWDA 1GQMA 2LMTA 2G9BA 3IQOA 1OMDA 4ICBA 1WRZA 1FI6A 3E3RA 1BJFA 3TDIA 2LP3A 2L50A 2L0PA 1SKTA 2BCBA 2Y5IA 2F2PA 4QJ3B 2A4JA 1H4BA 5CSNA 2F8PA 4MRXA 1G33A 1IWQA 2KBMA 2KGRA 1LA3A 1QV1A 1F8HA 3BQ3A 1JWDA 3WHTB 2M9GA 3DF0B 1SCVA 3EKJA 1KSOA 5DKRA 4XYNA 4FQOA 5K89A 1XA5A 2I94A 3O78A 2COLB 4YGDB 1AK8A 3CWGA 4PALA 2H61A 2KYCA 3JVTC 3AKBA 3O6BA 3NXAA 1NP8A 1W7IB 1KK7Z 1QIVA 5HLOA 1XYDA 2FJUB 2K2AA 5JOLA 4DCKA 1YTZC 4Q04A 4AQJA 2LM5A 1U5IB 2JNXA 3F45A 5D7FA 4FTGA 2KAVA 4F0ZB 1CFCA 1ODBA 4MEWA 1BT6A 1RTP1 1ZUZA 2MHHA 1MWNA 4N1FA 2HPSA 1WY9A 1WDCC 3CZTX 1EXRA 2WOSA 1IRJA 2NCOA 4MZJA 4E68A 1CDNA 1R2UA 2EC6C 2JT3A 3EKHA 4C0KA 1UHKA 1EH2A 2LLUA 3PN7C 1SYMA 4WQ2A 4XJKB 5HKWA 1K95A 4DUQA 3TS5C 1GGZA 2JPTA 2EHBA 1RJVA 2LAPA 2MAZA 2M97A 3CR4X 2KI6C 4GAOA 4PHKA 3EK4A 2OTGB 2BL0C 2BE4A 4PE7A 5CSIA 1J7PA 3GK4X 3I5GC 1GJYA 2KQYA 3KEVA 1CLMA 1C7VA 1B8RA 1TNXA 1NX0A 1XVJA 1OQPA 1YVHA 2LNKA 4GFTA 5I2LA 1MR8A 5G08A 1SY9A 1B7TZ 2B1UA 1WLMA 2LLTA 1CMGA 1IGVA 1KQMB 2H61C 1BF5A 1BOCA 2SCPA 1F4QA 1WRKA 2ISDA 2MJWB 1K96A 1KK7Y 2KAYA 1JF2A 2M3WA 3BOWB 3KHEA 2LVKA 4NDBA 1YRUB 2M29A 1EG3A 5DKQA 4CLNA 1K2HA 1B8CA 2F3YA 1S36A 1YVLA 3BXKA 4P2YB 1KK8C 3KPXA 3GOFA 1OOJA 4N5XA 2KHNA 3WNXB 1M63B 1YUTA 1MXLC 1Q80A 4YI8A 1WLZA 1YRTB 1KWOC 2ZNEA 1DJXA 2PSRA 5D69A 2OS8B 2BE6A 2LANA 4TNCA 1BMOA 4HREE 3ZWHA 3SG5A 1S6IA 4ZCUA 3I5FB 1BR4B 1FI5A 1TNPA 1DJHA 3VRNA 2LMVA 4DS7A 3HX4A 2NXQA 4WQ3A 1QVIZ 1SPYA 3DD4A 2HF5A 2PASA 4MBEA 4OVNF 3SJSA 4CFQA 1QX5B 1N2DA 1D1OA 3WHUB 1QV0A 3D0YA 3I5HB 4HSZA 3NSOA 1UHJA 4CFRA 1NSHA 1QATA 1PRWA 4OR9B 4PHJA 2CNPA 2O60A 2LP2A 2LVJA 4JPZB 2LCPA 1GGWA 1K9UA 2JT0A 4GBAA 3NSKA 2JU0A 1B7TY 5HKZA 2FCEA 1R6PA 4BY5A 2JXLA 2CXJA 1SK6D 1DVIA 1CM1A 4R1EA 3SIBA 2Y1MA 2GV5A 3AAJA 1WRLA 3EK8A 4GPLB 4ORAB 1YX8A 1S5GY 2PVBA 3CR2A 2LVVA 3SG6A 2WC8A 1IKUA 4YI9A 1E8AA 1K9KA 3KO0A 4OV2A 1CFPA 3MSEB 1TOPA 3CTNA 3OP0A 1B4CA 5AFPA 3DVEA 1H8BA 1S26D 1NX3A 2F2OA 2AAOA 2ZRSA 1J55A 3H4SE 3JTDC 3ICBA 1PVBA 1QTXA 3CLNA 2F33A 3BUOB 3LLEA 3OB1B 1MQ1A 2E6WA 4I5KA 4ZCVA 1JF0A 5J3XA 1J1DA 3I5IB 2K7OA 2K7CA 1S6CA 5AXIA 2GGMA 1A29A 2K7DA 3JVTB 1PSBA 1SCMC 1RWYA 1CTRA 3PSRA 5CPVA 1M46A 3CGAA 1BU3A 4M2PA 1IQ5A 4ORCB 2P6BB 3A4UB 1FPWA 2F3ZA 3SG4A 1VRKA 1QVIY 2JWWA 3LK1A 5IBWA 1NUBA 2Q4UA 2LVIA 1YX7A 2JRFA 1UWOA 1YURA 1G8IA 1QLSA 1CNPA 1S1EA 4PE1A 3SG2A 2JOJA 1KSMA 1DF0A 4MN0A 1WDCB 1B9AA 3O2PA 3D0YB 1CDMA 3LL8B 1PK0D 2EC6B 1TIZA 3BUNB 1K9PA 5BPJA 4MZLA 5ER4X 5FYXA 3PN7B 4N1GA 1EJ3A 4JWQA 1KFXS 1SRAA 2L5XB 4C0LA 1LVCD 4U8DA 5CSFA 3TUYC 1CB1A 3TS5B 4PDZA 1K90D 1BG1A 1A03A 3AAKA 1IJ5A 1CFDA 3ZNIA 1Y1AA 1HQVA 1IJ6A 2SASA 4BY4A 1SR6C 2ZNDA 1TCFA 3DVKA 1IG5A 4OKHA 3CR5X 2BL0B 3OHMB 2LLSA 2I7AA 3VGOA 1OMVA 1J7OA 3I5GB 2OTGC 1UHHA 1NX1A 1FW4A 2BCAA 3VRRA 2MLFC 4YGCB 1SBJA 1M31A 1DJIA 1UP5A 1XFYO 2KFFA 3SG7A 2KI6D 1PVAA 1FBVA 1S5GZ 1Y1XA 1DMOA 1OSAA 1BODA 1NCZA 1CDPA 2KOTA 2H2KA 2NLNA 2JTZA 2M49B 4JQ0D 2NCPA 1J7RA 4P5OE 1A2XA 1KFUS 1DJWA 2PRUA 1DTLA 4MSPA 1TNWA 1C7WA 2HQWA 2BECA 4PE4A 1UHIA 2ZKMX 2BBNA 3TDZA 1KK8B 1XFXO 2KI4C 2JULA 4PHMA 4AQIA 4QJ5B 1SL8A 1OZSA 4HRHA 3C1VA 4I5JA 4CPVA 1PSRA 5AANA 2ZRTA 2RGIA 1KWOB 1TTXA 2JNFA 2R2IA 4DRWA 1ZOTB 4NDDA 2TN4A 2KFHA 1CMFA 2WORA 5JJGA 3K21A 2HQ8A 1DF0B 4C0JA 5ER5A 1L2OC 2FOTA 1U5IA 3FS7A 1JSAA 4HRGA 2FCDA 1ZMZA 4GNKB 4OCIA 1DT7B 1YR5A 1UUSA 1SNLA 1DJYA 2ZFDA 3SIAA 4MLWA 1JC2A 1DJZA 2QACA 2WCFA 2E30A 1OZOA 1JFJA 5KSZA 3WXAA 3M0WA 3EK7A 3CS1A 2K0JA 1QLKA 1B8LA 3LCPC 3PM8A 1LA0A 1MHOA 4YGAA 1AVSA 1A75A 2LV7A 2KGBC 3FWBA 3PFVA 3TDUA 1K93D 3O4YA 3QRXA 2JC2A 4XJKA 4USLA 2LHLA 4M2QA 3BUWB 3BYAA 2CBLA 1S6JA 1CM4A 2KNEA 5I2QA 2KYFA 2AUCA 2KBIA 2PALA 1V1FA 3PATA 3SG3A 1J7QA 1YUSA 1N65A 2KFGA 3DVJA 3KF9A 4GUKA 1F4OA 2V53A 1UURA 2Y4QA 1OE9B 3OX5A 2BBMA 2JTTA 1XFZO 2CCMA 2LUXA 1K8UA 5B8IB 4YGEB 2M7LA 2MRDA 3JTDB 2CT9A 1BR1B 4DIRA 2M7NA 1N0YA 1RECA 4PHNA 4AOMA 2Y1NA 3GK2A 1RFJA 1CDLA 2K2FA 5HLVA 3VRQA 3A8RA 3GK1A 1PULA 4GGFC 3BOWA 1Y6WA 3I5IC 3VRPA 3FIAA 1SCMB 1S3PA 4A4BA 1YUUA 2CTNA 2K61A 2KDHA 1TNQA 1CLLA 2LMUA 2NZ0A 1LKJA 2L2EA 2OPOA 3AKAA 1ALWA 2MA2A 2K8MB 5HYDA 1AP4A 1MF8B 3IQQA 1XK4A 1UHNA 1F71A 2M8UA 1QX7A 1B1GA 2BCXA 1KFXL 2JZIA 3EVUA 1AHRA 1J1EA 2L4IA 4QJ4B 4L9MA 1K94A 3TZ1A 4ETOA 5KTYA 2D8NA 1JUOA 1C07A 4YRUA 3PALA 2VRGA 1M45A 1NCXA
chains in the Genus database with same CATH superfamily
1SW8A 3FWCA 4A4CA 3NHIA 1NYAA 1JBAA 1EG4A 1F70A 3S0AA 2JXCA 2DOQA 1LXFC 1A75B 1XFRA 3IF7A 1AJ4A 1SMGA 5KU1A 1C3ZA 3TUYB 2GGZA 1DGVA 2JQ6A 1KQVA 1LINA 1CLBA 1TN4A 2G2BA 4MZKA 2Q91A 1KCYA 5TNCA 1QX2A 2KSPA 2L4HA 1XFWO 2L98A 1OMRA 1SR6B 1QXPA 2KQ6A 3OGNA 4MRYA 4ORBB 3NSLA 1L7ZA 1NCYA 2AMIA 2MBXA 3BUMB 2IS9A 2M1KB 1DGUA 1JFKA 1TRFA 1A4PA 3LK0A 2FJYA 2ZN9A 1ALVA 3OX6A 4M2OA 1XFVO 1B47A 2JT8A 1KFUL 2KAXA 4GGNA 1HT9A 3RLZA 5F6TA 1KQMC 1SL7A 1QIWA 1CFFA 1NX2A 1IH0A 5CSJA 4YGBB 1F55A 5PALA 4UPGA 2WNDA 1EL4A 1XFUO 2LUCA 2QPTA 4YBHB 2BKIB 2YGUA 3PLFB 2MLEC 1BLQA 2ZN8A 3DF0A 1ZACA 3OB2B 4NDCA 1V1GA 3EVVA 3HCMA 3VROA 1QASA 2WCBA 1PALA 3VB1A 1IQ3A 4IL1A 5FI2A 1DQEA 1XK4C 3BFBA 3B6XA 2L51A 5D3OA 3NSIA 2KI4B 2M1UA 3DZTA 1TCOB 2WCKA 2PYQA 2M0RA 5GQQC 4GGFA 1SL9A 2OS8C 3S0BA 2BKHB 1F54A 2EGDA 3CZ0A 4I5LB 3DVMA 