2GGZA

Crystal structure of human guanylate cyclase activating protein-3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
WYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase activator
molecule keywords Guanylyl cyclase-activating protein 3
publication title The Crystal Structure of GCAP3 Suggests Molecular Mechanism of GCAP-linked Cone Dystrophies.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggzA00
2KNEA 1JF2A 4XJKA 1AJ4A 3BQ3A 3TDZA 5HYDA 1MHOA 1OE9B 1M45A 3DVKA 4OCIA 4P2YB 3BOWB 4HREE 1C07A 1IGVA 2JNXA 3ICBA 1MR8A 4GBAA 3WXAA 1ZACA 2ZN8A 2BCBA 2O60A 3WHUB 3KPXA 3SJSA 5KU1A 1CTRA 1K95A 2E6WA 1K9PA 2KGRA 1F8HA 2KQ6A 2HQ8A 2L0PA 3GK4X 4PHNA 5ER4X 5IBWA 2KI4C 3IQQA 5CSNA 4WQ2A 1R6PA 1JWDA 4WQ3A 2KQYA 2OS8C 1H8BA 1KFUS 2K7DA 4OR9B 2CCMA 2BCXA 4PE4A 4FTGA 3JVTB 1B8LA 1YVHA 2MA2A 1K96A 1RJVA 2CBLA 2M49B 2LVJA 3TUYC 2JZIA 2OPOA 1WRKA 1YX7A 2QPTA 1DJYA 2KFFA 1KK8C 5I2LA 4CFQA 1S1EA 3EKJA 1S6CA 1NIWA 2M0RA 3IF7A 2L50A 1RTP1 1UHKA 3I5IB 1Y1AA 2PMYA 2MJWB 1C7WA 2M1KB 1SMGA 1UUSA 1RECA 4C0KA 5ER5A 1EXRA 4I5KA 1JC2A 3PM8A 4MZJA 2KAYA 3E3RA 2LP2A 2WNDA 2LUCA 1WDCB 2R2IA 3A8RA 1JFJA 2KDHA 1CLMA 1QV0A 4JQ0D 1KWOC 1SNLA 1A03A 2NLNA 4MRYA 3TDUA 1PK0D 1G8IA 1KSOA 4ETOA 3DVJA 3DF0A 1N0YA 1VRKA 4DUQA 1TRFA 3SG7A 2E30A 1LKJA 3NSIA 4JWQA 1SCMB 2BBNA 1L2OB 1R2UA 1BODA 4JPZB 1TNWA 1YRTB 2JPTA 2PALA 1QX7A 1N65A 2F33A 4ORAB 4BY5A 3I5HC 1NWDA 3FS7A 2KI6C 2Q91A 2ISDA 2PASA 3TZ1A 4HRHA 3AKAA 1TTXA 2ZNEA 1A2XA 2BL0C 1QV1A 4A4CA 2NCOA 3NSKA 1OZOA 1U5IB 3TDIA 1GGWA 1V1FA 4GPLB 1IJ5A 2M29A 1DF0B 1BR4B 1PALA 1TCOB 2D8NA 2TN4A 4QJ4B 4E68A 1BR1B 1KFXL 2NZ0A 4I5NB 1HT9A 3I5GC 1IWQA 4IL1A 2LNKA 1M39A 1S6IA 3O78A 3PFVA 1ODBA 2LANA 1QLKA 1NX0A 5F6TA 1CLLA 1SYMA 3VRNA 1DJWA 2KI4B 1KSMA 1FW4A 4USLA 1CMGA 2LE9B 3PALA 1UHIA 2WCBA 2MAZA 1ALVA 2ZRSA 5BPJA 4ORCB 2OS8B 5KSZA 1F54A 3WNXB 1J1DA 4AQIA 1K2HA 1DGUA 1D1OA 1S3PA 1YURA 2LM5A 1IQ5A 3GK2A 4C0LA 1CFPA 1JBAA 2H2KA 4XJKB 1KK8B 1SR6C 1N2DA 2LLTA 2M8UA 1B8CA 3QRXA 5FYXA 1DGVA 1MQ1A 4BY4A 1AUIB 2FJUB 1MUXA 1EL4A 4OV2A 3SIBA 4HSZA 4MZKA 2ZKMX 4MVFA 1MXEA 3K21A 2HETA 3AKBA 4NQGA 1HQVA 1ZUZA 3KF9A 1GJYA 1UHNA 4AOMA 5D7FA 1TN4A 3NSLA 1BF5A 1XFZO 1YTZC 3C1VA 3EVVA 1NX2A 1LA3A 3ZNIA 1BOCA 2JT0A 3A4UB 2FCEA 3AAJA 1KWOB 2WOSA 3SG4A 1XFYO 1PVBA 2LHIA 1AP4A 1DTLA 1QIWA 2KYFA 2Y5IA 5CSJA 3O2PA 3HCMA 2IS9A 2GGMA 2HF5A 4YGDB 1RFJA 1NCYA 1E8AA 3EVRA 1OMRA 1ZOTB 2MLFC 2MHHA 3CR2A 2KBIA 2AUCA 1H4BA 5HKYA 1NP8A 1PRWA 3SG2A 1GQMA 4HRGA 1Q80A 2LLSA 3I5HB 1SY9A 3EVUA 3PSRA 1K8UA 1V1GA 3GK1A 2LAPA 1G4YR 1ALWA 2L98A 3BXKA 4MSPA 5I2QA 1GGZA 2LCPA 2JXLA 2OTGC 3JTDC 4PE1A 1SBJA 4YGEB 2QACA 3SIAA 1YUUA 1TNPA 2JOJA 3BUNB 1NYAA 1OZSA 2F2PA 4OVNF 2FOTA 1CDNA 2LHLA 4D1EA 3KO0A 4MN0A 4R1EA 3GOFA 3CLNA 3RM1A 2K7BA 3EKHA 3D10A 1WY9A 1YUTA 4YRUA 3I5GB 3FIAA 2CT9A 1B1GA 1IH0A 1PULA 1DJHA 1CM4A 2LLUA 2KBMA 1LXFC 3DF0B 2F3ZA 2JU0A 1F55A 4PHJA 2KSPA 2LVVA 1FI5A 5CSFA 1QS7A 1QX2A 1CKKA 4Q04A 2K61A 2NXQA 3OP0A 4I5LB 1PVAA 5I2OA 2WCFA 2KAVA 2K7CA 1KQVA 4GGFA 2PSRA 2CXJA 2M97A 4GUKA 1SKTA 2EC6C 1AK8A 2KFGA 1SK6D 1XK4A 2AMIA 2JULA 2F8PA 1EG3A 2LV7A 3NXAA 4QJ3B 1NX3A 1OOJA 1K93D 4N5XA 2HQWA 1SR6B 1DJZA 1KFUL 4AQJA 2JNFA 1G33A 5K89A 1F71A 1TNXA 1CNPA 2Q4UA 2Y4QA 2MRDA 2COLB 5B8IB 2LC5A 4DCKA 2SCPA 2MBXA 1DMOA 1J55A 2JQ6A 1QIVA 3VRPA 1PSBA 1MWNA 4MRXA 4YGBB 1CB1A 4MLWA 3TS5C 1IG5A 3EK7A 1FI6A 1SRAA 4NDBA 2LMVA 3FWBA 1QXPA 2KFHA 2Y1MA 1BJFA 1EG4A 5DKQA 1JF0A 2LUXA 2I94A 4GGFC 5DKNA 2KAXA 2DOQA 1XFVO 1UWOA 1OSAA 5DKRA 1XK4C 3CS1A 4NDDA 1RWYA 2KOTA 4DIRA 2BKHB 1J1EA 2V53A 4PDZA 1A75A 2JT3A 2L4HA 1ZMZA 4DS7A 2L2EA 1QJTA 2JT8A 2K7OA 3LCPC 3I5FC 4CPVA 4CFRA 4UPGA 4PHMA 4P5OE 4M2OA 1F4OA 1PSRA 2OTGB 1NUBA 3TUYB 5HLOA 4YBHB 4A4BA 3JTDB 3D0YA 1B7TZ 1DJGA 1KK7Z 2M7NA 2ZN9A 2JC2A 2MLEC 2KI6D 1M31A 2RGIA 1IKUA 1Y0VH 1WDCC 3HX4A 2I7AA 2BECA 3BUWB 1UHJA 4L9MA 5AANA 1JFKA 4ICBA 2L4IA 1BT6A 1S26D 1XFXO 3O4YA 2JRFA 1CFCA 1MF8B 1K9UA 5PALA 3SG3A 2ZRTA 5GQQC 5AEQA 4GGNA 2AAOA 2M9GA 1B4CA 1J7PA 1S6JA 1DVIA 1UHHA 1SL9A 3EK4A 4TNCA 3SG6A 1XA5A 2EC6B 2I18A 1TCFA 1A29A 3WHTB 1K9KA 3CGAA 3BUOB 1OMDA 1BLQA 1SPYA 3VROA 4QJ5B 1CLBA 1J7QA 4N1GA 1SL8A 1B7TY 5CPVA 2BKIB 2LMTA 1UP5A 1KK7Y 2BBMA 1EH2A 4YGCB 5JJGA 2BL0B 1QVIZ 1SCVA 3PN7C 2M7LA 1IRJA 1JSAA 1Y1XA 3EK8A 2ZFDA 1NX1A 1QX5B 1XO5A 4I5JA 3BOWA 3TS5B 1QLSA 2SASA 3VRQA 1BU3A 1IQ3A 2LP3A 2B1UA 2NCPA 1XYDA 1B8RA 2JWWA 4ZCVA 3AAKA 1CFFA 1FF1A 2GV5A 1S5GZ 2A4JA 3CR5X 2H61A 3VRRA 2VRGA 4F0ZB 2F3YA 4MBEA 2K8MB 1FBVA 1FPWA 1WRZA 4ZCUA 2O5GA 2HPSA 2KHNA 1CM1A 2Y1NA 3CTNA 1LINA 2LMUA 1CDMA 1SW8A 1LA0A 1KQMC 4NDCA 3O6BA 2BE4A 1C7VA 3I5FB 2I2RE 4M2PA 1KCYA 3DVMA 3LL8B 4OKHA 2M3WA 1YX8A 2WC8A 3CR4X 4PHKA 1EJ3A 4ORBB 3PATA 1KFXS 4M2QA 3BUXB 1J7OA 3VGOA 1UURA 5HLVA 4MZLA 2CTNA 2BE6A 1XFUO 2K2AA 3IQOA 1QVIY 5CSIA 1ZFSA 2M1UA 3LLEA 5D69A 1RK9A 2EHBA 1WRLA 5I8NA 1DJIA 1CFDA 4C0JA 1TIZA 3MSEB 5TNCA 3KHEA 3ZWHA 3CWGA 1K90D 2H61C 1YVLA 4FQOA 3LK0A 1YR5A 3BUMB 5AERA 4GFTA 3BYAA 1S5GY 2FCDA 2KYCA 4PALA 2KGBC 2BCAA 1QTXA 1A75B 4YI8A 2L51A 1NPQA 5AXIA 4PE7A 1XVJA 1YRUB 4GNKB 3PLFB 4MEWA 3JVTC 1OQPA 1AJ5A 1W7IB 5HKWA 4YGAA 1M46A 1Y6WA 1SL7A 2K2FA 3NSOA 3D0YB 4N1FA 3F45A 4CIDA 1B9AA 1DT7B 4U8DA 3RLZA 1W7JB 2JXCA 1XFWO 1NCZA 1WLZA 2CNPA 2PRUA 3OB1B 3PN7B 3I5IC 1TNQA 1S36A 1F70A 1BMOA 1A4PA 1U5IA 2EGDA 3H4SE 1B47A 2JTTA 2LVIA 1WLMA 1CDPA 1AHRA 1DF0A 1TOPA 1X02A 2F2OA 2K0JA 2PVBA 5J3XA 2LVKA 2G2BA 2ZNDA 1CMFA 1JUOA 1Y1UA 3LK1A 1DJXA 1M63B 5HKZA 3M0WA 2JTZA 5KTYA 1NCXA 4YI9A 3KEVA 5G08A 1K94A 3OX5A 1F4QA 1RROA 3DVEA 2WORA 1QASA 2GGZA 1SCMC 4PE0A 3FWCA 1CDLA 1L2OC 2WCEA 2L5XB 1IJ6A 1AVSA 3SG5A 3DD4A 1KQMB 4GAOA 1BG1A 3OX6A 4XYNA 4PCWA 1YUSA 4DRWA 2G9BA 4WRIA 1J7RA 1QATA 1L7ZA 3OB2B 1LVCD 4CLNA 1OMVA 5AFPA 2P6BB 1MXLC 3OHMB 1NSHA 3CZTX 5JOLA
