3VB1A

Crystal structure of anopholes gambiae odorant binding protein 20 in open state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
119
Chain Sequence
MTVEQMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords AGAP005208-PA
publication title A novel mechanism of ligand binding and release in the odorant binding protein 20 from the malaria mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 41
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3vb1A00
3CZ1A 3RZSA 1ORGA 2QEHA 3D77A 3L4LA 3DYEA 2ERBA 3BFBA 3CDNA 3R72A 3BFAA 3K1EA 1GM0A 3CABA 1DQEA 3D74A 4JD9A 2WC6A 4INXA 3Q8IA 2L2CA 3FE6A 2JPOA 3BFHA 3PJIA 3B87A 3D73A 3S0AA 2P71A 3S0DA 1QWVA 1TUJA 2H8VA 2WC5A 3V2LA 3D75A 4FQTA 3B6XA 3D78A 1TWOA 3S0FA 3QMEA 3S0EA 1OOFA 3NHIA 2QEVA 1C3YA 3B7AA 3CZ0A 4PT1A 2KPHA 1LS8A 3DXLA 3N7HA 4INWA 3OGNA 3DY9A 5EL2A 3S0GA 3NGVA 2FJYA 1C3ZA 2P70A 3B86A 2WCLA 3CYZA 2WCMA 1T14A 3VB1A 2QEBA 3R1VA 3R1PA 2GTEA 1OOGA 3R1OA 3FE9A 3DZTA 1XFRA 2PQLA 1P28A 1OOIX 2QDIA 1OW4A 3CZ2A 3S0BA 2QEOA 3NHTA 2WCHA 4OZDA 1OOHA 2WCKA 3B88A 4F7FA 3D76A 3FE8A 5DICA 2WCJA 3L47A 3BJHA 3L4AA
chains in the Genus database with same CATH superfamily
1DELA 1M31A 1QX5B 2LM5A 3VROA 1K2HA 2LVKA 2JNFA 5HKZA 2ZN8A 4C0LA 4N1FA 1OMRA 2LAPA 2KGBC 1Y0VH 2KAXA 1ORGA 2L0PA 3ZNIA 2L5XB 1SR6B 2JULA 2OPOA 1A4PA 1W7IB 1S3PA 1K90D 1CDPA 1KK7Z 3CDNA 3R72A 3PM2A 1C07A 1BG1A 1MQ1A 3TUYB 1BF5A 1W7JB 2BBMA 3KO0A 1GM0A 1OZSA 5CSIA 3TS5B 1KFUS 1L2OC 3WHUB 1KK7Y 4DUQA 1F4OA 2BE6A 1H8BA 1M45A 1M63B 1B7TZ 2KQYA 5AEQA 1D1OA 1M46A 1V1GA 1SKTA 1UP5A 5CSNA 3EG5B 3SG5A 1SRAA 1FW4A 1WDCC 3PFVA 4MN0A 3VRPA 2P6BB 2ZRSA 1K9KA 4MZKA 5AFPA 3B87A 2M97A 4GGFC 3BYAA 3OBVA 4NDBA 1SL8A 1R6PA 2AAOA 5CSJA 3A4UB 1G33A 1V1FA 1BR1B 1UHNA 1YURA 2BNXA 2JTZA 3OHMB 3SS5A 4GGNA 2VRGA 2EC6B 2QPTA 1IGVA 1MUXA 4XJKB 3UO9A 2WC5A 2LCPA 1B1GA 4JPZB 1NUBA 5F6TA 1U5IA 3ICBA 3OX5A 4PHNA 3O4YA 3DVEA 2K7DA 5ER5A 1JSAA 2E6WA 2PASA 2I94A 3EK8A 1RK9A 4GUKA 