1NPQA 1MXEA 2WCEA 2I2RE 5AEQA 3I5FC 4WRIA 1FF1A 1OOIX 4MVFA 1M39A 3BUXB 1L2OB 1Y1UA 1QS7A 1AJ5A 1DELA 1G4YR 4CIDA 5HKYA 1CKKA 2PMYA 1RROA 4D1EA 2LE9B 1NIWA 2LC5A 3I5HC 5AERA 3D10A 2I18A 2HETA 2LHIA 1MUXA 1Y0VH 1X02A 3CABA 1XO5A 4NQGA 5DKNA 3S0EA 2K7BA 4I5NB 1AUIB 1QJTA 1W7JB 3SS3A 2O5GA 3EVRA 3RM1A 2JPOA 1ZFSA 1RK9A 5I8NA 1DJGA 5I2OA 4PE0A 4PCWA 1NWDA 1GQMA 2LMTA 5I94A 2G9BA 3IQOA 1OMDA 4ICBA 1WRZA 1FI6A 3E3RA 1BJFA 3TDIA 5FI7A 2LP3A 2L50A 2L0PA 1SKTA 2BCBA 2Y5IA 2F2PA 4QJ3B 2A4JA 1H4BA 5CSNA 2F8PA 4MRXA 1G33A 1IWQA 2KBMA 2KGRA 3V2LA 1LA3A 1QV1A 1F8HA 3BQ3A 1OOGA 1JWDA 3WHTB 2M9GA 3DF0B 1SCVA 3EKJA 3D73A 1Z2CB 1KSOA 5DKRA 4XYNA 4FQOA 5K89A 1XA5A 2I94A 3O78A 2COLB 4YGDB 1AK8A 3CWGA 4PALA 2H61A 1SSEB 2KYCA 3PM2A 3JVTC 3AKBA 3D77A 3O6BA 3NXAA 1DEKA 3BFAA 1NP8A 1W7IB 1KK7Z 1QIVA 5HLOA 1XYDA 2FJUB 2K2AA 5JOLA 4DCKA 1YTZC 4Q04A 4AQJA 2LM5A 3D76A 1U5IB 2JNXA 3NGVA 3F45A 5D7FA 4FTGA 3B86A 2KAVA 4F0ZB 1CFCA 1ODBA 4MEWA 2ERBA 1BT6A 1RTP1 1ZUZA 1Z4HA 1MWNA 2MHHA 4N1FA 2HPSA 1WY9A 2KLEA 1WDCC 3CZTX 1EXRA 2WOSA 1IRJA 2NCOA 4MZJA 4E68A 1CDNA 1R2UA 2EC6C 2JT3A 2WCLA 3EKHA 4C0KA 1UHKA 1EH2A 2LLUA 3PN7C 1SYMA 4WQ2A 4XJKB 5HKWA 1K95A 4JD9A 4DUQA 3TS5C 1GGZA 2JPTA 2QEVA 3S0DA 2EHBA 1RJVA 2LAPA 2MAZA 2M97A 3CR4X 2KI6C 4GAOA 4PHKA 3EK4A 2OTGB 2BL0C 2BE4A 4PE7A 5CSIA 1J7PA 3R1VA 3GK4X 3I5GC 1GJYA 2KQYA 3SS4A 3KEVA 1CLMA 1C7VA 1B8RA 1TNXA 1NX0A 1T14A 1OQPA 1XVJA 1YVHA 2LNKA 4GFTA 5I2LA 1MR8A 5G08A 1SY9A 1B7TZ 2B1UA 1WLMA 2LLTA 4KYNA 3CZ2A 1CMGA 1IGVA 1KQMB 2H61C 1BF5A 1BOCA 2SCPA 3DY9A 1F4QA 1WRKA 3UNWA 2ISDA 2L5YA 2MJWB 1K96A 3CZ1A 1KK7Y 2KAYA 1JF2A 2M3WA 3BOWB 3KHEA 2LVKA 1OW4A 1YRUB 2WC5A 4NDBA 2M29A 1EG3A 5DKQA 4CLNA 1K2HA 1B8CA 2F3YA 1C3YA 1S36A 1YVLA 3BXKA 1P28A 4P2YB 1KK8C 3KPXA 3GOFA 1OOJA 4N5XA 2KHNA 3WNXB 1M63B 1YUTA 1MXLC 1Q80A 2WCJA 4YI8A 1WLZA 1YRTB 1KWOC 2ZNEA 4PT1A 1DJXA 1QWVA 2PSRA 5D69A 2OS8B 2BE6A 2LANA 4TNCA 1BMOA 3RZSA 4HREE 3ZWHA 3SG5A 1S6IA 4ZCUA 3I5FB 1BR4B 1FI5A 1TNPA 1DJHA 3L4AA 3VRNA 2LMVA 4DS7A 3HX4A 2NXQA 4WQ3A 1QVIZ 1SPYA 3DD4A 2HF5A 2PASA 4MBEA 4OVNF 3SJSA 4CFQA 1QX5B 1N2DA 1D1OA 3WHUB 1QV0A 1TWOA 3D0YA 3DYEA 3I5HB 1UHJA 3NSOA 1NSHA 1QATA 1PRWA 4HSZA 4OR9B 4PHJA 2CNPA 2O60A 2LP2A 2LVJA 4JPZB 3DXLA 2LCPA 1GGWA 1K9UA 3BFHA 2JT0A 4GBAA 3NSKA 2JU0A 1B7TY 5HKZA 2FCEA 1R6PA 4BY5A 2JXLA 2CXJA 1SK6D 1DVIA 1CM1A 4R1EA 5FI6A 2Y1MA 2GV5A 3AAJA 1WRLA 3EK8A 4GPLB 4ORAB 3SIBA 1YX8A 1S5GY 2PVBA 3O4XA 3D78A 3CR2A 2LVVA 3SG6A 2WC8A 1IKUA 4YI9A 1E8AA 1K9KA 3KO0A 4OV2A 1CFPA 3MSEB 3OBVA 1TOPA 3CTNA 3OP0A 1B4CA 5AFPA 3DVEA 3QMEA 3R1PA 1H8BA 1S26D 1NX3A 2F2OA 2AAOA 2ZRSA 1J55A 3R72A 3H4SE 1TUZA 3JTDC 3ICBA 1PVBA 1QTXA 3CLNA 2F33A 3BUOB 3LLEA 3OB1B 1MQ1A 2E6WA 4I5KA 4ZCVA 3BJHA 1JF0A 5J3XA 1J1DA 3I5IB 2K7OA 1DC1A 1W9ZA 2K7CA 3N7HA 1S6CA 4F7FA 5AXIA 2GGMA 1A29A 2K7DA 3JVTB 1ORGA 1PSBA 1SCMC 1RWYA 1CTRA 3PSRA 5CPVA 1M46A 3CGAA 1BU3A 2WC6A 1IQ5A 4M2PA 2KPHA 2P6BB 3A4UB 2F3ZA 4ORCB 1VRKA 3CDNA 3SG4A 1FPWA 1QVIY 2JWWA 3LK1A 5IBWA 5DICA 1NUBA 2Q4UA 2LVIA 1YX7A 2JRFA 1UWOA 1YURA 1G8IA 1QLSA 1GM0A 3Q8IA 1CNPA 1S1EA 4PE1A 3SG2A 2JOJA 1KSMA 1DF0A 4MN0A 1WDCB 1B9AA 3O2PA 3B88A 1LS8A 3D0YB 1CDMA 3LL8B 1PK0D 2EC6B 1TIZA 3BUNB 1K9PA 3S0GA 3L47A 5BPJA 4MZLA 5ER4X 4INWA 5FYXA 3PN7B 4N1GA 1EJ3A 4JWQA 1KFXS 1SRAA 2L5XB 4C0LA 1LVCD 4U8DA 5CSFA 3TUYC 1CB1A 4JKTA 4PDZA 1K90D 3TS5B 1BG1A 2H8VA 3AAKA 1IJ5A 1CFDA 3ZNIA 1A03A 1Y1AA 1HQVA 1IJ6A 2SASA 4BY4A 1OOFA 1SR6C 2ZNDA 3UO9A 1IIOA 1TCFA 3DVKA 1IG5A 4OKHA 3CR5X 2BL0B 3OHMB 2LLSA 2I7AA 3VGOA 1OMVA 1J7OA 3I5GB 2OTGC 1UHHA 1NX1A 1FW4A 2BCAA 3VRRA 2MLFC 4INXA 4YGCB 1SBJA 1M31A 1DJIA 1UP5A 1XFYO 3B87A 5HL1A 2KFFA 3SG7A 2KI6D 1PVAA 1FBVA 1S5GZ 1Y1XA 2WCHA 1OSAA 1BODA 1NCZA 1CDPA 1DMOA 3D75A 2KOTA 2H2KA 2NLNA 2JTZA 2PQLA 2GTEA 2M49B 4JQ0D 3FE8A 2NCPA 1J7RA 4P5OE 1A2XA 1KFUS 1DJWA 2PRUA 1DTLA 4MSPA 1TNWA 1C7WA 2HQWA 2BECA 4PE4A 1UHIA 2ZKMX 2BBNA 3SS5A 3TDZA 1KK8B 1XFXO 2KI4C 2JULA 4PHMA 4AQIA 4QJ5B 1SL8A 4FQTA 1OZSA 4HRHA 3C1VA 4I5JA 4CPVA 2BNXA 1PSRA 5AANA 2ZRTA 2RGIA 1KWOB 3PJIA 1TTXA 2JNFA 2R2IA 4DRWA 1ZOTB 4NDDA 2TN4A 2KFHA 1CMFA 3K1EA 2WORA 3IVTA 5JJGA 3K21A 2HQ8A 1DF0B 4C0JA 5ER5A 2BAPA 3L4LA 1L2OC 2FOTA 1U5IA 3FS7A 1JSAA 4HRGA 2FCDA 1ZMZA 4GNKB 3CYZA 4OCIA 1DT7B 1OOHA 1YR5A 1UUSA 1SNLA 1DJYA 2ZFDA 3SIAA 4MLWA 1JC2A 1DJZA 2QACA 2WCFA 2E30A 1OZOA 1JFJA 5KSZA 3WXAA 3M0WA 3EK7A 3CS1A 3FE6A 2K0JA 1QLKA 1B8LA 3LCPC 3B7AA 1LA0A 1MHOA 3PM8A 1AVSA 4YGAA 1A75A 2LV7A 4IJ7A 2KGBC 3FWBA 3PFVA 3TDUA 1K93D 3O4YA 4OZDA 3QRXA 2JC2A 4XJKA 4USLA 2LHLA 4M2QA 3S0FA 4CFRA 2QEHA 2K60A 3BUWB 2L2CA 3BYAA 3R1OA 2CBLA 1S6JA 1CM4A 2KNEA 5I2QA 2KYFA 2AUCA 2KBIA 2PALA 1V1FA 2QDIA 3PATA 3SG3A 1J7QA 1YUSA 1N65A 2KFGA 3DVJA 3KF9A 4GUKA 1F4OA 2KLDA 1TUJA 2V53A 1UURA 2QEOA 2Y4QA 1OE9B 3OX5A 2BBMA 2JTTA 1XFZO 2CCMA 5EL2A 2LUXA 1K8UA 5B8IB 4YGEB 2M7LA 2MRDA 3JTDB 2CT9A 1BR1B 4DIRA 2M7NA 1N0YA 1RECA 2WCMA 4PHNA 4AOMA 2Y1NA 3GK2A 3NHTA 1RFJA 1CDLA 2K2FA 5HLVA 3VRQA 3A8RA 3EG5B 3GK1A 1PULA 3FE9A 4GGFC 3BOWA 1Y6WA 3I5IC 3VRPA 3FIAA 1SCMB 1S3PA 2P70A 4A4BA 1YUUA 2CTNA 2K61A 2KDHA 2P71A 1TNQA 1CLLA 2LMUA 2NZ0A 1LKJA 2L2EA 2OPOA 3AKAA 1ALWA 2MA2A 2QEBA 2K8MB 5HYDA 1AP4A 1MF8B 3D74A 3IQQA 1XK4A 1UHNA 1F71A 2M8UA 1QX7A 1B1GA 2BCXA 1KFXL 2JZIA 3EVUA 1AHRA 1J1EA 2L4IA 4QJ4B 4L9MA 1K94A 3TZ1A 4ETOA 5KTYA 2D8NA 1JUOA 1C07A 4YRUA 3PALA 2VRGA 1M45A 1NCXA