chains in the Genus database with same CATH superfamily
2KNEA 1JF2A 4XJKA 3SS5A 1AJ4A 3BQ3A 3TDZA 3BFHA 5HYDA 1MHOA 1OE9B 1M45A 3DVKA 4OCIA 4P2YB 3BOWB 2QEHA 4HREE 1IGVA 2JNXA 3ICBA 1C07A 1XFRA 1MR8A 4GBAA 3WXAA 1ZACA 2ZN8A 2BCBA 2O60A 3WHUB 3KPXA 3SJSA 5KU1A 1CTRA 1K95A 2E6WA 1K9PA 2KGRA 1F8HA 2KQ6A 2HQ8A 3R1VA 2L0PA 3GK4X 4PHNA 5ER4X 2QDIA 5IBWA 1QWVA 2KI4C 3IQQA 5CSNA 4WQ2A 1R6PA 1JWDA 4WQ3A 2KQYA 2OS8C 2WC6A 1H8BA 1KFUS 2K7DA 4OR9B 2CCMA 2BCXA 2GTEA 4PE4A 3DYEA 4FTGA 3JVTB 1B8LA 1YVHA 2MA2A 1K96A 2PYQA 1RJVA 2CBLA 2L5YA 2M49B 2WCKA 2LVJA 3TUYC 2JZIA 2OPOA 1WRKA 1YX7A 2QPTA 5FI2A 1DJYA 2KFFA 3CYZA 1KK8C 5I2LA 4CFQA 1S1EA 2QEOA 3EKJA 1S6CA 2BNXA 1NIWA 2M0RA 3IF7A 3CABA 4FQTA 2L50A 1RTP1 1UHKA 3I5IB 1Y1AA 2PMYA 3NGVA 2MJWB 1C7WA 2M1KB 1SMGA 1UUSA 1RECA 4C0KA 5ER5A 1EXRA 4I5KA 1JC2A 3PM8A 4MZJA 2KAYA 3E3RA 2LP2A 2WNDA 3D75A 2LUCA 1WDCB 2R2IA 3A8RA 1JFJA 2KDHA 1CLMA 3CZ0A 1QV0A 4JQ0D 1KWOC 1SNLA 1A03A 2NLNA 4MRYA 3TDUA 1PK0D 1G8IA 1KSOA 4ETOA 3DVJA 3DF0A 1N0YA 3DY9A 1VRKA 4DUQA 1TRFA 3SG7A 2E30A 1LKJA 3NHTA 3NSIA 4JWQA 1SCMB 2BBNA 1L2OB 2QEVA 1R2UA 1BODA 4JPZB 1TNWA 1YRTB 2JPTA 2PALA 1QX7A 1N65A 2F33A 4ORAB 4BY5A 2KLEA 3I5HC 1NWDA 3FS7A 2KI6C 2Q91A 2ISDA 5D3OA 2PASA 3TZ1A 4HRHA 3AKAA 1TTXA 2ZNEA 1A2XA 2BL0C 1QV1A 4A4CA 2NCOA 3NSKA 1OZOA 1U5IB 3TDIA 1GGWA 1V1FA 4GPLB 1IJ5A 2M29A 1DF0B 1BR4B 1PALA 1TCOB 2D8NA 2TN4A 3NHIA 4QJ4B 4E68A 1BR1B 1KFXL 2NZ0A 4I5NB 1HT9A 3I5GC 1IWQA 4IL1A 2LNKA 1M39A 3O4XA 1S6IA 3EG5B 3O78A 3PFVA 1ODBA 2LANA 1GM0A 1QLKA 1NX0A 5F6TA 1CLLA 1SYMA 3VRNA 1DJWA 2KI4B 1KSMA 1Z4HA 1FW4A 4USLA 2LE9B 3PALA 1UHIA 2WCBA 1CMGA 3VB1A 2MAZA 1ALVA 2ZRSA 5BPJA 4ORCB 2OS8B 5KSZA 1F54A 3WNXB 2P71A 1J1DA 4AQIA 1K2HA 1DGUA 1D1OA 1S3PA 1YURA 2LM5A 1W9ZA 3N7HA 1IQ5A 3GK2A 4C0LA 1CFPA 1JBAA 2H2KA 4XJKB 1KK8B 1SR6C 3R72A 1N2DA 2JPOA 2LLTA 2M8UA 1B8CA 3QRXA 5FYXA 1DGVA 1MQ1A 4BY4A 1AUIB 2FJUB 1MUXA 1EL4A 4OV2A 3SIBA 4HSZA 3IVTA 4MZKA 2ZKMX 3Q8IA 4MVFA 1MXEA 1Z2CB 3K21A 2HETA 3AKBA 4NQGA 1HQVA 1ZUZA 3KF9A 1GJYA 1UHNA 4AOMA 5D7FA 1TN4A 3NSLA 1BF5A 1XFZO 2K60A 1YTZC 2WCJA 3C1VA 3EVVA 1IIOA 3PJIA 1NX2A 1LA3A 3ZNIA 1BOCA 2JT0A 3A4UB 3K1EA 2FCEA 3AAJA 1KWOB 2WOSA 3SG4A 1XFYO 1PVBA 2WCLA 2LHIA 4IJ7A 1DTLA 1QIWA 2KYFA 1T14A 2Y5IA 4INXA 5CSJA 1AP4A 3O2PA 3HCMA 2IS9A 2GGMA 2HF5A 4YGDB 4KYNA 1RFJA 1NCYA 1E8AA 3EVRA 1OMRA 1ZOTB 2MLFC 3B6XA 2MHHA 3CR2A 2KBIA 4OZDA 2AUCA 1H4BA 5HKYA 1NP8A 1PRWA 3SG2A 1GQMA 4HRGA 3S0DA 1Q80A 2LLSA 3UNWA 3I5HB 1SY9A 3EVUA 3PSRA 1K8UA 1V1GA 3GK1A 2LAPA 2BAPA 1G4YR 1ALWA 2L98A 3BXKA 4MSPA 5I2QA 1GGZA 2LCPA 2JXLA 2OTGC 3B88A 3JTDC 4PE1A 1SBJA 4YGEB 2QACA 3SIAA 1YUUA 1TNPA 2JOJA 3B7AA 3BUNB 1NYAA 1OZSA 2F2PA 4OVNF 2FOTA 1CDNA 1DEKA 2LHLA 4D1EA 3KO0A 1DQEA 4MN0A 4R1EA 3GOFA 3CLNA 3D78A 3RM1A 2K7BA 3D74A 3D10A 1WY9A 1YUTA 3EKHA 3I5GB 4YRUA 3FIAA 2CT9A 1B1GA 1IH0A 1PULA 1DJHA 1CM4A 2LLUA 2KBMA 1LXFC 3DF0B 2F3ZA 2JU0A 1F55A 4PHJA 3R1PA 2KSPA 2LVVA 1FI5A 5CSFA 3QMEA 1QS7A 1QX2A 1CKKA 4Q04A 2K61A 2NXQA 3OP0A 4I5LB 1PVAA 5I2OA 2WCFA 2KAVA 2K7CA 5FI7A 1KQVA 3S0AA 4GGFA 2PSRA 2CXJA 2M97A 4GUKA 1SKTA 2EC6C 1AK8A 2KFGA 3FE6A 1SK6D 1XK4A 2AMIA 2JULA 2F8PA 1EG3A 2LV7A 3NXAA 4JKTA 1NX3A 4QJ3B 1OOJA 1K93D 4N5XA 2HQWA 1SR6B 1DJZA 1KFUL 1ORGA 4AQJA 2JNFA 1G33A 5K89A 1F71A 1TNXA 3S0GA 1CNPA 2Q4UA 2Y4QA 2MRDA 2COLB 3S0EA 1OOFA 5B8IB 2LC5A 3DXLA 2SCPA 2MBXA 4DCKA 1DMOA 1J55A 2JQ6A 1QIVA 3VRPA 1PSBA 2WC5A 1OOIX 5DICA 1MWNA 4MRXA 4YGBB 1CB1A 4MLWA 3TS5C 1IG5A 3EK7A 1FI6A 1SRAA 4NDBA 2LMVA 3FWBA 1QXPA 2KFHA 2Y1MA 1BJFA 1EG4A 5DKQA 3CZ2A 3S0FA 1JF0A 2LUXA 2I94A 4GGFC 5DKNA 2KAXA 2DOQA 1XFVO 1UWOA 2KPHA 3FE9A 1OSAA 5DKRA 1XK4C 3CS1A 4NDDA 1RWYA 2KOTA 4DIRA 2BKHB 1J1EA 2ERBA 2V53A 4PDZA 1A75A 2JT3A 2L4HA 1ZMZA 4DS7A 2L2EA 1QJTA 2JT8A 2K7OA 3LCPC 3I5FC 4CPVA 4CFRA 4UPGA 2WCMA 4PHMA 1OOHA 4M2OA 3BJHA 4P5OE 1F4OA 1PSRA 2OTGB 1NUBA 3TUYB 5HLOA 4YBHB 4A4BA 3JTDB 3D0YA 3OBVA 1B7TZ 1C3YA 1DJGA 1KK7Z 2M7NA 2ZN9A 1OW4A 2JC2A 2MLEC 2KI6D 1M31A 2RGIA 1IKUA 1Y0VH 1WDCC 5HL1A 3HX4A 2I7AA 2BECA 3BUWB 1UHJA 4L9MA 5AANA 1JFKA 4ICBA 2L4IA 1BT6A 1S26D 1XFXO 3O4YA 2JRFA 1CFCA 1MF8B 1K9UA 5PALA 3SG3A 2ZRTA 5GQQC 5AEQA 4GGNA 2AAOA 2M9GA 1B4CA 1P28A 1J7PA 1S6JA 1DVIA 1UHHA 1SL9A 3EK4A 4TNCA 3SG6A 1XA5A 2EC6B 2I18A 1TCFA 1A29A 4JD9A 3WHTB 1K9KA 3CGAA 3V2LA 3BUOB 1OMDA 1BLQA 1SPYA 3VROA 4QJ5B 1CLBA 1J7QA 4N1GA 1SL8A 5EL2A 1B7TY 5CPVA 2BKIB 2LMTA 2P70A 1UP5A 1KK7Y 2BBMA 1EH2A 4YGCB 2PQLA 5JJGA 3BFAA 2BL0B 1QVIZ 1SCVA 3PN7C 4PT1A 2M7LA 1IRJA 1JSAA 1Y1XA 3EK8A 2ZFDA 1NX1A 1QX5B 1XO5A 4I5JA 3BOWA 3TS5B 1TUZA 1QLSA 2SASA 3S0BA 1BU3A 3VRQA 2LP3A 2B1UA 2NCPA 1XYDA 1B8RA 1IQ3A 2JWWA 4ZCVA 3AAKA 1CFFA 1FF1A 2GV5A 3BFBA 1S5GZ 3L4AA 2A4JA 3CR5X 2H61A 3VRRA 3RZSA 2VRGA 4F0ZB 2F3YA 4MBEA 2K8MB 1FBVA 1FPWA 1WRZA 4ZCUA 2O5GA 2HPSA 2KHNA 1CM1A 2Y1NA 1DELA 1LINA 2LMUA 3CTNA 4F7FA 1CDMA 1SW8A 1LA0A 1KQMC 3CDNA 4NDCA 3DZTA 2BE4A 3O6BA 3I5FB 1C7VA 2I2RE 4M2PA 1KCYA 3DVMA 3LL8B 4OKHA 2M3WA 1YX8A 2WC8A 3CR4X 