2GGZA

Crystal structure of human guanylate cyclase activating protein-3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
WYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylyl cyclase-activating protein 3
publication title The Crystal Structure of GCAP3 Suggests Molecular Mechanism of GCAP-linked Cone Dystrophies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase activator
total genus 55
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggzA00
2MLFC 3LCPC 3KHEA 5FYXA 1DGUA 3JTDB 1DF0B 1N65A 5HYDA 2PSRA 1QLSA 4QJ4B 2L50A 4CFQA 4DS7A 1MXLC 1LA3A 2ZRSA 2LMVA 3F45A 3O78A 1V1FA 4JQ0D 3VROA 1AP4A 2NCOA 1OMVA 1QIVA 1KSMA 2O60A 4OV2A 1CFCA 1GJYA 2OTGB 5HKZA 3RLZA 1CFDA 1UHNA 2M7LA 1C07A 2KNEA 1J1EA 2KQYA 5ER5A 1K96A 3FIAA 2MBXA 4PHNA 1QIWA 2JXLA 1S26D 1M63B 3EK7A 4I5LB 4WRIA 3TUYB 1NX1A 2BBMA 2L51A 3CR2A 4QJ3B 1Y1AA 1L2OC 1B8RA 1QS7A 1YVHA 1YUUA 1DJIA 2I94A 1Y0VH 2WNDA 4FTGA 1K9PA 2KGRA 1J1DA 3BQ3A 5CSJA 1S3PA 2LM5A 3EK8A 1KK7Y 4YGCB 2LC5A 1NCZA 1LA0A 3PLFB 1GGZA 2EGDA 2K2AA 4AQIA 1FI5A 1UHIA 4MSPA 2M1UA 4HRHA 1YX8A 1B8CA 1IRJA 4OCIA 1XVJA 4HSZA 2BE4A 4MLWA 1CMFA 4I5JA 4ORCB 1CB1A 2KAVA 3PN7C 1SY9A 1UHHA 1K2HA 2MA2A 1QVIY 1SBJA 1BMOA 1OMDA 4JWQA 2KYCA 1IJ6A 1H8BA 1FF1A 1R6PA 4GGNA 2LMTA 5I2LA 2BCXA 1LKJA 1D1OA 2EC6B 2E30A 1MHOA 2V53A 5J3XA 1CLLA 1CDLA 3VGOA 1JBAA 2E6WA 1SKTA 1QX2A 1F4QA 1IQ5A 1EJ3A 1OQPA 1YR5A 1A75A 1TTXA 2ZN9A 4BY4A 2BL0C 1FW4A 2JULA 5K89A 4PE7A 3KF9A 1XFWO 3BUXB 2NCPA 4NDBA 4USLA 1SR6C 3WNXB 4YGEB 3SG5A 1BODA 3D0YA 1A03A 1MQ1A 4Q04A 2JC2A 2LHLA 3I5HC 5GQQC 2KBMA 2L2EA 4XJKA 5AERA 1QXPA 2BCBA 1KQVA 1WDCB 2G2BA 1AJ4A 1RECA 3LK0A 2LLTA 3BUMB 4PALA 1SL8A 2PASA 1KCYA 2LMUA 2GGMA 2F3ZA 1MUXA 5B8IB 4DIRA 2FJUB 4YGDB 2WCEA 4PE4A 1U5IB 4MZJA 1M46A 4I5KA 2Q4UA 4ETOA 1BF5A 1TIZA 1JUOA 2ISDA 2JOJA 4GBAA 5D69A 1F70A 2JTZA 4D1EA 1B1GA 3M0WA 1JWDA 1G8IA 1UHJA 2M9GA 4ZCVA 1ZFSA 3GK1A 4JPZB 2MHHA 1NPQA 1NWDA 1TNPA 2H2KA 2AMIA 2RGIA 1HT9A 4AQJA 1KQMC 1IGVA 2HQWA 1UHKA 2LLSA 4GPLB 1YX7A 1NX0A 1RK9A 3JTDC 3OP0A 1Y6WA 1MR8A 2JWWA 3ZWHA 2M3WA 3NSOA 1JF2A 5CSFA 1YVLA 1S36A 1XFXO 3CR4X 1IQ3A 3EKHA 2LVIA 2OS8B 2OTGC 5AXIA 1AHRA 1TOPA 1RTP1 1QVIZ 1FPWA 4DUQA 1ZUZA 1QATA 2LNKA 3DF0B 3OHMB 1OZSA 3GK2A 5G08A 3PSRA 4MRYA 1JFKA 1LINA 2K7DA 3LL8B 3KO0A 1B47A 3BOWA 3EKJA 4IL1A 3TUYC 1DJGA 1RJVA 1UWOA 3CZTX 4R1EA 1EG3A 2G9BA 4N5XA 1EH2A 3DVEA 5IBWA 3QRXA 3E3RA 1K93D 3PFVA 1BT6A 1TN4A 2K7BA 1TNQA 2LUCA 3I5FB 1Y1XA 1SL9A 1J55A 2MJWB 1PSBA 3BXKA 2KI6C 3EK4A 4MBEA 4ZCUA 1S5GZ 2K61A 1EXRA 2CT9A 4HRGA 2DOQA 2LLUA 1A2XA 4MZKA 4CIDA 1K95A 5AANA 2WCFA 2JU0A 1F8HA 1KK8B 1B4CA 1S1EA 4PE1A 5HLVA 1J7PA 2KFHA 2F3YA 1WRZA 4OR9B 1XFYO 4M2PA 5JJGA 1AJ5A 1BU3A 3ICBA 1N0YA 1SCMB 1DJWA 2F2PA 2O5GA 1K9KA 5CPVA 2EC6C 3AAKA 4CLNA 2ZRTA 1IG5A 1LVCD 4C0LA 3A4UB 1BLQA 1CMGA 2JXCA 2CNPA 1HQVA 5AFPA 2ZFDA 1J7RA 1BR4B 2HETA 1PRWA 3DVJA 1DJZA 2JT0A 5HKWA 4UPGA 1M45A 5DKRA 2F2OA 3AAJA 4YRUA 1ZACA 2SASA 3CR5X 1WLMA 2JQ6A 1DJYA 2CCMA 2K7CA 2KQ6A 2KDHA 2K7OA 3CTNA 1B7TY 4A4BA 4WQ3A 2QACA 4GFTA 3OB1B 4GGFC 1WDCC 2ZNEA 5TNCA 4P2YB 3BUNB 1H4BA 4GUKA 1ZMZA 2COLB 2GGZA 2AAOA 4YI9A 1IJ5A 5KU1A 3SIAA 1KWOB 2I18A 4PHMA 4YGAA 1JC2A 1SRAA 1OZOA 4XYNA 4AOMA 1CTRA 4PHKA 5HLOA 1CNPA 1NYAA 1XK4C 1RWYA 2LE9B 3OB2B 2EHBA 1Y1UA 1M31A 2BKIB 2M29A 1V1GA 3MSEB 3OX6A 1JF0A 1QTXA 4WQ2A 1BJFA 3LLEA 2D8NA 3D10A 3NSKA 1F54A 2K0JA 1JSAA 2LVVA 2BCAA 2CBLA 1E8AA 1NSHA 2A4JA 2ZKMX 1BG1A 2R2IA 2ZNDA 3DVKA 4CPVA 1A75B 3VRQA 1Q80A 1WY9A 4M2QA 1SK6D 1SPYA 3TS5B 1AK8A 2PALA 2BE6A 1ZOTB 2OS8C 3I5GB 1N2DA 3D0YB 1KK7Z 1RROA 5BPJA 1A4PA 1NUBA 2MLEC 3WHTB 1EL4A 1GGWA 4XJKB 1NCXA 1F71A 2KGBC 1LXFC 3A8RA 1A29A 1MF8B 4HREE 5I2OA 1DF0A 1FBVA 2KYFA 3KPXA 3IQOA 1IWQA 2FCDA 3GOFA 4N1GA 4DCKA 2PRUA 5DKNA 2LHIA 4NDDA 1DMOA 1XO5A 2LV7A 2MRDA 2BBNA 3VRNA 5CSNA 4U8DA 1F4OA 2KI4B 2M7NA 4A4CA 2LUXA 4PDZA 2JT3A 4E68A 4I5NB 1SNLA 1CFFA 2I2RE 4F0ZB 1FI6A 1OMRA 3I5FC 2K8MB 2F8PA 1CDNA 2NZ0A 3BUWB 1AVSA 2WCBA 5PALA 2H61C 4NQGA 4OVNF 4YI8A 3ZNIA 2LVJA 5I8NA 1B9AA 1UP5A 2HQ8A 2L5XB 3EVVA 2Y5IA 1KK8C 1TCFA 2K2FA 1S6IA 4MRXA 1NIWA 5DKQA 2JNXA 4TNCA 3IF7A 1K94A 1DT7B 1DVIA 1MXEA 1VRKA 5JOLA 3IQQA 1QLKA 2WORA 1OSAA 3EVRA 2GV5A 1SCMC 5F6TA 1JFJA 1NX3A 4L9MA 1NCYA 2QPTA 1QJTA 1DJHA 3H4SE 2FOTA 5KTYA 1DGVA 3JVTB 3BYAA 1K9UA 2SCPA 1YUSA 3AKBA 2LCPA 1J7QA 1TCOB 4QJ5B 3BOWB 2JRFA 2FCEA 3RM1A 1DTLA 1MWNA 3GK4X 3NSIA 4OKHA 2WOSA 3BUOB 2LVKA 4FQOA 4DRWA 2P6BB 3NSLA 2Y4QA 2I7AA 2M0RA 1K90D 3WHUB 3TZ1A 2KBIA 4MZLA 5D7FA 1SMGA 2KFGA 1R2UA 1CDPA 1XA5A 1TNWA 1M39A 1CKKA 3SG2A 1TRFA 4CFRA 1DJXA 1WLZA 1CDMA 1PVAA 1OE9B 4MEWA 4GAOA 1YRUB 2Y1NA 1KWOC 2F33A 1C7WA 4MN0A 1L2OB 3NXAA 4P5OE 1GQMA 3CWGA 1QV1A 3O6BA 1XYDA 1QASA 1PULA 1YUTA 1L7ZA 2MAZA 1KFUS 2L98A 3PALA 3SIBA 2TN4A 2KI6D 3EVUA 4GNKB 2KOTA 4GGFA 1S6JA 3SJSA 4ICBA 2NXQA 5AEQA 1SW8A 4PCWA 1J7OA 1PK0D 1RFJA 1X02A 2HPSA 1ODBA 3CGAA 1K8UA 2M49B 3PN7B 5ER4X 1CLBA 5CSIA 2IS9A 1CLMA 1ALVA 2LP3A 1QX5B 1U5IA 1XK4A 3TS5C 1B8LA 2L4IA 3PM8A 4C0KA 2KAYA 2WC8A 1S6CA 2M1KB 1SCVA 3I5GC 1XFZO 3CLNA 3K21A 4BY5A 1BR1B 1KFUL 3CS1A 1UURA 4PHJA 3VRPA 1F55A 1S5GY 2B1UA 3TDUA 1G4YR 1YRTB 1BOCA 2OPOA 1KFXS 1PVBA 2AUCA 2BL0B 2Q91A 2NLNA 1EG4A 1UUSA 1XFVO 4YGBB 2KHNA 3WXAA 2PMYA 3OX5A 3SG4A 1C7VA 2KSPA 2JNFA 1KSOA 1SR6B 1W7JB 2KI4C 1SL7A 4ORAB 2M8UA 2PVBA 4ORBB 2ZN8A 3O2PA 3SG3A 1QX7A 2JPTA 2VRGA 2LAPA 1AUIB 3TDIA 3DVMA 2M97A 5KSZA 3I5HB 1WRKA 2JZIA 2KAXA 3DF0A 2L4HA 1TNXA 3FWBA 3DD4A 2BKHB 2HF5A 1W7IB 3I5IC 2L0PA 2BECA 3FWCA 1CM1A 4N1FA 4MVFA 1OOJA 3SG7A 1QV0A 3FS7A 3SG6A 4YBHB 5HKYA 1IH0A 5I2QA 1SYMA 4PE0A 1KFXL 4C0JA 2JTTA 1G33A 3HCMA 2CXJA 1ALWA 3C1VA 3AKAA 1NX2A 3LK1A 1YURA 2JT8A 2LANA 2LP2A 2CTNA 3O4YA 1CM4A 2Y1MA 1YTZC 3I5IB 3KEVA 1XFUO 3JVTC 1B7TZ 3VRRA 3PATA 4NDCA 1WRLA 2KFFA 1NP8A 2H61A 4M2OA 3TDZA 1IKUA 1PSRA 3HX4A 1CFPA 1PALA 1KQMB