chains in the Genus database with same CATH topology
1SW8A 3FWCA 4A4CA 1NYAA 1JBAA 1EG4A 1F70A 2JXCA 2DOQA 1LXFC 1A75B 3IF7A 1AJ4A 1SMGA 5KU1A 3TUYB 1KQVA 2GGZA 1DGVA 2JQ6A 1LINA 1CLBA 1TN4A 2G2BA 4MZKA 2Q91A 1KCYA 5TNCA 1QX2A 2KSPA 2L4HA 1XFWO 2L98A 1OMRA 1SR6B 1QXPA 2KQ6A 4MRYA 4ORBB 3NSLA 1L7ZA 1NCYA 2AMIA 2MBXA 3BUMB 2IS9A 2M1KB 1DGUA 1JFKA 1TRFA 1A4PA 3LK0A 2ZN9A 1ALVA 3OX6A 4M2OA 1XFVO 1B47A 2JT8A 1KFUL 2KAXA 4GGNA 1HT9A 3RLZA 5F6TA 1KQMC 1SL7A 1QIWA 1CFFA 1NX2A 1IH0A 5CSJA 4YGBB 1F55A 5PALA 4UPGA 2WNDA 1EL4A 1XFUO 2LUCA 2QPTA 4YBHB 2BKIB 3PLFB 2MLEC 1BLQA 2ZN8A 3DF0A 1ZACA 3OB2B 4NDCA 1V1GA 3EVVA 3HCMA 3VROA 1QASA 2WCBA 1PALA 1IQ3A 4IL1A 1XK4C 2L51A 3NSIA 2KI4B 2M1UA 1TCOB 2M0RA 5GQQC 4GGFA 1SL9A 2OS8C 2BKHB 1F54A 2EGDA 4I5LB 3DVMA 1NPQA 1MXEA 2WCEA 2I2RE 5AEQA 3I5FC 4WRIA 1FF1A 4MVFA 1M39A 3BUXB 1L2OB 1Y1UA 1QS7A 1AJ5A 1G4YR 4CIDA 5HKYA 1CKKA 2PMYA 1RROA 4D1EA 2LE9B 1NIWA 2LC5A 3I5HC 5AERA 3D10A 2I18A 2HETA 2LHIA 1MUXA 1Y0VH 1X02A 1XO5A 4NQGA 5DKNA 2K7BA 4I5NB 1AUIB 1QJTA 1W7JB 2O5GA 3EVRA 3RM1A 1ZFSA 1RK9A 5I8NA 1DJGA 5I2OA 4PE0A 4PCWA 1NWDA 1GQMA 2LMTA 2G9BA 3IQOA 1OMDA 4ICBA 1WRZA 1FI6A 3E3RA 1BJFA 3TDIA 2LP3A 2L50A 2L0PA 1SKTA 2BCBA 2Y5IA 2F2PA 4QJ3B 2A4JA 1H4BA 5CSNA 2F8PA 4MRXA 1G33A 1IWQA 2KBMA 2KGRA 1LA3A 1QV1A 1F8HA 3BQ3A 1JWDA 3WHTB 2M9GA 3DF0B 1SCVA 3EKJA 1KSOA 5DKRA 4XYNA 4FQOA 5K89A 1XA5A 2I94A 3O78A 2COLB 4YGDB 1AK8A 3CWGA 4PALA 2H61A 2KYCA 3JVTC 3AKBA 3O6BA 3NXAA 1NP8A 1W7IB 1KK7Z 1QIVA 5HLOA 1XYDA 2FJUB 2K2AA 5JOLA 4DCKA 1YTZC 4Q04A 4AQJA 2LM5A 1U5IB 2JNXA 3F45A 5D7FA 4FTGA 2KAVA 4F0ZB 1CFCA 1ODBA 4MEWA 1BT6A 1RTP1 1ZUZA 2MHHA 1MWNA 4N1FA 2HPSA 1WY9A 1WDCC 3CZTX 1EXRA 2WOSA 1IRJA 2NCOA 4MZJA 4E68A 1CDNA 1R2UA 2EC6C 2JT3A 3EKHA 4C0KA 1UHKA 1EH2A 2LLUA 3PN7C 1SYMA 4WQ2A 4XJKB 5HKWA 1K95A 4DUQA 3TS5C 1GGZA 2JPTA 2EHBA 1RJVA 2LAPA 2MAZA 2M97A 3CR4X 2KI6C 4GAOA 4PHKA 3EK4A 2OTGB 2BL0C 2BE4A 4PE7A 5CSIA 1J7PA 3GK4X 3I5GC 1GJYA 2KQYA 3KEVA 1CLMA 1C7VA 1B8RA 1TNXA 1NX0A 1XVJA 1OQPA 1YVHA 2LNKA 4GFTA 5I2LA 1MR8A 5G08A 1SY9A 1B7TZ 2B1UA 1WLMA 2LLTA 1CMGA 1IGVA 1KQMB 2H61C 1BF5A 1BOCA 2SCPA 1F4QA 1WRKA 2ISDA 2MJWB 1K96A 1KK7Y 2KAYA 1JF2A 2M3WA 3BOWB 3KHEA 2LVKA 4NDBA 1YRUB 2M29A 1EG3A 5DKQA 4CLNA 1K2HA 1B8CA 2F3YA 1S36A 1YVLA 3BXKA 4P2YB 1KK8C 3KPXA 3GOFA 1OOJA 4N5XA 2KHNA 3WNXB 1M63B 1YUTA 1MXLC 1Q80A 4YI8A 1WLZA 1YRTB 1KWOC 2ZNEA 1DJXA 2PSRA 5D69A 2OS8B 2BE6A 2LANA 4TNCA 1BMOA 4HREE 3ZWHA 3SG5A 1S6IA 4ZCUA 3I5FB 1BR4B 1FI5A 1TNPA 1DJHA 3VRNA 2LMVA 4DS7A 3HX4A 2NXQA 4WQ3A 1QVIZ 1SPYA 3DD4A 2HF5A 2PASA 4MBEA 4OVNF 3SJSA 4CFQA 1QX5B 1N2DA 1D1OA 3WHUB 1QV0A 3D0YA 3I5HB 4HSZA 3NSOA 1UHJA 4CFRA 1NSHA 1QATA 1PRWA 4OR9B 4PHJA 2CNPA 2O60A 2LP2A 2LVJA 4JPZB 2LCPA 1GGWA 1K9UA 2JT0A 4GBAA 3NSKA 2JU0A 1B7TY 5HKZA 2FCEA 1R6PA 4BY5A 2JXLA 2CXJA 1SK6D 1DVIA 1CM1A 4R1EA 3SIBA 2Y1MA 2GV5A 3AAJA 1WRLA 3EK8A 4GPLB 4ORAB 1YX8A 1S5GY 2PVBA 3CR2A 2LVVA 3SG6A 2WC8A 1IKUA 4YI9A 1E8AA 1K9KA 3KO0A 4OV2A 1CFPA 3MSEB 1TOPA 3CTNA 3OP0A 1B4CA 5AFPA 3DVEA 1H8BA 1S26D 1NX3A 2F2OA 2AAOA 2ZRSA 1J55A 3H4SE 3JTDC 3ICBA 1PVBA 1QTXA 3CLNA 2F33A 3BUOB 3LLEA 3OB1B 1MQ1A 2E6WA 4I5KA 4ZCVA 1JF0A 5J3XA 1J1DA 3I5IB 2K7OA 2K7CA 1S6CA 5AXIA 2GGMA 1A29A 2K7DA 3JVTB 1PSBA 1SCMC 1RWYA 1CTRA 3PSRA 5CPVA 1M46A 3CGAA 1BU3A 4M2PA 1IQ5A 4ORCB 2P6BB 3A4UB 1FPWA 2F3ZA 3SG4A 1VRKA 1QVIY 2JWWA 3LK1A 5IBWA 1NUBA 2Q4UA 2LVIA 1YX7A 2JRFA 1UWOA 1YURA 1G8IA 1QLSA 1CNPA 1S1EA 4PE1A 3SG2A 2JOJA 1KSMA 1DF0A 4MN0A 1WDCB 1B9AA 3O2PA 3D0YB 1CDMA 3LL8B 1PK0D 2EC6B 1TIZA 3BUNB 1K9PA 5BPJA 4MZLA 5ER4X 5FYXA 3PN7B 4N1GA 1EJ3A 4JWQA 1KFXS 1SRAA 2L5XB 4C0LA 1LVCD 4U8DA 5CSFA 3TUYC 1CB1A 3TS5B 4PDZA 1K90D 1BG1A 1A03A 3AAKA 1IJ5A 1CFDA 3ZNIA 1Y1AA 1HQVA 1IJ6A 2SASA 4BY4A 1SR6C 2ZNDA 1TCFA 3DVKA 1IG5A 4OKHA 3CR5X 2BL0B 3OHMB 2LLSA 2I7AA 3VGOA 1OMVA 1J7OA 3I5GB 2OTGC 1UHHA 1NX1A 1FW4A 2BCAA 3VRRA 2MLFC 4YGCB 1SBJA 1M31A 1DJIA 1UP5A 1XFYO 2KFFA 3SG7A 2KI6D 1PVAA 1FBVA 1S5GZ 1Y1XA 1DMOA 1OSAA 1BODA 1NCZA 1CDPA 2KOTA 2H2KA 2NLNA 2JTZA 2M49B 4JQ0D 2NCPA 1J7RA 4P5OE 1A2XA 1KFUS 1DJWA 2PRUA 1DTLA 4MSPA 1TNWA 1C7WA 2HQWA 2BECA 4PE4A 1UHIA 2ZKMX 2BBNA 3TDZA 1KK8B 1XFXO 2KI4C 2JULA 4PHMA 4AQIA 4QJ5B 1SL8A 1OZSA 4HRHA 3C1VA 4I5JA 4CPVA 1PSRA 5AANA 2ZRTA 2RGIA 1KWOB 1TTXA 2JNFA 2R2IA 4DRWA 1ZOTB 4NDDA 2TN4A 2KFHA 1CMFA 2WORA 5JJGA 3K21A 2HQ8A 1DF0B 4C0JA 5ER5A 1L2OC 2FOTA 1U5IA 3FS7A 1JSAA 4HRGA 2FCDA 1ZMZA 4GNKB 4OCIA 1DT7B 1YR5A 1UUSA 1SNLA 1DJYA 2ZFDA 3SIAA 4MLWA 1JC2A 1DJZA 2QACA 2WCFA 2E30A 1OZOA 1JFJA 5KSZA 3WXAA 3M0WA 3EK7A 3CS1A 2K0JA 1QLKA 1B8LA 3LCPC 3PM8A 1LA0A 1MHOA 4YGAA 1AVSA 1A75A 2LV7A 2KGBC 3FWBA 3PFVA 3TDUA 1K93D 3O4YA 3QRXA 2JC2A 4XJKA 4USLA 2LHLA 4M2QA 3BUWB 3BYAA 2CBLA 1S6JA 1CM4A 2KNEA 5I2QA 2KYFA 2AUCA 2KBIA 2PALA 1V1FA 3PATA 3SG3A 1J7QA 1YUSA 1N65A 2KFGA 3DVJA 3KF9A 4GUKA 1F4OA 2V53A 1UURA 2Y4QA 1OE9B 3OX5A 2BBMA 2JTTA 1XFZO 2CCMA 2LUXA 1K8UA 5B8IB 4YGEB 2M7LA 2MRDA 3JTDB 2CT9A 1BR1B 4DIRA 2M7NA 1N0YA 1RECA 4PHNA 4AOMA 2Y1NA 3GK2A 1RFJA 1CDLA 