2L50A

Solution structure of apo s100a16
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l50A00
1YX8A 3O78A 1WLZA 2L51A 4MLWA 4PDZA 2ZRSA 2LANA 3KO0A 3I5HB 2JWWA 1QVIY 1SPYA 2ZN9A 3EKHA 1UP5A 3PATA 2HF5A 3QRXA 4GAOA 1AVSA 5F6TA 1SNLA 4PALA 4D1EA 2NXQA 4MRXA 4AQJA 1H8BA 1QVIZ 1IQ5A 1SL9A 4L9MA 4BY4A 5JJGA 2NCPA 1JF0A 3KF9A 3TS5B 5CPVA 4OR9B 2M29A 1PSRA 1TOPA 3LCPC 1JSAA 2EHBA 1ODBA 2HPSA 1GGZA 1PSBA 4YGBB 1KSMA 1K9PA 1FF1A 2WOSA 2E30A 1KFXL 2KGRA 2L2EA 3I5GC 2F8PA 3AKBA 4XJKA 1IJ6A 1CDMA 2PSRA 1QX2A 5ER5A 1B7TY 2G2BA 1YX7A 1Y1XA 1WRKA 1EXRA 2GGZA 1OZSA 2M7NA 1F54A 3BUOB 1FI6A 1B7TZ 1XO5A 3GK4X 1YVLA 3LK1A 1YRUB 4I5KA 5CSJA 4CFQA 2BCXA 4DCKA 2P6BB 1KQMC 2LV7A 2JULA 1XK4C 1X02A 1DMOA 4HSZA 4GPLB 4USLA 1RFJA 1A75A 1Y1UA 2MA2A 5AANA 1JWDA 3EK7A 1AJ4A 1BR1B 2LUCA 4BY5A 3CR2A 1IKUA 5AXIA 3GK2A 4QJ4B 3KEVA 2KDHA 5KSZA 2OTGC 1SK6D 1AJ5A 3DVMA 1TN4A 3I5FB 1XFZO 1W7JB 2CTNA 4OVNF 2LMVA 1CFFA 1J7OA 2ZKMX 4JWQA 5CSNA 5DKNA 1M46A 1K90D 3CS1A 3LK0A 1TRFA 3BUMB 1XFYO 2COLB 2KAYA 1SCMC 4C0LA 2I2RE 1NCZA 1V1FA 1CKKA 1OE9B 1GJYA 5IBWA 1CLLA 1CM4A 1CM1A 2M1KB 1SCVA 1BLQA 1PK0D 1XFWO 1IRJA 3D0YA 3SIAA 4CLNA 5BPJA 3NSOA 1FPWA 4GNKB 2TN4A 3EK4A 1S6IA 3KHEA 1FI5A 1TNQA 4DS7A 4ICBA 5ER4X 2JQ6A 2F33A 1YUTA 1LA0A 5I8NA 1PVBA 1DJXA 1L7ZA 1NX0A 4MEWA 2CBLA 1J55A 2ZNDA 1SRAA 2I94A 1QIWA 3I5HC 1CFCA 2FCEA 1J7QA 1ZMZA 2OS8C 1CDNA 3RM1A 2H61A 1A29A 1WDCC 2HETA 3CTNA 1BODA 4NQGA 3I5IB 1BOCA 3TDZA 2LC5A 1XFVO 4M2PA 3PSRA 1UHHA 2MHHA 1D1OA 2PASA 1BT6A 1XK4A 2I7AA 5I2LA 2NLNA 3TS5C 3HCMA 2ZFDA 1U5IB 4QJ5B 2PRUA 2L98A 3EK8A 2JTTA 3H4SE 3LL8B 5D69A 1S36A 3TDIA 5AEQA 1EL4A 1UHNA 4UPGA 1QASA 3BXKA 3PN7B 1N65A 1BG1A 4GGFA 1PALA 5TNCA 1K2HA 4OCIA 1S3PA 1Y1AA 2ZN8A 3PFVA 2KOTA 2B1UA 1SBJA 3O4YA 2F2OA 4MRYA 1QX7A 3JTDB 1QS7A 2V53A 1CFPA 2CCMA 1L2OB 2K7BA 1JBAA 1OMVA 1M63B 2BCAA 3E3RA 3PLFB 2Q91A 2L4HA 3WNXB 2M3WA 2JNXA 3AAKA 4I5LB 4PE1A 3BOWB 1CNPA 2K61A 2CNPA 2PVBA 5HYDA 5KTYA 1J1EA 3IQOA 3I5FC 4YRUA 1KFUS 4NDDA 1B8CA 3SG4A 4N1GA 2L4IA 2K7DA 2NCOA 3BUNB 4PE4A 2LLUA 4R1EA 2SASA 1NSHA 4PE7A 1QJTA 1KK7Y 5HLVA 1FBVA 2LM5A 3C1VA 3O6BA 1LA3A 1M39A 2LNKA 3TZ1A 5B8IB 2BKHB 1XFXO 1DJZA 4ZCVA 2LE9B 1KK7Z 1DT7B 1DJGA 1QLSA 2BBMA 2ISDA 1MXLC 3MSEB 1EG4A 1IGVA 1KWOB 1LINA 1UURA 2LHIA 2WCFA 3OB2B 3NSKA 1G33A 1ZFSA 1HQVA 3FIAA 1KSOA 1QTXA 2AAOA 2AMIA 4C0KA 2OPOA 3VRQA 3WHTB 1YUUA 4E68A 2ZNEA 4DRWA 4MBEA 1J7PA 1KFUL 2JT8A 2K7OA 4GUKA 2BKIB 1CTRA 1MUXA 2JT3A 4MZLA 4XJKB 4YGDB 3RLZA 1SL7A 4ETOA 5HKZA 2KGBC 1DJIA 2KI6C 1AK8A 1G8IA 1CDLA 4ORAB 2F3ZA 1CB1A 1LXFC 3JVTB 3O2PA 2HQ8A 1NCYA 5DKQA 1K9KA 1F55A 4N5XA 4YBHB 1N0YA 2KI4C 1A2XA 2VRGA 1OMRA 4TNCA 1QV0A 2DOQA 2IS9A 1IG5A 1A75B 3VRNA 1SR6B 1KK8C 2WORA 3VRRA 1J7RA 4N1FA 3VROA 4MZJA 1MXEA 1QLKA 1R2UA 1OMDA 1S26D 2HQWA 1RK9A 1DJYA 2WCBA 2BE6A 2M0RA 1E8AA 2ZRTA 1S1EA 1EH2A 2M8UA 1TCFA 3CR5X 1ALWA 1RROA 1B8LA 2AUCA 1QX5B 3HX4A 1YTZC 1L2OC 2LVVA 3IQQA 2M1UA 3GK1A 1CLBA 1UHIA 2BL0B 2K7CA 3NXAA 4YI8A 1NX1A 1QATA 3D0YB 1OZOA 2KBMA 1AUIB 4GGNA 4A4BA 2JXCA 1AP4A 2Y4QA 3CWGA 3DVJA 3EKJA 3BYAA 2O60A 3TUYB 1GQMA 1B8RA 1JFKA 3FS7A 2JNFA 3CGAA 1PRWA 1YVHA 1ZUZA 3I5GB 2CT9A 1K8UA 2WCEA 1NPQA 2A4JA 4PHNA 1EG3A 1UHKA 1NCXA 2K0JA 3VGOA 1WLMA 3DD4A 1BMOA 1OSAA 3DF0A 5J3XA 1ZOTB 2JPTA 3A8RA 4U8DA 2Q4UA 3SG3A 1S6JA 2KYFA 3LLEA 3IF7A 4MVFA 1KWOC 2E6WA 1DGVA 1YRTB 4WQ2A 1SYMA 2WC8A 5FYXA 1RJVA 2F2PA 1TCOB 1CLMA 1ZACA 4P5OE 3OX5A 2LVJA 2LMTA 4YGAA 1R6PA 2L50A 4HRHA 4JQ0D 1A03A 2FCDA 3CR4X 2GV5A 2LHLA 2RGIA 1YUSA 4Q04A 5D7FA 4NDCA 5PALA 1Q80A 1B47A 1IJ5A 1NYAA 1K96A 2KNEA 4DIRA 3CZTX 1XYDA 2BCBA 2BBNA 4I5NB 1CMFA 4HRGA 2I18A 1HT9A 1Y0VH 2JT0A 2K8MB 3WHUB 3PM8A 4CIDA 1W7IB 4GFTA 1JFJA 2L5XB 5I2OA 3DVKA 1KCYA 3SJSA 5AERA 3TDUA 2LMUA 2M7LA 1NWDA 2M9GA 5CSFA 2MRDA 4GBAA 1OOJA 2OS8B 3SG7A 1WDCB 1XVJA 4ORCB 4FTGA 3BUXB 4YGEB 2EC6B 2R2IA 1QXPA 3VRPA 1BF5A 2KI6D 1IH0A 1M45A 4PHJA 2BL0C 3SG2A 1K94A 4YI9A 1XA5A 5HKWA 1SY9A 2FOTA 2LLTA 1C07A 1BJFA 1TTXA 2NZ0A 2Y5IA 3D10A 3TUYC 2G9BA 4F0ZB 3SIBA 4WRIA 1TIZA 1DVIA 3I5IC 1DJHA 2CXJA 3A4UB 1UWOA 2GGMA 1PULA 3NSLA 1JUOA 2PALA 3EVUA 4XYNA 1DTLA 2KQ6A 5GQQC 2JOJA 4I5JA 1NX3A 4YGCB 2H61C 1SMGA 2O5GA 1SKTA 1RWYA 4QJ3B 1XFUO 2H2KA 3F45A 1K95A 2Y1NA 1UUSA 2LVIA 3CLNA 3EVRA 5K89A 2M97A 4FQOA 2MLFC 1GGWA 5AFPA 1OQPA 1VRKA 2LP2A 5DKRA 1M31A 1FW4A 4AOMA 1DGUA 3PN7C 2JXLA 2L0PA 2K2AA 1CFDA 3M0WA 1F71A 1F70A 3ICBA 1NX2A 2JZIA 2LVKA 1NIWA 4JPZB 5I2QA 3SG5A 3JTDC 4MZKA 1WRZA 1A4PA 1N2DA 1Y6WA 1G4YR 4GGFC 2EGDA 2JC2A 5CSIA 1SW8A 1IQ3A 3OHMB 4DUQA 2KQYA 3SG6A 1F4QA 2D8NA 1B1GA 4A4CA 1JF2A 5G08A 1B9AA 4CFRA 1KQVA 1BR4B 1J1DA 2LLSA 2LUXA 2LAPA 1LVCD 3K21A 2QPTA 4PHMA 3OP0A 1CDPA 4HREE 1C7VA 1V1GA 1EJ3A 1S5GY 3PALA 4AQIA 2KFHA 1CMGA 4PHKA 1JC2A 2Y1MA 1KQMB 4C0JA 2LP3A 1S5GZ 2QACA 3ZNIA 2JTZA 1LKJA 3GOFA 5KU1A 4MSPA 4ORBB 2KYCA 1U5IA 2KFGA 3FWCA 2M49B 3BQ3A 1B4CA 1TNXA 2JRFA 3DF0B 4IL1A 4MN0A 2KSPA 3OB1B 3WXAA 2KI4B 2OTGB 2EC6C 4WQ3A 1YR5A 1MWNA 1MF8B 1PVAA 2MBXA 2WNDA 3ZWHA 1S6CA 1NUBA 1MR8A 1UHJA 1KK8B 1DJWA 1IWQA 4PCWA 3FWBA 1TNWA 3OX6A 1YURA 4M2QA 2LCPA 2KHNA 3JVTC 2FJUB 1K93D 1SCMB 1WY9A 4OKHA 5HKYA 4NDBA 1TNPA 1RTP1 2MJWB 4OV2A 4P2YB 1H4BA 1DF0A 2SCPA 4CPVA 1AHRA 1MHOA 3BUWB 1F8HA 4M2OA 2KAXA 5HLOA 2KFFA 2PMYA 4ZCUA 1WRLA 2KBIA 5JOLA 3DVEA 1SR6C 4PE0A 1QIVA 1NP8A 1SL8A 2KAVA 3BOWA 2JU0A 3NSIA 1F4OA 1QV1A 1ALVA 1C7WA 1DF0B 1K9UA 2F3YA 2MLEC 3AKAA 2BECA 1RECA 3AAJA 2MAZA 2BE4A 2K2FA 3KPXA 1BU3A 3EVVA 1KFXS 1MQ1A