4PHKA 1EJ3A 4ORBB 3PATA 1KFXS 4M2QA 3D76A 2KLDA 2L2CA 3BUXB 1J7OA 3VGOA 5I94A 1UURA 3CZ1A 5HLVA 4MZLA 2CTNA 2BE6A 1XFUO 2K2AA 3IQOA 1QVIY 2FJYA 1ZFSA 2M1UA 3LLEA 5CSIA 5D69A 1RK9A 2EHBA 1WRLA 3R1OA 5I8NA 1DJIA 1CFDA 4C0JA 1TIZA 3MSEB 5TNCA 2YGUA 3KHEA 3ZWHA 3CWGA 3L47A 1K90D 2H61C 1YVLA 4FQOA 3LK0A 1YR5A 3BUMB 1TUJA 5AERA 4GFTA 3BYAA 1S5GY 2FCDA 2KYCA 4PALA 2KGBC 2BCAA 1QTXA 3D77A 1A75B 3D73A 4YI8A 2L51A 1NPQA 5AXIA 4PE7A 1DC1A 1XVJA 1YRUB 4GNKB 3PLFB 4MEWA 3JVTC 5FI6A 1OQPA 1AJ5A 1W7IB 5HKWA 1SSEB 1M46A 3PM2A 1Y6WA 4YGAA 1SL7A 2K2FA 3NSOA 3D0YB 3SS4A 4N1FA 3F45A 3FE8A 4CIDA 1B9AA 1DT7B 4U8DA 3L4LA 3RLZA 1W7JB 2JXCA 1XFWO 1NCZA 1WLZA 3UO9A 2CNPA 2PRUA 3OB1B 3PN7B 2QEBA 3I5IC 1TNQA 1S36A 3OGNA 1F70A 1BMOA 1A4PA 1U5IA 2EGDA 3B86A 3H4SE 4INWA 1B47A 2JTTA 2LVIA 1WLMA 1CDPA 1AHRA 1DF0A 1TOPA 1X02A 2F2OA 2K0JA 2PVBA 5J3XA 1C3ZA 2LVKA 2G2BA 2ZNDA 3B87A 1CMFA 1JUOA 1Y1UA 3LK1A 1DJXA 1M63B 5HKZA 3M0WA 2JTZA 5KTYA 1NCXA 4YI9A 3KEVA 5G08A 1K94A 3OX5A 1F4QA 1RROA 3DVEA 2WORA 1OOGA 1QASA 2GGZA 1SCMC 4PE0A 3FWCA 1CDLA 1L2OC 2WCEA 2L5XB 1IJ6A 1AVSA 2H8VA 3SG5A 3DD4A 1KQMB 4GAOA 1BG1A 3OX6A 4XYNA 4PCWA 1YUSA 4DRWA 2G9BA 4WRIA 1J7RA 1QATA 1L7ZA 2WCHA 3OB2B 1LVCD 4CLNA 1OMVA 5AFPA 1LS8A 1MXLC 1TWOA 2P6BB 1NSHA 3OHMB 3SS3A 3CZTX 5JOLA
chains in the Genus database with same CATH topology
2KNEA 1JF2A 4XJKA 1AJ4A 3BQ3A 3TDZA 5HYDA 1MHOA 1OE9B 1M45A 3DVKA 4OCIA 4P2YB 3BOWB 4HREE 1C07A 1IGVA 2JNXA 3ICBA 1MR8A 4GBAA 3WXAA 1ZACA 2ZN8A 2BCBA 2O60A 3WHUB 3KPXA 3SJSA 5KU1A 1CTRA 1K95A 2E6WA 1K9PA 2KGRA 1F8HA 2KQ6A 2HQ8A 2L0PA 3GK4X 4PHNA 5ER4X 5IBWA 2KI4C 3IQQA 5CSNA 4WQ2A 1R6PA 1JWDA 4WQ3A 2KQYA 2OS8C 1H8BA 1KFUS 2K7DA 4OR9B 2CCMA 2BCXA 4PE4A 4FTGA 3JVTB 1B8LA 1YVHA 2MA2A 1K96A 1RJVA 2CBLA 2M49B 2LVJA 3TUYC 2JZIA 2OPOA 1WRKA 1YX7A 2QPTA 1DJYA 2KFFA 1KK8C 5I2LA 4CFQA 1S1EA 3EKJA 1S6CA 1NIWA 2M0RA 3IF7A 2L50A 1RTP1 1UHKA 3I5IB 1Y1AA 2PMYA 2MJWB 1C7WA 2M1KB 1SMGA 1UUSA 1RECA 4C0KA 5ER5A 1EXRA 4I5KA 1JC2A 3PM8A 4MZJA 2KAYA 3E3RA 2LP2A 2WNDA 2LUCA 1WDCB 2R2IA 3A8RA 1JFJA 2KDHA 1CLMA 1QV0A 4JQ0D 1KWOC 1SNLA 1A03A 2NLNA 4MRYA 3TDUA 1PK0D 1G8IA 1KSOA 4ETOA 3DVJA 3DF0A 1N0YA 1VRKA 4DUQA 1TRFA 3SG7A 2E30A 1LKJA 3NSIA 4JWQA 1SCMB 2BBNA 1L2OB 1R2UA 1BODA 4JPZB 1TNWA 1YRTB 2JPTA 2PALA 1QX7A 1N65A 2F33A 4ORAB 4BY5A 3I5HC 1NWDA 3FS7A 2KI6C 2Q91A 2ISDA 2PASA 3TZ1A 4HRHA 3AKAA 1TTXA 2ZNEA 1A2XA 2BL0C 1QV1A 4A4CA 2NCOA 3NSKA 1OZOA 1U5IB 3TDIA 1GGWA 1V1FA 4GPLB 1IJ5A 2M29A 1DF0B 1BR4B 1PALA 1TCOB 2D8NA 2TN4A 4QJ4B 4E68A 1BR1B 1KFXL 2NZ0A 4I5NB 1HT9A 3I5GC 1IWQA 4IL1A 2LNKA 1M39A 1S6IA 3O78A 3PFVA 1ODBA 2LANA 1QLKA 1NX0A 5F6TA 1CLLA 1SYMA 3VRNA 1DJWA 2KI4B 1KSMA 1FW4A 4USLA 1CMGA 2LE9B 3PALA 1UHIA 2WCBA 2MAZA 1ALVA 2ZRSA 5BPJA 4ORCB 2OS8B 5KSZA 1F54A 3WNXB 1J1DA 4AQIA 1K2HA 1DGUA 1D1OA 1S3PA 1YURA 2LM5A 1IQ5A 3GK2A 4C0LA 1CFPA 1JBAA 2H2KA 4XJKB 1KK8B 1SR6C 1N2DA 2LLTA 2M8UA 1B8CA 3QRXA 5FYXA 1DGVA 1MQ1A 4BY4A 1AUIB 2FJUB 1MUXA 1EL4A 4OV2A 3SIBA 4HSZA 4MZKA 2ZKMX 4MVFA 1MXEA 3K21A 2HETA 3AKBA 4NQGA 1HQVA 1ZUZA 3KF9A 1GJYA 1UHNA 4AOMA 5D7FA 1TN4A 3NSLA 1BF5A 1XFZO 1YTZC 3C1VA 3EVVA 1NX2A 1LA3A 3ZNIA 1BOCA 2JT0A 3A4UB 2FCEA 3AAJA 1KWOB 2WOSA 3SG4A 1XFYO 1PVBA 2LHIA 1AP4A 1DTLA 1QIWA 2KYFA 2Y5IA 5CSJA 3O2PA 3HCMA 2IS9A 2GGMA 2HF5A 4YGDB 1RFJA 1NCYA 1E8AA 3EVRA 1OMRA 1ZOTB 2MLFC 2MHHA 3CR2A 2KBIA 2AUCA 1H4BA 5HKYA 1NP8A 1PRWA 3SG2A 1GQMA 4HRGA 1Q80A 2LLSA 3I5HB 1SY9A 3EVUA 3PSRA 1K8UA 1V1GA 3GK1A 2LAPA 1G4YR 1ALWA 2L98A 3BXKA 4MSPA 5I2QA 1GGZA 2LCPA 2JXLA 2OTGC 3JTDC 4PE1A 1SBJA 4YGEB 2QACA 3SIAA 1YUUA 1TNPA 2JOJA 3BUNB 1NYAA 1OZSA 2F2PA 4OVNF 2FOTA 1CDNA 2LHLA 4D1EA 3KO0A 4MN0A 4R1EA 3GOFA 3CLNA 3RM1A 2K7BA 3EKHA 3D10A 1WY9A 1YUTA 4YRUA 3I5GB 3FIAA 2CT9A 1B1GA 1IH0A 1PULA 1DJHA 1CM4A 2LLUA 2KBMA 1LXFC 3DF0B 2F3ZA 2JU0A 1F55A 4PHJA 2KSPA 2LVVA 1FI5A 5CSFA 1QS7A 1QX2A 1CKKA 4Q04A 2K61A 2NXQA 3OP0A 4I5LB 1PVAA 5I2OA 2WCFA 2KAVA 2K7CA 1KQVA 4GGFA 2PSRA 2CXJA 2M97A 4GUKA 1SKTA 2EC6C 1AK8A 2KFGA 1SK6D 1XK4A 2AMIA 2JULA 2F8PA 1EG3A 2LV7A 3NXAA 4QJ3B 1NX3A 1OOJA 1K93D 4N5XA 2HQWA 1SR6B 1DJZA 1KFUL 4AQJA 2JNFA 1G33A 5K89A 1F71A 1TNXA 1CNPA 2Q4UA 2Y4QA 2MRDA 2COLB 5B8IB 2LC5A 4DCKA 2SCPA 2MBXA 1DMOA 1J55A 2JQ6A 1QIVA 3VRPA 1PSBA 1MWNA 4MRXA 4YGBB 1CB1A 4MLWA 3TS5C 1IG5A 3EK7A 1FI6A 1SRAA 4NDBA 2LMVA 3FWBA 1QXPA 2KFHA 2Y1MA 1BJFA 1EG4A 5DKQA 1JF0A 2LUXA 2I94A 4GGFC 5DKNA 2KAXA 2DOQA 1XFVO 1UWOA 1OSAA 5DKRA 1XK4C 3CS1A 4NDDA 1RWYA 2KOTA 4DIRA 2BKHB 1J1EA 2V53A 4PDZA 1A75A 2JT3A 2L4HA 1ZMZA 4DS7A 2L2EA 1QJTA 2JT8A 2K7OA 3LCPC 3I5FC 4CPVA 4CFRA 4UPGA 4PHMA 4P5OE 4M2OA 1F4OA 1PSRA 2OTGB 1NUBA 3TUYB 5HLOA 4YBHB 4A4BA 3JTDB 3D0YA 1B7TZ 1DJGA 1KK7Z 2M7NA 2ZN9A 2JC2A 2MLEC 2KI6D 1M31A 2RGIA 1IKUA 1Y0VH 1WDCC 3HX4A 2I7AA 2BECA 3BUWB 1UHJA 4L9MA 5AANA 1JFKA 4ICBA 2L4IA 1BT6A 1S26D 1XFXO 3O4YA 2JRFA 1CFCA 1MF8B 1K9UA 5PALA 3SG3A 2ZRTA 5GQQC 5AEQA 4GGNA 2AAOA 2M9GA 1B4CA 1J7PA 1S6JA 1DVIA 1UHHA 1SL9A 3EK4A 4TNCA 3SG6A 1XA5A 2EC6B 2I18A 1TCFA 1A29A 3WHTB 1K9KA 3CGAA 3BUOB 1OMDA 1BLQA 1SPYA 3VROA 4QJ5B 1CLBA 1J7QA 4N1GA 1SL8A 1B7TY 5CPVA 2BKIB 2LMTA 1UP5A 1KK7Y 2BBMA 1EH2A 4YGCB 5JJGA 2BL0B 1QVIZ 1SCVA 3PN7C 2M7LA 1IRJA 1JSAA 1Y1XA 3EK8A 2ZFDA 1NX1A 1QX5B 1XO5A 4I5JA 3BOWA 3TS5B 1QLSA 2SASA 3VRQA 1BU3A 1IQ3A 2LP3A 2B1UA 2NCPA 1XYDA 1B8RA 2JWWA 4ZCVA 3AAKA 1CFFA 1FF1A 2GV5A 1S5GZ 2A4JA 3CR5X 2H61A 3VRRA 