2K2FA 5HLVA 3VRQA 3A8RA 3GK1A 1PULA 4GGFC 3BOWA 1Y6WA 3I5IC 3VRPA 3FIAA 1SCMB 1S3PA 4A4BA 1YUUA 2CTNA 2K61A 2KDHA 1TNQA 1CLLA 2LMUA 2NZ0A 1LKJA 2L2EA 2OPOA 3AKAA 1ALWA 2MA2A 2K8MB 5HYDA 1AP4A 1MF8B 3IQQA 1XK4A 1UHNA 1F71A 2M8UA 1QX7A 1B1GA 2BCXA 1KFXL 2JZIA 3EVUA 1AHRA 1J1EA 2L4IA 4QJ4B 4L9MA 1K94A 3TZ1A 4ETOA 5KTYA 2D8NA 1JUOA 1C07A 4YRUA 3PALA 2VRGA 1M45A 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW8 A;  3FWC A;  4A4C A;  1NYA A;  1JBA A;  1EG4 A;  1F70 A;  2JXC A;  2DOQ A;  1LXF C;  1A75 B;  3IF7 A;  1AJ4 A;  1SMG A;  5KU1 A;  3TUY B;  1KQV A;  2GGZ A;  1DGV A;  2JQ6 A;  1LIN A;  1CLB A;  1TN4 A;  2G2B A;  4MZK A;  2Q91 A;  1KCY A;  5TNC A;  1QX2 A;  2KSP A;  2L4H A;  1XFW O;  2L98 A;  1OMR A;  1SR6 B;  1QXP A;  2KQ6 A;  4MRY A;  4ORB B;  3NSL A;  1L7Z A;  1NCY A;  2AMI A;  2MBX A;  3BUM B;  2IS9 A;  2M1K B;  1DGU A;  1JFK A;  1TRF A;  1A4P A;  3LK0 A;  2ZN9 A;  1ALV A;  3OX6 A;  4M2O A;  1XFV O;  1B47 A;  2JT8 A;  1KFU L;  2KAX A;  4GGN A;  1HT9 A;  3RLZ A;  5F6T A;  1KQM C;  1SL7 A;  1QIW A;  1CFF A;  1NX2 A;  1IH0 A;  5CSJ A;  4YGB B;  1F55 A;  5PAL A;  4UPG A;  2WND A;  1EL4 A;  1XFU O;  2LUC A;  2QPT A;  4YBH B;  2BKI B;  3PLF B;  2MLE C;  1BLQ A;  2ZN8 A;  3DF0 A;  1ZAC A;  3OB2 B;  4NDC A;  1V1G A;  3EVV A;  3HCM A;  3VRO A;  1QAS A;  2WCB A;  1PAL A;  1IQ3 A;  4IL1 A;  1XK4 C;  2L51 A;  3NSI A;  2KI4 B;  2M1U A;  1TCO B;  2M0R A;  5GQQ C;  4GGF A;  1SL9 A;  2OS8 C;  2BKH B;  1F54 A;  2EGD A;  4I5L B;  3DVM A;  1NPQ A;  1MXE A;  2WCE A;  2I2R E;  5AEQ A;  3I5F C;  4WRI A;  1FF1 A;  4MVF A;  1M39 A;  3BUX B;  1L2O B;  1Y1U A;  1QS7 A;  1AJ5 A;  1G4Y R;  4CID A;  5HKY A;  1CKK A;  2PMY A;  1RRO A;  4D1E A;  2LE9 B;  1NIW A;  2LC5 A;  3I5H C;  5AER A;  3D10 A;  2I18 A;  2HET A;  2LHI A;  1MUX A;  1Y0V H;  1X02 A;  1XO5 A;  4NQG A;  5DKN A;  2K7B A;  4I5N B;  1AUI B;  1QJT A;  1W7J B;  2O5G A;  3EVR A;  3RM1 A;  1ZFS A;  1RK9 A;  5I8N A;  1DJG A;  5I2O A;  4PE0 A;  4PCW A;  1NWD A;  1GQM A;  2LMT A;  2G9B A;  3IQO A;  1OMD A;  4ICB A;  1WRZ A;  1FI6 A;  3E3R A;  1BJF A;  3TDI A;  2LP3 A;  2L50 A;  2L0P A;  1SKT A;  2BCB A;  2Y5I A;  2F2P A;  4QJ3 B;  2A4J A;  1H4B A;  5CSN A;  2F8P A;  4MRX A;  1G33 A;  1IWQ A;  2KBM A;  2KGR A;  1LA3 A;  1QV1 A;  1F8H A;  3BQ3 A;  1JWD A;  3WHT B;  2M9G A;  3DF0 B;  1SCV A;  3EKJ A;  1KSO A;  5DKR A;  4XYN A;  4FQO A;  5K89 A;  1XA5 A;  2I94 A;  3O78 A;  2COL B;  4YGD B;  1AK8 A;  3CWG A;  4PAL A;  2H61 A;  2KYC A;  3JVT C;  3AKB A;  3O6B A;  3NXA A;  1NP8 A;  1W7I B;  1KK7 Z;  1QIV A;  5HLO A;  1XYD A;  2FJU B;  2K2A A;  5JOL A;  4DCK A;  1YTZ C;  4Q04 A;  4AQJ A;  2LM5 A;  1U5I B;  2JNX A;  3F45 A;  5D7F A;  4FTG A;  2KAV A;  4F0Z B;  1CFC A;  1ODB A;  4MEW A;  1BT6 A;  1RTP 1;  1ZUZ A;  2MHH A;  1MWN A;  4N1F A;  2HPS A;  1WY9 A;  1WDC C;  3CZT X;  1EXR A;  2WOS A;  1IRJ A;  2NCO A;  4MZJ A;  4E68 A;  1CDN A;  1R2U A;  2EC6 C;  2JT3 A;  3EKH A;  4C0K A;  1UHK A;  1EH2 A;  2LLU A;  3PN7 C;  1SYM A;  4WQ2 A;  4XJK B;  5HKW A;  1K95 A;  4DUQ A;  3TS5 C;  1GGZ A;  2JPT A;  2EHB A;  1RJV A;  2LAP A;  2MAZ A;  2M97 A;  3CR4 X;  2KI6 C;  4GAO A;  4PHK A;  3EK4 A;  2OTG B;  2BL0 C;  2BE4 A;  4PE7 A;  5CSI A;  1J7P A;  3GK4 X;  3I5G C;  1GJY A;  2KQY A;  3KEV A;  1CLM A;  1C7V A;  1B8R A;  1TNX A;  1NX0 A;  1XVJ A;  1OQP A;  1YVH A;  2LNK A;  4GFT A;  5I2L A;  1MR8 A;  5G08 A;  1SY9 A;  1B7T Z;  2B1U A;  1WLM A;  2LLT A;  1CMG A;  1IGV A;  1KQM B;  2H61 C;  1BF5 A;  1BOC A;  2SCP A;  1F4Q A;  1WRK A;  2ISD A;  2MJW B;  1K96 A;  1KK7 Y;  2KAY A;  1JF2 A;  2M3W A;  3BOW B;  3KHE A;  2LVK A;  4NDB A;  1YRU B;  2M29 A;  1EG3 A;  5DKQ A;  4CLN A;  1K2H A;  1B8C A;  2F3Y A;  1S36 A;  1YVL A;  3BXK A;  4P2Y B;  1KK8 C;  3KPX A;  3GOF A;  1OOJ A;  4N5X A;  2KHN A;  3WNX B;  1M63 B;  1YUT A;  1MXL C;  1Q80 A;  4YI8 A;  1WLZ A;  1YRT B;  1KWO C;  2ZNE A;  1DJX A;  2PSR A;  5D69 A;  2OS8 B;  2BE6 A;  2LAN A;  4TNC A;  1BMO A;  4HRE E;  3ZWH A;  3SG5 A;  1S6I A;  4ZCU A;  3I5F B;  1BR4 B;  1FI5 A;  1TNP A;  1DJH A;  3VRN A;  2LMV A;  4DS7 A;  3HX4 A;  2NXQ A;  4WQ3 A;  1QVI Z;  1SPY A;  3DD4 A;  2HF5 A;  2PAS A;  4MBE A;  4OVN F;  3SJS A;  4CFQ A;  1QX5 B;  1N2D A;  1D1O A;  3WHU B;  1QV0 A;  3D0Y A;  3I5H B;  4HSZ A;  3NSO A;  1UHJ A;  4CFR A;  1NSH A;  1QAT A;  1PRW A;  4OR9 B;  4PHJ A;  2CNP A;  2O60 A;  2LP2 A;  2LVJ A;  4JPZ B;  2LCP A;  1GGW A;  1K9U A;  2JT0 A;  4GBA A;  3NSK A;  2JU0 A;  1B7T Y;  5HKZ A;  2FCE A;  1R6P A;  4BY5 A;  2JXL A;  2CXJ A;  1SK6 D;  1DVI A;  1CM1 A;  4R1E A;  3SIB A;  2Y1M A;  2GV5 A;  3AAJ A;  1WRL A;  3EK8 A;  4GPL B;  4ORA B;  1YX8 A;  1S5G Y;  2PVB A;  3CR2 A;  2LVV A;  3SG6 A;  2WC8 A;  1IKU A;  4YI9 A;  1E8A A;  1K9K A;  3KO0 A;  4OV2 A;  1CFP A;  3MSE B;  1TOP A;  3CTN A;  3OP0 A;  1B4C A;  5AFP A;  3DVE A;  1H8B A;  1S26 D;  1NX3 A;  2F2O A;  2AAO A;  2ZRS A;  1J55 A;  3H4S E;  3JTD C;  3ICB A;  1PVB A;  1QTX A;  3CLN A;  2F33 A;  3BUO B;  3LLE A;  3OB1 B;  1MQ1 A;  2E6W A;  4I5K A;  4ZCV A;  1JF0 A;  5J3X A;  1J1D A;  3I5I B;  2K7O A;  2K7C A;  1S6C A;  5AXI A;  2GGM A;  1A29 