chains in the Genus database with same CATH superfamily
1OOGA 1YX8A 3O78A 1WLZA 2L51A 4MLWA 4PDZA 2ZRSA 2LANA 3KO0A 3I5HB 2JWWA 3BFAA 1QVIY 1SPYA 2ZN9A 3B88A 3EKHA 1UP5A 3PATA 2HF5A 3QRXA 4GAOA 3NHIA 1AVSA 5F6TA 1SNLA 4PALA 4D1EA 2NXQA 4MRXA 4AQJA 1H8BA 1QVIZ 1IQ5A 1SL9A 4L9MA 4BY4A 5JJGA 2NCPA 1JF0A 3KF9A 3S0EA 5CPVA 3TS5B 4OR9B 2M29A 1PSRA 1TOPA 2QDIA 3CZ0A 3LCPC 3VB1A 1JSAA 2EHBA 1ODBA 2HPSA 1GGZA 2YGUA 1PSBA 4YGBB 1KSMA 1K9PA 1FF1A 2WOSA 2E30A 1KFXL 2KGRA 2L2EA 3I5GC 2F8PA 3AKBA 4XJKA 1IJ6A 1CDMA 2PSRA 1QX2A 5ER5A 1B7TY 2G2BA 1YX7A 1Y1XA 1WRKA 1EXRA 2GGZA 1OZSA 2M7NA 1F54A 3BUOB 1FI6A 3CZ1A 3BFBA 1B7TZ 1XO5A 3GK4X 1YVLA 3LK1A 1YRUB 4I5KA 5CSJA 4CFQA 2BCXA 1Z2CB 4DCKA 2P6BB 1KQMC 2LV7A 2JULA 1XK4C 1X02A 1DMOA 3CYZA 4GPLB 4HSZA 4USLA 3S0GA 1QWVA 1A75A 1RFJA 1Y1UA 2MA2A 5AANA 1JWDA 2P70A 1AJ4A 1BR1B 2LUCA 3EK7A 3CR2A 4BY5A 5AXIA 3GK2A 4INWA 4QJ4B 1IKUA 3KEVA 2KDHA 5KSZA 2OTGC 1SK6D 1AJ5A 3DVMA 1TN4A 3I5FB 4JKTA 1XFZO 1W7JB 2CTNA 3OGNA 2L5YA 4OVNF 2LMVA 1CFFA 1J7OA 2ZKMX 4JWQA 2L2CA 3B7AA 5CSNA 5DKNA 1M46A 1K90D 3CS1A 3LK0A 2WCMA 1TRFA 3BUMB 1XFYO 2COLB 2KAYA 4JD9A 1SCMC 4C0LA 2I2RE 1NCZA 1V1FA 2WC5A 1CKKA 1OE9B 1GJYA 5IBWA 1OOHA 1CLLA 1CM4A 1CM1A 2M1KB 3CABA 1SCVA 1BLQA 1PK0D 1XFWO 1IRJA 3D0YA 3SIAA 4CLNA 5BPJA 3NSOA 1FPWA 4GNKB 2TN4A 2QEVA 3EK4A 1S6IA 3KHEA 1FI5A 1TNQA 3O4XA 4DS7A 4ICBA 5ER4X 2JQ6A 2WCJA 2F33A 1YUTA 1LA0A 5I8NA 1PVBA 3N7HA 1DJXA 1L7ZA 1NX0A 4MEWA 2CBLA 1J55A 2ZNDA 3B6XA 1SRAA 2I94A 1QIWA 3I5HC 1CFCA 2FCEA 1J7QA 2H8VA 1ZMZA 2OS8C 1CDNA 3RM1A 2H61A 1A29A 1WDCC 2HETA 3CTNA 2GTEA 1BODA 4NQGA 3I5IB 1BOCA 3TDZA 2LC5A 1XFVO 4M2PA 3PSRA 1UHHA 2MHHA 3D77A 2PASA 1D1OA 1BT6A 1XK4A 2I7AA 5I2LA 2NLNA 4FQTA 1DQEA 3TS5C 3HCMA 2ZFDA 1U5IB 4QJ5B 2PRUA 2L98A 3EK8A 2JTTA 3H4SE 3LL8B 1W9ZA 5D69A 1S36A 3TDIA 5AEQA 1EL4A 1UHNA 4UPGA 1QASA 3BXKA 3PN7B 1N65A 1BG1A 4GGFA 1PALA 5TNCA 1K2HA 4OCIA 1S3PA 1TWOA 1Y1AA 2ZN8A 3PFVA 2KOTA 2B1UA 1SBJA 3O4YA 2F2OA 4MRYA 1QX7A 3JTDB 1QS7A 3L47A 3FE9A 2V53A 1CFPA 2CCMA 1L2OB 2WCLA 2K7BA 1JBAA 1OMVA 1M63B 2BCAA 3E3RA 2WC6A 3PLFB 2Q91A 2L4HA 3WNXB 2M3WA 2JNXA 1XFRA 3AAKA 4I5LB 3BOWB 3IVTA 4KYNA 4PE1A 1CNPA 4F7FA 2K61A 4OZDA 2CNPA 2PVBA 5HYDA 5KTYA 1J1EA 3IQOA 3I5FC 4YRUA 1KFUS 4NDDA 1B8CA 3SG4A 4N1GA 2L4IA 2K7DA 2NCOA 3BUNB 4PE4A 2LLUA 4R1EA 2SASA 1NSHA 4IJ7A 1QJTA 1KK7Y 4PE7A 1FBVA 5HLVA 2LM5A 3C1VA 3O6BA 1LA3A 1M39A 2LNKA 2KLDA 3D75A 3TZ1A 5B8IB 2BKHB 1XFXO 1DJZA 4ZCVA 5I94A 2LE9B 1KK7Z 1DT7B 1DJGA 1QLSA 3S0AA 2BBMA 3SS3A 2ISDA 1MXLC 3MSEB 1EG4A 1IGVA 1KWOB 1LINA 1C3ZA 1UURA 2LHIA 2WCFA 3B86A 3OB2B 3NSKA 1C3YA 1G33A 1ZFSA 1HQVA 3FIAA 1KSOA 3S0DA 1QTXA 2AAOA 2AMIA 4C0KA 2OPOA 3VRQA 3WHTB 1YUUA 4E68A 1IIOA 2ZNEA 4DRWA 4MBEA 1J7PA 1KFUL 2JT8A 2K7OA 4GUKA 2BKIB 1CTRA 1MUXA 2JT3A 4MZLA 4XJKB 4YGDB 3RLZA 3PM2A 1SL7A 4ETOA 2K60A 2KGBC 1DJIA 2KI6C 5HKZA 1AK8A 1T14A 3DYEA 3QMEA 1G8IA 1CDLA 4ORAB 1LS8A 2ERBA 2F3ZA 1LXFC 3D78A 3JVTB 1CB1A 3O2PA 2HQ8A 1NCYA 5DKQA 1K9KA 1OW4A 1F55A 1P28A 4N5XA 4YBHB 1N0YA 2KI4C 1A2XA 2VRGA 1OMRA 4TNCA 1QV0A 2DOQA 2IS9A 2PQLA 1IG5A 1A75B 3VRNA 3NHTA 1SR6B 1KK8C 2WORA 3R72A 3VRRA 1J7RA 4N1FA 1DC1A 3FE8A 3VROA 4MZJA 3Q8IA 5DICA 1MXEA 1QLKA 1R2UA 1OMDA 1S26D 2HQWA 1RK9A 1DJYA 2WCBA 2BE6A 2M0RA 1E8AA 2ZRTA 1S1EA 1EH2A 2M8UA 1TCFA 3CR5X 1ALWA 1RROA 3K1EA 1B8LA 2AUCA 1QX5B 3HX4A 1YTZC 1L2OC 2LVVA 3IQQA 2M1UA 3GK1A 1CLBA 1UHIA 2BL0B 2K7CA 3NXAA 1TUJA 3L4LA 4YI8A 1NX1A 1QATA 3D0YB 1OZOA 2KBMA 3NGVA 1AUIB 4GGNA 4A4BA 2JXCA 1AP4A 2Y4QA 3CWGA 3DVJA 3EKJA 5FI2A 3BYAA 2O60A 3TUYB 1JFKA 1B8RA 1GQMA 3FS7A 2JNFA 3CGAA 1PRWA 1YVHA 1ZUZA 3I5GB 3D73A 2CT9A 1DEKA 1K8UA 2WCEA 1NPQA 2A4JA 3D74A 4PHNA 1EG3A 3BFHA 1UHKA 1NCXA 2K0JA 3BJHA 5D3OA 3VGOA 1WLMA 3DD4A 1BMOA 1OSAA 3DF0A 5J3XA 1ZOTB 2JPTA 3A8RA 4U8DA 2Q4UA 3SG3A 1S6JA 2KYFA 3LLEA 3IF7A 4MVFA 1KWOC 2E6WA 1DGVA 1YRTB 4WQ2A 2WCKA 1SYMA 2WC8A 2WCHA 5FYXA 1RJVA 2F2PA 3DZTA 1TCOB 3L4AA 1CLMA 1ZACA 2BNXA 4P5OE 3OX5A 2LVJA 2LMTA 1TUZA 4YGAA 1OOIX 1R6PA 2L50A 4HRHA 4JQ0D 3CDNA 3PJIA 3SS5A 1A03A 2FCDA 3CR4X 2GV5A 2LHLA 2RGIA 1YUSA 4Q04A 5D7FA 4NDCA 5PALA 1Q80A 1B47A 1IJ5A 1NYAA 1K96A 2KNEA 4DIRA 3CZTX 1XYDA 2BCBA 2BBNA 4I5NB 5FI6A 1CMFA 4HRGA 2I18A 1HT9A 1Y0VH 2JPOA 2JT0A 2K8MB 3WHUB 3PM8A 4CIDA 1W7IB 4GFTA 1JFJA 2L5XB 5I2OA 3DVKA 1KCYA 3SJSA 5AERA 3TDUA 1DELA 2LMUA 1NWDA 2M9GA 3OBVA 5CSFA 2MRDA 4GBAA 2M7LA 1OOJA 2OS8B 3SG7A 1WDCB 1XVJA 4ORCB 4FTGA 2KPHA 3BUXB 4YGEB 2EC6B 1ORGA 2R2IA 1QXPA 3VRPA 1BF5A 2KI6D 1IH0A 1M45A 4PHJA 2BL0C 2FJYA 2BAPA 1K94A 3SG2A 4YI9A 1XA5A 5HKWA 1SY9A 2FOTA 2LLTA 1C07A 1BJFA 1TTXA 2NZ0A 2Y5IA 3FE6A 3D10A 3TUYC 2G9BA 4F0ZB 3SIBA 4WRIA 1TIZA 1DVIA 3I5IC 1DJHA 2CXJA 3A4UB 1UWOA 2GGMA 1PULA 3NSLA 1JUOA 2PALA 3EVUA 4XYNA 3R1VA 2QEHA 1DTLA 3UO9A 2KQ6A 3S0FA 5GQQC 2JOJA 4I5JA 1NX3A 4YGCB 2H61C 1SMGA 2O5GA 1SKTA 1RWYA 4QJ3B 1XFUO 2H2KA 3F45A 1K95A 1Z4HA 1UUSA 2LVIA 2Y1NA 3CLNA 3EVRA 2M97A 4FQOA 2MLFC 3SS4A 5K89A 1GGWA 5AFPA 1OQPA 1VRKA 2LP2A 5DKRA 3EG5B 1M31A 1FW4A 4PT1A 4AOMA 1DGUA 3PN7C 2JXLA 2L0PA 2K2AA 3R1OA 3UNWA 1CFDA 3M0WA 1F71A 1F70A 3ICBA 1NX2A 2JZIA 2LVKA 1NIWA 4JPZB 5I2QA 2P71A 3JTDC 4MZKA 1WRZA 1A4PA 5EL2A 3SG5A 1N2DA 1Y6WA 1G4YR 4GGFC 2EGDA 2JC2A 5CSIA 3V2LA 1SW8A 1IQ3A 3DXLA 