2VRGA 4F0ZB 2F3YA 4MBEA 2K8MB 1FBVA 1FPWA 1WRZA 4ZCUA 2O5GA 2HPSA 2KHNA 1CM1A 2Y1NA 3CTNA 1LINA 2LMUA 1CDMA 1SW8A 1LA0A 1KQMC 4NDCA 3O6BA 2BE4A 1C7VA 3I5FB 2I2RE 4M2PA 1KCYA 3DVMA 3LL8B 4OKHA 2M3WA 1YX8A 2WC8A 3CR4X 4PHKA 1EJ3A 4ORBB 3PATA 1KFXS 4M2QA 3BUXB 1J7OA 3VGOA 1UURA 5HLVA 4MZLA 2CTNA 2BE6A 1XFUO 2K2AA 3IQOA 1QVIY 5CSIA 1ZFSA 2M1UA 3LLEA 5D69A 1RK9A 2EHBA 1WRLA 5I8NA 1DJIA 1CFDA 4C0JA 1TIZA 3MSEB 5TNCA 3KHEA 3ZWHA 3CWGA 1K90D 2H61C 1YVLA 4FQOA 3LK0A 1YR5A 3BUMB 5AERA 4GFTA 3BYAA 1S5GY 2FCDA 2KYCA 4PALA 2KGBC 2BCAA 1QTXA 1A75B 4YI8A 2L51A 1NPQA 5AXIA 4PE7A 1XVJA 1YRUB 4GNKB 3PLFB 4MEWA 3JVTC 1OQPA 1AJ5A 1W7IB 5HKWA 4YGAA 1M46A 1Y6WA 1SL7A 2K2FA 3NSOA 3D0YB 4N1FA 3F45A 4CIDA 1B9AA 1DT7B 4U8DA 3RLZA 1W7JB 2JXCA 1XFWO 1NCZA 1WLZA 2CNPA 2PRUA 3OB1B 3PN7B 3I5IC 1TNQA 1S36A 1F70A 1BMOA 1A4PA 1U5IA 2EGDA 3H4SE 1B47A 2JTTA 2LVIA 1WLMA 1CDPA 1AHRA 1DF0A 1TOPA 1X02A 2F2OA 2K0JA 2PVBA 5J3XA 2LVKA 2G2BA 2ZNDA 1CMFA 1JUOA 1Y1UA 3LK1A 1DJXA 1M63B 5HKZA 3M0WA 2JTZA 5KTYA 1NCXA 4YI9A 3KEVA 5G08A 1K94A 3OX5A 1F4QA 1RROA 3DVEA 2WORA 1QASA 2GGZA 1SCMC 4PE0A 3FWCA 1CDLA 1L2OC 2WCEA 2L5XB 1IJ6A 1AVSA 3SG5A 3DD4A 1KQMB 4GAOA 1BG1A 3OX6A 4XYNA 4PCWA 1YUSA 4DRWA 2G9BA 4WRIA 1J7RA 1QATA 1L7ZA 3OB2B 1LVCD 4CLNA 1OMVA 5AFPA 2P6BB 1MXLC 3OHMB 1NSHA 3CZTX 5JOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNE A;  1JF2 A;  4XJK A;  1AJ4 A;  3BQ3 A;  3TDZ A;  5HYD A;  1MHO A;  1OE9 B;  1M45 A;  3DVK A;  4OCI A;  4P2Y B;  3BOW B;  4HRE E;  1C07 A;  1IGV A;  2JNX A;  3ICB A;  1MR8 A;  4GBA A;  3WXA A;  1ZAC A;  2ZN8 A;  2BCB A;  2O60 A;  3WHU B;  3KPX A;  3SJS A;  5KU1 A;  1CTR A;  1K95 A;  2E6W A;  1K9P A;  2KGR A;  1F8H A;  2KQ6 A;  2HQ8 A;  2L0P A;  3GK4 X;  4PHN A;  5ER4 X;  5IBW A;  2KI4 C;  3IQQ A;  5CSN A;  4WQ2 A;  1R6P A;  1JWD A;  4WQ3 A;  2KQY A;  2OS8 C;  1H8B A;  1KFU S;  2K7D A;  4OR9 B;  2CCM A;  2BCX A;  4PE4 A;  4FTG A;  3JVT B;  1B8L A;  1YVH A;  2MA2 A;  1K96 A;  1RJV A;  2CBL A;  2M49 B;  2LVJ A;  3TUY C;  2JZI A;  2OPO A;  1WRK A;  1YX7 A;  2QPT A;  1DJY A;  2KFF A;  1KK8 C;  5I2L A;  4CFQ A;  1S1E A;  3EKJ A;  1S6C A;  1NIW A;  2M0R A;  3IF7 A;  2L50 A;  1RTP 1;  1UHK A;  3I5I B;  1Y1A A;  2PMY A;  2MJW B;  1C7W A;  2M1K B;  1SMG A;  1UUS A;  1REC A;  4C0K A;  5ER5 A;  1EXR A;  4I5K A;  1JC2 A;  3PM8 A;  4MZJ A;  2KAY A;  3E3R A;  2LP2 A;  2WND A;  2LUC A;  1WDC B;  2R2I A;  3A8R A;  1JFJ A;  2KDH A;  1CLM A;  1QV0 A;  4JQ0 D;  1KWO C;  1SNL A;  1A03 A;  2NLN A;  4MRY A;  3TDU A;  1PK0 D;  1G8I A;  1KSO A;  4ETO A;  3DVJ A;  3DF0 A;  1N0Y A;  1VRK A;  4DUQ A;  1TRF A;  3SG7 A;  2E30 A;  1LKJ A;  3NSI A;  4JWQ A;  1SCM B;  2BBN A;  1L2O B;  1R2U A;  1BOD A;  4JPZ B;  1TNW A;  1YRT B;  2JPT A;  2PAL A;  1QX7 A;  1N65 A;  2F33 A;  4ORA B;  4BY5 A;  3I5H C;  1NWD A;  3FS7 A;  2KI6 C;  2Q91 A;  2ISD A;  2PAS A;  3TZ1 A;  4HRH A;  3AKA A;  1TTX A;  2ZNE A;  1A2X A;  2BL0 C;  1QV1 A;  4A4C A;  2NCO A;  3NSK A;  1OZO A;  1U5I B;  3TDI A;  1GGW A;  1V1F A;  4GPL B;  1IJ5 A;  2M29 A;  1DF0 B;  1BR4 B;  1PAL A;  1TCO B;  2D8N A;  2TN4 A;  4QJ4 B;  4E68 A;  1BR1 B;  1KFX L;  2NZ0 A;  4I5N B;  1HT9 A;  3I5G C;  1IWQ A;  4IL1 A;  2LNK A;  1M39 A;  1S6I A;  3O78 A;  3PFV A;  1ODB A;  2LAN A;  1QLK A;  1NX0 A;  5F6T A;  1CLL A;  1SYM A;  3VRN A;  1DJW A;  2KI4 B;  1KSM A;  1FW4 A;  4USL A;  1CMG A;  2LE9 B;  3PAL A;  1UHI A;  2WCB A;  2MAZ A;  1ALV A;  2ZRS A;  5BPJ A;  4ORC B;  2OS8 B;  5KSZ A;  1F54 A;  3WNX B;  1J1D A;  4AQI A;  1K2H A;  1DGU A;  1D1O A;  1S3P A;  1YUR A;  2LM5 A;  1IQ5 A;  3GK2 A;  4C0L A;  1CFP A;  1JBA A;  2H2K A;  4XJK B;  1KK8 B;  1SR6 C;  1N2D A;  2LLT A;  2M8U A;  1B8C A;  3QRX A;  5FYX A;  1DGV A;  1MQ1 A;  4BY4 A;  1AUI B;  2FJU B;  1MUX A;  1EL4 A;  4OV2 A;  3SIB A;  4HSZ A;  4MZK A;  2ZKM X;  4MVF A;  1MXE A;  3K21 A;  2HET A;  3AKB A;  4NQG A;  1HQV A;  1ZUZ A;  3KF9 A;  1GJY A;  1UHN A;  4AOM A;  5D7F A;  1TN4 A;  3NSL A;  1BF5 A;  1XFZ O;  1YTZ C;  3C1V A;  3EVV A;  1NX2 A;  1LA3 A;  3ZNI A;  1BOC A;  2JT0 A;  3A4U B;  2FCE A;  3AAJ A;  1KWO B;  2WOS A;  3SG4 A;  1XFY O;  1PVB A;  2LHI A;  1AP4 A;  1DTL A;  1QIW A;  2KYF A;  2Y5I A;  5CSJ A;  3O2P A;  3HCM A;  2IS9 A;  2GGM A;  2HF5 A;  4YGD B;  1RFJ A;  1NCY A;  1E8A A;  3EVR A;  1OMR A;  1ZOT B;  2MLF C;  2MHH A;  3CR2 A;  2KBI A;  2AUC A;  1H4B A;  5HKY A;  1NP8 A;  1PRW A;  3SG2 A;  1GQM A;  4HRG A;  1Q80 A;  2LLS A;  3I5H B;  1SY9 A;  3EVU A;  3PSR A;  1K8U A;  1V1G A;  3GK1 A;  2LAP A;  1G4Y R;  1ALW A;  2L98 A;  3BXK A;  4MSP A;  5I2Q A;  1GGZ A;  2LCP A;  2JXL A;  2OTG C;  3JTD C;  4PE1 A;  1SBJ A;  4YGE B;  2QAC A;  3SIA A;  1YUU A;  1TNP A;  2JOJ A;  3BUN B;  1NYA A;  1OZS A;  2F2P A;  4OVN F;  2FOT A;  1CDN A;  2LHL A;  4D1E A;  3KO0 A;  4MN0 A;  4R1E A;  3GOF A;  3CLN A;  3RM1 A;  2K7B A;  3EKH A;  3D10 A;  1WY9 A;  1YUT A;  4YRU A;  3I5G B;  3FIA A;  2CT9 A;  1B1G A;  1IH0 A;  1PUL A;  1DJH A;  1CM4 A;  2LLU A;  2KBM A;  1LXF C;  3DF0 B;  2F3Z A;  2JU0 A;  1F55 A;  4PHJ A;  2KSP A;  2LVV A;  1FI5 A;  5CSF A;  1QS7 A;  1QX2 A;  1CKK A;  4Q04 A;  2K61 A;  2NXQ A;  3OP0 A;  4I5L B;  1PVA A;  5I2O A;  2WCF A;  2KAV A;  2K7C A;  1KQV A;  4GGF A;  2PSR A;  2CXJ A;  2M97 A;  4GUK A;  1SKT A;  2EC6 C;  1AK8 A;  2KFG A;  1SK6 D;  1XK4 A;  2AMI A;  2JUL A;  