chains in the Genus database with same CATH superfamily
3CZ1A 2MLFC 3LCPC 3KHEA 5FYXA 1DGUA 3JTDB 1DF0B 1N65A 5HYDA 2PSRA 1QLSA 4QJ4B 1QWVA 2L50A 4CFQA 4DS7A 1MXLC 1LA3A 2ZRSA 2LMVA 1C3ZA 3F45A 1V1FA 3O78A 4JQ0D 3VROA 2NCOA 1OMVA 1QIVA 1KSMA 2O60A 4OV2A 3S0GA 1GJYA 2OTGB 5HKZA 1CFCA 3RLZA 1CFDA 2WC6A 1UHNA 2M7LA 5HL1A 1C07A 2KNEA 1J1EA 2KQYA 5ER5A 1K96A 3FIAA 2MBXA 4PHNA 2BAPA 1QIWA 2JXLA 1S26D 1M63B 1IIOA 3EK7A 4I5LB 4WRIA 3TUYB 1NX1A 2BBMA 2L51A 3CR2A 3D73A 3D78A 4QJ3B 1Y1AA 1L2OC 1B8RA 1QS7A 1YVHA 1YUUA 1DJIA 2I94A 1Y0VH 2WNDA 4FTGA 1K9PA 2KGRA 4PT1A 1J1DA 3BQ3A 3S0DA 5CSJA 1S3PA 2LM5A 2P71A 3EK8A 1KK7Y 4YGCB 2LC5A 1NCZA 1LA0A 3PLFB 3FE8A 1GGZA 2EGDA 2K2AA 4AQIA 1FI5A 1UHIA 4MSPA 2M1UA 4HRHA 1YX8A 1B8CA 1IRJA 4OCIA 1XVJA 4HSZA 2BE4A 4MLWA 1CMFA 4I5JA 3PM2A 3B86A 4ORCB 1CB1A 2KAVA 3PN7C 1SY9A 1UHHA 1K2HA 2MA2A 1QVIY 1SBJA 1BMOA 1OMDA 4JWQA 2KYCA 1IJ6A 1H8BA 1FF1A 1R6PA 4GGNA 2LMTA 5I2LA 2BCXA 1LKJA 1D1OA 2EC6B 2E30A 1MHOA 2V53A 3B6XA 5J3XA 1CLLA 3K1EA 1CDLA 3VGOA 1JBAA 2E6WA 1SKTA 2QEHA 1QX2A 1F4QA 1IQ5A 1EJ3A 4KYNA 1OQPA 3D76A 3DXLA 4OZDA 1YR5A 1A75A 1LS8A 1TTXA 2ZN9A 4BY4A 2BL0C 1FW4A 2JULA 5K89A 4PE7A 1OOHA 2P70A 3KF9A 1XFWO 3BUXB 2NCPA 4NDBA 4USLA 1SR6C 3WNXB 4YGEB 3SG5A 4FQTA 3UO9A 1BODA 3D0YA 1A03A 1MQ1A 3BFHA 4Q04A 1C3YA 2JC2A 2LHLA 3I5HC 5GQQC 1DC1A 2KBMA 2L2EA 4XJKA 5AERA 1QXPA 2BCBA 3R1PA 1KQVA 1WDCB 2G2BA 1AJ4A 1RECA 3LK0A 2LLTA 3BUMB 4PALA 1SL8A 3Q8IA 2PASA 1KCYA 2LMUA 3N7HA 2GGMA 2F3ZA 1MUXA 5B8IB 4DIRA 3CABA 3DYEA 2FJUB 4YGDB 2WCEA 4PE4A 1U5IB 4MZJA 1M46A 4I5KA 2Q4UA 4ETOA 1BF5A 1TIZA 1JUOA 2ISDA 2JOJA 4GBAA 5D69A 1F70A 2JTZA 4D1EA 1B1GA 5FI2A 3M0WA 1JWDA 1G8IA 1UHJA 2M9GA 4ZCVA 1ZFSA 3GK1A 4JPZB 2MHHA 1NPQA 1NWDA 1TNPA 2H2KA 2AMIA 2RGIA 1HT9A 4AQJA 1KQMC 1IGVA 3BJHA 2HQWA 1UHKA 3S0FA 2LLSA 4GPLB 1YX7A 1NX0A 1RK9A 3D77A 3JTDC 1Y6WA 1MR8A 2JWWA 1TUJA 3OP0A 3R1OA 4IJ7A 3ZWHA 2M3WA 3NSOA 1JF2A 5CSFA 1GM0A 1YVLA 1S36A 1XFXO 3CR4X 1IQ3A 3EKHA 3OBVA 2LVIA 2OS8B 2OTGC 5AXIA 1AHRA 1TOPA 1W9ZA 1RTP1 1QVIZ 1FPWA 4DUQA 1ZUZA 1QATA 2LNKA 3DF0B 3OHMB 1OZSA 2KLDA 3GK2A 5G08A 3PSRA 4MRYA 1JFKA 1LINA 2K7DA 3LL8B 3KO0A 1B47A 3BOWA 3EKJA 4IL1A 3TUYC 1DJGA 1RJVA 1UWOA 3CZTX 1SSEB 4R1EA 1EG3A 2G9BA 4N5XA 1EH2A 3DVEA 3QMEA 5IBWA 3QRXA 3E3RA 1K93D 3PFVA 1BT6A 1TN4A 2K7BA 1TNQA 2LUCA 3I5FB 3SS3A 1Y1XA 1SL9A 3NHIA 1J55A 2MJWB 3IVTA 2H8VA 1PSBA 3BXKA 2KI6C 3EK4A 4MBEA 4ZCUA 1S5GZ 2K61A 1EXRA 2CT9A 4HRGA 2DOQA 2LLUA 1A2XA 4MZKA 4CIDA 1K95A 5AANA 2WCFA 2JU0A 1F8HA 1KK8B 1B4CA 1S1EA 4PE1A 5HLVA 1J7PA 2KFHA 2F3YA 3S0AA 4INWA 3CZ2A 1WRZA 4OR9B 1XFYO 4M2PA 5JJGA 1AJ5A 1BU3A 3ICBA 1N0YA 1SCMB 2K60A 1DJWA 2F2PA 2O5GA 1K9KA 5CPVA 1T14A 2EC6C 3AAKA 4CLNA 2ZRTA 1IG5A 1LVCD 3DZTA 4C0LA 3A4UB 1BLQA 1CMGA 2JXCA 2CNPA 1HQVA 5AFPA 2ZFDA 1J7RA 1BR4B 2HETA 1PRWA 3DVJA 1DJZA 2JT0A 5HKWA 4UPGA 1M45A 2PYQA 2L2CA 2F2OA 5DKRA 3AAJA 4YRUA 1ZACA 2SASA 3CR5X 1WLMA 4F7FA 2JQ6A 1DJYA 2CCMA 2K7CA 2KQ6A 2KDHA 2K7OA 3CTNA 1B7TY 2WCMA 4A4BA 4WQ3A 2QACA 4GFTA 3OB1B 4GGFC 1WDCC 2ZNEA 3B88A 4P2YB 3BUNB 5TNCA 4GUKA 1H4BA 1ZMZA 2COLB 3B87A 2GGZA 2AAOA 4YI9A 1IJ5A 5KU1A 3SIAA 1KWOB 2I18A 4PHMA 4YGAA 2BNXA 1JC2A 1SRAA 4JKTA 1OZOA 4XYNA 4AOMA 1CTRA 3S0BA 4PHKA 5HLOA 1CNPA 1NYAA 1XK4C 1RWYA 2LE9B 3OB2B 1TUZA 1Y1UA 2EHBA 1M31A 2BKIB 2M29A 1V1GA 3MSEB 3OX6A 1JF0A 1QTXA 4WQ2A 1BJFA 3LLEA 2D8NA 3D10A 3NSKA 1F54A 2K0JA 1JSAA 2LVVA 2BCAA 2CBLA 1E8AA 1NSHA 2A4JA 2ZKMX 4JD9A 1BG1A 2R2IA 2WCJA 3O4XA 2ZNDA 3UNWA 3DVKA 4CPVA 1A75B 3VRQA 1Q80A 1WY9A 3B7AA 3BFBA 4M2QA 1SK6D 1SPYA 3TS5B 1AK8A 2PALA 3L47A 2BE6A 1ZOTB 2OS8C 3I5GB 1N2DA 3D0YB 1KK7Z 1RROA 5BPJA 1A4PA 1NUBA 2MLEC 3WHTB 1EL4A 1GGWA 4XJKB 1NCXA 2KLEA 1F71A 2KGBC 1LXFC 3A8RA 1A29A 1MF8B 4HREE 5I2OA 1DF0A 1FBVA 2KYFA 3KPXA 3IQOA 1IWQA 2FCDA 3GOFA 4N1GA 4DCKA 2PRUA 5DKNA 2LHIA 4NDDA 3FE9A 1DMOA 1XO5A 2LV7A 2MRDA 2BBNA 3VRNA 5CSNA 4U8DA 1F4OA 2KI4B 2M7NA 4A4CA 2LUXA 2KPHA 4PDZA 2JT3A 4E68A 4I5NB 1SNLA 1CFFA 1DELA 2I2RE 4F0ZB 1OOFA 1FI6A 3S0EA 1OMRA 3I5FC 2K8MB 2F8PA 1AP4A 1CDNA 2NZ0A 3BUWB 1AVSA 2WCBA 5PALA 2H61C 4NQGA 4OVNF 4YI8A 3ZNIA 2LVJA 5I8NA 1B9AA 1UP5A 2HQ8A 1DQEA 3L4LA 2FJYA 2L5YA 2L5XB 3EVVA 2Y5IA 1KK8C 1TCFA 1Z4HA 2K2FA 1S6IA 4MRXA 1NIWA 5DKQA 2JNXA 4TNCA 3IF7A 1K94A 1DT7B 1DVIA 1MXEA 2WCKA 1VRKA 5JOLA 3IQQA 1QLKA 2WORA 1OSAA 3EVRA 2GV5A 3D74A 1SCMC 5F6TA 1JFJA 1NX3A 1P28A 3NHTA 4L9MA 5D3OA 1NCYA 2QPTA 1QJTA 1DJHA 3H4SE 2FOTA 5KTYA 2QEBA 3R1VA 1DGVA 3JVTB 3BYAA 1K9UA 2SCPA 1YUSA 3AKBA 2LCPA 1J7QA 1TCOB 2GTEA 3R72A 4QJ5B 3BOWB 2JRFA 2FCEA 3RM1A 5DICA 1DTLA 1MWNA 3GK4X 3NSIA 4OKHA 3SS5A 3NGVA 2WOSA 3BUOB 2LVKA 4FQOA 4DRWA 1OOGA 2P6BB 2QDIA 3NSLA 2Y4QA 2I7AA 2M0RA 1K90D 3WHUB 2WCHA 3TZ1A 2KBIA 4MZLA 3CDNA 5D7FA 1SMGA 2KFGA 1R2UA 1CDPA 1XA5A 1TNWA 1M39A 1CKKA 3SG2A 1TRFA 3CZ0A 4CFRA 1DJXA 1WLZA 1CDMA 1PVAA 1OE9B 4MEWA 4GAOA 1YRUB 2Y1NA 1KWOC 2F33A 1C7WA 4MN0A 1L2OB 3NXAA 4P5OE 1ORGA 1GQMA 3CWGA 1QV1A 3O6BA 1XYDA 