3OHMB 4DUQA 2KQYA 3SG6A 1F4QA 2D8NA 5HL1A 1B1GA 4A4CA 1JF2A 5G08A 1B9AA 4CFRA 1KQVA 1BR4B 1J1DA 2LLSA 2LUXA 2LAPA 1LVCD 3K21A 2QPTA 4PHMA 3OP0A 1CDPA 3DY9A 4HREE 4INXA 3RZSA 1C7VA 1V1GA 1EJ3A 1S5GY 3PALA 4AQIA 1GM0A 2KFHA 3CZ2A 1CMGA 4PHKA 1JC2A 2Y1MA 1OOFA 1KQMB 4C0JA 2LP3A 1S5GZ 2QACA 3ZNIA 2JTZA 1LKJA 3GOFA 5KU1A 4MSPA 4ORBB 2KYCA 1U5IA 2KFGA 3FWCA 2M49B 3BQ3A 5FI7A 1B4CA 1TNXA 2JRFA 3DF0B 4IL1A 4MN0A 2KSPA 3OB1B 3WXAA 2KI4B 2KLEA 2EC6C 2OTGB 3R1PA 1YR5A 4WQ3A 3B87A 3S0BA 1MWNA 1MF8B 1PVAA 2QEOA 2MBXA 2WNDA 3ZWHA 1S6CA 1NUBA 1MR8A 1UHJA 1KK8B 1DJWA 1IWQA 4PCWA 3FWBA 1TNWA 3OX6A 1YURA 4M2QA 2LCPA 2KHNA 3JVTC 2FJUB 1K93D 1SCMB 1WY9A 4OKHA 5HKYA 4NDBA 1TNPA 1RTP1 2MJWB 4OV2A 4P2YB 1H4BA 1DF0A 2SCPA 4CPVA 1AHRA 1MHOA 3BUWB 2QEBA 1F8HA 4M2OA 2KAXA 5HLOA 2KFFA 2PMYA 4ZCUA 1WRLA 2KBIA 5JOLA 3DVEA 1SR6C 4PE0A 1QIVA 2PYQA 1NP8A 1SL8A 2KAVA 3BOWA 2JU0A 3NSIA 1F4OA 1QV1A 1ALVA 1C7WA 1DF0B 1K9UA 2F3YA 1SSEB 2MLEC 3AKAA 2BECA 1RECA 3AAJA 2MAZA 2BE4A 2K2FA 3D76A 3KPXA 1BU3A 3EVVA 1KFXS 1MQ1A
chains in the Genus database with same CATH topology
1YX8A 3O78A 1WLZA 2L51A 4MLWA 4PDZA 2ZRSA 2LANA 3KO0A 3I5HB 2JWWA 1QVIY 1SPYA 2ZN9A 3EKHA 1UP5A 3PATA 2HF5A 3QRXA 4GAOA 1AVSA 5F6TA 1SNLA 4PALA 4D1EA 2NXQA 4MRXA 4AQJA 1H8BA 1QVIZ 1IQ5A 1SL9A 4L9MA 4BY4A 5JJGA 2NCPA 1JF0A 3KF9A 3TS5B 5CPVA 4OR9B 2M29A 1PSRA 1TOPA 3LCPC 1JSAA 2EHBA 1ODBA 2HPSA 1GGZA 1PSBA 4YGBB 1KSMA 1K9PA 1FF1A 2WOSA 2E30A 1KFXL 2KGRA 2L2EA 3I5GC 2F8PA 3AKBA 4XJKA 1IJ6A 1CDMA 2PSRA 1QX2A 5ER5A 1B7TY 2G2BA 1YX7A 1Y1XA 1WRKA 1EXRA 2GGZA 1OZSA 2M7NA 1F54A 3BUOB 1FI6A 1B7TZ 1XO5A 3GK4X 1YVLA 3LK1A 1YRUB 4I5KA 5CSJA 4CFQA 2BCXA 4DCKA 2P6BB 1KQMC 2LV7A 2JULA 1XK4C 1X02A 1DMOA 4HSZA 4GPLB 4USLA 1RFJA 1A75A 1Y1UA 2MA2A 5AANA 1JWDA 3EK7A 1AJ4A 1BR1B 2LUCA 4BY5A 3CR2A 1IKUA 5AXIA 3GK2A 4QJ4B 3KEVA 2KDHA 5KSZA 2OTGC 1SK6D 1AJ5A 3DVMA 1TN4A 3I5FB 1XFZO 1W7JB 2CTNA 4OVNF 2LMVA 1CFFA 1J7OA 2ZKMX 4JWQA 5CSNA 5DKNA 1M46A 1K90D 3CS1A 3LK0A 1TRFA 3BUMB 1XFYO 2COLB 2KAYA 1SCMC 4C0LA 2I2RE 1NCZA 1V1FA 1CKKA 1OE9B 1GJYA 5IBWA 1CLLA 1CM4A 1CM1A 2M1KB 1SCVA 1BLQA 1PK0D 1XFWO 1IRJA 3D0YA 3SIAA 4CLNA 5BPJA 3NSOA 1FPWA 4GNKB 2TN4A 3EK4A 1S6IA 3KHEA 1FI5A 1TNQA 4DS7A 4ICBA 5ER4X 2JQ6A 2F33A 1YUTA 1LA0A 5I8NA 1PVBA 1DJXA 1L7ZA 1NX0A 4MEWA 2CBLA 1J55A 2ZNDA 1SRAA 2I94A 1QIWA 3I5HC 1CFCA 2FCEA 1J7QA 1ZMZA 2OS8C 1CDNA 3RM1A 2H61A 1A29A 1WDCC 2HETA 3CTNA 1BODA 4NQGA 3I5IB 1BOCA 3TDZA 2LC5A 1XFVO 4M2PA 3PSRA 1UHHA 2MHHA 1D1OA 2PASA 1BT6A 1XK4A 2I7AA 5I2LA 2NLNA 3TS5C 3HCMA 2ZFDA 1U5IB 4QJ5B 2PRUA 2L98A 3EK8A 2JTTA 3H4SE 3LL8B 5D69A 1S36A 3TDIA 5AEQA 1EL4A 1UHNA 4UPGA 1QASA 3BXKA 3PN7B 1N65A 1BG1A 4GGFA 1PALA 5TNCA 1K2HA 4OCIA 1S3PA 1Y1AA 2ZN8A 3PFVA 2KOTA 2B1UA 1SBJA 3O4YA 2F2OA 4MRYA 1QX7A 3JTDB 1QS7A 2V53A 1CFPA 2CCMA 1L2OB 2K7BA 1JBAA 1OMVA 1M63B 2BCAA 3E3RA 3PLFB 2Q91A 2L4HA 3WNXB 2M3WA 2JNXA 3AAKA 4I5LB 4PE1A 3BOWB 1CNPA 2K61A 2CNPA 2PVBA 5HYDA 5KTYA 1J1EA 3IQOA 3I5FC 4YRUA 1KFUS 4NDDA 1B8CA 3SG4A 4N1GA 2L4IA 2K7DA 2NCOA 3BUNB 4PE4A 2LLUA 4R1EA 2SASA 1NSHA 4PE7A 1QJTA 1KK7Y 5HLVA 1FBVA 2LM5A 3C1VA 3O6BA 1LA3A 1M39A 2LNKA 3TZ1A 5B8IB 2BKHB 1XFXO 1DJZA 4ZCVA 2LE9B 1KK7Z 1DT7B 1DJGA 1QLSA 2BBMA 2ISDA 1MXLC 3MSEB 1EG4A 1IGVA 1KWOB 1LINA 1UURA 2LHIA 2WCFA 3OB2B 3NSKA 1G33A 1ZFSA 1HQVA 3FIAA 1KSOA 1QTXA 2AAOA 2AMIA 4C0KA 2OPOA 3VRQA 3WHTB 1YUUA 4E68A 2ZNEA 4DRWA 4MBEA 1J7PA 1KFUL 2JT8A 2K7OA 4GUKA 2BKIB 1CTRA 1MUXA 2JT3A 4MZLA 4XJKB 4YGDB 3RLZA 1SL7A 4ETOA 5HKZA 2KGBC 1DJIA 2KI6C 1AK8A 1G8IA 1CDLA 4ORAB 2F3ZA 1CB1A 1LXFC 3JVTB 3O2PA 2HQ8A 1NCYA 5DKQA 1K9KA 1F55A 4N5XA 4YBHB 1N0YA 2KI4C 1A2XA 2VRGA 1OMRA 4TNCA 1QV0A 2DOQA 2IS9A 1IG5A 1A75B 3VRNA 1SR6B 1KK8C 2WORA 3VRRA 1J7RA 4N1FA 3VROA 4MZJA 1MXEA 1QLKA 1R2UA 1OMDA 1S26D 2HQWA 1RK9A 1DJYA 2WCBA 2BE6A 2M0RA 1E8AA 2ZRTA 1S1EA 1EH2A 2M8UA 1TCFA 3CR5X 1ALWA 1RROA 1B8LA 2AUCA 1QX5B 3HX4A 1YTZC 1L2OC 2LVVA 3IQQA 2M1UA 3GK1A 1CLBA 1UHIA 2BL0B 2K7CA 3NXAA 4YI8A 1NX1A 1QATA 3D0YB 1OZOA 2KBMA 1AUIB 4GGNA 4A4BA 2JXCA 1AP4A 2Y4QA 3CWGA 3DVJA 3EKJA 3BYAA 2O60A 3TUYB 1GQMA 1B8RA 1JFKA 3FS7A 2JNFA 3CGAA 1PRWA 1YVHA 1ZUZA 3I5GB 2CT9A 1K8UA 2WCEA 1NPQA 2A4JA 4PHNA 1EG3A 1UHKA 1NCXA 2K0JA 3VGOA 1WLMA 3DD4A 1BMOA 1OSAA 3DF0A 5J3XA 1ZOTB 2JPTA 3A8RA 4U8DA 2Q4UA 3SG3A 1S6JA 2KYFA 3LLEA 3IF7A 4MVFA 1KWOC 2E6WA 1DGVA 1YRTB 4WQ2A 1SYMA 2WC8A 5FYXA 1RJVA 2F2PA 1TCOB 1CLMA 1ZACA 4P5OE 3OX5A 2LVJA 2LMTA 4YGAA 1R6PA 2L50A 4HRHA 4JQ0D 1A03A 2FCDA 3CR4X 2GV5A 2LHLA 2RGIA 1YUSA 4Q04A 5D7FA 4NDCA 5PALA 1Q80A 1B47A 1IJ5A 1NYAA 1K96A 2KNEA 4DIRA 3CZTX 1XYDA 2BCBA 2BBNA 4I5NB 1CMFA 4HRGA 2I18A 1HT9A 1Y0VH 2JT0A 2K8MB 3WHUB 3PM8A 4CIDA 1W7IB 4GFTA 1JFJA 2L5XB 5I2OA 3DVKA 1KCYA 3SJSA 5AERA 3TDUA 2LMUA 2M7LA 1NWDA 2M9GA 5CSFA 2MRDA 4GBAA 1OOJA 2OS8B 3SG7A 1WDCB 1XVJA 4ORCB 4FTGA 3BUXB 4YGEB 2EC6B 2R2IA 1QXPA 3VRPA 1BF5A 2KI6D 1IH0A 1M45A 4PHJA 2BL0C 3SG2A 1K94A 4YI9A 1XA5A 5HKWA 1SY9A 2FOTA 2LLTA 1C07A 1BJFA 1TTXA 2NZ0A 2Y5IA 3D10A 3TUYC 2G9BA 4F0ZB 3SIBA 4WRIA 1TIZA 1DVIA 3I5IC 1DJHA 2CXJA 3A4UB 1UWOA 2GGMA 1PULA 3NSLA 1JUOA 2PALA 3EVUA 4XYNA 1DTLA 2KQ6A 5GQQC 2JOJA 4I5JA 1NX3A 4YGCB 2H61C 1SMGA 2O5GA 1SKTA 1RWYA 4QJ3B 1XFUO 2H2KA 3F45A 1K95A 2Y1NA 1UUSA 2LVIA 3CLNA 3EVRA 5K89A 2M97A 4FQOA 2MLFC 1GGWA 5AFPA 1OQPA 1VRKA 2LP2A 5DKRA 1M31A 1FW4A 4AOMA 1DGUA 3PN7C 