2F8P A;  1EG3 A;  2LV7 A;  3NXA A;  4QJ3 B;  1NX3 A;  1OOJ A;  1K93 D;  4N5X A;  2HQW A;  1SR6 B;  1DJZ A;  1KFU L;  4AQJ A;  2JNF A;  1G33 A;  5K89 A;  1F71 A;  1TNX A;  1CNP A;  2Q4U A;  2Y4Q A;  2MRD A;  2COL B;  5B8I B;  2LC5 A;  4DCK A;  2SCP A;  2MBX A;  1DMO A;  1J55 A;  2JQ6 A;  1QIV A;  3VRP A;  1PSB A;  1MWN A;  4MRX A;  4YGB B;  1CB1 A;  4MLW A;  3TS5 C;  1IG5 A;  3EK7 A;  1FI6 A;  1SRA A;  4NDB A;  2LMV A;  3FWB A;  1QXP A;  2KFH A;  2Y1M A;  1BJF A;  1EG4 A;  5DKQ A;  1JF0 A;  2LUX A;  2I94 A;  4GGF C;  5DKN A;  2KAX A;  2DOQ A;  1XFV O;  1UWO A;  1OSA A;  5DKR A;  1XK4 C;  3CS1 A;  4NDD A;  1RWY A;  2KOT A;  4DIR A;  2BKH B;  1J1E A;  2V53 A;  4PDZ A;  1A75 A;  2JT3 A;  2L4H A;  1ZMZ A;  4DS7 A;  2L2E A;  1QJT A;  2JT8 A;  2K7O A;  3LCP C;  3I5F C;  4CPV A;  4CFR A;  4UPG A;  4PHM A;  4P5O E;  4M2O A;  1F4O A;  1PSR A;  2OTG B;  1NUB A;  3TUY B;  5HLO A;  4YBH B;  4A4B A;  3JTD B;  3D0Y A;  1B7T Z;  1DJG A;  1KK7 Z;  2M7N A;  2ZN9 A;  2JC2 A;  2MLE C;  2KI6 D;  1M31 A;  2RGI A;  1IKU A;  1Y0V H;  1WDC C;  3HX4 A;  2I7A A;  2BEC A;  3BUW B;  1UHJ A;  4L9M A;  5AAN A;  1JFK A;  4ICB A;  2L4I A;  1BT6 A;  1S26 D;  1XFX O;  3O4Y A;  2JRF A;  1CFC A;  1MF8 B;  1K9U A;  5PAL A;  3SG3 A;  2ZRT A;  5GQQ C;  5AEQ A;  4GGN A;  2AAO A;  2M9G A;  1B4C A;  1J7P A;  1S6J A;  1DVI A;  1UHH A;  1SL9 A;  3EK4 A;  4TNC A;  3SG6 A;  1XA5 A;  2EC6 B;  2I18 A;  1TCF A;  1A29 A;  3WHT B;  1K9K A;  3CGA A;  3BUO B;  1OMD A;  1BLQ A;  1SPY A;  3VRO A;  4QJ5 B;  1CLB A;  1J7Q A;  4N1G A;  1SL8 A;  1B7T Y;  5CPV A;  2BKI B;  2LMT A;  1UP5 A;  1KK7 Y;  2BBM A;  1EH2 A;  4YGC B;  5JJG A;  2BL0 B;  1QVI Z;  1SCV A;  3PN7 C;  2M7L A;  1IRJ A;  1JSA A;  1Y1X A;  3EK8 A;  2ZFD A;  1NX1 A;  1QX5 B;  1XO5 A;  4I5J A;  3BOW A;  3TS5 B;  1QLS A;  2SAS A;  3VRQ A;  1BU3 A;  1IQ3 A;  2LP3 A;  2B1U A;  2NCP A;  1XYD A;  1B8R A;  2JWW A;  4ZCV A;  3AAK A;  1CFF A;  1FF1 A;  2GV5 A;  1S5G Z;  2A4J A;  3CR5 X;  2H61 A;  3VRR A;  2VRG A;  4F0Z B;  2F3Y A;  4MBE A;  2K8M B;  1FBV A;  1FPW A;  1WRZ A;  4ZCU A;  2O5G A;  2HPS A;  2KHN A;  1CM1 A;  2Y1N A;  3CTN A;  1LIN A;  2LMU A;  1CDM A;  1SW8 A;  1LA0 A;  1KQM C;  4NDC A;  3O6B A;  2BE4 A;  1C7V A;  3I5F B;  2I2R E;  4M2P A;  1KCY A;  3DVM A;  3LL8 B;  4OKH A;  2M3W A;  1YX8 A;  2WC8 A;  3CR4 X;  4PHK A;  1EJ3 A;  4ORB B;  3PAT A;  1KFX S;  4M2Q A;  3BUX B;  1J7O A;  3VGO A;  1UUR A;  5HLV A;  4MZL A;  2CTN A;  2BE6 A;  1XFU O;  2K2A A;  3IQO A;  1QVI Y;  5CSI A;  1ZFS A;  2M1U A;  3LLE A;  5D69 A;  1RK9 A;  2EHB A;  1WRL A;  5I8N A;  1DJI A;  1CFD A;  4C0J A;  1TIZ A;  3MSE B;  5TNC A;  3KHE A;  3ZWH A;  3CWG A;  1K90 D;  2H61 C;  1YVL A;  4FQO A;  3LK0 A;  1YR5 A;  3BUM B;  5AER A;  4GFT A;  3BYA A;  1S5G Y;  2FCD A;  2KYC A;  4PAL A;  2KGB C;  2BCA A;  1QTX A;  1A75 B;  4YI8 A;  2L51 A;  1NPQ A;  5AXI A;  4PE7 A;  1XVJ A;  1YRU B;  4GNK B;  3PLF B;  4MEW A;  3JVT C;  1OQP A;  1AJ5 A;  1W7I B;  5HKW A;  4YGA A;  1M46 A;  1Y6W A;  1SL7 A;  2K2F A;  3NSO A;  3D0Y B;  4N1F A;  3F45 A;  4CID A;  1B9A A;  1DT7 B;  4U8D A;  3RLZ A;  1W7J B;  2JXC A;  1XFW O;  1NCZ A;  1WLZ A;  2CNP A;  2PRU A;  3OB1 B;  3PN7 B;  3I5I C;  1TNQ A;  1S36 A;  1F70 A;  1BMO A;  1A4P A;  1U5I A;  2EGD A;  3H4S E;  1B47 A;  2JTT A;  2LVI A;  1WLM A;  1CDP A;  1AHR A;  1DF0 A;  1TOP A;  1X02 A;  2F2O A;  2K0J A;  2PVB A;  5J3X A;  2LVK A;  2G2B A;  2ZND A;  1CMF A;  1JUO A;  1Y1U A;  3LK1 A;  1DJX A;  1M63 B;  5HKZ A;  3M0W A;  2JTZ A;  5KTY A;  1NCX A;  4YI9 A;  3KEV A;  5G08 A;  1K94 A;  3OX5 A;  1F4Q A;  1RRO A;  3DVE A;  2WOR A;  1QAS A;  2GGZ A;  1SCM C;  4PE0 A;  3FWC A;  1CDL A;  1L2O C;  2WCE A;  2L5X B;  1IJ6 A;  1AVS A;  3SG5 A;  3DD4 A;  1KQM B;  4GAO A;  1BG1 A;  3OX6 A;  4XYN A;  4PCW A;  1YUS A;  4DRW A;  2G9B A;  4WRI A;  1J7R A;  1QAT A;  1L7Z A;  3OB2 B;  1LVC D;  4CLN A;  1OMV A;  5AFP A;  2P6B B;  1MXL C;  3OHM B;  1NSH A;  3CZT X;  5JOL A; 
#chains in the Genus database with same CATH topology
 2KNE A;  1JF2 A;  4XJK A;  3SS5 A;  1AJ4 A;  3BQ3 A;  3TDZ A;  3BFH A;  5HYD A;  1MHO A;  1OE9 B;  1M45 A;  3DVK A;  4OCI A;  4P2Y B;  3BOW B;  2QEH A;  4HRE E;  1IGV A;  2JNX A;  3ICB A;  1C07 A;  1XFR A;  1MR8 A;  4GBA A;  3WXA A;  1ZAC A;  2ZN8 A;  2BCB A;  2O60 A;  3WHU B;  3KPX A;  3SJS A;  5KU1 A;  1CTR A;  1K95 A;  2E6W A;  1K9P A;  2KGR A;  1F8H A;  2KQ6 A;  2HQ8 A;  3R1V A;  2L0P A;  3GK4 X;  4PHN A;  5ER4 X;  2QDI A;  5IBW A;  1QWV A;  2KI4 C;  3IQQ A;  5CSN A;  4WQ2 A;  1R6P A;  1JWD A;  4WQ3 A;  2KQY A;  2OS8 C;  2WC6 A;  1H8B A;  1KFU S;  2K7D A;  4OR9 B;  2CCM A;  2BCX A;  2GTE A;  4PE4 A;  3DYE A;  4FTG A;  3JVT B;  1B8L A;  1YVH A;  2MA2 A;  1K96 A;  2PYQ A;  1RJV A;  2CBL A;  2L5Y A;  2M49 B;  2WCK A;  2LVJ A;  3TUY C;  2JZI A;  2OPO A;  1WRK A;  1YX7 A;  2QPT A;  5FI2 A;  1DJY A;  2KFF A;  3CYZ A;  1KK8 C;  5I2L A;  4CFQ A;  1S1E A;  2QEO A;  3EKJ A;  1S6C A;  2BNX A;  1NIW A;  2M0R A;  3IF7 A;  3CAB A;  4FQT A;  2L50 A;  1RTP 1;  1UHK A;  3I5I B;  1Y1A A;  2PMY A;  3NGV A;  2MJW B;  1C7W A;  2M1K B;  1SMG A;  1UUS A;  1REC A;  4C0K A;  5ER5 A;  1EXR A;  4I5K A;  1JC2 A;  3PM8 A;  4MZJ A;  2KAY A;  3E3R A;  2LP2 A;  2WND A;  3D75 A;  2LUC A;  1WDC B;  2R2I A;  3A8R A;  1JFJ A;  2KDH A;  1CLM A;  3CZ0 A;  1QV0 