1QASA 1PULA 1YUTA 1Z2CB 3VB1A 3RZSA 1L7ZA 1TWOA 2MAZA 1KFUS 2L98A 3PALA 3SIBA 2TN4A 2KI6D 3EVUA 4GNKB 2KOTA 4GGFA 1S6JA 5FI6A 4ICBA 2YGUA 3SJSA 2NXQA 5AEQA 3BFAA 1SW8A 4PCWA 1J7OA 1PK0D 1RFJA 1X02A 2HPSA 1ODBA 3CGAA 1K8UA 2M49B 3PN7B 5ER4X 1CLBA 5CSIA 1OW4A 2IS9A 1CLMA 1ALVA 2LP3A 1QX5B 1U5IA 5FI7A 1XK4A 3TS5C 1B8LA 2L4IA 1XFRA 3PM8A 4C0KA 2KAYA 2WC8A 3EG5B 1S6CA 2M1KB 3PJIA 1SCVA 3V2LA 3I5GC 5I94A 1XFZO 3CLNA 3K21A 1DEKA 4BY5A 1BR1B 1KFUL 3CS1A 1UURA 3DY9A 4PHJA 3VRPA 1F55A 1S5GY 2B1UA 3TDUA 1G4YR 1YRTB 3L4AA 2WC5A 2OPOA 1BOCA 1KFXS 1PVBA 2AUCA 3OGNA 2BL0B 2Q91A 2NLNA 1EG4A 5EL2A 1UUSA 1XFVO 1OOIX 4YGBB 2KHNA 3WXAA 2PMYA 3OX5A 3SG4A 1C7VA 2KSPA 2JNFA 1KSOA 1SR6B 1W7JB 2KI4C 1SL7A 3SS4A 4ORAB 2M8UA 2PVBA 4ORBB 2ZN8A 2PQLA 3O2PA 3SG3A 1QX7A 2JPTA 2QEOA 2LAPA 1AUIB 2VRGA 3DVMA 2M97A 3TDIA 3I5HB 5KSZA 1WRKA 2ERBA 2JZIA 2KAXA 2L4HA 1TNXA 2JPOA 3DF0A 3FWBA 2WCLA 3DD4A 2BKHB 2HF5A 1W7IB 3I5IC 2L0PA 2BECA 3FWCA 1CM1A 4N1FA 3FE6A 4MVFA 1OOJA 3SG7A 1QV0A 3FS7A 3SG6A 4YBHB 5HKYA 1IH0A 5I2QA 1SYMA 4INXA 4PE0A 1KFXL 4C0JA 2JTTA 1G33A 3HCMA 2CXJA 1ALWA 3C1VA 3AKAA 1NX2A 3LK1A 1YURA 2JT8A 2LANA 2LP2A 2CTNA 3O4YA 1CM4A 2Y1MA 1YTZC 3I5IB 3KEVA 1XFUO 3JVTC 1B7TZ 3VRRA 2QEVA 3PATA 4NDCA 3D75A 1WRLA 2KFFA 1NP8A 2H61A 4M2OA 3CYZA 3TDZA 1PSRA 3HX4A 1IKUA 1CFPA 1PALA 1KQMB
chains in the Genus database with same CATH topology
2MLFC 3LCPC 3KHEA 5FYXA 1DGUA 3JTDB 1DF0B 1N65A 5HYDA 2PSRA 1QLSA 4QJ4B 2L50A 4CFQA 4DS7A 1MXLC 1LA3A 2ZRSA 2LMVA 3F45A 3O78A 1V1FA 4JQ0D 3VROA 1AP4A 2NCOA 1OMVA 1QIVA 1KSMA 2O60A 4OV2A 1CFCA 1GJYA 2OTGB 5HKZA 3RLZA 1CFDA 1UHNA 2M7LA 1C07A 2KNEA 1J1EA 2KQYA 5ER5A 1K96A 3FIAA 2MBXA 4PHNA 1QIWA 2JXLA 1S26D 1M63B 3EK7A 4I5LB 4WRIA 3TUYB 1NX1A 2BBMA 2L51A 3CR2A 4QJ3B 1Y1AA 1L2OC 1B8RA 1QS7A 1YVHA 1YUUA 1DJIA 2I94A 1Y0VH 2WNDA 4FTGA 1K9PA 2KGRA 1J1DA 3BQ3A 5CSJA 1S3PA 2LM5A 3EK8A 1KK7Y 4YGCB 2LC5A 1NCZA 1LA0A 3PLFB 1GGZA 2EGDA 2K2AA 4AQIA 1FI5A 1UHIA 4MSPA 2M1UA 4HRHA 1YX8A 1B8CA 1IRJA 4OCIA 1XVJA 4HSZA 2BE4A 4MLWA 1CMFA 4I5JA 4ORCB 1CB1A 2KAVA 3PN7C 1SY9A 1UHHA 1K2HA 2MA2A 1QVIY 1SBJA 1BMOA 1OMDA 4JWQA 2KYCA 1IJ6A 1H8BA 1FF1A 1R6PA 4GGNA 2LMTA 5I2LA 2BCXA 1LKJA 1D1OA 2EC6B 2E30A 1MHOA 2V53A 5J3XA 1CLLA 1CDLA 3VGOA 1JBAA 2E6WA 1SKTA 1QX2A 1F4QA 1IQ5A 1EJ3A 1OQPA 1YR5A 1A75A 1TTXA 2ZN9A 4BY4A 2BL0C 1FW4A 2JULA 5K89A 4PE7A 3KF9A 1XFWO 3BUXB 2NCPA 4NDBA 4USLA 1SR6C 3WNXB 4YGEB 3SG5A 1BODA 3D0YA 1A03A 1MQ1A 4Q04A 2JC2A 2LHLA 3I5HC 5GQQC 2KBMA 2L2EA 4XJKA 5AERA 1QXPA 2BCBA 1KQVA 1WDCB 2G2BA 1AJ4A 1RECA 3LK0A 2LLTA 3BUMB 4PALA 1SL8A 2PASA 1KCYA 2LMUA 2GGMA 2F3ZA 1MUXA 5B8IB 4DIRA 2FJUB 4YGDB 2WCEA 4PE4A 1U5IB 4MZJA 1M46A 4I5KA 2Q4UA 4ETOA 1BF5A 1TIZA 1JUOA 2ISDA 2JOJA 4GBAA 5D69A 1F70A 2JTZA 4D1EA 1B1GA 3M0WA 1JWDA 1G8IA 1UHJA 2M9GA 4ZCVA 1ZFSA 3GK1A 4JPZB 2MHHA 1NPQA 1NWDA 1TNPA 2H2KA 2AMIA 2RGIA 1HT9A 4AQJA 1KQMC 1IGVA 2HQWA 1UHKA 2LLSA 4GPLB 1YX7A 1NX0A 1RK9A 3JTDC 3OP0A 1Y6WA 1MR8A 2JWWA 3ZWHA 2M3WA 3NSOA 1JF2A 5CSFA 1YVLA 1S36A 1XFXO 3CR4X 1IQ3A 3EKHA 2LVIA 2OS8B 2OTGC 5AXIA 1AHRA 1TOPA 1RTP1 1QVIZ 1FPWA 4DUQA 1ZUZA 1QATA 2LNKA 3DF0B 3OHMB 1OZSA 3GK2A 5G08A 3PSRA 4MRYA 1JFKA 1LINA 2K7DA 3LL8B 3KO0A 1B47A 3BOWA 3EKJA 4IL1A 3TUYC 1DJGA 1RJVA 1UWOA 3CZTX 4R1EA 1EG3A 2G9BA 4N5XA 1EH2A 3DVEA 5IBWA 3QRXA 3E3RA 1K93D 3PFVA 1BT6A 1TN4A 2K7BA 1TNQA 2LUCA 3I5FB 1Y1XA 1SL9A 1J55A 2MJWB 1PSBA 3BXKA 2KI6C 3EK4A 4MBEA 4ZCUA 1S5GZ 2K61A 1EXRA 2CT9A 4HRGA 2DOQA 2LLUA 1A2XA 4MZKA 4CIDA 1K95A 5AANA 2WCFA 2JU0A 1F8HA 1KK8B 1B4CA 1S1EA 4PE1A 5HLVA 1J7PA 2KFHA 2F3YA 1WRZA 4OR9B 1XFYO 4M2PA 5JJGA 1AJ5A 1BU3A 3ICBA 1N0YA 1SCMB 1DJWA 2F2PA 2O5GA 1K9KA 5CPVA 2EC6C 3AAKA 4CLNA 2ZRTA 1IG5A 1LVCD 4C0LA 3A4UB 1BLQA 1CMGA 2JXCA 2CNPA 1HQVA 5AFPA 2ZFDA 1J7RA 1BR4B 2HETA 1PRWA 3DVJA 1DJZA 2JT0A 5HKWA 4UPGA 1M45A 5DKRA 2F2OA 3AAJA 4YRUA 1ZACA 2SASA 3CR5X 1WLMA 2JQ6A 1DJYA 2CCMA 2K7CA 2KQ6A 2KDHA 2K7OA 3CTNA 1B7TY 4A4BA 4WQ3A 2QACA 4GFTA 3OB1B 4GGFC 1WDCC 2ZNEA 5TNCA 4P2YB 3BUNB 1H4BA 4GUKA 1ZMZA 2COLB 2GGZA 2AAOA 4YI9A 1IJ5A 5KU1A 3SIAA 1KWOB 2I18A 4PHMA 4YGAA 1JC2A 1SRAA 1OZOA 4XYNA 4AOMA 1CTRA 4PHKA 5HLOA 1CNPA 1NYAA 1XK4C 1RWYA 2LE9B 3OB2B 2EHBA 1Y1UA 1M31A 2BKIB 2M29A 1V1GA 3MSEB 3OX6A 1JF0A 1QTXA 4WQ2A 1BJFA 3LLEA 2D8NA 3D10A 3NSKA 1F54A 2K0JA 1JSAA 2LVVA 2BCAA 2CBLA 1E8AA 1NSHA 2A4JA 2ZKMX 1BG1A 2R2IA 2ZNDA 3DVKA 4CPVA 1A75B 3VRQA 1Q80A 1WY9A 4M2QA 1SK6D 1SPYA 3TS5B 1AK8A 2PALA 2BE6A 1ZOTB 2OS8C 3I5GB 1N2DA 3D0YB 1KK7Z 1RROA 5BPJA 1A4PA 1NUBA 2MLEC 3WHTB 1EL4A 1GGWA 4XJKB 1NCXA 1F71A 2KGBC 1LXFC 3A8RA 1A29A 1MF8B 4HREE 5I2OA 1DF0A 1FBVA 2KYFA 3KPXA 3IQOA 1IWQA 2FCDA 3GOFA 4N1GA 4DCKA 2PRUA 5DKNA 2LHIA 4NDDA 1DMOA 1XO5A 2LV7A 2MRDA 2BBNA 3VRNA 5CSNA 4U8DA 1F4OA 2KI4B 2M7NA 4A4CA 2LUXA 4PDZA 2JT3A 4E68A 4I5NB 1SNLA 1CFFA 2I2RE 4F0ZB 1FI6A 1OMRA 3I5FC 2K8MB 2F8PA 1CDNA 2NZ0A 3BUWB 1AVSA 2WCBA 5PALA 2H61C 4NQGA 4OVNF 4YI8A 3ZNIA 2LVJA 5I8NA 1B9AA 1UP5A 2HQ8A 2L5XB 3EVVA 2Y5IA 1KK8C 1TCFA 2K2FA 1S6IA 4MRXA 1NIWA 5DKQA 2JNXA 4TNCA 3IF7A 1K94A 1DT7B 1DVIA 1MXEA 1VRKA 5JOLA 3IQQA 1QLKA 2WORA 1OSAA 3EVRA 2GV5A 1SCMC 5F6TA 1JFJA 1NX3A 4L9MA 1NCYA 2QPTA 1QJTA 1DJHA 3H4SE 2FOTA 5KTYA 1DGVA 3JVTB 3BYAA 1K9UA 2SCPA 1YUSA 3AKBA 2LCPA 1J7QA 1TCOB 4QJ5B 3BOWB 2JRFA 2FCEA 3RM1A 1DTLA 1MWNA 3GK4X 3NSIA 4OKHA 2WOSA 3BUOB 2LVKA 4FQOA 4DRWA 2P6BB 3NSLA 2Y4QA 2I7AA 2M0RA 1K90D 3WHUB 3TZ1A 