A;  2K7D A;  3JVT B;  1PSB A;  1SCM C;  1RWY A;  1CTR A;  3PSR A;  5CPV A;  1M46 A;  3CGA A;  1BU3 A;  4M2P A;  1IQ5 A;  4ORC B;  2P6B B;  3A4U B;  1FPW A;  2F3Z A;  3SG4 A;  1VRK A;  1QVI Y;  2JWW A;  3LK1 A;  5IBW A;  1NUB A;  2Q4U A;  2LVI A;  1YX7 A;  2JRF A;  1UWO A;  1YUR A;  1G8I A;  1QLS A;  1CNP A;  1S1E A;  4PE1 A;  3SG2 A;  2JOJ A;  1KSM A;  1DF0 A;  4MN0 A;  1WDC B;  1B9A A;  3O2P A;  3D0Y B;  1CDM A;  3LL8 B;  1PK0 D;  2EC6 B;  1TIZ A;  3BUN B;  1K9P A;  5BPJ A;  4MZL A;  5ER4 X;  5FYX A;  3PN7 B;  4N1G A;  1EJ3 A;  4JWQ A;  1KFX S;  1SRA A;  2L5X B;  4C0L A;  1LVC D;  4U8D A;  5CSF A;  3TUY C;  1CB1 A;  3TS5 B;  4PDZ A;  1K90 D;  1BG1 A;  1A03 A;  3AAK A;  1IJ5 A;  1CFD A;  3ZNI A;  1Y1A A;  1HQV A;  1IJ6 A;  2SAS A;  4BY4 A;  1SR6 C;  2ZND A;  1TCF A;  3DVK A;  1IG5 A;  4OKH A;  3CR5 X;  2BL0 B;  3OHM B;  2LLS A;  2I7A A;  3VGO A;  1OMV A;  1J7O A;  3I5G B;  2OTG C;  1UHH A;  1NX1 A;  1FW4 A;  2BCA A;  3VRR A;  2MLF C;  4YGC B;  1SBJ A;  1M31 A;  1DJI A;  1UP5 A;  1XFY O;  2KFF A;  3SG7 A;  2KI6 D;  1PVA A;  1FBV A;  1S5G Z;  1Y1X A;  1DMO A;  1OSA A;  1BOD A;  1NCZ A;  1CDP A;  2KOT A;  2H2K A;  2NLN A;  2JTZ A;  2M49 B;  4JQ0 D;  2NCP A;  1J7R A;  4P5O E;  1A2X A;  1KFU S;  1DJW A;  2PRU A;  1DTL A;  4MSP A;  1TNW A;  1C7W A;  2HQW A;  2BEC A;  4PE4 A;  1UHI A;  2ZKM X;  2BBN A;  3TDZ A;  1KK8 B;  1XFX O;  2KI4 C;  2JUL A;  4PHM A;  4AQI A;  4QJ5 B;  1SL8 A;  1OZS A;  4HRH A;  3C1V A;  4I5J A;  4CPV A;  1PSR A;  5AAN A;  2ZRT A;  2RGI A;  1KWO B;  1TTX A;  2JNF A;  2R2I A;  4DRW A;  1ZOT B;  4NDD A;  2TN4 A;  2KFH A;  1CMF A;  2WOR A;  5JJG A;  3K21 A;  2HQ8 A;  1DF0 B;  4C0J A;  5ER5 A;  1L2O C;  2FOT A;  1U5I A;  3FS7 A;  1JSA A;  4HRG A;  2FCD A;  1ZMZ A;  4GNK B;  4OCI A;  1DT7 B;  1YR5 A;  1UUS A;  1SNL A;  1DJY A;  2ZFD A;  3SIA A;  4MLW A;  1JC2 A;  1DJZ A;  2QAC A;  2WCF A;  2E30 A;  1OZO A;  1JFJ A;  5KSZ A;  3WXA A;  3M0W A;  3EK7 A;  3CS1 A;  2K0J A;  1QLK A;  1B8L A;  3LCP C;  3PM8 A;  1LA0 A;  1MHO A;  4YGA A;  1AVS A;  1A75 A;  2LV7 A;  2KGB C;  3FWB A;  3PFV A;  3TDU A;  1K93 D;  3O4Y A;  3QRX A;  2JC2 A;  4XJK A;  4USL A;  2LHL A;  4M2Q A;  3BUW B;  3BYA A;  2CBL A;  1S6J A;  1CM4 A;  2KNE A;  5I2Q A;  2KYF A;  2AUC A;  2KBI A;  2PAL A;  1V1F A;  3PAT A;  3SG3 A;  1J7Q A;  1YUS A;  1N65 A;  2KFG A;  3DVJ A;  3KF9 A;  4GUK A;  1F4O A;  2V53 A;  1UUR A;  2Y4Q A;  1OE9 B;  3OX5 A;  2BBM A;  2JTT A;  1XFZ O;  2CCM A;  2LUX A;  1K8U A;  5B8I B;  4YGE B;  2M7L A;  2MRD A;  3JTD B;  2CT9 A;  1BR1 B;  4DIR A;  2M7N A;  1N0Y A;  1REC A;  4PHN A;  4AOM A;  2Y1N A;  3GK2 A;  1RFJ A;  1CDL A;  2K2F A;  5HLV A;  3VRQ A;  3A8R A;  3GK1 A;  1PUL A;  4GGF C;  3BOW A;  1Y6W A;  3I5I C;  3VRP A;  3FIA A;  1SCM B;  1S3P A;  4A4B A;  1YUU A;  2CTN A;  2K61 A;  2KDH A;  1TNQ A;  1CLL A;  2LMU A;  2NZ0 A;  1LKJ A;  2L2E A;  2OPO A;  3AKA A;  1ALW A;  2MA2 A;  2K8M B;  5HYD A;  1AP4 A;  1MF8 B;  3IQQ A;  1XK4 A;  1UHN A;  1F71 A;  2M8U A;  1QX7 A;  1B1G A;  2BCX A;  1KFX L;  2JZI A;  3EVU A;  1AHR A;  1J1E A;  2L4I A;  4QJ4 B;  4L9M A;  1K94 A;  3TZ1 A;  4ETO A;  5KTY A;  2D8N A;  1JUO A;  1C07 A;  4YRU A;  3PAL A;  2VRG A;  1M45 A;  1NCX A; 
#chains in the Genus database with same CATH topology
 1SW8 A;  3FWC A;  4A4C A;  3NHI A;  1NYA A;  1JBA A;  1EG4 A;  1F70 A;  3S0A A;  2JXC A;  2DOQ A;  1LXF C;  1A75 B;  1XFR A;  3IF7 A;  1AJ4 A;  1SMG A;  5KU1 A;  1C3Z A;  3TUY B;  2GGZ A;  1DGV A;  2JQ6 A;  1KQV A;  1LIN A;  1CLB A;  1TN4 A;  2G2B A;  4MZK A;  2Q91 A;  1KCY A;  5TNC A;  1QX2 A;  2KSP A;  2L4H A;  1XFW O;  2L98 A;  1OMR A;  1SR6 B;  1QXP A;  2KQ6 A;  3OGN A;  4MRY A;  4ORB B;  3NSL A;  1L7Z A;  1NCY A;  2AMI A;  2MBX A;  3BUM B;  2IS9 A;  2M1K B;  1DGU A;  1JFK A;  1TRF A;  1A4P A;  3LK0 A;  2FJY A;  2ZN9 A;  1ALV A;  3OX6 A;  4M2O A;  1XFV O;  1B47 A;  2JT8 A;  1KFU L;  2KAX A;  4GGN A;  1HT9 A;  3RLZ A;  5F6T A;  1KQM C;  1SL7 A;  1QIW A;  1CFF A;  1NX2 A;  1IH0 A;  5CSJ A;  4YGB B;  1F55 A;  5PAL A;  4UPG A;  2WND A;  1EL4 A;  1XFU O;  2LUC A;  2QPT A;  4YBH B;  2BKI B;  2YGU A;  3PLF B;  2MLE C;  1BLQ A;  2ZN8 A;  3DF0 A;  1ZAC A;  3OB2 B;  4NDC A;  1V1G A;  3EVV A;  3HCM A;  3VRO A;  1QAS A;  2WCB A;  1PAL A;  3VB1 A;  1IQ3 A;  4IL1 A;  5FI2 A;  1DQE A;  1XK4 C;  3BFB A;  3B6X A;  2L51 A;  5D3O A;  3NSI A;  2KI4 B;  2M1U A;  3DZT A;  1TCO B;  2WCK A;  2PYQ A;  2M0R A;  5GQQ C;  4GGF A;  1SL9 A;  2OS8 C;  3S0B A;  2BKH B;  1F54 A;  2EGD A;  3CZ0 A;  4I5L B;  3DVM A;  1NPQ A;  1MXE A;  2WCE A;  2I2R E;  5AEQ A;  3I5F C;  4WRI A;  1FF1 A;  1OOI X;  4MVF A;  1M39 A;  3BUX B;  1L2O B;  1Y1U A;  1QS7 A;  1AJ5 A;  1DEL A;  1G4Y R;  4CID A;  5HKY A;  1CKK A;  2PMY A;  1RRO A;  4D1E A;  2LE9 B;  1NIW A;  2LC5 A;  3I5H C;  5AER A;  3D10 A;  2I18 A;  2HET A;  2LHI A;  1MUX A;  1Y0V H;  1X02 A;  3CAB A;  1XO5 A;  4NQG A;  5DKN A;  3S0E A;  2K7B A;  4I5N B;  1AUI B;  1QJT A;  1W7J B;  3SS3 A;  2O5G A;  3EVR A;  3RM1 A;  2JPO A;  1ZFS A;  1RK9 A;  5I8N A;  1DJG A;  5I2O A;  4PE0 A;  4PCW A;  1NWD A;  1GQM A;  2LMT A;  5I94 A;  2G9B A;  3IQO