2JXLA 2L0PA 2K2AA 1CFDA 3M0WA 1F71A 1F70A 3ICBA 1NX2A 2JZIA 2LVKA 1NIWA 4JPZB 5I2QA 3SG5A 3JTDC 4MZKA 1WRZA 1A4PA 1N2DA 1Y6WA 1G4YR 4GGFC 2EGDA 2JC2A 5CSIA 1SW8A 1IQ3A 3OHMB 4DUQA 2KQYA 3SG6A 1F4QA 2D8NA 1B1GA 4A4CA 1JF2A 5G08A 1B9AA 4CFRA 1KQVA 1BR4B 1J1DA 2LLSA 2LUXA 2LAPA 1LVCD 3K21A 2QPTA 4PHMA 3OP0A 1CDPA 4HREE 1C7VA 1V1GA 1EJ3A 1S5GY 3PALA 4AQIA 2KFHA 1CMGA 4PHKA 1JC2A 2Y1MA 1KQMB 4C0JA 2LP3A 1S5GZ 2QACA 3ZNIA 2JTZA 1LKJA 3GOFA 5KU1A 4MSPA 4ORBB 2KYCA 1U5IA 2KFGA 3FWCA 2M49B 3BQ3A 1B4CA 1TNXA 2JRFA 3DF0B 4IL1A 4MN0A 2KSPA 3OB1B 3WXAA 2KI4B 2OTGB 2EC6C 4WQ3A 1YR5A 1MWNA 1MF8B 1PVAA 2MBXA 2WNDA 3ZWHA 1S6CA 1NUBA 1MR8A 1UHJA 1KK8B 1DJWA 1IWQA 4PCWA 3FWBA 1TNWA 3OX6A 1YURA 4M2QA 2LCPA 2KHNA 3JVTC 2FJUB 1K93D 1SCMB 1WY9A 4OKHA 5HKYA 4NDBA 1TNPA 1RTP1 2MJWB 4OV2A 4P2YB 1H4BA 1DF0A 2SCPA 4CPVA 1AHRA 1MHOA 3BUWB 1F8HA 4M2OA 2KAXA 5HLOA 2KFFA 2PMYA 4ZCUA 1WRLA 2KBIA 5JOLA 3DVEA 1SR6C 4PE0A 1QIVA 1NP8A 1SL8A 2KAVA 3BOWA 2JU0A 3NSIA 1F4OA 1QV1A 1ALVA 1C7WA 1DF0B 1K9UA 2F3YA 2MLEC 3AKAA 2BECA 1RECA 3AAJA 2MAZA 2BE4A 2K2FA 3KPXA 1BU3A 3EVVA 1KFXS 1MQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX8 A;  3O78 A;  1WLZ A;  2L51 A;  4MLW A;  4PDZ A;  2ZRS A;  2LAN A;  3KO0 A;  3I5H B;  2JWW A;  1QVI Y;  1SPY A;  2ZN9 A;  3EKH A;  1UP5 A;  3PAT A;  2HF5 A;  3QRX A;  4GAO A;  1AVS A;  5F6T A;  1SNL A;  4PAL A;  4D1E A;  2NXQ A;  4MRX A;  4AQJ A;  1H8B A;  1QVI Z;  1IQ5 A;  1SL9 A;  4L9M A;  4BY4 A;  5JJG A;  2NCP A;  1JF0 A;  3KF9 A;  3TS5 B;  5CPV A;  4OR9 B;  2M29 A;  1PSR A;  1TOP A;  3LCP C;  1JSA A;  2EHB A;  1ODB A;  2HPS A;  1GGZ A;  1PSB A;  4YGB B;  1KSM A;  1K9P A;  1FF1 A;  2WOS A;  2E30 A;  1KFX L;  2KGR A;  2L2E A;  3I5G C;  2F8P A;  3AKB A;  4XJK A;  1IJ6 A;  1CDM A;  2PSR A;  1QX2 A;  5ER5 A;  1B7T Y;  2G2B A;  1YX7 A;  1Y1X A;  1WRK A;  1EXR A;  2GGZ A;  1OZS A;  2M7N A;  1F54 A;  3BUO B;  1FI6 A;  1B7T Z;  1XO5 A;  3GK4 X;  1YVL A;  3LK1 A;  1YRU B;  4I5K A;  5CSJ A;  4CFQ A;  2BCX A;  4DCK A;  2P6B B;  1KQM C;  2LV7 A;  2JUL A;  1XK4 C;  1X02 A;  1DMO A;  4HSZ A;  4GPL B;  4USL A;  1RFJ A;  1A75 A;  1Y1U A;  2MA2 A;  5AAN A;  1JWD A;  3EK7 A;  1AJ4 A;  1BR1 B;  2LUC A;  4BY5 A;  3CR2 A;  1IKU A;  5AXI A;  3GK2 A;  4QJ4 B;  3KEV A;  2KDH A;  5KSZ A;  2OTG C;  1SK6 D;  1AJ5 A;  3DVM A;  1TN4 A;  3I5F B;  1XFZ O;  1W7J B;  2CTN A;  4OVN F;  2LMV A;  1CFF A;  1J7O A;  2ZKM X;  4JWQ A;  5CSN A;  5DKN A;  1M46 A;  1K90 D;  3CS1 A;  3LK0 A;  1TRF A;  3BUM B;  1XFY O;  2COL B;  2KAY A;  1SCM C;  4C0L A;  2I2R E;  1NCZ A;  1V1F A;  1CKK A;  1OE9 B;  1GJY A;  5IBW A;  1CLL A;  1CM4 A;  1CM1 A;  2M1K B;  1SCV A;  1BLQ A;  1PK0 D;  1XFW O;  1IRJ A;  3D0Y A;  3SIA A;  4CLN A;  5BPJ A;  3NSO A;  1FPW A;  4GNK B;  2TN4 A;  3EK4 A;  1S6I A;  3KHE A;  1FI5 A;  1TNQ A;  4DS7 A;  4ICB A;  5ER4 X;  2JQ6 A;  2F33 A;  1YUT A;  1LA0 A;  5I8N A;  1PVB A;  1DJX A;  1L7Z A;  1NX0 A;  4MEW A;  2CBL A;  1J55 A;  2ZND A;  1SRA A;  2I94 A;  1QIW A;  3I5H C;  1CFC A;  2FCE A;  1J7Q A;  1ZMZ A;  2OS8 C;  1CDN A;  3RM1 A;  2H61 A;  1A29 A;  1WDC C;  2HET A;  3CTN A;  1BOD A;  4NQG A;  3I5I B;  1BOC A;  3TDZ A;  2LC5 A;  1XFV O;  4M2P A;  3PSR A;  1UHH A;  2MHH A;  1D1O A;  2PAS A;  1BT6 A;  1XK4 A;  2I7A A;  5I2L A;  2NLN A;  3TS5 C;  3HCM A;  2ZFD A;  1U5I B;  4QJ5 B;  2PRU A;  2L98 A;  3EK8 A;  2JTT A;  3H4S E;  3LL8 B;  5D69 A;  1S36 A;  3TDI A;  5AEQ A;  1EL4 A;  1UHN A;  4UPG A;  1QAS A;  3BXK A;  3PN7 B;  1N65 A;  1BG1 A;  4GGF A;  1PAL A;  5TNC A;  1K2H A;  4OCI A;  1S3P A;  1Y1A A;  2ZN8 A;  3PFV A;  2KOT A;  2B1U A;  1SBJ A;  3O4Y A;  2F2O A;  4MRY A;  1QX7 A;  3JTD B;  1QS7 A;  2V53 A;  1CFP A;  2CCM A;  1L2O B;  2K7B A;  1JBA A;  1OMV A;  1M63 B;  2BCA A;  3E3R A;  3PLF B;  2Q91 A;  2L4H A;  3WNX B;  2M3W A;  2JNX A;  3AAK A;  4I5L B;  4PE1 A;  3BOW B;  1CNP A;  2K61 A;  2CNP A;  2PVB A;  5HYD A;  5KTY A;  1J1E A;  3IQO A;  3I5F C;  4YRU A;  1KFU S;  4NDD A;  1B8C A;  3SG4 A;  4N1G A;  2L4I A;  2K7D A;  2NCO A;  3BUN B;  4PE4 A;  2LLU A;  4R1E A;  2SAS A;  1NSH A;  4PE7 A;  1QJT A;  1KK7 Y;  5HLV A;  1FBV A;  2LM5 A;  3C1V A;  3O6B A;  1LA3 A;  1M39 A;  2LNK A;  3TZ1 A;  5B8I B;  2BKH B;  1XFX O;  1DJZ A;  4ZCV A;  2LE9 B;  1KK7 Z;  1DT7 B;  1DJG A;  1QLS A;  2BBM A;  2ISD A;  1MXL C;  3MSE B;  1EG4 A;  1IGV A;  1KWO B;  1LIN A;  1UUR A;  2LHI A;  2WCF A;  3OB2 B;  3NSK A;  1G33 A;  1ZFS A;  1HQV A;  3FIA A;  1KSO A;  1QTX A;  2AAO A;  2AMI A;  4C0K A;  2OPO A;  3VRQ A;  3WHT B;  1YUU A;  4E68 A;  2ZNE A;  4DRW A;  4MBE A;  1J7P A;  1KFU L;  2JT8 A;  2K7O A;  4GUK A;  2BKI B;  1CTR A;  1MUX A;  2JT3 A;  4MZL A;  4XJK B;  4YGD B;  3RLZ A;  1SL7 A;  4ETO A;  5HKZ A;  2KGB C;  1DJI A;  2KI6 C;  1AK8 A;  1G8I A;  1CDL A;  4ORA B;  2F3Z A;  1CB1 A;  1LXF C;  3JVT B;  3O2P A;  2HQ8 A;  1NCY A;  5DKQ A;  1K9K A;  1F55 A;  4N5X A;  4YBH B;  1N0Y A;  2KI4 C;  1A2X A;  2VRG A;  1OMR A;  4TNC A;  1QV0 A;  2DOQ A;  2IS9 A;  1IG5 A;  1A75 B;  3VRN A;  1SR6 B;  1KK8 C;  2WOR A;  3VRR A;  1J7R A;  4N1F A;  3VRO A;  4MZJ A;  1MXE A;  1QLK A;  1R2U A;  1OMD A;  1S26 D;  2HQW A;  1RK9 A;  1DJY A;  2WCB A;  2BE6 A;  2M0R A;  1E8A A;  2ZRT A;  1S1E A;  1EH2 A;  2M8U A;  1TCF A;  3CR5 X;  1ALW A;  1RRO A;  1B8L A;  2AUC A;  