2ISDA 4HRGA 4PE0A 5AERA 1OOFA 1TCOB 3KHEA 3NHIA 2MLEC 3B7AA 1CLLA 1IQ5A 1EXRA 5TNCA 1NIWA 3TDZA 4PT1A 2MJWB 2KPHA 1SY9A 2K8MB 3DXLA 3AAKA 3N7HA 1QLKA 3NSOA 2H61C 4MEWA 2WCEA 1GGWA 2COLB 3I5FB 3LK1A 4YGDB 1CM4A 3I5HC 4HRHA 2KI6D 3O78A 5HLVA 2B1UA 3PN7C 1C3ZA 2P70A 3GK4X 4YI8A 2NZ0A 1E8AA 1CDNA 1CFPA 3H4SE 2E30A 1NWDA 1TNWA 2F3ZA 4YBHB 1NX2A 3JTDC 2QEBA 3R1VA 1EL4A 2IS9A 2ZNEA 1IWQA 4PE4A 2MLFC 2M29A 1BU3A 1K96A 3BOWA 1XFRA 4NDCA 2PSRA 1QJTA 1OOIX 1KQMB 2GV5A 2QDIA 3EK7A 3CZ2A 3IQQA 4ZCUA 2K0JA 1LA3A 1NX3A 2O5GA 2QEOA 4I5KA 1B8RA 2ZFDA 2FCEA 1NX1A 1OOHA 3A8RA 2ZN9A 2ZKMX 1MF8B 2D8NA 2KLEA 3I5GB 1UUSA 1SNLA 2K61A 2WCJA 2LVJA 1YX7A 3I5IC 1UHKA 3WNXB 1KK8B 2LUCA 1A75B 1S36A 2CNPA 1DC1A 1Q80A 1H4BA 3L4AA 1F4QA 1EG3A 4D1EA 1K95A 1BT6A 2K7OA 1NP8A 4MSPA 4GAOA 2MA2A 2HPSA 1K93D 1CFDA 1UURA 2KI4B 1DF0B 2LVIA 1Y1AA 2QEHA 1QLSA 2NLNA 1SMGA 3D10A 3HX4A 1FPWA 1NCXA 3DVKA 3BFBA 2DOQA 2M9GA 1A03A 3BFAA 2K2AA 2LLTA 1UWOA 2JNXA 4PALA 2KI6C 1M39A 1SR6C 1CNPA 1Y1UA 4UPGA 1UHHA 1W9ZA 4JD9A 1WY9A 2KBMA 2WC6A 4P2YB 1XFXO 1AJ5A 3TUYC 1J1DA 1J7OA 4INXA 4CIDA 1KQVA 2AMIA 3TS5C 2YGUA 1CFCA 2LNKA 2G9BA 1NYAA 2M1UA 1LKJA 2WNDA 3RM1A 1QIWA 3NXAA 3AKAA 3DF0A 1ZOTB 2BAPA 2F33A 4DRWA 2KNEA 3PJIA 1AVSA 1Y1XA 3FS7A 2P71A 3BUOB 1PVAA 1F70A 1F54A 1QXPA 1HQVA 3K21A 4MLWA 2H8VA 1ALVA 1DJIA 2M1KB 3NSLA 1AJ4A 4CFQA 3QRXA 1JF2A 1KWOB 1CKKA 2WORA 2LP2A 4P5OE 3VRRA 3GK2A 2JT0A 4A4CA 3B6XA 2Y4QA 1K9PA 1EH2A 5KSZA 3D78A 2EC6C 5FI2A 1GGZA 1QS7A 1RROA 2KFFA 1DJZA 3CZTX 4GGFA 4ORAB 4QJ3B 5I2LA 2WC8A 2JZIA 2QEVA 1CDLA 5I8NA 1SPYA 2GGMA 1JBAA 2LLUA 1CMGA 1GQMA 4USLA 2I18A 1YX8A 2FCDA 3OGNA 4OR9B 3DY9A 1S6IA 4WQ3A 3SJSA 2L5YA 3S0GA 3CGAA 4A4BA 1WRKA 4I5NB 5G08A 4N5XA 4ZCVA 4U8DA 3KF9A 3CYZA 2M3WA 3LLEA 4GFTA 3I5FC 4GBAA 2WCMA 1T14A 1DJGA 1AK8A 1IJ6A 2CBLA 3VB1A 2M7NA 2LLSA 3JVTB 2F3YA 3CLNA 5JOLA 3TDUA 5DKRA 3OB2B 1OOGA 4OV2A 1PRWA 3R1OA 2PYQA 2JXCA 1LA0A 2H61A 5DKNA 5GQQC 1P28A 3VRQA 2ZNDA 1HT9A 2NCOA 