A;  1OMD A;  4ICB A;  1WRZ A;  1FI6 A;  3E3R A;  1BJF A;  3TDI A;  5FI7 A;  2LP3 A;  2L50 A;  2L0P A;  1SKT A;  2BCB A;  2Y5I A;  2F2P A;  4QJ3 B;  2A4J A;  1H4B A;  5CSN A;  2F8P A;  4MRX A;  1G33 A;  1IWQ A;  2KBM A;  2KGR A;  3V2L A;  1LA3 A;  1QV1 A;  1F8H A;  3BQ3 A;  1OOG A;  1JWD A;  3WHT B;  2M9G A;  3DF0 B;  1SCV A;  3EKJ A;  3D73 A;  1Z2C B;  1KSO A;  5DKR A;  4XYN A;  4FQO A;  5K89 A;  1XA5 A;  2I94 A;  3O78 A;  2COL B;  4YGD B;  1AK8 A;  3CWG A;  4PAL A;  2H61 A;  1SSE B;  2KYC A;  3PM2 A;  3JVT C;  3AKB A;  3D77 A;  3O6B A;  3NXA A;  1DEK A;  3BFA A;  1NP8 A;  1W7I B;  1KK7 Z;  1QIV A;  5HLO A;  1XYD A;  2FJU B;  2K2A A;  5JOL A;  4DCK A;  1YTZ C;  4Q04 A;  4AQJ A;  2LM5 A;  3D76 A;  1U5I B;  2JNX A;  3NGV A;  3F45 A;  5D7F A;  4FTG A;  3B86 A;  2KAV A;  4F0Z B;  1CFC A;  1ODB A;  4MEW A;  2ERB A;  1BT6 A;  1RTP 1;  1ZUZ A;  1Z4H A;  1MWN A;  2MHH A;  4N1F A;  2HPS A;  1WY9 A;  2KLE A;  1WDC C;  3CZT X;  1EXR A;  2WOS A;  1IRJ A;  2NCO A;  4MZJ A;  4E68 A;  1CDN A;  1R2U A;  2EC6 C;  2JT3 A;  2WCL A;  3EKH A;  4C0K A;  1UHK A;  1EH2 A;  2LLU A;  3PN7 C;  1SYM A;  4WQ2 A;  4XJK B;  5HKW A;  1K95 A;  4JD9 A;  4DUQ A;  3TS5 C;  1GGZ A;  2JPT A;  2QEV A;  3S0D A;  2EHB A;  1RJV A;  2LAP A;  2MAZ A;  2M97 A;  3CR4 X;  2KI6 C;  4GAO A;  4PHK A;  3EK4 A;  2OTG B;  2BL0 C;  2BE4 A;  4PE7 A;  5CSI A;  1J7P A;  3R1V A;  3GK4 X;  3I5G C;  1GJY A;  2KQY A;  3SS4 A;  3KEV A;  1CLM A;  1C7V A;  1B8R A;  1TNX A;  1NX0 A;  1T14 A;  1OQP A;  1XVJ A;  1YVH A;  2LNK A;  4GFT A;  5I2L A;  1MR8 A;  5G08 A;  1SY9 A;  1B7T Z;  2B1U A;  1WLM A;  2LLT A;  4KYN A;  3CZ2 A;  1CMG A;  1IGV A;  1KQM B;  2H61 C;  1BF5 A;  1BOC A;  2SCP A;  3DY9 A;  1F4Q A;  1WRK A;  3UNW A;  2ISD A;  2L5Y A;  2MJW B;  1K96 A;  3CZ1 A;  1KK7 Y;  2KAY A;  1JF2 A;  2M3W A;  3BOW B;  3KHE A;  2LVK A;  1OW4 A;  1YRU B;  2WC5 A;  4NDB A;  2M29 A;  1EG3 A;  5DKQ A;  4CLN A;  1K2H A;  1B8C A;  2F3Y A;  1C3Y A;  1S36 A;  1YVL A;  3BXK A;  1P28 A;  4P2Y B;  1KK8 C;  3KPX A;  3GOF A;  1OOJ A;  4N5X A;  2KHN A;  3WNX B;  1M63 B;  1YUT A;  1MXL C;  1Q80 A;  2WCJ A;  4YI8 A;  1WLZ A;  1YRT B;  1KWO C;  2ZNE A;  4PT1 A;  1DJX A;  1QWV A;  2PSR A;  5D69 A;  2OS8 B;  2BE6 A;  2LAN A;  4TNC A;  1BMO A;  3RZS A;  4HRE E;  3ZWH A;  3SG5 A;  1S6I A;  4ZCU A;  3I5F B;  1BR4 B;  1FI5 A;  1TNP A;  1DJH A;  3L4A A;  3VRN A;  2LMV A;  4DS7 A;  3HX4 A;  2NXQ A;  4WQ3 A;  1QVI Z;  1SPY A;  3DD4 A;  2HF5 A;  2PAS A;  4MBE A;  4OVN F;  3SJS A;  4CFQ A;  1QX5 B;  1N2D A;  1D1O A;  3WHU B;  1QV0 A;  1TWO A;  3D0Y A;  3DYE A;  3I5H B;  1UHJ A;  3NSO A;  1NSH A;  1QAT A;  1PRW A;  4HSZ A;  4OR9 B;  4PHJ A;  2CNP A;  2O60 A;  2LP2 A;  2LVJ A;  4JPZ B;  3DXL A;  2LCP A;  1GGW A;  1K9U A;  3BFH A;  2JT0 A;  4GBA A;  3NSK A;  2JU0 A;  1B7T Y;  5HKZ A;  2FCE A;  1R6P A;  4BY5 A;  2JXL A;  2CXJ A;  1SK6 D;  1DVI A;  1CM1 A;  4R1E A;  5FI6 A;  2Y1M A;  2GV5 A;  3AAJ A;  1WRL A;  3EK8 A;  4GPL B;  4ORA B;  3SIB A;  1YX8 A;  1S5G Y;  2PVB A;  3O4X A;  3D78 A;  3CR2 A;  2LVV A;  3SG6 A;  2WC8 A;  1IKU A;  4YI9 A;  1E8A A;  1K9K A;  3KO0 A;  4OV2 A;  1CFP A;  3MSE B;  3OBV A;  1TOP A;  3CTN A;  3OP0 A;  1B4C A;  5AFP A;  3DVE A;  3QME A;  3R1P A;  1H8B A;  1S26 D;  1NX3 A;  2F2O A;  2AAO A;  2ZRS A;  1J55 A;  3R72 A;  3H4S E;  1TUZ A;  3JTD C;  3ICB A;  1PVB A;  1QTX A;  3CLN A;  2F33 A;  3BUO B;  3LLE A;  3OB1 B;  1MQ1 A;  2E6W A;  4I5K A;  4ZCV A;  3BJH A;  1JF0 A;  5J3X A;  1J1D A;  3I5I B;  2K7O A;  1DC1 A;  1W9Z A;  2K7C A;  3N7H A;  1S6C A;  4F7F A;  5AXI A;  2GGM A;  1A29 A;  2K7D A;  3JVT B;  1ORG A;  1PSB A;  1SCM C;  1RWY A;  1CTR A;  3PSR A;  5CPV A;  1M46 A;  3CGA A;  1BU3 A;  2WC6 A;  1IQ5 A;  4M2P A;  2KPH A;  2P6B B;  3A4U B;  2F3Z A;  4ORC B;  1VRK A;  3CDN A;  3SG4 A;  1FPW A;  1QVI Y;  2JWW A;  3LK1 A;  5IBW A;  5DIC A;  1NUB A;  2Q4U A;  2LVI A;  1YX7 A;  2JRF A;  1UWO A;  1YUR A;  1G8I A;  1QLS A;  1GM0 A;  3Q8I A;  1CNP A;  1S1E A;  4PE1 A;  3SG2 A;  2JOJ A;  1KSM A;  1DF0 A;  4MN0 A;  1WDC B;  1B9A A;  3O2P A;  3B88 A;  1LS8 A;  3D0Y B;  1CDM A;  3LL8 B;  1PK0 D;  2EC6 B;  1TIZ A;  3BUN B;  1K9P A;  3S0G A;  3L47 A;  5BPJ A;  4MZL A;  5ER4 X;  4INW A;  5FYX A;  3PN7 B;  4N1G A;  1EJ3 A;  4JWQ A;  1KFX S;  1SRA A;  2L5X B;  4C0L A;  1LVC D;  4U8D A;  5CSF A;  3TUY C;  1CB1 A;  4JKT A;  4PDZ A;  1K90 D;  3TS5 B;  1BG1 A;  2H8V A;  3AAK A;  1IJ5 A;  1CFD A;  3ZNI A;  1A03 A;  1Y1A A;  1HQV A;  1IJ6 A;  2SAS A;  4BY4 A;  1OOF A;  1SR6 C;  2ZND A;  3UO9 A;  1IIO A;  1TCF A;  3DVK A;  1IG5 A;  4OKH A;  3CR5 X;  2BL0 B;  3OHM B;  2LLS A;  2I7A A;  3VGO A;  1OMV A;  1J7O A;  3I5G B;  2OTG C;  1UHH A;  1NX1 A;  1FW4 A;  2BCA A;  3VRR A;  2MLF C;  4INX A;  4YGC B;  1SBJ A;  1M31 A;  1DJI A;  1UP5 A;  1XFY O;  3B87 A;  5HL1 A;  2KFF A;  3SG7 A;  2KI6 D;  1PVA A;  1FBV A;  1S5G Z;  1Y1X A;  2WCH A;  1OSA A;  1BOD A;  1NCZ A;  1CDP A;  1DMO A;  3D75 A;  2KOT A;  2H2K A;  2NLN A;  2JTZ A;  2PQL A;  2GTE A;  2M49 B;  4JQ0 D;  3FE8 A;  2NCP A;  1J7R A;  4P5O E;  1A2X A;  1KFU S;  1DJW A;  2PRU A;  1DTL A;  4MSP A;  1TNW A;  