1QX5 B;  3HX4 A;  1YTZ C;  1L2O C;  2LVV A;  3IQQ A;  2M1U A;  3GK1 A;  1CLB A;  1UHI A;  2BL0 B;  2K7C A;  3NXA A;  4YI8 A;  1NX1 A;  1QAT A;  3D0Y B;  1OZO A;  2KBM A;  1AUI B;  4GGN A;  4A4B A;  2JXC A;  1AP4 A;  2Y4Q A;  3CWG A;  3DVJ A;  3EKJ A;  3BYA A;  2O60 A;  3TUY B;  1GQM A;  1B8R A;  1JFK A;  3FS7 A;  2JNF A;  3CGA A;  1PRW A;  1YVH A;  1ZUZ A;  3I5G B;  2CT9 A;  1K8U A;  2WCE A;  1NPQ A;  2A4J A;  4PHN A;  1EG3 A;  1UHK A;  1NCX A;  2K0J A;  3VGO A;  1WLM A;  3DD4 A;  1BMO A;  1OSA A;  3DF0 A;  5J3X A;  1ZOT B;  2JPT A;  3A8R A;  4U8D A;  2Q4U A;  3SG3 A;  1S6J A;  2KYF A;  3LLE A;  3IF7 A;  4MVF A;  1KWO C;  2E6W A;  1DGV A;  1YRT B;  4WQ2 A;  1SYM A;  2WC8 A;  5FYX A;  1RJV A;  2F2P A;  1TCO B;  1CLM A;  1ZAC A;  4P5O E;  3OX5 A;  2LVJ A;  2LMT A;  4YGA A;  1R6P A;  2L50 A;  4HRH A;  4JQ0 D;  1A03 A;  2FCD A;  3CR4 X;  2GV5 A;  2LHL A;  2RGI A;  1YUS A;  4Q04 A;  5D7F A;  4NDC A;  5PAL A;  1Q80 A;  1B47 A;  1IJ5 A;  1NYA A;  1K96 A;  2KNE A;  4DIR A;  3CZT X;  1XYD A;  2BCB A;  2BBN A;  4I5N B;  1CMF A;  4HRG A;  2I18 A;  1HT9 A;  1Y0V H;  2JT0 A;  2K8M B;  3WHU B;  3PM8 A;  4CID A;  1W7I B;  4GFT A;  1JFJ A;  2L5X B;  5I2O A;  3DVK A;  1KCY A;  3SJS A;  5AER A;  3TDU A;  2LMU A;  2M7L A;  1NWD A;  2M9G A;  5CSF A;  2MRD A;  4GBA A;  1OOJ A;  2OS8 B;  3SG7 A;  1WDC B;  1XVJ A;  4ORC B;  4FTG A;  3BUX B;  4YGE B;  2EC6 B;  2R2I A;  1QXP A;  3VRP A;  1BF5 A;  2KI6 D;  1IH0 A;  1M45 A;  4PHJ A;  2BL0 C;  3SG2 A;  1K94 A;  4YI9 A;  1XA5 A;  5HKW A;  1SY9 A;  2FOT A;  2LLT A;  1C07 A;  1BJF A;  1TTX A;  2NZ0 A;  2Y5I A;  3D10 A;  3TUY C;  2G9B A;  4F0Z B;  3SIB A;  4WRI A;  1TIZ A;  1DVI A;  3I5I C;  1DJH A;  2CXJ A;  3A4U B;  1UWO A;  2GGM A;  1PUL A;  3NSL A;  1JUO A;  2PAL A;  3EVU A;  4XYN A;  1DTL A;  2KQ6 A;  5GQQ C;  2JOJ A;  4I5J A;  1NX3 A;  4YGC B;  2H61 C;  1SMG A;  2O5G A;  1SKT A;  1RWY A;  4QJ3 B;  1XFU O;  2H2K A;  3F45 A;  1K95 A;  2Y1N A;  1UUS A;  2LVI A;  3CLN A;  3EVR A;  5K89 A;  2M97 A;  4FQO A;  2MLF C;  1GGW A;  5AFP A;  1OQP A;  1VRK A;  2LP2 A;  5DKR A;  1M31 A;  1FW4 A;  4AOM A;  1DGU A;  3PN7 C;  2JXL A;  2L0P A;  2K2A A;  1CFD A;  3M0W A;  1F71 A;  1F70 A;  3ICB A;  1NX2 A;  2JZI A;  2LVK A;  1NIW A;  4JPZ B;  5I2Q A;  3SG5 A;  3JTD C;  4MZK A;  1WRZ A;  1A4P A;  1N2D A;  1Y6W A;  1G4Y R;  4GGF C;  2EGD A;  2JC2 A;  5CSI A;  1SW8 A;  1IQ3 A;  3OHM B;  4DUQ A;  2KQY A;  3SG6 A;  1F4Q A;  2D8N A;  1B1G A;  4A4C A;  1JF2 A;  5G08 A;  1B9A A;  4CFR A;  1KQV A;  1BR4 B;  1J1D A;  2LLS A;  2LUX A;  2LAP A;  1LVC D;  3K21 A;  2QPT A;  4PHM A;  3OP0 A;  1CDP A;  4HRE E;  1C7V A;  1V1G A;  1EJ3 A;  1S5G Y;  3PAL A;  4AQI A;  2KFH A;  1CMG A;  4PHK A;  1JC2 A;  2Y1M A;  1KQM B;  4C0J A;  2LP3 A;  1S5G Z;  2QAC A;  3ZNI A;  2JTZ A;  1LKJ A;  3GOF A;  5KU1 A;  4MSP A;  4ORB B;  2KYC A;  1U5I A;  2KFG A;  3FWC A;  2M49 B;  3BQ3 A;  1B4C A;  1TNX A;  2JRF A;  3DF0 B;  4IL1 A;  4MN0 A;  2KSP A;  3OB1 B;  3WXA A;  2KI4 B;  2OTG B;  2EC6 C;  4WQ3 A;  1YR5 A;  1MWN A;  1MF8 B;  1PVA A;  2MBX A;  2WND A;  3ZWH A;  1S6C A;  1NUB A;  1MR8 A;  1UHJ A;  1KK8 B;  1DJW A;  1IWQ A;  4PCW A;  3FWB A;  1TNW A;  3OX6 A;  1YUR A;  4M2Q A;  2LCP A;  2KHN A;  3JVT C;  2FJU B;  1K93 D;  1SCM B;  1WY9 A;  4OKH A;  5HKY A;  4NDB A;  1TNP A;  1RTP 1;  2MJW B;  4OV2 A;  4P2Y B;  1H4B A;  1DF0 A;  2SCP A;  4CPV A;  1AHR A;  1MHO A;  3BUW B;  1F8H A;  4M2O A;  2KAX A;  5HLO A;  2KFF A;  2PMY A;  4ZCU A;  1WRL A;  2KBI A;  5JOL A;  3DVE A;  1SR6 C;  4PE0 A;  1QIV A;  1NP8 A;  1SL8 A;  2KAV A;  3BOW A;  2JU0 A;  3NSI A;  1F4O A;  1QV1 A;  1ALV A;  1C7W A;  1DF0 B;  1K9U A;  2F3Y A;  2MLE C;  3AKA A;  2BEC A;  1REC A;  3AAJ A;  2MAZ A;  2BE4 A;  2K2F A;  3KPX A;  1BU3 A;  3EVV A;  1KFX S;  1MQ1 A; 
#chains in the Genus database with same CATH topology
 1OOG A;  1YX8 A;  3O78 A;  1WLZ A;  2L51 A;  4MLW A;  4PDZ A;  2ZRS A;  2LAN A;  3KO0 A;  3I5H B;  2JWW A;  3BFA A;  1QVI Y;  1SPY A;  2ZN9 A;  3B88 A;  3EKH A;  1UP5 A;  3PAT A;  2HF5 A;  3QRX A;  4GAO A;  3NHI A;  1AVS A;  5F6T A;  1SNL A;  4PAL A;  4D1E A;  2NXQ A;  4MRX A;  4AQJ A;  1H8B A;  1QVI Z;  1IQ5 A;  1SL9 A;  4L9M A;  4BY4 A;  5JJG A;  2NCP A;  1JF0 A;  3KF9 A;  3S0E A;  5CPV A;  3TS5 B;  4OR9 B;  2M29 A;  1PSR A;  1TOP A;  2QDI A;  3CZ0 A;  3LCP C;  3VB1 A;  1JSA A;  2EHB A;  1ODB A;  2HPS A;  1GGZ A;  2YGU A;  1PSB A;  4YGB B;  1KSM A;  1K9P A;  1FF1 A;  2WOS A;  2E30 A;  1KFX L;  2KGR A;  2L2E A;  3I5G C;  2F8P A;  3AKB A;  4XJK A;  1IJ6 A;  1CDM A;  2PSR A;  1QX2 A;  5ER5 A;  1B7T Y;  2G2B A;  1YX7 A;  1Y1X A;  1WRK A;  1EXR A;  2GGZ A;  1OZS A;  2M7N A;  1F54 A;  3BUO B;  1FI6 A;  3CZ1 A;  3BFB A;  1B7T Z;  1XO5 A;  3GK4 X;  1YVL A;  3LK1 A;  1YRU B;  4I5K A;  5CSJ A;  4CFQ A;  2BCX A;  1Z2C B;  4DCK A;  2P6B B;  1KQM C;  2LV7 A;  2JUL A;  1XK4 C;  1X02 A;  1DMO A;  3CYZ A;  4GPL B;  4HSZ A;  4USL A;  3S0G A;  1QWV A;  1A75 A;  1RFJ A;  1Y1U A;  2MA2 A;  5AAN A;  1JWD A;  2P70 A;  1AJ4 A;  1BR1 B;  2LUC A;  3EK7 A;  3CR2 A;  4BY5 A;  5AXI A;  3GK2 A;  4INW A;  4QJ4 B;  1IKU A;  3KEV A;  2KDH A;  5KSZ A;  2OTG C;  1SK6 D;  1AJ5 A;  3DVM A;  1TN4 A;  3I5F B;  4JKT A;  1XFZ O;  1W7J B;  2CTN A;  3OGN A;  2L5Y A;  4OVN F;  2LMV