2KBIA 4MZLA 5D7FA 1SMGA 2KFGA 1R2UA 1CDPA 1XA5A 1TNWA 1M39A 1CKKA 3SG2A 1TRFA 4CFRA 1DJXA 1WLZA 1CDMA 1PVAA 1OE9B 4MEWA 4GAOA 1YRUB 2Y1NA 1KWOC 2F33A 1C7WA 4MN0A 1L2OB 3NXAA 4P5OE 1GQMA 3CWGA 1QV1A 3O6BA 1XYDA 1QASA 1PULA 1YUTA 1L7ZA 2MAZA 1KFUS 2L98A 3PALA 3SIBA 2TN4A 2KI6D 3EVUA 4GNKB 2KOTA 4GGFA 1S6JA 3SJSA 4ICBA 2NXQA 5AEQA 1SW8A 4PCWA 1J7OA 1PK0D 1RFJA 1X02A 2HPSA 1ODBA 3CGAA 1K8UA 2M49B 3PN7B 5ER4X 1CLBA 5CSIA 2IS9A 1CLMA 1ALVA 2LP3A 1QX5B 1U5IA 1XK4A 3TS5C 1B8LA 2L4IA 3PM8A 4C0KA 2KAYA 2WC8A 1S6CA 2M1KB 1SCVA 3I5GC 1XFZO 3CLNA 3K21A 4BY5A 1BR1B 1KFUL 3CS1A 1UURA 4PHJA 3VRPA 1F55A 1S5GY 2B1UA 3TDUA 1G4YR 1YRTB 1BOCA 2OPOA 1KFXS 1PVBA 2AUCA 2BL0B 2Q91A 2NLNA 1EG4A 1UUSA 1XFVO 4YGBB 2KHNA 3WXAA 2PMYA 3OX5A 3SG4A 1C7VA 2KSPA 2JNFA 1KSOA 1SR6B 1W7JB 2KI4C 1SL7A 4ORAB 2M8UA 2PVBA 4ORBB 2ZN8A 3O2PA 3SG3A 1QX7A 2JPTA 2VRGA 2LAPA 1AUIB 3TDIA 3DVMA 2M97A 5KSZA 3I5HB 1WRKA 2JZIA 2KAXA 3DF0A 2L4HA 1TNXA 3FWBA 3DD4A 2BKHB 2HF5A 1W7IB 3I5IC 2L0PA 2BECA 3FWCA 1CM1A 4N1FA 4MVFA 1OOJA 3SG7A 1QV0A 3FS7A 3SG6A 4YBHB 5HKYA 1IH0A 5I2QA 1SYMA 4PE0A 1KFXL 4C0JA 2JTTA 1G33A 3HCMA 2CXJA 1ALWA 3C1VA 3AKAA 1NX2A 3LK1A 1YURA 2JT8A 2LANA 2LP2A 2CTNA 3O4YA 1CM4A 2Y1MA 1YTZC 3I5IB 3KEVA 1XFUO 3JVTC 1B7TZ 3VRRA 3PATA 4NDCA 1WRLA 2KFFA 1NP8A 2H61A 4M2OA 3TDZA 1IKUA 1PSRA 3HX4A 1CFPA 1PALA 1KQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLF C;  3LCP C;  3KHE A;  5FYX A;  1DGU A;  3JTD B;  1DF0 B;  1N65 A;  5HYD A;  2PSR A;  1QLS A;  4QJ4 B;  2L50 A;  4CFQ A;  4DS7 A;  1MXL C;  1LA3 A;  2ZRS A;  2LMV A;  3F45 A;  3O78 A;  1V1F A;  4JQ0 D;  3VRO A;  1AP4 A;  2NCO A;  1OMV A;  1QIV A;  1KSM A;  2O60 A;  4OV2 A;  1CFC A;  1GJY A;  2OTG B;  5HKZ A;  3RLZ A;  1CFD A;  1UHN A;  2M7L A;  1C07 A;  2KNE A;  1J1E A;  2KQY A;  5ER5 A;  1K96 A;  3FIA A;  2MBX A;  4PHN A;  1QIW A;  2JXL A;  1S26 D;  1M63 B;  3EK7 A;  4I5L B;  4WRI A;  3TUY B;  1NX1 A;  2BBM A;  2L51 A;  3CR2 A;  4QJ3 B;  1Y1A A;  1L2O C;  1B8R A;  1QS7 A;  1YVH A;  1YUU A;  1DJI A;  2I94 A;  1Y0V H;  2WND A;  4FTG A;  1K9P A;  2KGR A;  1J1D A;  3BQ3 A;  5CSJ A;  1S3P A;  2LM5 A;  3EK8 A;  1KK7 Y;  4YGC B;  2LC5 A;  1NCZ A;  1LA0 A;  3PLF B;  1GGZ A;  2EGD A;  2K2A A;  4AQI A;  1FI5 A;  1UHI A;  4MSP A;  2M1U A;  4HRH A;  1YX8 A;  1B8C A;  1IRJ A;  4OCI A;  1XVJ A;  4HSZ A;  2BE4 A;  4MLW A;  1CMF A;  4I5J A;  4ORC B;  1CB1 A;  2KAV A;  3PN7 C;  1SY9 A;  1UHH A;  1K2H A;  2MA2 A;  1QVI Y;  1SBJ A;  1BMO A;  1OMD A;  4JWQ A;  2KYC A;  1IJ6 A;  1H8B A;  1FF1 A;  1R6P A;  4GGN A;  2LMT A;  5I2L A;  2BCX A;  1LKJ A;  1D1O A;  2EC6 B;  2E30 A;  1MHO A;  2V53 A;  5J3X A;  1CLL A;  1CDL A;  3VGO A;  1JBA A;  2E6W A;  1SKT A;  1QX2 A;  1F4Q A;  1IQ5 A;  1EJ3 A;  1OQP A;  1YR5 A;  1A75 A;  1TTX A;  2ZN9 A;  4BY4 A;  2BL0 C;  1FW4 A;  2JUL A;  5K89 A;  4PE7 A;  3KF9 A;  1XFW O;  3BUX B;  2NCP A;  4NDB A;  4USL A;  1SR6 C;  3WNX B;  4YGE B;  3SG5 A;  1BOD A;  3D0Y A;  1A03 A;  1MQ1 A;  4Q04 A;  2JC2 A;  2LHL A;  3I5H C;  5GQQ C;  2KBM A;  2L2E A;  4XJK A;  5AER A;  1QXP A;  2BCB A;  1KQV A;  1WDC B;  2G2B A;  1AJ4 A;  1REC A;  3LK0 A;  2LLT A;  3BUM B;  4PAL A;  1SL8 A;  2PAS A;  1KCY A;  2LMU A;  2GGM A;  2F3Z A;  1MUX A;  5B8I B;  4DIR A;  2FJU B;  4YGD B;  2WCE A;  4PE4 A;  1U5I B;  4MZJ A;  1M46 A;  4I5K A;  2Q4U A;  4ETO A;  1BF5 A;  1TIZ A;  1JUO A;  2ISD A;  2JOJ A;  4GBA A;  5D69 A;  1F70 A;  2JTZ A;  4D1E A;  1B1G A;  3M0W A;  1JWD A;  1G8I A;  1UHJ A;  2M9G A;  4ZCV A;  1ZFS A;  3GK1 A;  4JPZ B;  2MHH A;  1NPQ A;  1NWD A;  1TNP A;  2H2K A;  2AMI A;  2RGI A;  1HT9 A;  4AQJ A;  1KQM C;  1IGV A;  2HQW A;  1UHK A;  2LLS A;  4GPL B;  1YX7 A;  1NX0 A;  1RK9 A;  3JTD C;  3OP0 A;  1Y6W A;  1MR8 A;  2JWW A;  3ZWH A;  2M3W A;  3NSO A;  1JF2 A;  5CSF A;  1YVL A;  1S36 A;  1XFX O;  3CR4 X;  1IQ3 A;  3EKH A;  2LVI A;  2OS8 B;  2OTG C;  5AXI A;  1AHR A;  1TOP A;  1RTP 1;  1QVI Z;  1FPW A;  4DUQ A;  1ZUZ A;  1QAT A;  2LNK A;  3DF0 B;  3OHM B;  1OZS A;  3GK2 A;  5G08 A;  3PSR A;  4MRY A;  1JFK A;  1LIN A;  2K7D A;  3LL8 B;  3KO0 A;  1B47 A;  3BOW A;  3EKJ A;  4IL1 A;  3TUY C;  1DJG A;  1RJV A;  1UWO A;  3CZT X;  4R1E A;  1EG3 A;  2G9B A;  4N5X A;  1EH2 A;  3DVE A;  5IBW A;  3QRX A;  3E3R A;  1K93 D;  3PFV A;  1BT6 A;  1TN4 A;  2K7B A;  1TNQ A;  2LUC A;  3I5F B;  1Y1X A;  1SL9 A;  1J55 A;  2MJW B;  1PSB A;  3BXK A;  2KI6 C;  3EK4 A;  4MBE A;  4ZCU A;  1S5G Z;  2K61 A;  1EXR A;  2CT9 A;  4HRG A;  2DOQ A;  2LLU A;  1A2X A;  4MZK A;  4CID A;  1K95 A;  5AAN A;  2WCF A;  2JU0 A;  1F8H A;  1KK8 B;  1B4C A;  1S1E A;  4PE1 A;  5HLV A;  1J7P A;  2KFH A;  2F3Y A;  1WRZ A;  4OR9 B;  1XFY O;  4M2P A;  5JJG A;  1AJ5 A;  1BU3 A;  3ICB A;  1N0Y A;  1SCM B;  1DJW A;  2F2P A;  2O5G A;  1K9K A;  5CPV A;  2EC6 C;  3AAK A;  4CLN A;  2ZRT A;  1IG5 A;  1LVC D;  4C0L A;  3A4U B;  1BLQ A;  1CMG A;  2JXC A;  2CNP A;  1HQV A;  5AFP A;  2ZFD A;  1J7R A;  1BR4 B;  2HET A;  1PRW A;  3DVJ A;  1DJZ A;  2JT0 A;  5HKW A;  4UPG A;  1M45 A;  5DKR A;  2F2O A;  3AAJ A;  4YRU A;  1ZAC A;  2SAS A;  3CR5 X;  1WLM A;  2JQ6 A;  1DJY A;  2CCM A;  2K7C A;  2KQ6 A;  2KDH A;  2K7O A;  3CTN A;  1B7T Y;  4A4B A;  4WQ3 A;  2QAC A;  4GFT A;  3OB1 B;  4GGF C;  1WDC C;  2ZNE A;  5TNC A;  4P2Y B;  3BUN B;  1H4B A;  4GUK A;  1ZMZ A;  2COL B;  2GGZ A;  2AAO A;  4YI9 A;  1IJ5 