1C7W A;  2HQW A;  2BEC A;  4PE4 A;  1UHI A;  2ZKM X;  2BBN A;  3SS5 A;  3TDZ A;  1KK8 B;  1XFX O;  2KI4 C;  2JUL A;  4PHM A;  4AQI A;  4QJ5 B;  1SL8 A;  4FQT A;  1OZS A;  4HRH A;  3C1V A;  4I5J A;  4CPV A;  2BNX A;  1PSR A;  5AAN A;  2ZRT A;  2RGI A;  1KWO B;  3PJI A;  1TTX A;  2JNF A;  2R2I A;  4DRW A;  1ZOT B;  4NDD A;  2TN4 A;  2KFH A;  1CMF A;  3K1E A;  2WOR A;  3IVT A;  5JJG A;  3K21 A;  2HQ8 A;  1DF0 B;  4C0J A;  5ER5 A;  2BAP A;  3L4L A;  1L2O C;  2FOT A;  1U5I A;  3FS7 A;  1JSA A;  4HRG A;  2FCD A;  1ZMZ A;  4GNK B;  3CYZ A;  4OCI A;  1DT7 B;  1OOH A;  1YR5 A;  1UUS A;  1SNL A;  1DJY A;  2ZFD A;  3SIA A;  4MLW A;  1JC2 A;  1DJZ A;  2QAC A;  2WCF A;  2E30 A;  1OZO A;  1JFJ A;  5KSZ A;  3WXA A;  3M0W A;  3EK7 A;  3CS1 A;  3FE6 A;  2K0J A;  1QLK A;  1B8L A;  3LCP C;  3B7A A;  1LA0 A;  1MHO A;  3PM8 A;  1AVS A;  4YGA A;  1A75 A;  2LV7 A;  4IJ7 A;  2KGB C;  3FWB A;  3PFV A;  3TDU A;  1K93 D;  3O4Y A;  4OZD A;  3QRX A;  2JC2 A;  4XJK A;  4USL A;  2LHL A;  4M2Q A;  3S0F A;  4CFR A;  2QEH A;  2K60 A;  3BUW B;  2L2C A;  3BYA A;  3R1O A;  2CBL A;  1S6J A;  1CM4 A;  2KNE A;  5I2Q A;  2KYF A;  2AUC A;  2KBI A;  2PAL A;  1V1F A;  2QDI A;  3PAT A;  3SG3 A;  1J7Q A;  1YUS A;  1N65 A;  2KFG A;  3DVJ A;  3KF9 A;  4GUK A;  1F4O A;  2KLD A;  1TUJ A;  2V53 A;  1UUR A;  2QEO A;  2Y4Q A;  1OE9 B;  3OX5 A;  2BBM A;  2JTT A;  1XFZ O;  2CCM A;  5EL2 A;  2LUX A;  1K8U A;  5B8I B;  4YGE B;  2M7L A;  2MRD A;  3JTD B;  2CT9 A;  1BR1 B;  4DIR A;  2M7N A;  1N0Y A;  1REC A;  2WCM A;  4PHN A;  4AOM A;  2Y1N A;  3GK2 A;  3NHT A;  1RFJ A;  1CDL A;  2K2F A;  5HLV A;  3VRQ A;  3A8R A;  3EG5 B;  3GK1 A;  1PUL A;  3FE9 A;  4GGF C;  3BOW A;  1Y6W A;  3I5I C;  3VRP A;  3FIA A;  1SCM B;  1S3P A;  2P70 A;  4A4B A;  1YUU A;  2CTN A;  2K61 A;  2KDH A;  2P71 A;  1TNQ A;  1CLL A;  2LMU A;  2NZ0 A;  1LKJ A;  2L2E A;  2OPO A;  3AKA A;  1ALW A;  2MA2 A;  2QEB A;  2K8M B;  5HYD A;  1AP4 A;  1MF8 B;  3D74 A;  3IQQ A;  1XK4 A;  1UHN A;  1F71 A;  2M8U A;  1QX7 A;  1B1G A;  2BCX A;  1KFX L;  2JZI A;  3EVU A;  1AHR A;  1J1E A;  2L4I A;  4QJ4 B;  4L9M A;  1K94 A;  3TZ1 A;  4ETO A;  5KTY A;  2D8N A;  1JUO A;  1C07 A;  4YRU A;  3PAL A;  2VRG A;  1M45 A;  1NCX A; 
#chains in the Genus database with same CATH homology
 1SW8 A;  3FWC A;  4A4C A;  1NYA A;  1JBA A;  1EG4 A;  1F70 A;  2JXC A;  2DOQ A;  1LXF C;  1A75 B;  3IF7 A;  1AJ4 A;  1SMG A;  5KU1 A;  3TUY B;  1KQV A;  2GGZ A;  1DGV A;  2JQ6 A;  1LIN A;  1CLB A;  1TN4 A;  2G2B A;  4MZK A;  2Q91 A;  1KCY A;  5TNC A;  1QX2 A;  2KSP A;  2L4H A;  1XFW O;  2L98 A;  1OMR A;  1SR6 B;  1QXP A;  2KQ6 A;  4MRY A;  4ORB B;  3NSL A;  1L7Z A;  1NCY A;  2AMI A;  2MBX A;  3BUM B;  2IS9 A;  2M1K B;  1DGU A;  1JFK A;  1TRF A;  1A4P A;  3LK0 A;  2ZN9 A;  1ALV A;  3OX6 A;  4M2O A;  1XFV O;  1B47 A;  2JT8 A;  1KFU L;  2KAX A;  4GGN A;  1HT9 A;  3RLZ A;  5F6T A;  1KQM C;  1SL7 A;  1QIW A;  1CFF A;  1NX2 A;  1IH0 A;  5CSJ A;  4YGB B;  1F55 A;  5PAL A;  4UPG A;  2WND A;  1EL4 A;  1XFU O;  2LUC A;  2QPT A;  4YBH B;  2BKI B;  3PLF B;  2MLE C;  1BLQ A;  2ZN8 A;  3DF0 A;  1ZAC A;  3OB2 B;  4NDC A;  1V1G A;  3EVV A;  3HCM A;  3VRO A;  1QAS A;  2WCB A;  1PAL A;  1IQ3 A;  4IL1 A;  1XK4 C;  2L51 A;  3NSI A;  2KI4 B;  2M1U A;  1TCO B;  2M0R A;  5GQQ C;  4GGF A;  1SL9 A;  2OS8 C;  2BKH B;  1F54 A;  2EGD A;  4I5L B;  3DVM A;  1NPQ A;  1MXE A;  2WCE A;  2I2R E;  5AEQ A;  3I5F C;  4WRI A;  1FF1 A;  4MVF A;  1M39 A;  3BUX B;  1L2O B;  1Y1U A;  1QS7 A;  1AJ5 A;  1G4Y R;  4CID A;  5HKY A;  1CKK A;  2PMY A;  1RRO A;  4D1E A;  2LE9 B;  1NIW A;  2LC5 A;  3I5H C;  5AER A;  3D10 A;  2I18 A;  2HET A;  2LHI A;  1MUX A;  1Y0V H;  1X02 A;  1XO5 A;  4NQG A;  5DKN A;  2K7B A;  4I5N B;  1AUI B;  1QJT A;  1W7J B;  2O5G A;  3EVR A;  3RM1 A;  1ZFS A;  1RK9 A;  5I8N A;  1DJG A;  5I2O A;  4PE0 A;  4PCW A;  1NWD A;  1GQM A;  2LMT A;  2G9B A;  3IQO A;  1OMD A;  4ICB A;  1WRZ A;  1FI6 A;  3E3R A;  1BJF A;  3TDI A;  2LP3 A;  2L50 A;  2L0P A;  1SKT A;  2BCB A;  2Y5I A;  2F2P A;  4QJ3 B;  2A4J A;  1H4B A;  5CSN A;  2F8P A;  4MRX A;  1G33 A;  1IWQ A;  2KBM A;  2KGR A;  1LA3 A;  1QV1 A;  1F8H A;  3BQ3 A;  1JWD A;  3WHT B;  2M9G A;  3DF0 B;  1SCV A;  3EKJ A;  1KSO A;  5DKR A;  4XYN A;  4FQO A;  5K89 A;  1XA5 A;  2I94 A;  3O78 A;  2COL B;  4YGD B;  1AK8 A;  3CWG A;  4PAL A;  2H61 A;  2KYC A;  3JVT C;  3AKB A;  3O6B A;  3NXA A;  1NP8 A;  1W7I B;  1KK7 Z;  1QIV A;  5HLO A;  1XYD A;  2FJU B;  2K2A A;  5JOL A;  4DCK A;  1YTZ C;  4Q04 A;  4AQJ A;  2LM5 A;  1U5I B;  2JNX A;  3F45 A;  5D7F A;  4FTG A;  2KAV A;  4F0Z B;  1CFC A;  1ODB A;  4MEW A;  1BT6 A;  1RTP 1;  1ZUZ A;  2MHH A;  1MWN A;  4N1F A;  2HPS A;  1WY9 A;  1WDC C;  3CZT X;  1EXR A;  2WOS A;  1IRJ A;  2NCO A;  4MZJ A;  4E68 A;  1CDN A;  1R2U A;  2EC6 C;  2JT3 A;  3EKH A;  4C0K A;  1UHK A;  1EH2 A;  2LLU A;  3PN7 C;  1SYM A;  4WQ2 A;  4XJK B;  5HKW A;  1K95 A;  4DUQ A;  3TS5 C;  1GGZ A;  2JPT A;  2EHB A;  1RJV A;  2LAP A;  2MAZ A;  2M97 A;  3CR4 X;  2KI6 C;  4GAO A;  4PHK A;  3EK4 A;  2OTG B;  2BL0 C;  2BE4 A;  4PE7 A;  5CSI A;  1J7P A;  3GK4 X;  3I5G C;  1GJY A;  2KQY