A;  1CFF A;  1J7O A;  2ZKM X;  4JWQ A;  2L2C A;  3B7A A;  5CSN A;  5DKN A;  1M46 A;  1K90 D;  3CS1 A;  3LK0 A;  2WCM A;  1TRF A;  3BUM B;  1XFY O;  2COL B;  2KAY A;  4JD9 A;  1SCM C;  4C0L A;  2I2R E;  1NCZ A;  1V1F A;  2WC5 A;  1CKK A;  1OE9 B;  1GJY A;  5IBW A;  1OOH A;  1CLL A;  1CM4 A;  1CM1 A;  2M1K B;  3CAB A;  1SCV A;  1BLQ A;  1PK0 D;  1XFW O;  1IRJ A;  3D0Y A;  3SIA A;  4CLN A;  5BPJ A;  3NSO A;  1FPW A;  4GNK B;  2TN4 A;  2QEV A;  3EK4 A;  1S6I A;  3KHE A;  1FI5 A;  1TNQ A;  3O4X A;  4DS7 A;  4ICB A;  5ER4 X;  2JQ6 A;  2WCJ A;  2F33 A;  1YUT A;  1LA0 A;  5I8N A;  1PVB A;  3N7H A;  1DJX A;  1L7Z A;  1NX0 A;  4MEW A;  2CBL A;  1J55 A;  2ZND A;  3B6X A;  1SRA A;  2I94 A;  1QIW A;  3I5H C;  1CFC A;  2FCE A;  1J7Q A;  2H8V A;  1ZMZ A;  2OS8 C;  1CDN A;  3RM1 A;  2H61 A;  1A29 A;  1WDC C;  2HET A;  3CTN A;  2GTE A;  1BOD A;  4NQG A;  3I5I B;  1BOC A;  3TDZ A;  2LC5 A;  1XFV O;  4M2P A;  3PSR A;  1UHH A;  2MHH A;  3D77 A;  2PAS A;  1D1O A;  1BT6 A;  1XK4 A;  2I7A A;  5I2L A;  2NLN A;  4FQT A;  1DQE A;  3TS5 C;  3HCM A;  2ZFD A;  1U5I B;  4QJ5 B;  2PRU A;  2L98 A;  3EK8 A;  2JTT A;  3H4S E;  3LL8 B;  1W9Z A;  5D69 A;  1S36 A;  3TDI A;  5AEQ A;  1EL4 A;  1UHN A;  4UPG A;  1QAS A;  3BXK A;  3PN7 B;  1N65 A;  1BG1 A;  4GGF A;  1PAL A;  5TNC A;  1K2H A;  4OCI A;  1S3P A;  1TWO A;  1Y1A A;  2ZN8 A;  3PFV A;  2KOT A;  2B1U A;  1SBJ A;  3O4Y A;  2F2O A;  4MRY A;  1QX7 A;  3JTD B;  1QS7 A;  3L47 A;  3FE9 A;  2V53 A;  1CFP A;  2CCM A;  1L2O B;  2WCL A;  2K7B A;  1JBA A;  1OMV A;  1M63 B;  2BCA A;  3E3R A;  2WC6 A;  3PLF B;  2Q91 A;  2L4H A;  3WNX B;  2M3W A;  2JNX A;  1XFR A;  3AAK A;  4I5L B;  3BOW B;  3IVT A;  4KYN A;  4PE1 A;  1CNP A;  4F7F A;  2K61 A;  4OZD A;  2CNP A;  2PVB A;  5HYD A;  5KTY A;  1J1E A;  3IQO A;  3I5F C;  4YRU A;  1KFU S;  4NDD A;  1B8C A;  3SG4 A;  4N1G A;  2L4I A;  2K7D A;  2NCO A;  3BUN B;  4PE4 A;  2LLU A;  4R1E A;  2SAS A;  1NSH A;  4IJ7 A;  1QJT A;  1KK7 Y;  4PE7 A;  1FBV A;  5HLV A;  2LM5 A;  3C1V A;  3O6B A;  1LA3 A;  1M39 A;  2LNK A;  2KLD A;  3D75 A;  3TZ1 A;  5B8I B;  2BKH B;  1XFX O;  1DJZ A;  4ZCV A;  5I94 A;  2LE9 B;  1KK7 Z;  1DT7 B;  1DJG A;  1QLS A;  3S0A A;  2BBM A;  3SS3 A;  2ISD A;  1MXL C;  3MSE B;  1EG4 A;  1IGV A;  1KWO B;  1LIN A;  1C3Z A;  1UUR A;  2LHI A;  2WCF A;  3B86 A;  3OB2 B;  3NSK A;  1C3Y A;  1G33 A;  1ZFS A;  1HQV A;  3FIA A;  1KSO A;  3S0D A;  1QTX A;  2AAO A;  2AMI A;  4C0K A;  2OPO A;  3VRQ A;  3WHT B;  1YUU A;  4E68 A;  1IIO A;  2ZNE A;  4DRW A;  4MBE A;  1J7P A;  1KFU L;  2JT8 A;  2K7O A;  4GUK A;  2BKI B;  1CTR A;  1MUX A;  2JT3 A;  4MZL A;  4XJK B;  4YGD B;  3RLZ A;  3PM2 A;  1SL7 A;  4ETO A;  2K60 A;  2KGB C;  1DJI A;  2KI6 C;  5HKZ A;  1AK8 A;  1T14 A;  3DYE A;  3QME A;  1G8I A;  1CDL A;  4ORA B;  1LS8 A;  2ERB A;  2F3Z A;  1LXF C;  3D78 A;  3JVT B;  1CB1 A;  3O2P A;  2HQ8 A;  1NCY A;  5DKQ A;  1K9K A;  1OW4 A;  1F55 A;  1P28 A;  4N5X A;  4YBH B;  1N0Y A;  2KI4 C;  1A2X A;  2VRG A;  1OMR A;  4TNC A;  1QV0 A;  2DOQ A;  2IS9 A;  2PQL A;  1IG5 A;  1A75 B;  3VRN A;  3NHT A;  1SR6 B;  1KK8 C;  2WOR A;  3R72 A;  3VRR A;  1J7R A;  4N1F A;  1DC1 A;  3FE8 A;  3VRO A;  4MZJ A;  3Q8I A;  5DIC A;  1MXE A;  1QLK A;  1R2U A;  1OMD A;  1S26 D;  2HQW A;  1RK9 A;  1DJY A;  2WCB A;  2BE6 A;  2M0R A;  1E8A A;  2ZRT A;  1S1E A;  1EH2 A;  2M8U A;  1TCF A;  3CR5 X;  1ALW A;  1RRO A;  3K1E A;  1B8L A;  2AUC A;  1QX5 B;  3HX4 A;  1YTZ C;  1L2O C;  2LVV A;  3IQQ A;  2M1U A;  3GK1 A;  1CLB A;  1UHI A;  2BL0 B;  2K7C A;  3NXA A;  1TUJ A;  3L4L A;  4YI8 A;  1NX1 A;  1QAT A;  3D0Y B;  1OZO A;  2KBM A;  3NGV A;  1AUI B;  4GGN A;  4A4B A;  2JXC A;  1AP4 A;  2Y4Q A;  3CWG A;  3DVJ A;  3EKJ A;  5FI2 A;  3BYA A;  2O60 A;  3TUY B;  1JFK A;  1B8R A;  1GQM A;  3FS7 A;  2JNF A;  3CGA A;  1PRW A;  1YVH A;  1ZUZ A;  3I5G B;  3D73 A;  2CT9 A;  1DEK A;  1K8U A;  2WCE A;  1NPQ A;  2A4J A;  3D74 A;  4PHN A;  1EG3 A;  3BFH A;  1UHK A;  1NCX A;  2K0J A;  3BJH A;  5D3O A;  3VGO A;  1WLM A;  3DD4 A;  1BMO A;  1OSA A;  3DF0 A;  5J3X A;  1ZOT B;  2JPT A;  3A8R A;  4U8D A;  2Q4U A;  3SG3 A;  1S6J A;  2KYF A;  3LLE A;  3IF7 A;  4MVF A;  1KWO C;  2E6W A;  1DGV A;  1YRT B;  4WQ2 A;  2WCK A;  1SYM A;  2WC8 A;  2WCH A;  5FYX A;  1RJV A;  2F2P A;  3DZT A;  1TCO B;  3L4A A;  1CLM A;  1ZAC A;  2BNX A;  4P5O E;  3OX5 A;  2LVJ A;  2LMT A;  1TUZ A;  4YGA A;  1OOI X;  1R6P A;  2L50 A;  4HRH A;  4JQ0 D;  3CDN A;  3PJI A;  3SS5 A;  1A03 A;  2FCD A;  3CR4 X;  2GV5 A;  2LHL A;  2RGI A;  1YUS A;  4Q04 A;  5D7F A;  4NDC A;  5PAL A;  1Q80 A;  1B47 A;  1IJ5 A;  1NYA A;  1K96 A;  2KNE A;  4DIR A;  3CZT X;  1XYD A;  2BCB A;  2BBN A;  4I5N B;  5FI6 A;  1CMF A;  4HRG A;  2I18 A;  1HT9 A;  1Y0V H;  2JPO A;  2JT0 A;  2K8M B;  3WHU B;  3PM8 A;  4CID A;  1W7I B;  4GFT A;  1JFJ A;  2L5X B;  5I2O A;  3DVK A;  1KCY A;  3SJS A;  5AER A;  3TDU A;  1DEL A;  2LMU A;  1NWD A;  2M9G A;  3OBV A;  5CSF A;  2MRD A;  4GBA A;  2M7L A;  1OOJ A;  2OS8 B;  3SG7 A;  1WDC B;  1XVJ A;  4ORC B;  4FTG A;  2KPH A;  3BUX B;  4YGE B;  2EC6 B;  1ORG A;  2R2I A;  1QXP A;  3VRP A;  1BF5 A;  2KI6 D;  1IH0 A;  1M45 A;  4PHJ A;  2BL0 C;  2FJY A;  2BAP A;  1K94 A;  3SG2 A;  4YI9 A;  1XA5 A;  5HKW A;  1SY9 A;  2FOT A;  2LLT A;  1C07 A;  1BJF