A;  5KU1 A;  3SIA A;  1KWO B;  2I18 A;  4PHM A;  4YGA A;  1JC2 A;  1SRA A;  1OZO A;  4XYN A;  4AOM A;  1CTR A;  4PHK A;  5HLO A;  1CNP A;  1NYA A;  1XK4 C;  1RWY A;  2LE9 B;  3OB2 B;  2EHB A;  1Y1U A;  1M31 A;  2BKI B;  2M29 A;  1V1G A;  3MSE B;  3OX6 A;  1JF0 A;  1QTX A;  4WQ2 A;  1BJF A;  3LLE A;  2D8N A;  3D10 A;  3NSK A;  1F54 A;  2K0J A;  1JSA A;  2LVV A;  2BCA A;  2CBL A;  1E8A A;  1NSH A;  2A4J A;  2ZKM X;  1BG1 A;  2R2I A;  2ZND A;  3DVK A;  4CPV A;  1A75 B;  3VRQ A;  1Q80 A;  1WY9 A;  4M2Q A;  1SK6 D;  1SPY A;  3TS5 B;  1AK8 A;  2PAL A;  2BE6 A;  1ZOT B;  2OS8 C;  3I5G B;  1N2D A;  3D0Y B;  1KK7 Z;  1RRO A;  5BPJ A;  1A4P A;  1NUB A;  2MLE C;  3WHT B;  1EL4 A;  1GGW A;  4XJK B;  1NCX A;  1F71 A;  2KGB C;  1LXF C;  3A8R A;  1A29 A;  1MF8 B;  4HRE E;  5I2O A;  1DF0 A;  1FBV A;  2KYF A;  3KPX A;  3IQO A;  1IWQ A;  2FCD A;  3GOF A;  4N1G A;  4DCK A;  2PRU A;  5DKN A;  2LHI A;  4NDD A;  1DMO A;  1XO5 A;  2LV7 A;  2MRD A;  2BBN A;  3VRN A;  5CSN A;  4U8D A;  1F4O A;  2KI4 B;  2M7N A;  4A4C A;  2LUX A;  4PDZ A;  2JT3 A;  4E68 A;  4I5N B;  1SNL A;  1CFF A;  2I2R E;  4F0Z B;  1FI6 A;  1OMR A;  3I5F C;  2K8M B;  2F8P A;  1CDN A;  2NZ0 A;  3BUW B;  1AVS A;  2WCB A;  5PAL A;  2H61 C;  4NQG A;  4OVN F;  4YI8 A;  3ZNI A;  2LVJ A;  5I8N A;  1B9A A;  1UP5 A;  2HQ8 A;  2L5X B;  3EVV A;  2Y5I A;  1KK8 C;  1TCF A;  2K2F A;  1S6I A;  4MRX A;  1NIW A;  5DKQ A;  2JNX A;  4TNC A;  3IF7 A;  1K94 A;  1DT7 B;  1DVI A;  1MXE A;  1VRK A;  5JOL A;  3IQQ A;  1QLK A;  2WOR A;  1OSA A;  3EVR A;  2GV5 A;  1SCM C;  5F6T A;  1JFJ A;  1NX3 A;  4L9M A;  1NCY A;  2QPT A;  1QJT A;  1DJH A;  3H4S E;  2FOT A;  5KTY A;  1DGV A;  3JVT B;  3BYA A;  1K9U A;  2SCP A;  1YUS A;  3AKB A;  2LCP A;  1J7Q A;  1TCO B;  4QJ5 B;  3BOW B;  2JRF A;  2FCE A;  3RM1 A;  1DTL A;  1MWN A;  3GK4 X;  3NSI A;  4OKH A;  2WOS A;  3BUO B;  2LVK A;  4FQO A;  4DRW A;  2P6B B;  3NSL A;  2Y4Q A;  2I7A A;  2M0R A;  1K90 D;  3WHU B;  3TZ1 A;  2KBI A;  4MZL A;  5D7F A;  1SMG A;  2KFG A;  1R2U A;  1CDP A;  1XA5 A;  1TNW A;  1M39 A;  1CKK A;  3SG2 A;  1TRF A;  4CFR A;  1DJX A;  1WLZ A;  1CDM A;  1PVA A;  1OE9 B;  4MEW A;  4GAO A;  1YRU B;  2Y1N A;  1KWO C;  2F33 A;  1C7W A;  4MN0 A;  1L2O B;  3NXA A;  4P5O E;  1GQM A;  3CWG A;  1QV1 A;  3O6B A;  1XYD A;  1QAS A;  1PUL A;  1YUT A;  1L7Z A;  2MAZ A;  1KFU S;  2L98 A;  3PAL A;  3SIB A;  2TN4 A;  2KI6 D;  3EVU A;  4GNK B;  2KOT A;  4GGF A;  1S6J A;  3SJS A;  4ICB A;  2NXQ A;  5AEQ A;  1SW8 A;  4PCW A;  1J7O A;  1PK0 D;  1RFJ A;  1X02 A;  2HPS A;  1ODB A;  3CGA A;  1K8U A;  2M49 B;  3PN7 B;  5ER4 X;  1CLB A;  5CSI A;  2IS9 A;  1CLM A;  1ALV A;  2LP3 A;  1QX5 B;  1U5I A;  1XK4 A;  3TS5 C;  1B8L A;  2L4I A;  3PM8 A;  4C0K A;  2KAY A;  2WC8 A;  1S6C A;  2M1K B;  1SCV A;  3I5G C;  1XFZ O;  3CLN A;  3K21 A;  4BY5 A;  1BR1 B;  1KFU L;  3CS1 A;  1UUR A;  4PHJ A;  3VRP A;  1F55 A;  1S5G Y;  2B1U A;  3TDU A;  1G4Y R;  1YRT B;  1BOC A;  2OPO A;  1KFX S;  1PVB A;  2AUC A;  2BL0 B;  2Q91 A;  2NLN A;  1EG4 A;  1UUS A;  1XFV O;  4YGB B;  2KHN A;  3WXA A;  2PMY A;  3OX5 A;  3SG4 A;  1C7V A;  2KSP A;  2JNF A;  1KSO A;  1SR6 B;  1W7J B;  2KI4 C;  1SL7 A;  4ORA B;  2M8U A;  2PVB A;  4ORB B;  2ZN8 A;  3O2P A;  3SG3 A;  1QX7 A;  2JPT A;  2VRG A;  2LAP A;  1AUI B;  3TDI A;  3DVM A;  2M97 A;  5KSZ A;  3I5H B;  1WRK A;  2JZI A;  2KAX A;  3DF0 A;  2L4H A;  1TNX A;  3FWB A;  3DD4 A;  2BKH B;  2HF5 A;  1W7I B;  3I5I C;  2L0P A;  2BEC A;  3FWC A;  1CM1 A;  4N1F A;  4MVF A;  1OOJ A;  3SG7 A;  1QV0 A;  3FS7 A;  3SG6 A;  4YBH B;  5HKY A;  1IH0 A;  5I2Q A;  1SYM A;  4PE0 A;  1KFX L;  4C0J A;  2JTT A;  1G33 A;  3HCM A;  2CXJ A;  1ALW A;  3C1V A;  3AKA A;  1NX2 A;  3LK1 A;  1YUR A;  2JT8 A;  2LAN A;  2LP2 A;  2CTN A;  3O4Y A;  1CM4 A;  2Y1M A;  1YTZ C;  3I5I B;  3KEV A;  1XFU O;  3JVT C;  1B7T Z;  3VRR A;  3PAT A;  4NDC A;  1WRL A;  2KFF A;  1NP8 A;  2H61 A;  4M2O A;  3TDZ A;  1IKU A;  1PSR A;  3HX4 A;  1CFP A;  1PAL A;  1KQM B; 
#chains in the Genus database with same CATH topology
 3CZ1 A;  2MLF C;  3LCP C;  3KHE A;  5FYX A;  1DGU A;  3JTD B;  1DF0 B;  1N65 A;  5HYD A;  2PSR A;  1QLS A;  4QJ4 B;  1QWV A;  2L50 A;  4CFQ A;  4DS7 A;  1MXL C;  1LA3 A;  2ZRS A;  2LMV A;  1C3Z A;  3F45 A;  1V1F A;  3O78 A;  4JQ0 D;  3VRO A;  2NCO A;  1OMV A;  1QIV A;  1KSM A;  2O60 A;  4OV2 A;  3S0G A;  1GJY A;  2OTG B;  5HKZ A;  1CFC A;  3RLZ A;  1CFD A;  2WC6 A;  1UHN A;  2M7L A;  5HL1 A;  1C07 A;  2KNE A;  1J1E A;  2KQY A;  5ER5 A;  1K96 A;  3FIA A;  2MBX A;  4PHN A;  2BAP A;  1QIW A;  2JXL A;  1S26 D;  1M63 B;  1IIO A;  3EK7 A;  4I5L B;  4WRI A;  3TUY B;  1NX1 A;  2BBM A;  2L51 A;  3CR2 A;  3D73 A;  3D78 A;  4QJ3 B;  1Y1A A;  1L2O C;  1B8R A;  1QS7 A;  1YVH A;  1YUU A;  1DJI A;  2I94 A;  1Y0V H;  2WND A;  4FTG A;  1K9P A;  2KGR A;  4PT1 A;  1J1D A;  3BQ3 A;  3S0D A;  5CSJ A;  1S3P A;  2LM5 A;  2P71 A;  3EK8 A;  1KK7 Y;  4YGC B;  2LC5 A;  1NCZ A;  1LA0 A;  3PLF B;  3FE8 A;  1GGZ A;  2EGD A;  2K2A A;  4AQI A;  1FI5 A;  1UHI A;  4MSP A;  2M1U A;  4HRH A;  1YX8 A;  1B8C A;  1IRJ A;  4OCI A;  1XVJ A;  4HSZ A;  2BE4 A;  4MLW A;  1CMF A;  4I5J A;  3PM2 A;  3B86 A;  4ORC B;  1CB1 A;  2KAV A;  3PN7 C;  1SY9 A;  1UHH A;  1K2H A;  2MA2 A;  1QVI Y;  1SBJ A;  1BMO A;  1OMD A;  4JWQ A;  2KYC A;  1IJ6 A;  1H8B A;  1FF1 