A;  4JQ0 D;  1KWO C;  1SNL A;  1A03 A;  2NLN A;  4MRY A;  3TDU A;  1PK0 D;  1G8I A;  1KSO A;  4ETO A;  3DVJ A;  3DF0 A;  1N0Y A;  3DY9 A;  1VRK A;  4DUQ A;  1TRF A;  3SG7 A;  2E30 A;  1LKJ A;  3NHT A;  3NSI A;  4JWQ A;  1SCM B;  2BBN A;  1L2O B;  2QEV A;  1R2U A;  1BOD A;  4JPZ B;  1TNW A;  1YRT B;  2JPT A;  2PAL A;  1QX7 A;  1N65 A;  2F33 A;  4ORA B;  4BY5 A;  2KLE A;  3I5H C;  1NWD A;  3FS7 A;  2KI6 C;  2Q91 A;  2ISD A;  5D3O A;  2PAS A;  3TZ1 A;  4HRH A;  3AKA A;  1TTX A;  2ZNE A;  1A2X A;  2BL0 C;  1QV1 A;  4A4C A;  2NCO A;  3NSK A;  1OZO A;  1U5I B;  3TDI A;  1GGW A;  1V1F A;  4GPL B;  1IJ5 A;  2M29 A;  1DF0 B;  1BR4 B;  1PAL A;  1TCO B;  2D8N A;  2TN4 A;  3NHI A;  4QJ4 B;  4E68 A;  1BR1 B;  1KFX L;  2NZ0 A;  4I5N B;  1HT9 A;  3I5G C;  1IWQ A;  4IL1 A;  2LNK A;  1M39 A;  3O4X A;  1S6I A;  3EG5 B;  3O78 A;  3PFV A;  1ODB A;  2LAN A;  1GM0 A;  1QLK A;  1NX0 A;  5F6T A;  1CLL A;  1SYM A;  3VRN A;  1DJW A;  2KI4 B;  1KSM A;  1Z4H A;  1FW4 A;  4USL A;  2LE9 B;  3PAL A;  1UHI A;  2WCB A;  1CMG A;  3VB1 A;  2MAZ A;  1ALV A;  2ZRS A;  5BPJ A;  4ORC B;  2OS8 B;  5KSZ A;  1F54 A;  3WNX B;  2P71 A;  1J1D A;  4AQI A;  1K2H A;  1DGU A;  1D1O A;  1S3P A;  1YUR A;  2LM5 A;  1W9Z A;  3N7H A;  1IQ5 A;  3GK2 A;  4C0L A;  1CFP A;  1JBA A;  2H2K A;  4XJK B;  1KK8 B;  1SR6 C;  3R72 A;  1N2D A;  2JPO A;  2LLT A;  2M8U A;  1B8C A;  3QRX A;  5FYX A;  1DGV A;  1MQ1 A;  4BY4 A;  1AUI B;  2FJU B;  1MUX A;  1EL4 A;  4OV2 A;  3SIB A;  4HSZ A;  3IVT A;  4MZK A;  2ZKM X;  3Q8I A;  4MVF A;  1MXE A;  1Z2C B;  3K21 A;  2HET A;  3AKB A;  4NQG A;  1HQV A;  1ZUZ A;  3KF9 A;  1GJY A;  1UHN A;  4AOM A;  5D7F A;  1TN4 A;  3NSL A;  1BF5 A;  1XFZ O;  2K60 A;  1YTZ C;  2WCJ A;  3C1V A;  3EVV A;  1IIO A;  3PJI A;  1NX2 A;  1LA3 A;  3ZNI A;  1BOC A;  2JT0 A;  3A4U B;  3K1E A;  2FCE A;  3AAJ A;  1KWO B;  2WOS A;  3SG4 A;  1XFY O;  1PVB A;  2WCL A;  2LHI A;  4IJ7 A;  1DTL A;  1QIW A;  2KYF A;  1T14 A;  2Y5I A;  4INX A;  5CSJ A;  1AP4 A;  3O2P A;  3HCM A;  2IS9 A;  2GGM A;  2HF5 A;  4YGD B;  4KYN A;  1RFJ A;  1NCY A;  1E8A A;  3EVR A;  1OMR A;  1ZOT B;  2MLF C;  3B6X A;  2MHH A;  3CR2 A;  2KBI A;  4OZD A;  2AUC A;  1H4B A;  5HKY A;  1NP8 A;  1PRW A;  3SG2 A;  1GQM A;  4HRG A;  3S0D A;  1Q80 A;  2LLS A;  3UNW A;  3I5H B;  1SY9 A;  3EVU A;  3PSR A;  1K8U A;  1V1G A;  3GK1 A;  2LAP A;  2BAP A;  1G4Y R;  1ALW A;  2L98 A;  3BXK A;  4MSP A;  5I2Q A;  1GGZ A;  2LCP A;  2JXL A;  2OTG C;  3B88 A;  3JTD C;  4PE1 A;  1SBJ A;  4YGE B;  2QAC A;  3SIA A;  1YUU A;  1TNP A;  2JOJ A;  3B7A A;  3BUN B;  1NYA A;  1OZS A;  2F2P A;  4OVN F;  2FOT A;  1CDN A;  1DEK A;  2LHL A;  4D1E A;  3KO0 A;  1DQE A;  4MN0 A;  4R1E A;  3GOF A;  3CLN A;  3D78 A;  3RM1 A;  2K7B A;  3D74 A;  3D10 A;  1WY9 A;  1YUT A;  3EKH A;  3I5G B;  4YRU A;  3FIA A;  2CT9 A;  1B1G A;  1IH0 A;  1PUL A;  1DJH A;  1CM4 A;  2LLU A;  2KBM A;  1LXF C;  3DF0 B;  2F3Z A;  2JU0 A;  1F55 A;  4PHJ A;  3R1P A;  2KSP A;  2LVV A;  1FI5 A;  5CSF A;  3QME A;  1QS7 A;  1QX2 A;  1CKK A;  4Q04 A;  2K61 A;  2NXQ A;  3OP0 A;  4I5L B;  1PVA A;  5I2O A;  2WCF A;  2KAV A;  2K7C A;  5FI7 A;  1KQV A;  3S0A A;  4GGF A;  2PSR A;  2CXJ A;  2M97 A;  4GUK A;  1SKT A;  2EC6 C;  1AK8 A;  2KFG A;  3FE6 A;  1SK6 D;  1XK4 A;  2AMI A;  2JUL A;  2F8P A;  1EG3 A;  2LV7 A;  3NXA A;  4JKT A;  1NX3 A;  4QJ3 B;  1OOJ A;  1K93 D;  4N5X A;  2HQW A;  1SR6 B;  1DJZ A;  1KFU L;  1ORG A;  4AQJ A;  2JNF A;  1G33 A;  5K89 A;  1F71 A;  1TNX A;  3S0G A;  1CNP A;  2Q4U A;  2Y4Q A;  2MRD A;  2COL B;  3S0E A;  1OOF A;  5B8I B;  2LC5 A;  3DXL A;  2SCP A;  2MBX A;  4DCK A;  1DMO A;  1J55 A;  2JQ6 A;  1QIV A;  3VRP A;  1PSB A;  2WC5 A;  1OOI X;  5DIC A;  1MWN A;  4MRX A;  4YGB B;  1CB1 A;  4MLW A;  3TS5 C;  1IG5 A;  3EK7 A;  1FI6 A;  1SRA A;  4NDB A;  2LMV A;  3FWB A;  1QXP A;  2KFH A;  2Y1M A;  1BJF A;  1EG4 A;  5DKQ A;  3CZ2 A;  3S0F A;  1JF0 A;  2LUX A;  2I94 A;  4GGF C;  5DKN A;  2KAX A;  2DOQ A;  1XFV O;  1UWO A;  2KPH A;  3FE9 A;  1OSA A;  5DKR A;  1XK4 C;  3CS1 A;  4NDD A;  1RWY A;  2KOT A;  4DIR A;  2BKH B;  1J1E A;  2ERB A;  2V53 A;  4PDZ A;  1A75 A;  2JT3 A;  2L4H A;  1ZMZ A;  4DS7 A;  2L2E A;  1QJT A;  2JT8 A;  2K7O A;  3LCP C;  3I5F C;  4CPV A;  4CFR A;  4UPG A;  2WCM A;  4PHM A;  1OOH A;  4M2O A;  3BJH A;  4P5O E;  1F4O A;  1PSR A;  2OTG B;  1NUB A;  3TUY B;  5HLO A;  4YBH B;  4A4B A;  3JTD B;  3D0Y A;  3OBV A;  1B7T Z;  1C3Y A;  1DJG A;  1KK7 Z;  2M7N A;  2ZN9 A;  1OW4 A;  2JC2 A;  2MLE C;  2KI6 D;  1M31 A;  2RGI A;  1IKU A;  1Y0V H;  1WDC C;  5HL1 A;  3HX4 A;  2I7A A;  2BEC A;  3BUW B;  1UHJ A;  4L9M A;  5AAN A;  1JFK A;  4ICB A;  2L4I A;  1BT6 A;  1S26 D;  1XFX O;  3O4Y A;  2JRF A;  1CFC A;  1MF8 B;  1K9U A;  5PAL A;  3SG3 A;  2ZRT A;  5GQQ C;  5AEQ A;  4GGN A;  2AAO A;  2M9G A;  1B4C A;  1P28 A;  1J7P A;  1S6J A;  1DVI A;  1UHH A;  1SL9 A;  3EK4 A;  4TNC A;  3SG6 A;  1XA5 A;  2EC6 B;  2I18 A;  1TCF A;  1A29 A;  4JD9 A;  3WHT B;  1K9K A;  3CGA A;  3V2L A;  3BUO B;  1OMD A;  1BLQ A;  1SPY A;  3VRO A;  4QJ5 B;  1CLB A;  1J7Q A;  4N1G A;  1SL8 A;  5EL2 A;  1B7T Y;  5CPV A;  2BKI B;  2LMT A;  2P70 A;  1UP5 A;  1KK7 Y;  2BBM A;  1EH2 A;  4YGC B;  2PQL A;  5JJG A;  3BFA A;  2BL0 B;  1QVI Z;  1SCV A;  3PN7 C;  4PT1 A;  2M7L A;  1IRJ A;  1JSA A;  1Y1X A;  3EK8 A;  2ZFD A;  