A;  3KEV A;  1CLM A;  1C7V A;  1B8R A;  1TNX A;  1NX0 A;  1XVJ A;  1OQP A;  1YVH A;  2LNK A;  4GFT A;  5I2L A;  1MR8 A;  5G08 A;  1SY9 A;  1B7T Z;  2B1U A;  1WLM A;  2LLT A;  1CMG A;  1IGV A;  1KQM B;  2H61 C;  1BF5 A;  1BOC A;  2SCP A;  1F4Q A;  1WRK A;  2ISD A;  2MJW B;  1K96 A;  1KK7 Y;  2KAY A;  1JF2 A;  2M3W A;  3BOW B;  3KHE A;  2LVK A;  4NDB A;  1YRU B;  2M29 A;  1EG3 A;  5DKQ A;  4CLN A;  1K2H A;  1B8C A;  2F3Y A;  1S36 A;  1YVL A;  3BXK A;  4P2Y B;  1KK8 C;  3KPX A;  3GOF A;  1OOJ A;  4N5X A;  2KHN A;  3WNX B;  1M63 B;  1YUT A;  1MXL C;  1Q80 A;  4YI8 A;  1WLZ A;  1YRT B;  1KWO C;  2ZNE A;  1DJX A;  2PSR A;  5D69 A;  2OS8 B;  2BE6 A;  2LAN A;  4TNC A;  1BMO A;  4HRE E;  3ZWH A;  3SG5 A;  1S6I A;  4ZCU A;  3I5F B;  1BR4 B;  1FI5 A;  1TNP A;  1DJH A;  3VRN A;  2LMV A;  4DS7 A;  3HX4 A;  2NXQ A;  4WQ3 A;  1QVI Z;  1SPY A;  3DD4 A;  2HF5 A;  2PAS A;  4MBE A;  4OVN F;  3SJS A;  4CFQ A;  1QX5 B;  1N2D A;  1D1O A;  3WHU B;  1QV0 A;  3D0Y A;  3I5H B;  4HSZ A;  3NSO A;  1UHJ A;  4CFR A;  1NSH A;  1QAT A;  1PRW A;  4OR9 B;  4PHJ A;  2CNP A;  2O60 A;  2LP2 A;  2LVJ A;  4JPZ B;  2LCP A;  1GGW A;  1K9U A;  2JT0 A;  4GBA A;  3NSK A;  2JU0 A;  1B7T Y;  5HKZ A;  2FCE A;  1R6P A;  4BY5 A;  2JXL A;  2CXJ A;  1SK6 D;  1DVI A;  1CM1 A;  4R1E A;  3SIB A;  2Y1M A;  2GV5 A;  3AAJ A;  1WRL A;  3EK8 A;  4GPL B;  4ORA B;  1YX8 A;  1S5G Y;  2PVB A;  3CR2 A;  2LVV A;  3SG6 A;  2WC8 A;  1IKU A;  4YI9 A;  1E8A A;  1K9K A;  3KO0 A;  4OV2 A;  1CFP A;  3MSE B;  1TOP A;  3CTN A;  3OP0 A;  1B4C A;  5AFP A;  3DVE A;  1H8B A;  1S26 D;  1NX3 A;  2F2O A;  2AAO A;  2ZRS A;  1J55 A;  3H4S E;  3JTD C;  3ICB A;  1PVB A;  1QTX A;  3CLN A;  2F33 A;  3BUO B;  3LLE A;  3OB1 B;  1MQ1 A;  2E6W A;  4I5K A;  4ZCV A;  1JF0 A;  5J3X A;  1J1D A;  3I5I B;  2K7O A;  2K7C A;  1S6C A;  5AXI A;  2GGM A;  1A29 A;  2K7D A;  3JVT B;  1PSB A;  1SCM C;  1RWY A;  1CTR A;  3PSR A;  5CPV A;  1M46 A;  3CGA A;  1BU3 A;  4M2P A;  1IQ5 A;  4ORC B;  2P6B B;  3A4U B;  1FPW A;  2F3Z A;  3SG4 A;  1VRK A;  1QVI Y;  2JWW A;  3LK1 A;  5IBW A;  1NUB A;  2Q4U A;  2LVI A;  1YX7 A;  2JRF A;  1UWO A;  1YUR A;  1G8I A;  1QLS A;  1CNP A;  1S1E A;  4PE1 A;  3SG2 A;  2JOJ A;  1KSM A;  1DF0 A;  4MN0 A;  1WDC B;  1B9A A;  3O2P A;  3D0Y B;  1CDM A;  3LL8 B;  1PK0 D;  2EC6 B;  1TIZ A;  3BUN B;  1K9P A;  5BPJ A;  4MZL A;  5ER4 X;  5FYX A;  3PN7 B;  4N1G A;  1EJ3 A;  4JWQ A;  1KFX S;  1SRA A;  2L5X B;  4C0L A;  1LVC D;  4U8D A;  5CSF A;  3TUY C;  1CB1 A;  3TS5 B;  4PDZ A;  1K90 D;  1BG1 A;  1A03 A;  3AAK A;  1IJ5 A;  1CFD A;  3ZNI A;  1Y1A A;  1HQV A;  1IJ6 A;  2SAS A;  4BY4 A;  1SR6 C;  2ZND A;  1TCF A;  3DVK A;  1IG5 A;  4OKH A;  3CR5 X;  2BL0 B;  3OHM B;  2LLS A;  2I7A A;  3VGO A;  1OMV A;  1J7O A;  3I5G B;  2OTG C;  1UHH A;  1NX1 A;  1FW4 A;  2BCA A;  3VRR A;  2MLF C;  4YGC B;  1SBJ A;  1M31 A;  1DJI A;  1UP5 A;  1XFY O;  2KFF A;  3SG7 A;  2KI6 D;  1PVA A;  1FBV A;  1S5G Z;  1Y1X A;  1DMO A;  1OSA A;  1BOD A;  1NCZ A;  1CDP A;  2KOT A;  2H2K A;  2NLN A;  2JTZ A;  2M49 B;  4JQ0 D;  2NCP A;  1J7R A;  4P5O E;  1A2X A;  1KFU S;  1DJW A;  2PRU A;  1DTL A;  4MSP A;  1TNW A;  1C7W A;  2HQW A;  2BEC A;  4PE4 A;  1UHI A;  2ZKM X;  2BBN A;  3TDZ A;  1KK8 B;  1XFX O;  2KI4 C;  2JUL A;  4PHM A;  4AQI A;  4QJ5 B;  1SL8 A;  1OZS A;  4HRH A;  3C1V A;  4I5J A;  4CPV A;  1PSR A;  5AAN A;  2ZRT A;  2RGI A;  1KWO B;  1TTX A;  2JNF A;  2R2I A;  4DRW A;  1ZOT B;  4NDD A;  2TN4 A;  2KFH A;  1CMF A;  2WOR A;  5JJG A;  3K21 A;  2HQ8 A;  1DF0 B;  4C0J A;  5ER5 A;  1L2O C;  2FOT A;  1U5I A;  3FS7 A;  1JSA A;  4HRG A;  2FCD A;  1ZMZ A;  4GNK B;  4OCI A;  1DT7 B;  1YR5 A;  1UUS A;  1SNL A;  1DJY A;  2ZFD A;  3SIA A;  4MLW A;  1JC2 A;  1DJZ A;  2QAC A;  2WCF A;  2E30 A;  1OZO A;  1JFJ A;  5KSZ A;  3WXA A;  3M0W A;  3EK7 A;  3CS1 A;  2K0J A;  1QLK A;  1B8L A;  3LCP C;  3PM8 A;  1LA0 A;  1MHO A;  4YGA A;  1AVS A;  1A75 A;  2LV7 A;  2KGB C;  3FWB A;  3PFV A;  3TDU A;  1K93 D;  3O4Y A;  3QRX A;  2JC2 A;  4XJK A;  4USL A;  2LHL A;  4M2Q A;  3BUW B;  3BYA A;  2CBL A;  1S6J A;  1CM4 A;  2KNE A;  5I2Q A;  2KYF A;  2AUC A;  2KBI A;  2PAL A;  1V1F A;  3PAT A;  3SG3 A;  1J7Q A;  1YUS A;  1N65 A;  2KFG A;  3DVJ A;  3KF9 A;  4GUK A;  1F4O A;  2V53 A;  1UUR A;  2Y4Q A;  1OE9 B;  3OX5 A;  2BBM A;  2JTT A;  1XFZ O;  2CCM A;  2LUX A;  1K8U A;  5B8I B;  4YGE B;  2M7L A;  2MRD A;  3JTD B;  2CT9 A;  1BR1 B;  4DIR A;  2M7N A;  1N0Y A;  1REC A;  4PHN A;  4AOM A;  2Y1N A;  3GK2 A;  1RFJ A;  1CDL A;  2K2F A;  5HLV A;  3VRQ A;  3A8R A;  3GK1 A;  1PUL A;  4GGF C;  3BOW A;  1Y6W A;  3I5I C;  3VRP A;  3FIA A;  1SCM B;  1S3P A;  4A4B A;  1YUU A;  2CTN A;  2K61 A;  2KDH A;  1TNQ A;  1CLL A;  2LMU A;  2NZ0 A;  1LKJ A;  2L2E A;  2OPO A;  3AKA A;  1ALW A;  2MA2 A;  2K8M B;  5HYD A;  1AP4 A;  1MF8 B;  3IQQ A;  1XK4 A;  1UHN A;  1F71 A;  2M8U A;  1QX7 A;  1B1G A;  2BCX A;  1KFX L;  2JZI A;  3EVU A;  1AHR A;  1J1E A;  2L4I A;  4QJ4 B;  4L9M A;  1K94 A;  3TZ1 A;  4ETO A;  5KTY A;  2D8N A;  1JUO A;  1C07 A;  4YRU A;  3PAL A;  2VRG A;  1M45 A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...