A;  1R6P A;  4GGN A;  2LMT A;  5I2L A;  2BCX A;  1LKJ A;  1D1O A;  2EC6 B;  2E30 A;  1MHO A;  2V53 A;  3B6X A;  5J3X A;  1CLL A;  3K1E A;  1CDL A;  3VGO A;  1JBA A;  2E6W A;  1SKT A;  2QEH A;  1QX2 A;  1F4Q A;  1IQ5 A;  1EJ3 A;  4KYN A;  1OQP A;  3D76 A;  3DXL A;  4OZD A;  1YR5 A;  1A75 A;  1LS8 A;  1TTX A;  2ZN9 A;  4BY4 A;  2BL0 C;  1FW4 A;  2JUL A;  5K89 A;  4PE7 A;  1OOH A;  2P70 A;  3KF9 A;  1XFW O;  3BUX B;  2NCP A;  4NDB A;  4USL A;  1SR6 C;  3WNX B;  4YGE B;  3SG5 A;  4FQT A;  3UO9 A;  1BOD A;  3D0Y A;  1A03 A;  1MQ1 A;  3BFH A;  4Q04 A;  1C3Y A;  2JC2 A;  2LHL A;  3I5H C;  5GQQ C;  1DC1 A;  2KBM A;  2L2E A;  4XJK A;  5AER A;  1QXP A;  2BCB A;  3R1P A;  1KQV A;  1WDC B;  2G2B A;  1AJ4 A;  1REC A;  3LK0 A;  2LLT A;  3BUM B;  4PAL A;  1SL8 A;  3Q8I A;  2PAS A;  1KCY A;  2LMU A;  3N7H A;  2GGM A;  2F3Z A;  1MUX A;  5B8I B;  4DIR A;  3CAB A;  3DYE A;  2FJU B;  4YGD B;  2WCE A;  4PE4 A;  1U5I B;  4MZJ A;  1M46 A;  4I5K A;  2Q4U A;  4ETO A;  1BF5 A;  1TIZ A;  1JUO A;  2ISD A;  2JOJ A;  4GBA A;  5D69 A;  1F70 A;  2JTZ A;  4D1E A;  1B1G A;  5FI2 A;  3M0W A;  1JWD A;  1G8I A;  1UHJ A;  2M9G A;  4ZCV A;  1ZFS A;  3GK1 A;  4JPZ B;  2MHH A;  1NPQ A;  1NWD A;  1TNP A;  2H2K A;  2AMI A;  2RGI A;  1HT9 A;  4AQJ A;  1KQM C;  1IGV A;  3BJH A;  2HQW A;  1UHK A;  3S0F A;  2LLS A;  4GPL B;  1YX7 A;  1NX0 A;  1RK9 A;  3D77 A;  3JTD C;  1Y6W A;  1MR8 A;  2JWW A;  1TUJ A;  3OP0 A;  3R1O A;  4IJ7 A;  3ZWH A;  2M3W A;  3NSO A;  1JF2 A;  5CSF A;  1GM0 A;  1YVL A;  1S36 A;  1XFX O;  3CR4 X;  1IQ3 A;  3EKH A;  3OBV A;  2LVI A;  2OS8 B;  2OTG C;  5AXI A;  1AHR A;  1TOP A;  1W9Z A;  1RTP 1;  1QVI Z;  1FPW A;  4DUQ A;  1ZUZ A;  1QAT A;  2LNK A;  3DF0 B;  3OHM B;  1OZS A;  2KLD A;  3GK2 A;  5G08 A;  3PSR A;  4MRY A;  1JFK A;  1LIN A;  2K7D A;  3LL8 B;  3KO0 A;  1B47 A;  3BOW A;  3EKJ A;  4IL1 A;  3TUY C;  1DJG A;  1RJV A;  1UWO A;  3CZT X;  1SSE B;  4R1E A;  1EG3 A;  2G9B A;  4N5X A;  1EH2 A;  3DVE A;  3QME A;  5IBW A;  3QRX A;  3E3R A;  1K93 D;  3PFV A;  1BT6 A;  1TN4 A;  2K7B A;  1TNQ A;  2LUC A;  3I5F B;  3SS3 A;  1Y1X A;  1SL9 A;  3NHI A;  1J55 A;  2MJW B;  3IVT A;  2H8V A;  1PSB A;  3BXK A;  2KI6 C;  3EK4 A;  4MBE A;  4ZCU A;  1S5G Z;  2K61 A;  1EXR A;  2CT9 A;  4HRG A;  2DOQ A;  2LLU A;  1A2X A;  4MZK A;  4CID A;  1K95 A;  5AAN A;  2WCF A;  2JU0 A;  1F8H A;  1KK8 B;  1B4C A;  1S1E A;  4PE1 A;  5HLV A;  1J7P A;  2KFH A;  2F3Y A;  3S0A A;  4INW A;  3CZ2 A;  1WRZ A;  4OR9 B;  1XFY O;  4M2P A;  5JJG A;  1AJ5 A;  1BU3 A;  3ICB A;  1N0Y A;  1SCM B;  2K60 A;  1DJW A;  2F2P A;  2O5G A;  1K9K A;  5CPV A;  1T14 A;  2EC6 C;  3AAK A;  4CLN A;  2ZRT A;  1IG5 A;  1LVC D;  3DZT A;  4C0L A;  3A4U B;  1BLQ A;  1CMG A;  2JXC A;  2CNP A;  1HQV A;  5AFP A;  2ZFD A;  1J7R A;  1BR4 B;  2HET A;  1PRW A;  3DVJ A;  1DJZ A;  2JT0 A;  5HKW A;  4UPG A;  1M45 A;  2PYQ A;  2L2C A;  2F2O A;  5DKR A;  3AAJ A;  4YRU A;  1ZAC A;  2SAS A;  3CR5 X;  1WLM A;  4F7F A;  2JQ6 A;  1DJY A;  2CCM A;  2K7C A;  2KQ6 A;  2KDH A;  2K7O A;  3CTN A;  1B7T Y;  2WCM A;  4A4B A;  4WQ3 A;  2QAC A;  4GFT A;  3OB1 B;  4GGF C;  1WDC C;  2ZNE A;  3B88 A;  4P2Y B;  3BUN B;  5TNC A;  4GUK A;  1H4B A;  1ZMZ A;  2COL B;  3B87 A;  2GGZ A;  2AAO A;  4YI9 A;  1IJ5 A;  5KU1 A;  3SIA A;  1KWO B;  2I18 A;  4PHM A;  4YGA A;  2BNX A;  1JC2 A;  1SRA A;  4JKT A;  1OZO A;  4XYN A;  4AOM A;  1CTR A;  3S0B A;  4PHK A;  5HLO A;  1CNP A;  1NYA A;  1XK4 C;  1RWY A;  2LE9 B;  3OB2 B;  1TUZ A;  1Y1U A;  2EHB A;  1M31 A;  2BKI B;  2M29 A;  1V1G A;  3MSE B;  3OX6 A;  1JF0 A;  1QTX A;  4WQ2 A;  1BJF A;  3LLE A;  2D8N A;  3D10 A;  3NSK A;  1F54 A;  2K0J A;  1JSA A;  2LVV A;  2BCA A;  2CBL A;  1E8A A;  1NSH A;  2A4J A;  2ZKM X;  4JD9 A;  1BG1 A;  2R2I A;  2WCJ A;  3O4X A;  2ZND A;  3UNW A;  3DVK A;  4CPV A;  1A75 B;  3VRQ A;  1Q80 A;  1WY9 A;  3B7A A;  3BFB A;  4M2Q A;  1SK6 D;  1SPY A;  3TS5 B;  1AK8 A;  2PAL A;  3L47 A;  2BE6 A;  1ZOT B;  2OS8 C;  3I5G B;  1N2D A;  3D0Y B;  1KK7 Z;  1RRO A;  5BPJ A;  1A4P A;  1NUB A;  2MLE C;  3WHT B;  1EL4 A;  1GGW A;  4XJK B;  1NCX A;  2KLE A;  1F71 A;  2KGB C;  1LXF C;  3A8R A;  1A29 A;  1MF8 B;  4HRE E;  5I2O A;  1DF0 A;  1FBV A;  2KYF A;  3KPX A;  3IQO A;  1IWQ A;  2FCD A;  3GOF A;  4N1G A;  4DCK A;  2PRU A;  5DKN A;  2LHI A;  4NDD A;  3FE9 A;  1DMO A;  1XO5 A;  2LV7 A;  2MRD A;  2BBN A;  3VRN A;  5CSN A;  4U8D A;  1F4O A;  2KI4 B;  2M7N A;  4A4C A;  2LUX A;  2KPH A;  4PDZ A;  2JT3 A;  4E68 A;  4I5N B;  1SNL A;  1CFF A;  1DEL A;  2I2R E;  4F0Z B;  1OOF A;  1FI6 A;  3S0E A;  1OMR A;  3I5F C;  2K8M B;  2F8P A;  1AP4 A;  1CDN A;  2NZ0 A;  3BUW B;  1AVS A;  2WCB A;  5PAL A;  2H61 C;  4NQG A;  4OVN F;  4YI8 A;  3ZNI A;  2LVJ A;  5I8N A;  1B9A A;  1UP5 A;  2HQ8 A;  1DQE A;  3L4L A;  2FJY A;  2L5Y A;  2L5X B;  3EVV A;  2Y5I A;  1KK8 C;  1TCF A;  1Z4H A;  2K2F A;  1S6I A;  4MRX A;  1NIW A;  5DKQ A;  2JNX A;  4TNC A;  3IF7 A;  1K94 A;  1DT7 B;  1DVI A;  1MXE A;  2WCK A;  1VRK A;  5JOL A;  3IQQ A;  1QLK A;  2WOR A;  1OSA A;  3EVR A;  2GV5 A;  3D74 A;  1SCM C;  5F6T A;  1JFJ A;  1NX3 A;  1P28 A;  3NHT A;  4L9M A;  5D3O A;  1NCY A;  2QPT A;  1QJT A;  1DJH A;  3H4S E;  2FOT A;  5KTY A;  2QEB A;  3R1V A;  1DGV A;  3JVT B;  3BYA A;  1K9U A;  2SCP A;  1YUS A;  3AKB A;  2LCP A;  1J7Q A;  1TCO B;  2GTE A;  3R72 