1NX1 A;  1QX5 B;  1XO5 A;  4I5J A;  3BOW A;  3TS5 B;  1TUZ A;  1QLS A;  2SAS A;  3S0B A;  1BU3 A;  3VRQ A;  2LP3 A;  2B1U A;  2NCP A;  1XYD A;  1B8R A;  1IQ3 A;  2JWW A;  4ZCV A;  3AAK A;  1CFF A;  1FF1 A;  2GV5 A;  3BFB A;  1S5G Z;  3L4A A;  2A4J A;  3CR5 X;  2H61 A;  3VRR A;  3RZS A;  2VRG A;  4F0Z B;  2F3Y A;  4MBE A;  2K8M B;  1FBV A;  1FPW A;  1WRZ A;  4ZCU A;  2O5G A;  2HPS A;  2KHN A;  1CM1 A;  2Y1N A;  1DEL A;  1LIN A;  2LMU A;  3CTN A;  4F7F A;  1CDM A;  1SW8 A;  1LA0 A;  1KQM C;  3CDN A;  4NDC A;  3DZT A;  2BE4 A;  3O6B A;  3I5F B;  1C7V A;  2I2R E;  4M2P A;  1KCY A;  3DVM A;  3LL8 B;  4OKH A;  2M3W A;  1YX8 A;  2WC8 A;  3CR4 X;  4PHK A;  1EJ3 A;  4ORB B;  3PAT A;  1KFX S;  4M2Q A;  3D76 A;  2KLD A;  2L2C A;  3BUX B;  1J7O A;  3VGO A;  5I94 A;  1UUR A;  3CZ1 A;  5HLV A;  4MZL A;  2CTN A;  2BE6 A;  1XFU O;  2K2A A;  3IQO A;  1QVI Y;  2FJY A;  1ZFS A;  2M1U A;  3LLE A;  5CSI A;  5D69 A;  1RK9 A;  2EHB A;  1WRL A;  3R1O A;  5I8N A;  1DJI A;  1CFD A;  4C0J A;  1TIZ A;  3MSE B;  5TNC A;  2YGU A;  3KHE A;  3ZWH A;  3CWG A;  3L47 A;  1K90 D;  2H61 C;  1YVL A;  4FQO A;  3LK0 A;  1YR5 A;  3BUM B;  1TUJ A;  5AER A;  4GFT A;  3BYA A;  1S5G Y;  2FCD A;  2KYC A;  4PAL A;  2KGB C;  2BCA A;  1QTX A;  3D77 A;  1A75 B;  3D73 A;  4YI8 A;  2L51 A;  1NPQ A;  5AXI A;  4PE7 A;  1DC1 A;  1XVJ A;  1YRU B;  4GNK B;  3PLF B;  4MEW A;  3JVT C;  5FI6 A;  1OQP A;  1AJ5 A;  1W7I B;  5HKW A;  1SSE B;  1M46 A;  3PM2 A;  1Y6W A;  4YGA A;  1SL7 A;  2K2F A;  3NSO A;  3D0Y B;  3SS4 A;  4N1F A;  3F45 A;  3FE8 A;  4CID A;  1B9A A;  1DT7 B;  4U8D A;  3L4L A;  3RLZ A;  1W7J B;  2JXC A;  1XFW O;  1NCZ A;  1WLZ A;  3UO9 A;  2CNP A;  2PRU A;  3OB1 B;  3PN7 B;  2QEB A;  3I5I C;  1TNQ A;  1S36 A;  3OGN A;  1F70 A;  1BMO A;  1A4P A;  1U5I A;  2EGD A;  3B86 A;  3H4S E;  4INW A;  1B47 A;  2JTT A;  2LVI A;  1WLM A;  1CDP A;  1AHR A;  1DF0 A;  1TOP A;  1X02 A;  2F2O A;  2K0J A;  2PVB A;  5J3X A;  1C3Z A;  2LVK A;  2G2B A;  2ZND A;  3B87 A;  1CMF A;  1JUO A;  1Y1U A;  3LK1 A;  1DJX A;  1M63 B;  5HKZ A;  3M0W A;  2JTZ A;  5KTY A;  1NCX A;  4YI9 A;  3KEV A;  5G08 A;  1K94 A;  3OX5 A;  1F4Q A;  1RRO A;  3DVE A;  2WOR A;  1OOG A;  1QAS A;  2GGZ A;  1SCM C;  4PE0 A;  3FWC A;  1CDL A;  1L2O C;  2WCE A;  2L5X B;  1IJ6 A;  1AVS A;  2H8V A;  3SG5 A;  3DD4 A;  1KQM B;  4GAO A;  1BG1 A;  3OX6 A;  4XYN A;  4PCW A;  1YUS A;  4DRW A;  2G9B A;  4WRI A;  1J7R A;  1QAT A;  1L7Z A;  2WCH A;  3OB2 B;  1LVC D;  4CLN A;  1OMV A;  5AFP A;  1LS8 A;  1MXL C;  1TWO A;  2P6B B;  1NSH A;  3OHM B;  3SS3 A;  3CZT X;  5JOL A; 
#chains in the Genus database with same CATH homology
 2KNE A;  1JF2 A;  4XJK A;  1AJ4 A;  3BQ3 A;  3TDZ A;  5HYD A;  1MHO A;  1OE9 B;  1M45 A;  3DVK A;  4OCI A;  4P2Y B;  3BOW B;  4HRE E;  1C07 A;  1IGV A;  2JNX A;  3ICB A;  1MR8 A;  4GBA A;  3WXA A;  1ZAC A;  2ZN8 A;  2BCB A;  2O60 A;  3WHU B;  3KPX A;  3SJS A;  5KU1 A;  1CTR A;  1K95 A;  2E6W A;  1K9P A;  2KGR A;  1F8H A;  2KQ6 A;  2HQ8 A;  2L0P A;  3GK4 X;  4PHN A;  5ER4 X;  5IBW A;  2KI4 C;  3IQQ A;  5CSN A;  4WQ2 A;  1R6P A;  1JWD A;  4WQ3 A;  2KQY A;  2OS8 C;  1H8B A;  1KFU S;  2K7D A;  4OR9 B;  2CCM A;  2BCX A;  4PE4 A;  4FTG A;  3JVT B;  1B8L A;  1YVH A;  2MA2 A;  1K96 A;  1RJV A;  2CBL A;  2M49 B;  2LVJ A;  3TUY C;  2JZI A;  2OPO A;  1WRK A;  1YX7 A;  2QPT A;  1DJY A;  2KFF A;  1KK8 C;  5I2L A;  4CFQ A;  1S1E A;  3EKJ A;  1S6C A;  1NIW A;  2M0R A;  3IF7 A;  2L50 A;  1RTP 1;  1UHK A;  3I5I B;  1Y1A A;  2PMY A;  2MJW B;  1C7W A;  2M1K B;  1SMG A;  1UUS A;  1REC A;  4C0K A;  5ER5 A;  1EXR A;  4I5K A;  1JC2 A;  3PM8 A;  4MZJ A;  2KAY A;  3E3R A;  2LP2 A;  2WND A;  2LUC A;  1WDC B;  2R2I A;  3A8R A;  1JFJ A;  2KDH A;  1CLM A;  1QV0 A;  4JQ0 D;  1KWO C;  1SNL A;  1A03 A;  2NLN A;  4MRY A;  3TDU A;  1PK0 D;  1G8I A;  1KSO A;  4ETO A;  3DVJ A;  3DF0 A;  1N0Y A;  1VRK A;  4DUQ A;  1TRF A;  3SG7 A;  2E30 A;  1LKJ A;  3NSI A;  4JWQ A;  1SCM B;  2BBN A;  1L2O B;  1R2U A;  1BOD A;  4JPZ B;  1TNW A;  1YRT B;  2JPT A;  2PAL A;  1QX7 A;  1N65 A;  2F33 A;  4ORA B;  4BY5 A;  3I5H C;  1NWD A;  3FS7 A;  2KI6 C;  2Q91 A;  2ISD A;  2PAS A;  3TZ1 A;  4HRH A;  3AKA A;  1TTX A;  2ZNE A;  1A2X A;  2BL0 C;  1QV1 A;  4A4C A;  2NCO A;  3NSK A;  1OZO A;  1U5I B;  3TDI A;  1GGW A;  1V1F A;  4GPL B;  1IJ5 A;  2M29 A;  1DF0 B;  1BR4 B;  1PAL A;  1TCO B;  2D8N A;  2TN4 A;  4QJ4 B;  4E68 A;  1BR1 B;  1KFX L;  2NZ0 A;  4I5N B;  1HT9 A;  3I5G C;  1IWQ A;  4IL1 A;  2LNK A;  1M39 A;  1S6I A;  3O78 A;  3PFV A;  1ODB A;  2LAN A;  1QLK A;  1NX0 A;  5F6T A;  1CLL A;  1SYM A;  3VRN A;  1DJW A;  2KI4 B;  1KSM A;  1FW4 A;  4USL A;  1CMG A;  2LE9 B;  3PAL A;  1UHI A;  2WCB A;  2MAZ A;  1ALV A;  2ZRS A;  5BPJ A;  4ORC B;  2OS8 B;  5KSZ A;  1F54 A;  3WNX B;  1J1D A;  4AQI A;  1K2H A;  1DGU A;  1D1O A;  1S3P A;  1YUR A;  2LM5 A;  1IQ5 A;  3GK2 A;  4C0L A;  1CFP A;  1JBA A;  2H2K A;  4XJK B;  1KK8 B;  1SR6 C;  1N2D A;  2LLT A;  2M8U A;  1B8C A;  3QRX A;  5FYX A;  1DGV A;  1MQ1 A;  4BY4 A;  1AUI B;  2FJU B;  1MUX A;  1EL4 A;  4OV2 A;  3SIB A;  4HSZ A;  4MZK A;  2ZKM X;  4MVF A;  1MXE A;  3K21 A;  2HET A;  3AKB A;  4NQG A;  1HQV A;  1ZUZ A;  3KF9 A;  1GJY A;  1UHN A;  4AOM A;  5D7F A;  1TN4 A;  3NSL A;  1BF5 A;  1XFZ O;  1YTZ C;  3C1V A;  3EVV A;  1NX2 A;  1LA3 A;  