A;  1TTX A;  2NZ0 A;  2Y5I A;  3FE6 A;  3D10 A;  3TUY C;  2G9B A;  4F0Z B;  3SIB A;  4WRI A;  1TIZ A;  1DVI A;  3I5I C;  1DJH A;  2CXJ A;  3A4U B;  1UWO A;  2GGM A;  1PUL A;  3NSL A;  1JUO A;  2PAL A;  3EVU A;  4XYN A;  3R1V A;  2QEH A;  1DTL A;  3UO9 A;  2KQ6 A;  3S0F A;  5GQQ C;  2JOJ A;  4I5J A;  1NX3 A;  4YGC B;  2H61 C;  1SMG A;  2O5G A;  1SKT A;  1RWY A;  4QJ3 B;  1XFU O;  2H2K A;  3F45 A;  1K95 A;  1Z4H A;  1UUS A;  2LVI A;  2Y1N A;  3CLN A;  3EVR A;  2M97 A;  4FQO A;  2MLF C;  3SS4 A;  5K89 A;  1GGW A;  5AFP A;  1OQP A;  1VRK A;  2LP2 A;  5DKR A;  3EG5 B;  1M31 A;  1FW4 A;  4PT1 A;  4AOM A;  1DGU A;  3PN7 C;  2JXL A;  2L0P A;  2K2A A;  3R1O A;  3UNW A;  1CFD A;  3M0W A;  1F71 A;  1F70 A;  3ICB A;  1NX2 A;  2JZI A;  2LVK A;  1NIW A;  4JPZ B;  5I2Q A;  2P71 A;  3JTD C;  4MZK A;  1WRZ A;  1A4P A;  5EL2 A;  3SG5 A;  1N2D A;  1Y6W A;  1G4Y R;  4GGF C;  2EGD A;  2JC2 A;  5CSI A;  3V2L A;  1SW8 A;  1IQ3 A;  3DXL A;  3OHM B;  4DUQ A;  2KQY A;  3SG6 A;  1F4Q A;  2D8N A;  5HL1 A;  1B1G A;  4A4C A;  1JF2 A;  5G08 A;  1B9A A;  4CFR A;  1KQV A;  1BR4 B;  1J1D A;  2LLS A;  2LUX A;  2LAP A;  1LVC D;  3K21 A;  2QPT A;  4PHM A;  3OP0 A;  1CDP A;  3DY9 A;  4HRE E;  4INX A;  3RZS A;  1C7V A;  1V1G A;  1EJ3 A;  1S5G Y;  3PAL A;  4AQI A;  1GM0 A;  2KFH A;  3CZ2 A;  1CMG A;  4PHK A;  1JC2 A;  2Y1M A;  1OOF A;  1KQM B;  4C0J A;  2LP3 A;  1S5G Z;  2QAC A;  3ZNI A;  2JTZ A;  1LKJ A;  3GOF A;  5KU1 A;  4MSP A;  4ORB B;  2KYC A;  1U5I A;  2KFG A;  3FWC A;  2M49 B;  3BQ3 A;  5FI7 A;  1B4C A;  1TNX A;  2JRF A;  3DF0 B;  4IL1 A;  4MN0 A;  2KSP A;  3OB1 B;  3WXA A;  2KI4 B;  2KLE A;  2EC6 C;  2OTG B;  3R1P A;  1YR5 A;  4WQ3 A;  3B87 A;  3S0B A;  1MWN A;  1MF8 B;  1PVA A;  2QEO A;  2MBX A;  2WND A;  3ZWH A;  1S6C A;  1NUB A;  1MR8 A;  1UHJ A;  1KK8 B;  1DJW A;  1IWQ A;  4PCW A;  3FWB A;  1TNW A;  3OX6 A;  1YUR A;  4M2Q A;  2LCP A;  2KHN A;  3JVT C;  2FJU B;  1K93 D;  1SCM B;  1WY9 A;  4OKH A;  5HKY A;  4NDB A;  1TNP A;  1RTP 1;  2MJW B;  4OV2 A;  4P2Y B;  1H4B A;  1DF0 A;  2SCP A;  4CPV A;  1AHR A;  1MHO A;  3BUW B;  2QEB A;  1F8H A;  4M2O A;  2KAX A;  5HLO A;  2KFF A;  2PMY A;  4ZCU A;  1WRL A;  2KBI A;  5JOL A;  3DVE A;  1SR6 C;  4PE0 A;  1QIV A;  2PYQ A;  1NP8 A;  1SL8 A;  2KAV A;  3BOW A;  2JU0 A;  3NSI A;  1F4O A;  1QV1 A;  1ALV A;  1C7W A;  1DF0 B;  1K9U A;  2F3Y A;  1SSE B;  2MLE C;  3AKA A;  2BEC A;  1REC A;  3AAJ A;  2MAZ A;  2BE4 A;  2K2F A;  3D76 A;  3KPX A;  1BU3 A;  3EVV A;  1KFX S;  1MQ1 A; 
#chains in the Genus database with same CATH homology
 1YX8 A;  3O78 A;  1WLZ A;  2L51 A;  4MLW A;  4PDZ A;  2ZRS A;  2LAN A;  3KO0 A;  3I5H B;  2JWW A;  1QVI Y;  1SPY A;  2ZN9 A;  3EKH A;  1UP5 A;  3PAT A;  2HF5 A;  3QRX A;  4GAO A;  1AVS A;  5F6T A;  1SNL A;  4PAL A;  4D1E A;  2NXQ A;  4MRX A;  4AQJ A;  1H8B A;  1QVI Z;  1IQ5 A;  1SL9 A;  4L9M A;  4BY4 A;  5JJG A;  2NCP A;  1JF0 A;  3KF9 A;  3TS5 B;  5CPV A;  4OR9 B;  2M29 A;  1PSR A;  1TOP A;  3LCP C;  1JSA A;  2EHB A;  1ODB A;  2HPS A;  1GGZ A;  1PSB A;  4YGB B;  1KSM A;  1K9P A;  1FF1 A;  2WOS A;  2E30 A;  1KFX L;  2KGR A;  2L2E A;  3I5G C;  2F8P A;  3AKB A;  4XJK A;  1IJ6 A;  1CDM A;  2PSR A;  1QX2 A;  5ER5 A;  1B7T Y;  2G2B A;  1YX7 A;  1Y1X A;  1WRK A;  1EXR A;  2GGZ A;  1OZS A;  2M7N A;  1F54 A;  3BUO B;  1FI6 A;  1B7T Z;  1XO5 A;  3GK4 X;  1YVL A;  3LK1 A;  1YRU B;  4I5K A;  5CSJ A;  4CFQ A;  2BCX A;  4DCK A;  2P6B B;  1KQM C;  2LV7 A;  2JUL A;  1XK4 C;  1X02 A;  1DMO A;  4HSZ A;  4GPL B;  4USL A;  1RFJ A;  1A75 A;  1Y1U A;  2MA2 A;  5AAN A;  1JWD A;  3EK7 A;  1AJ4 A;  1BR1 B;  2LUC A;  4BY5 A;  3CR2 A;  1IKU A;  5AXI A;  3GK2 A;  4QJ4 B;  3KEV A;  2KDH A;  5KSZ A;  2OTG C;  1SK6 D;  1AJ5 A;  3DVM A;  1TN4 A;  3I5F B;  1XFZ O;  1W7J B;  2CTN A;  4OVN F;  2LMV A;  1CFF A;  1J7O A;  2ZKM X;  4JWQ A;  5CSN A;  5DKN A;  1M46 A;  1K90 D;  3CS1 A;  3LK0 A;  1TRF A;  3BUM B;  1XFY O;  2COL B;  2KAY A;  1SCM C;  4C0L A;  2I2R E;  1NCZ A;  1V1F A;  1CKK A;  1OE9 B;  1GJY A;  5IBW A;  1CLL A;  1CM4 A;  1CM1 A;  2M1K B;  1SCV A;  1BLQ A;  1PK0 D;  1XFW O;  1IRJ A;  3D0Y A;  3SIA A;  4CLN A;  5BPJ A;  3NSO A;  1FPW A;  4GNK B;  2TN4 A;  3EK4 A;  1S6I A;  3KHE A;  1FI5 A;  1TNQ A;  4DS7 A;  4ICB A;  5ER4 X;  2JQ6 A;  2F33 A;  1YUT A;  1LA0 A;  5I8N A;  1PVB A;  1DJX A;  1L7Z A;  1NX0 A;  4MEW A;  2CBL A;  1J55 A;  2ZND A;  1SRA A;  2I94 A;  1QIW A;  3I5H C;  1CFC A;  2FCE A;  1J7Q A;  1ZMZ A;  2OS8 C;  1CDN A;  3RM1 A;  2H61 A;  1A29 A;  1WDC C;  2HET A;  3CTN A;  1BOD A;  4NQG A;  3I5I B;  1BOC A;  3TDZ A;  2LC5 A;  1XFV O;  4M2P A;  3PSR A;  1UHH A;  2MHH A;  1D1O A;  2PAS A;  1BT6 A;  1XK4 A;  2I7A A;  5I2L A;  2NLN A;  3TS5 C;  3HCM A;  2ZFD A;  1U5I B;  4QJ5 B;  2PRU A;  2L98 A;  3EK8 A;  2JTT A;  3H4S E;  3LL8 B;  5D69 A;  1S36 A;  3TDI A;  5AEQ A;  1EL4 A;  1UHN A;  4UPG A;  1QAS A;  3BXK A;  3PN7 B;  1N65 A;  1BG1 A;  4GGF A;  1PAL A;  5TNC A;  1K2H A;  4OCI A;  1S3P A;  1Y1A A;  2ZN8 A;  3PFV A;  2KOT A;  2B1U A;  1SBJ A;  3O4Y A;  2F2O A;  4MRY A;  1QX7 A;  3JTD B;  1QS7 A;  2V53 A;  1CFP A;  2CCM A;  1L2O B;  2K7B A;  1JBA A;  1OMV A;  1M63 B;  2BCA A;  3E3R A;  3PLF B;  2Q91 A;  2L4H A;  3WNX B;  2M3W A;  2JNX A;  3AAK A;  4I5L B;  4PE1 A;  3BOW B;  1CNP