A;  4QJ5 B;  3BOW B;  2JRF A;  2FCE A;  3RM1 A;  5DIC A;  1DTL A;  1MWN A;  3GK4 X;  3NSI A;  4OKH A;  3SS5 A;  3NGV A;  2WOS A;  3BUO B;  2LVK A;  4FQO A;  4DRW A;  1OOG A;  2P6B B;  2QDI A;  3NSL A;  2Y4Q A;  2I7A A;  2M0R A;  1K90 D;  3WHU B;  2WCH A;  3TZ1 A;  2KBI A;  4MZL A;  3CDN A;  5D7F A;  1SMG A;  2KFG A;  1R2U A;  1CDP A;  1XA5 A;  1TNW A;  1M39 A;  1CKK A;  3SG2 A;  1TRF A;  3CZ0 A;  4CFR A;  1DJX A;  1WLZ A;  1CDM A;  1PVA A;  1OE9 B;  4MEW A;  4GAO A;  1YRU B;  2Y1N A;  1KWO C;  2F33 A;  1C7W A;  4MN0 A;  1L2O B;  3NXA A;  4P5O E;  1ORG A;  1GQM A;  3CWG A;  1QV1 A;  3O6B A;  1XYD A;  1QAS A;  1PUL A;  1YUT A;  1Z2C B;  3VB1 A;  3RZS A;  1L7Z A;  1TWO A;  2MAZ A;  1KFU S;  2L98 A;  3PAL A;  3SIB A;  2TN4 A;  2KI6 D;  3EVU A;  4GNK B;  2KOT A;  4GGF A;  1S6J A;  5FI6 A;  4ICB A;  2YGU A;  3SJS A;  2NXQ A;  5AEQ A;  3BFA A;  1SW8 A;  4PCW A;  1J7O A;  1PK0 D;  1RFJ A;  1X02 A;  2HPS A;  1ODB A;  3CGA A;  1K8U A;  2M49 B;  3PN7 B;  5ER4 X;  1CLB A;  5CSI A;  1OW4 A;  2IS9 A;  1CLM A;  1ALV A;  2LP3 A;  1QX5 B;  1U5I A;  5FI7 A;  1XK4 A;  3TS5 C;  1B8L A;  2L4I A;  1XFR A;  3PM8 A;  4C0K A;  2KAY A;  2WC8 A;  3EG5 B;  1S6C A;  2M1K B;  3PJI A;  1SCV A;  3V2L A;  3I5G C;  5I94 A;  1XFZ O;  3CLN A;  3K21 A;  1DEK A;  4BY5 A;  1BR1 B;  1KFU L;  3CS1 A;  1UUR A;  3DY9 A;  4PHJ A;  3VRP A;  1F55 A;  1S5G Y;  2B1U A;  3TDU A;  1G4Y R;  1YRT B;  3L4A A;  2WC5 A;  2OPO A;  1BOC A;  1KFX S;  1PVB A;  2AUC A;  3OGN A;  2BL0 B;  2Q91 A;  2NLN A;  1EG4 A;  5EL2 A;  1UUS A;  1XFV O;  1OOI X;  4YGB B;  2KHN A;  3WXA A;  2PMY A;  3OX5 A;  3SG4 A;  1C7V A;  2KSP A;  2JNF A;  1KSO A;  1SR6 B;  1W7J B;  2KI4 C;  1SL7 A;  3SS4 A;  4ORA B;  2M8U A;  2PVB A;  4ORB B;  2ZN8 A;  2PQL A;  3O2P A;  3SG3 A;  1QX7 A;  2JPT A;  2QEO A;  2LAP A;  1AUI B;  2VRG A;  3DVM A;  2M97 A;  3TDI A;  3I5H B;  5KSZ A;  1WRK A;  2ERB A;  2JZI A;  2KAX A;  2L4H A;  1TNX A;  2JPO A;  3DF0 A;  3FWB A;  2WCL A;  3DD4 A;  2BKH B;  2HF5 A;  1W7I B;  3I5I C;  2L0P A;  2BEC A;  3FWC A;  1CM1 A;  4N1F A;  3FE6 A;  4MVF A;  1OOJ A;  3SG7 A;  1QV0 A;  3FS7 A;  3SG6 A;  4YBH B;  5HKY A;  1IH0 A;  5I2Q A;  1SYM A;  4INX A;  4PE0 A;  1KFX L;  4C0J A;  2JTT A;  1G33 A;  3HCM A;  2CXJ A;  1ALW A;  3C1V A;  3AKA A;  1NX2 A;  3LK1 A;  1YUR A;  2JT8 A;  2LAN A;  2LP2 A;  2CTN A;  3O4Y A;  1CM4 A;  2Y1M A;  1YTZ C;  3I5I B;  3KEV A;  1XFU O;  3JVT C;  1B7T Z;  3VRR A;  2QEV A;  3PAT A;  4NDC A;  3D75 A;  1WRL A;  2KFF A;  1NP8 A;  2H61 A;  4M2O A;  3CYZ A;  3TDZ A;  1PSR A;  3HX4 A;  1IKU A;  1CFP A;  1PAL A;  1KQM B; 
#chains in the Genus database with same CATH homology
 2MLF C;  3LCP C;  3KHE A;  5FYX A;  1DGU A;  3JTD B;  1DF0 B;  1N65 A;  5HYD A;  2PSR A;  1QLS A;  4QJ4 B;  2L50 A;  4CFQ A;  4DS7 A;  1MXL C;  1LA3 A;  2ZRS A;  2LMV A;  3F45 A;  3O78 A;  1V1F A;  4JQ0 D;  3VRO A;  1AP4 A;  2NCO A;  1OMV A;  1QIV A;  1KSM A;  2O60 A;  4OV2 A;  1CFC A;  1GJY A;  2OTG B;  5HKZ A;  3RLZ A;  1CFD A;  1UHN A;  2M7L A;  1C07 A;  2KNE A;  1J1E A;  2KQY A;  5ER5 A;  1K96 A;  3FIA A;  2MBX A;  4PHN A;  1QIW A;  2JXL A;  1S26 D;  1M63 B;  3EK7 A;  4I5L B;  4WRI A;  3TUY B;  1NX1 A;  2BBM A;  2L51 A;  3CR2 A;  4QJ3 B;  1Y1A A;  1L2O C;  1B8R A;  1QS7 A;  1YVH A;  1YUU A;  1DJI A;  2I94 A;  1Y0V H;  2WND A;  4FTG A;  1K9P A;  2KGR A;  1J1D A;  3BQ3 A;  5CSJ A;  1S3P A;  2LM5 A;  3EK8 A;  1KK7 Y;  4YGC B;  2LC5 A;  1NCZ A;  1LA0 A;  3PLF B;  1GGZ A;  2EGD A;  2K2A A;  4AQI A;  1FI5 A;  1UHI A;  4MSP A;  2M1U A;  4HRH A;  1YX8 A;  1B8C A;  1IRJ A;  4OCI A;  1XVJ A;  4HSZ A;  2BE4 A;  4MLW A;  1CMF A;  4I5J A;  4ORC B;  1CB1 A;  2KAV A;  3PN7 C;  1SY9 A;  1UHH A;  1K2H A;  2MA2 A;  1QVI Y;  1SBJ A;  1BMO A;  1OMD A;  4JWQ A;  2KYC A;  1IJ6 A;  1H8B A;  1FF1 A;  1R6P A;  4GGN A;  2LMT A;  5I2L A;  2BCX A;  1LKJ A;  1D1O A;  2EC6 B;  2E30 A;  1MHO A;  2V53 A;  5J3X A;  1CLL A;  1CDL A;  3VGO A;  1JBA A;  2E6W A;  1SKT A;  1QX2 A;  1F4Q A;  1IQ5 A;  1EJ3 A;  1OQP A;  1YR5 A;  1A75 A;  1TTX A;  2ZN9 A;  4BY4 A;  2BL0 C;  1FW4 A;  2JUL A;  5K89 A;  4PE7 A;  3KF9 A;  1XFW O;  3BUX B;  2NCP A;  4NDB A;  4USL A;  1SR6 C;  3WNX B;  4YGE B;  3SG5 A;  1BOD A;  3D0Y A;  1A03 A;  1MQ1 A;  4Q04 A;  2JC2 A;  2LHL A;  3I5H C;  5GQQ C;  2KBM A;  2L2E A;  4XJK A;  5AER A;  1QXP A;  2BCB A;  1KQV A;  1WDC B;  2G2B A;  1AJ4 A;  1REC A;  3LK0 A;  2LLT A;  3BUM B;  4PAL A;  1SL8 A;  2PAS A;  1KCY A;  2LMU A;  2GGM A;  2F3Z A;  1MUX A;  5B8I B;  4DIR A;  2FJU B;  4YGD B;  2WCE A;  4PE4 A;  1U5I B;  4MZJ A;  1M46 A;  4I5K A;  2Q4U A;  4ETO A;  1BF5 A;  1TIZ A;  1JUO A;  2ISD A;  2JOJ A;  4GBA A;  5D69 A;  1F70 A;  2JTZ A;  4D1E A;  1B1G A;  3M0W A;  1JWD A;  1G8I A;  1UHJ A;  2M9G A;  4ZCV A;  1ZFS A;  3GK1 A;  4JPZ B;  2MHH A;  1NPQ A;  1NWD A;  1TNP A;  2H2K A;  2AMI A;  2RGI A;  1HT9 A;  4AQJ A;  1KQM C;  1IGV A;  2HQW A;  1UHK A;  2LLS A;  4GPL B;  1YX7 A;  1NX0 A;  1RK9 A;  3JTD C;  3OP0 A;  1Y6W A;  1MR8 A;  2JWW A;  3ZWH A;  2M3W A;  3NSO A;  1JF2 A;  5CSF A;  1YVL A;  1S36 A;  1XFX O;  3CR4 X;  1IQ3 A;  3EKH A;  2LVI A;  2OS8 B;  2OTG C;  5AXI A;  1AHR A;  1TOP A;  1RTP 1;  1QVI Z;  1FPW A;  4DUQ A;  1ZUZ A;  1QAT A;  2LNK A;  3DF0 B;  3OHM B;  1OZS A;  3GK2 A;  5G08 A;  3PSR A;  4MRY A;  1JFK A;  1LIN A;  2K7D