3ZNI A;  1BOC A;  2JT0 A;  3A4U B;  2FCE A;  3AAJ A;  1KWO B;  2WOS A;  3SG4 A;  1XFY O;  1PVB A;  2LHI A;  1AP4 A;  1DTL A;  1QIW A;  2KYF A;  2Y5I A;  5CSJ A;  3O2P A;  3HCM A;  2IS9 A;  2GGM A;  2HF5 A;  4YGD B;  1RFJ A;  1NCY A;  1E8A A;  3EVR A;  1OMR A;  1ZOT B;  2MLF C;  2MHH A;  3CR2 A;  2KBI A;  2AUC A;  1H4B A;  5HKY A;  1NP8 A;  1PRW A;  3SG2 A;  1GQM A;  4HRG A;  1Q80 A;  2LLS A;  3I5H B;  1SY9 A;  3EVU A;  3PSR A;  1K8U A;  1V1G A;  3GK1 A;  2LAP A;  1G4Y R;  1ALW A;  2L98 A;  3BXK A;  4MSP A;  5I2Q A;  1GGZ A;  2LCP A;  2JXL A;  2OTG C;  3JTD C;  4PE1 A;  1SBJ A;  4YGE B;  2QAC A;  3SIA A;  1YUU A;  1TNP A;  2JOJ A;  3BUN B;  1NYA A;  1OZS A;  2F2P A;  4OVN F;  2FOT A;  1CDN A;  2LHL A;  4D1E A;  3KO0 A;  4MN0 A;  4R1E A;  3GOF A;  3CLN A;  3RM1 A;  2K7B A;  3EKH A;  3D10 A;  1WY9 A;  1YUT A;  4YRU A;  3I5G B;  3FIA A;  2CT9 A;  1B1G A;  1IH0 A;  1PUL A;  1DJH A;  1CM4 A;  2LLU A;  2KBM A;  1LXF C;  3DF0 B;  2F3Z A;  2JU0 A;  1F55 A;  4PHJ A;  2KSP A;  2LVV A;  1FI5 A;  5CSF A;  1QS7 A;  1QX2 A;  1CKK A;  4Q04 A;  2K61 A;  2NXQ A;  3OP0 A;  4I5L B;  1PVA A;  5I2O A;  2WCF A;  2KAV A;  2K7C A;  1KQV A;  4GGF A;  2PSR A;  2CXJ A;  2M97 A;  4GUK A;  1SKT A;  2EC6 C;  1AK8 A;  2KFG A;  1SK6 D;  1XK4 A;  2AMI A;  2JUL A;  2F8P A;  1EG3 A;  2LV7 A;  3NXA A;  4QJ3 B;  1NX3 A;  1OOJ A;  1K93 D;  4N5X A;  2HQW A;  1SR6 B;  1DJZ A;  1KFU L;  4AQJ A;  2JNF A;  1G33 A;  5K89 A;  1F71 A;  1TNX A;  1CNP A;  2Q4U A;  2Y4Q A;  2MRD A;  2COL B;  5B8I B;  2LC5 A;  4DCK A;  2SCP A;  2MBX A;  1DMO A;  1J55 A;  2JQ6 A;  1QIV A;  3VRP A;  1PSB A;  1MWN A;  4MRX A;  4YGB B;  1CB1 A;  4MLW A;  3TS5 C;  1IG5 A;  3EK7 A;  1FI6 A;  1SRA A;  4NDB A;  2LMV A;  3FWB A;  1QXP A;  2KFH A;  2Y1M A;  1BJF A;  1EG4 A;  5DKQ A;  1JF0 A;  2LUX A;  2I94 A;  4GGF C;  5DKN A;  2KAX A;  2DOQ A;  1XFV O;  1UWO A;  1OSA A;  5DKR A;  1XK4 C;  3CS1 A;  4NDD A;  1RWY A;  2KOT A;  4DIR A;  2BKH B;  1J1E A;  2V53 A;  4PDZ A;  1A75 A;  2JT3 A;  2L4H A;  1ZMZ A;  4DS7 A;  2L2E A;  1QJT A;  2JT8 A;  2K7O A;  3LCP C;  3I5F C;  4CPV A;  4CFR A;  4UPG A;  4PHM A;  4P5O E;  4M2O A;  1F4O A;  1PSR A;  2OTG B;  1NUB A;  3TUY B;  5HLO A;  4YBH B;  4A4B A;  3JTD B;  3D0Y A;  1B7T Z;  1DJG A;  1KK7 Z;  2M7N A;  2ZN9 A;  2JC2 A;  2MLE C;  2KI6 D;  1M31 A;  2RGI A;  1IKU A;  1Y0V H;  1WDC C;  3HX4 A;  2I7A A;  2BEC A;  3BUW B;  1UHJ A;  4L9M A;  5AAN A;  1JFK A;  4ICB A;  2L4I A;  1BT6 A;  1S26 D;  1XFX O;  3O4Y A;  2JRF A;  1CFC A;  1MF8 B;  1K9U A;  5PAL A;  3SG3 A;  2ZRT A;  5GQQ C;  5AEQ A;  4GGN A;  2AAO A;  2M9G A;  1B4C A;  1J7P A;  1S6J A;  1DVI A;  1UHH A;  1SL9 A;  3EK4 A;  4TNC A;  3SG6 A;  1XA5 A;  2EC6 B;  2I18 A;  1TCF A;  1A29 A;  3WHT B;  1K9K A;  3CGA A;  3BUO B;  1OMD A;  1BLQ A;  1SPY A;  3VRO A;  4QJ5 B;  1CLB A;  1J7Q A;  4N1G A;  1SL8 A;  1B7T Y;  5CPV A;  2BKI B;  2LMT A;  1UP5 A;  1KK7 Y;  2BBM A;  1EH2 A;  4YGC B;  5JJG A;  2BL0 B;  1QVI Z;  1SCV A;  3PN7 C;  2M7L A;  1IRJ A;  1JSA A;  1Y1X A;  3EK8 A;  2ZFD A;  1NX1 A;  1QX5 B;  1XO5 A;  4I5J A;  3BOW A;  3TS5 B;  1QLS A;  2SAS A;  3VRQ A;  1BU3 A;  1IQ3 A;  2LP3 A;  2B1U A;  2NCP A;  1XYD A;  1B8R A;  2JWW A;  4ZCV A;  3AAK A;  1CFF A;  1FF1 A;  2GV5 A;  1S5G Z;  2A4J A;  3CR5 X;  2H61 A;  3VRR A;  2VRG A;  4F0Z B;  2F3Y A;  4MBE A;  2K8M B;  1FBV A;  1FPW A;  1WRZ A;  4ZCU A;  2O5G A;  2HPS A;  2KHN A;  1CM1 A;  2Y1N A;  3CTN A;  1LIN A;  2LMU A;  1CDM A;  1SW8 A;  1LA0 A;  1KQM C;  4NDC A;  3O6B A;  2BE4 A;  1C7V A;  3I5F B;  2I2R E;  4M2P A;  1KCY A;  3DVM A;  3LL8 B;  4OKH A;  2M3W A;  1YX8 A;  2WC8 A;  3CR4 X;  4PHK A;  1EJ3 A;  4ORB B;  3PAT A;  1KFX S;  4M2Q A;  3BUX B;  1J7O A;  3VGO A;  1UUR A;  5HLV A;  4MZL A;  2CTN A;  2BE6 A;  1XFU O;  2K2A A;  3IQO A;  1QVI Y;  5CSI A;  1ZFS A;  2M1U A;  3LLE A;  5D69 A;  1RK9 A;  2EHB A;  1WRL A;  5I8N A;  1DJI A;  1CFD A;  4C0J A;  1TIZ A;  3MSE B;  5TNC A;  3KHE A;  3ZWH A;  3CWG A;  1K90 D;  2H61 C;  1YVL A;  4FQO A;  3LK0 A;  1YR5 A;  3BUM B;  5AER A;  4GFT A;  3BYA A;  1S5G Y;  2FCD A;  2KYC A;  4PAL A;  2KGB C;  2BCA A;  1QTX A;  1A75 B;  4YI8 A;  2L51 A;  1NPQ A;  5AXI A;  4PE7 A;  1XVJ A;  1YRU B;  4GNK B;  3PLF B;  4MEW A;  3JVT C;  1OQP A;  1AJ5 A;  1W7I B;  5HKW A;  4YGA A;  1M46 A;  1Y6W A;  1SL7 A;  2K2F A;  3NSO A;  3D0Y B;  4N1F A;  3F45 A;  4CID A;  1B9A A;  1DT7 B;  4U8D A;  3RLZ A;  1W7J B;  2JXC A;  1XFW O;  1NCZ A;  1WLZ A;  2CNP A;  2PRU A;  3OB1 B;  3PN7 B;  3I5I C;  1TNQ A;  1S36 A;  1F70 A;  1BMO A;  1A4P A;  1U5I A;  2EGD A;  3H4S E;  1B47 A;  2JTT A;  2LVI A;  1WLM A;  1CDP A;  1AHR A;  1DF0 A;  1TOP A;  1X02 A;  2F2O A;  2K0J A;  2PVB A;  5J3X A;  2LVK A;  2G2B A;  2ZND A;  1CMF A;  1JUO A;  1Y1U A;  3LK1 A;  1DJX A;  1M63 B;  5HKZ A;  3M0W A;  2JTZ A;  5KTY A;  1NCX A;  4YI9 A;  3KEV A;  5G08 A;  1K94 A;  3OX5 A;  1F4Q A;  1RRO A;  3DVE A;  2WOR A;  1QAS A;  2GGZ A;  1SCM C;  4PE0 A;  3FWC A;  1CDL A;  1L2O C;  2WCE A;  2L5X B;  1IJ6 A;  1AVS A;  3SG5 A;  3DD4 A;  1KQM B;  4GAO A;  1BG1 A;  3OX6 A;  4XYN A;  4PCW A;  1YUS A;  4DRW A;  2G9B A;  4WRI A;  1J7R A;  1QAT A;  1L7Z A;  3OB2 B;  1LVC D;  4CLN A;  1OMV A;  5AFP A;  2P6B B;  1MXL C;  3OHM B;  1NSH A;  3CZT X;  5JOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...