A;  2K61 A;  2CNP A;  2PVB A;  5HYD A;  5KTY A;  1J1E A;  3IQO A;  3I5F C;  4YRU A;  1KFU S;  4NDD A;  1B8C A;  3SG4 A;  4N1G A;  2L4I A;  2K7D A;  2NCO A;  3BUN B;  4PE4 A;  2LLU A;  4R1E A;  2SAS A;  1NSH A;  4PE7 A;  1QJT A;  1KK7 Y;  5HLV A;  1FBV A;  2LM5 A;  3C1V A;  3O6B A;  1LA3 A;  1M39 A;  2LNK A;  3TZ1 A;  5B8I B;  2BKH B;  1XFX O;  1DJZ A;  4ZCV A;  2LE9 B;  1KK7 Z;  1DT7 B;  1DJG A;  1QLS A;  2BBM A;  2ISD A;  1MXL C;  3MSE B;  1EG4 A;  1IGV A;  1KWO B;  1LIN A;  1UUR A;  2LHI A;  2WCF A;  3OB2 B;  3NSK A;  1G33 A;  1ZFS A;  1HQV A;  3FIA A;  1KSO A;  1QTX A;  2AAO A;  2AMI A;  4C0K A;  2OPO A;  3VRQ A;  3WHT B;  1YUU A;  4E68 A;  2ZNE A;  4DRW A;  4MBE A;  1J7P A;  1KFU L;  2JT8 A;  2K7O A;  4GUK A;  2BKI B;  1CTR A;  1MUX A;  2JT3 A;  4MZL A;  4XJK B;  4YGD B;  3RLZ A;  1SL7 A;  4ETO A;  5HKZ A;  2KGB C;  1DJI A;  2KI6 C;  1AK8 A;  1G8I A;  1CDL A;  4ORA B;  2F3Z A;  1CB1 A;  1LXF C;  3JVT B;  3O2P A;  2HQ8 A;  1NCY A;  5DKQ A;  1K9K A;  1F55 A;  4N5X A;  4YBH B;  1N0Y A;  2KI4 C;  1A2X A;  2VRG A;  1OMR A;  4TNC A;  1QV0 A;  2DOQ A;  2IS9 A;  1IG5 A;  1A75 B;  3VRN A;  1SR6 B;  1KK8 C;  2WOR A;  3VRR A;  1J7R A;  4N1F A;  3VRO A;  4MZJ A;  1MXE A;  1QLK A;  1R2U A;  1OMD A;  1S26 D;  2HQW A;  1RK9 A;  1DJY A;  2WCB A;  2BE6 A;  2M0R A;  1E8A A;  2ZRT A;  1S1E A;  1EH2 A;  2M8U A;  1TCF A;  3CR5 X;  1ALW A;  1RRO A;  1B8L A;  2AUC A;  1QX5 B;  3HX4 A;  1YTZ C;  1L2O C;  2LVV A;  3IQQ A;  2M1U A;  3GK1 A;  1CLB A;  1UHI A;  2BL0 B;  2K7C A;  3NXA A;  4YI8 A;  1NX1 A;  1QAT A;  3D0Y B;  1OZO A;  2KBM A;  1AUI B;  4GGN A;  4A4B A;  2JXC A;  1AP4 A;  2Y4Q A;  3CWG A;  3DVJ A;  3EKJ A;  3BYA A;  2O60 A;  3TUY B;  1GQM A;  1B8R A;  1JFK A;  3FS7 A;  2JNF A;  3CGA A;  1PRW A;  1YVH A;  1ZUZ A;  3I5G B;  2CT9 A;  1K8U A;  2WCE A;  1NPQ A;  2A4J A;  4PHN A;  1EG3 A;  1UHK A;  1NCX A;  2K0J A;  3VGO A;  1WLM A;  3DD4 A;  1BMO A;  1OSA A;  3DF0 A;  5J3X A;  1ZOT B;  2JPT A;  3A8R A;  4U8D A;  2Q4U A;  3SG3 A;  1S6J A;  2KYF A;  3LLE A;  3IF7 A;  4MVF A;  1KWO C;  2E6W A;  1DGV A;  1YRT B;  4WQ2 A;  1SYM A;  2WC8 A;  5FYX A;  1RJV A;  2F2P A;  1TCO B;  1CLM A;  1ZAC A;  4P5O E;  3OX5 A;  2LVJ A;  2LMT A;  4YGA A;  1R6P A;  2L50 A;  4HRH A;  4JQ0 D;  1A03 A;  2FCD A;  3CR4 X;  2GV5 A;  2LHL A;  2RGI A;  1YUS A;  4Q04 A;  5D7F A;  4NDC A;  5PAL A;  1Q80 A;  1B47 A;  1IJ5 A;  1NYA A;  1K96 A;  2KNE A;  4DIR A;  3CZT X;  1XYD A;  2BCB A;  2BBN A;  4I5N B;  1CMF A;  4HRG A;  2I18 A;  1HT9 A;  1Y0V H;  2JT0 A;  2K8M B;  3WHU B;  3PM8 A;  4CID A;  1W7I B;  4GFT A;  1JFJ A;  2L5X B;  5I2O A;  3DVK A;  1KCY A;  3SJS A;  5AER A;  3TDU A;  2LMU A;  2M7L A;  1NWD A;  2M9G A;  5CSF A;  2MRD A;  4GBA A;  1OOJ A;  2OS8 B;  3SG7 A;  1WDC B;  1XVJ A;  4ORC B;  4FTG A;  3BUX B;  4YGE B;  2EC6 B;  2R2I A;  1QXP A;  3VRP A;  1BF5 A;  2KI6 D;  1IH0 A;  1M45 A;  4PHJ A;  2BL0 C;  3SG2 A;  1K94 A;  4YI9 A;  1XA5 A;  5HKW A;  1SY9 A;  2FOT A;  2LLT A;  1C07 A;  1BJF A;  1TTX A;  2NZ0 A;  2Y5I A;  3D10 A;  3TUY C;  2G9B A;  4F0Z B;  3SIB A;  4WRI A;  1TIZ A;  1DVI A;  3I5I C;  1DJH A;  2CXJ A;  3A4U B;  1UWO A;  2GGM A;  1PUL A;  3NSL A;  1JUO A;  2PAL A;  3EVU A;  4XYN A;  1DTL A;  2KQ6 A;  5GQQ C;  2JOJ A;  4I5J A;  1NX3 A;  4YGC B;  2H61 C;  1SMG A;  2O5G A;  1SKT A;  1RWY A;  4QJ3 B;  1XFU O;  2H2K A;  3F45 A;  1K95 A;  2Y1N A;  1UUS A;  2LVI A;  3CLN A;  3EVR A;  5K89 A;  2M97 A;  4FQO A;  2MLF C;  1GGW A;  5AFP A;  1OQP A;  1VRK A;  2LP2 A;  5DKR A;  1M31 A;  1FW4 A;  4AOM A;  1DGU A;  3PN7 C;  2JXL A;  2L0P A;  2K2A A;  1CFD A;  3M0W A;  1F71 A;  1F70 A;  3ICB A;  1NX2 A;  2JZI A;  2LVK A;  1NIW A;  4JPZ B;  5I2Q A;  3SG5 A;  3JTD C;  4MZK A;  1WRZ A;  1A4P A;  1N2D A;  1Y6W A;  1G4Y R;  4GGF C;  2EGD A;  2JC2 A;  5CSI A;  1SW8 A;  1IQ3 A;  3OHM B;  4DUQ A;  2KQY A;  3SG6 A;  1F4Q A;  2D8N A;  1B1G A;  4A4C A;  1JF2 A;  5G08 A;  1B9A A;  4CFR A;  1KQV A;  1BR4 B;  1J1D A;  2LLS A;  2LUX A;  2LAP A;  1LVC D;  3K21 A;  2QPT A;  4PHM A;  3OP0 A;  1CDP A;  4HRE E;  1C7V A;  1V1G A;  1EJ3 A;  1S5G Y;  3PAL A;  4AQI A;  2KFH A;  1CMG A;  4PHK A;  1JC2 A;  2Y1M A;  1KQM B;  4C0J A;  2LP3 A;  1S5G Z;  2QAC A;  3ZNI A;  2JTZ A;  1LKJ A;  3GOF A;  5KU1 A;  4MSP A;  4ORB B;  2KYC A;  1U5I A;  2KFG A;  3FWC A;  2M49 B;  3BQ3 A;  1B4C A;  1TNX A;  2JRF A;  3DF0 B;  4IL1 A;  4MN0 A;  2KSP A;  3OB1 B;  3WXA A;  2KI4 B;  2OTG B;  2EC6 C;  4WQ3 A;  1YR5 A;  1MWN A;  1MF8 B;  1PVA A;  2MBX A;  2WND A;  3ZWH A;  1S6C A;  1NUB A;  1MR8 A;  1UHJ A;  1KK8 B;  1DJW A;  1IWQ A;  4PCW A;  3FWB A;  1TNW A;  3OX6 A;  1YUR A;  4M2Q A;  2LCP A;  2KHN A;  3JVT C;  2FJU B;  1K93 D;  1SCM B;  1WY9 A;  4OKH A;  5HKY A;  4NDB A;  1TNP A;  1RTP 1;  2MJW B;  4OV2 A;  4P2Y B;  1H4B A;  1DF0 A;  2SCP A;  4CPV A;  1AHR A;  1MHO A;  3BUW B;  1F8H A;  4M2O A;  2KAX A;  5HLO A;  2KFF A;  2PMY A;  4ZCU A;  1WRL A;  2KBI A;  5JOL A;  3DVE A;  1SR6 C;  4PE0 A;  1QIV A;  1NP8 A;  1SL8 A;  2KAV A;  3BOW A;  2JU0 A;  3NSI A;  1F4O A;  1QV1 A;  1ALV A;  1C7W A;  1DF0 B;  1K9U A;  2F3Y A;  2MLE C;  3AKA A;  2BEC A;  1REC A;  3AAJ A;  2MAZ A;  2BE4 A;  2K2F A;  3KPX A;  1BU3 A;  3EVV A;  1KFX S;  1MQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...