A;  3LL8 B;  3KO0 A;  1B47 A;  3BOW A;  3EKJ A;  4IL1 A;  3TUY C;  1DJG A;  1RJV A;  1UWO A;  3CZT X;  4R1E A;  1EG3 A;  2G9B A;  4N5X A;  1EH2 A;  3DVE A;  5IBW A;  3QRX A;  3E3R A;  1K93 D;  3PFV A;  1BT6 A;  1TN4 A;  2K7B A;  1TNQ A;  2LUC A;  3I5F B;  1Y1X A;  1SL9 A;  1J55 A;  2MJW B;  1PSB A;  3BXK A;  2KI6 C;  3EK4 A;  4MBE A;  4ZCU A;  1S5G Z;  2K61 A;  1EXR A;  2CT9 A;  4HRG A;  2DOQ A;  2LLU A;  1A2X A;  4MZK A;  4CID A;  1K95 A;  5AAN A;  2WCF A;  2JU0 A;  1F8H A;  1KK8 B;  1B4C A;  1S1E A;  4PE1 A;  5HLV A;  1J7P A;  2KFH A;  2F3Y A;  1WRZ A;  4OR9 B;  1XFY O;  4M2P A;  5JJG A;  1AJ5 A;  1BU3 A;  3ICB A;  1N0Y A;  1SCM B;  1DJW A;  2F2P A;  2O5G A;  1K9K A;  5CPV A;  2EC6 C;  3AAK A;  4CLN A;  2ZRT A;  1IG5 A;  1LVC D;  4C0L A;  3A4U B;  1BLQ A;  1CMG A;  2JXC A;  2CNP A;  1HQV A;  5AFP A;  2ZFD A;  1J7R A;  1BR4 B;  2HET A;  1PRW A;  3DVJ A;  1DJZ A;  2JT0 A;  5HKW A;  4UPG A;  1M45 A;  5DKR A;  2F2O A;  3AAJ A;  4YRU A;  1ZAC A;  2SAS A;  3CR5 X;  1WLM A;  2JQ6 A;  1DJY A;  2CCM A;  2K7C A;  2KQ6 A;  2KDH A;  2K7O A;  3CTN A;  1B7T Y;  4A4B A;  4WQ3 A;  2QAC A;  4GFT A;  3OB1 B;  4GGF C;  1WDC C;  2ZNE A;  5TNC A;  4P2Y B;  3BUN B;  1H4B A;  4GUK A;  1ZMZ A;  2COL B;  2GGZ A;  2AAO A;  4YI9 A;  1IJ5 A;  5KU1 A;  3SIA A;  1KWO B;  2I18 A;  4PHM A;  4YGA A;  1JC2 A;  1SRA A;  1OZO A;  4XYN A;  4AOM A;  1CTR A;  4PHK A;  5HLO A;  1CNP A;  1NYA A;  1XK4 C;  1RWY A;  2LE9 B;  3OB2 B;  2EHB A;  1Y1U A;  1M31 A;  2BKI B;  2M29 A;  1V1G A;  3MSE B;  3OX6 A;  1JF0 A;  1QTX A;  4WQ2 A;  1BJF A;  3LLE A;  2D8N A;  3D10 A;  3NSK A;  1F54 A;  2K0J A;  1JSA A;  2LVV A;  2BCA A;  2CBL A;  1E8A A;  1NSH A;  2A4J A;  2ZKM X;  1BG1 A;  2R2I A;  2ZND A;  3DVK A;  4CPV A;  1A75 B;  3VRQ A;  1Q80 A;  1WY9 A;  4M2Q A;  1SK6 D;  1SPY A;  3TS5 B;  1AK8 A;  2PAL A;  2BE6 A;  1ZOT B;  2OS8 C;  3I5G B;  1N2D A;  3D0Y B;  1KK7 Z;  1RRO A;  5BPJ A;  1A4P A;  1NUB A;  2MLE C;  3WHT B;  1EL4 A;  1GGW A;  4XJK B;  1NCX A;  1F71 A;  2KGB C;  1LXF C;  3A8R A;  1A29 A;  1MF8 B;  4HRE E;  5I2O A;  1DF0 A;  1FBV A;  2KYF A;  3KPX A;  3IQO A;  1IWQ A;  2FCD A;  3GOF A;  4N1G A;  4DCK A;  2PRU A;  5DKN A;  2LHI A;  4NDD A;  1DMO A;  1XO5 A;  2LV7 A;  2MRD A;  2BBN A;  3VRN A;  5CSN A;  4U8D A;  1F4O A;  2KI4 B;  2M7N A;  4A4C A;  2LUX A;  4PDZ A;  2JT3 A;  4E68 A;  4I5N B;  1SNL A;  1CFF A;  2I2R E;  4F0Z B;  1FI6 A;  1OMR A;  3I5F C;  2K8M B;  2F8P A;  1CDN A;  2NZ0 A;  3BUW B;  1AVS A;  2WCB A;  5PAL A;  2H61 C;  4NQG A;  4OVN F;  4YI8 A;  3ZNI A;  2LVJ A;  5I8N A;  1B9A A;  1UP5 A;  2HQ8 A;  2L5X B;  3EVV A;  2Y5I A;  1KK8 C;  1TCF A;  2K2F A;  1S6I A;  4MRX A;  1NIW A;  5DKQ A;  2JNX A;  4TNC A;  3IF7 A;  1K94 A;  1DT7 B;  1DVI A;  1MXE A;  1VRK A;  5JOL A;  3IQQ A;  1QLK A;  2WOR A;  1OSA A;  3EVR A;  2GV5 A;  1SCM C;  5F6T A;  1JFJ A;  1NX3 A;  4L9M A;  1NCY A;  2QPT A;  1QJT A;  1DJH A;  3H4S E;  2FOT A;  5KTY A;  1DGV A;  3JVT B;  3BYA A;  1K9U A;  2SCP A;  1YUS A;  3AKB A;  2LCP A;  1J7Q A;  1TCO B;  4QJ5 B;  3BOW B;  2JRF A;  2FCE A;  3RM1 A;  1DTL A;  1MWN A;  3GK4 X;  3NSI A;  4OKH A;  2WOS A;  3BUO B;  2LVK A;  4FQO A;  4DRW A;  2P6B B;  3NSL A;  2Y4Q A;  2I7A A;  2M0R A;  1K90 D;  3WHU B;  3TZ1 A;  2KBI A;  4MZL A;  5D7F A;  1SMG A;  2KFG A;  1R2U A;  1CDP A;  1XA5 A;  1TNW A;  1M39 A;  1CKK A;  3SG2 A;  1TRF A;  4CFR A;  1DJX A;  1WLZ A;  1CDM A;  1PVA A;  1OE9 B;  4MEW A;  4GAO A;  1YRU B;  2Y1N A;  1KWO C;  2F33 A;  1C7W A;  4MN0 A;  1L2O B;  3NXA A;  4P5O E;  1GQM A;  3CWG A;  1QV1 A;  3O6B A;  1XYD A;  1QAS A;  1PUL A;  1YUT A;  1L7Z A;  2MAZ A;  1KFU S;  2L98 A;  3PAL A;  3SIB A;  2TN4 A;  2KI6 D;  3EVU A;  4GNK B;  2KOT A;  4GGF A;  1S6J A;  3SJS A;  4ICB A;  2NXQ A;  5AEQ A;  1SW8 A;  4PCW A;  1J7O A;  1PK0 D;  1RFJ A;  1X02 A;  2HPS A;  1ODB A;  3CGA A;  1K8U A;  2M49 B;  3PN7 B;  5ER4 X;  1CLB A;  5CSI A;  2IS9 A;  1CLM A;  1ALV A;  2LP3 A;  1QX5 B;  1U5I A;  1XK4 A;  3TS5 C;  1B8L A;  2L4I A;  3PM8 A;  4C0K A;  2KAY A;  2WC8 A;  1S6C A;  2M1K B;  1SCV A;  3I5G C;  1XFZ O;  3CLN A;  3K21 A;  4BY5 A;  1BR1 B;  1KFU L;  3CS1 A;  1UUR A;  4PHJ A;  3VRP A;  1F55 A;  1S5G Y;  2B1U A;  3TDU A;  1G4Y R;  1YRT B;  1BOC A;  2OPO A;  1KFX S;  1PVB A;  2AUC A;  2BL0 B;  2Q91 A;  2NLN A;  1EG4 A;  1UUS A;  1XFV O;  4YGB B;  2KHN A;  3WXA A;  2PMY A;  3OX5 A;  3SG4 A;  1C7V A;  2KSP A;  2JNF A;  1KSO A;  1SR6 B;  1W7J B;  2KI4 C;  1SL7 A;  4ORA B;  2M8U A;  2PVB A;  4ORB B;  2ZN8 A;  3O2P A;  3SG3 A;  1QX7 A;  2JPT A;  2VRG A;  2LAP A;  1AUI B;  3TDI A;  3DVM A;  2M97 A;  5KSZ A;  3I5H B;  1WRK A;  2JZI A;  2KAX A;  3DF0 A;  2L4H A;  1TNX A;  3FWB A;  3DD4 A;  2BKH B;  2HF5 A;  1W7I B;  3I5I C;  2L0P A;  2BEC A;  3FWC A;  1CM1 A;  4N1F A;  4MVF A;  1OOJ A;  3SG7 A;  1QV0 A;  3FS7 A;  3SG6 A;  4YBH B;  5HKY A;  1IH0 A;  5I2Q A;  1SYM A;  4PE0 A;  1KFX L;  4C0J A;  2JTT A;  1G33 A;  3HCM A;  2CXJ A;  1ALW A;  3C1V A;  3AKA A;  1NX2 A;  3LK1 A;  1YUR A;  2JT8 A;  2LAN A;  2LP2 A;  2CTN A;  3O4Y A;  1CM4 A;  2Y1M A;  1YTZ C;  3I5I B;  3KEV A;  1XFU O;  3JVT C;  1B7T Z;  3VRR A;  3PAT A;  4NDC A;  1WRL A;  2KFF A;  1NP8 A;  2H61 A;  4M2O A;  3TDZ A;  1IKU A;  1PSR A;  3HX4 A;  1CFP A;  1PAL A;  1KQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...