2OS8B 3S0BA 1OW4A 1K9UA 2JQ6A 3EVRA 3EKHA 1XFZO 4NDDA 2LVVA 4CLNA 5KTYA 1J7PA 1JUOA 1Z2CB 2I7AA 1ZFSA 2WCHA 4AQIA 2HQWA 2H2KA 2WCKA 3B88A 1KQMC 4F7FA 3FE8A 4JWQA 1R2UA 1Z4HA 2PMYA 1N65A 2SASA 2LE9B 4ORBB 5DICA 4AQJA 4C0JA 2LHLA 3BJHA 1IIOA 2M49B 3CS1A 3EVVA 2BKHB 3LL8B 2O60A 1TIZA 5HKYA 4YGCB 1QATA 1QVIZ 2JT3A 4KYNA 1JC2A 3CR2A 2GGZA 3I5GC 4ICBA 1FF1A 1OMDA 1EG4A 3CZ1A 3RZSA 1LVCD 2KAYA 3SS3A 1J7RA 1KK8C 2LV7A 3TDIA 3GK1A 1NX0A 3SIBA 3CR4X 4FTGA 1QVIY 1AP4A 1WLMA 2F2OA 2WCBA 2BL0B 3L4LA 1CB1A 5DKQA 4M2OA 4MRYA 2R2IA 3O2PA 1DQEA 2KYCA 2K2FA 2KI4C 5D7FA 1MWNA 3PATA 3ZWHA 1U5IB 1QTXA 1WRZA 1IQ3A 1PULA 2AUCA 1MXLC 1QASA 1IKUA 1QX2A 3BQ3A 1MHOA 2SCPA 1F71A 2G2BA 3GOFA 2Y5IA 1BOCA 2HETA 5I2OA 2EGDA 1SW8A 1RWYA 3Q8IA 3EKJA 2L2CA 1S26D 2JWWA 3FE6A 1LXFC 4HSZA 4N1GA 2LC5A 3LCPC 3TZ1A 4AOMA 2JXLA 1RJVA 2L98A 4IL1A 5CPVA 2K7BA 2QACA 1CMFA 3NSKA 2LANA 2BECA 1JF0A 1N0YA 3OX6A 3D73A 1YVHA 2KHNA 4HREE 1PVBA 5D69A 1DVIA 2JRFA 3BUWB 2I2RE 2M8UA 3O4XA 2K60A 3SG2A 3UNWA 3PSRA 4F0ZB 5HLOA 4DIRA 3PM8A 1IRJA 1QIVA 3C1VA 1F55A 1F8HA 2BCAA 4PCWA 5B8IB 2KYFA 3FIAA 2F8PA 2KFGA 4FQTA 1KFUL 3LK0A 2KQ6A 1PSRA 1TUZA 2BE4A 2CCMA 1C7WA 2LHIA 1TWOA 3S0FA 3M0WA 4GPLB 1DGUA 3D0YA 1SBJA 1J1EA 4BY5A 2RGIA 1S6JA 2PVBA 3BOWB 1S1EA 1OE9B 4ETOA 3CZ0A 2NXQA 2OTGB 2JOJA 1DGVA 4CFRA 1LS8A 3F45A 5CSFA 1LINA 1DJXA 1OQPA 1OOJA 1KFXL 2LMVA 4INWA 1B4CA 1CM1A 2MAZA 3CR5X 4JQ0D 1PSBA 2L51A 4DCKA 2BCBA 3BUNB 2L2EA 1BJFA 1ODBA 2FJYA 2M0RA 1SL9A 4GNKB 2MBXA 4IJ7A 4XJKA 1SCMB 5D3OA 1TCFA 3PLFB 3HCMA 1YUUA 1OZOA 2LP3A 4PHJA 4YGEB 2FOTA 2FJUB 2TN4A 4TNCA 3SG4A 1AUIB 3R1PA 1TOPA 3IQOA 4WQ2A 2GTEA 3IF7A 1XK4C 1IH0A 1PK0D 1VRKA 4MZJA 4PE7A 5K89A 3DZTA 4Q04A 2CT9A 2HF5A 5HL1A 3WHTB 2KOTA 1XFYO 5PALA 3JVTC 2BBNA 1B8LA 1YRUB 3NHTA 4MVFA 4YGAA 1BODA 2JTTA 1TNXA 2JPTA 2PRUA 1SK6D 2WCFA 1K94A 1QX7A 3SS4A 4ORCB 5KU1A 2OS8C 3D76A 4OVNF 2LMTA 1CTRA 1A2XA 4PE1A 2BKIB 1X02A 1DJHA 4I5LB 3DVMA 3L47A 3O6BA 4QJ4B 1XO5A 3D0YB 3SIAA 3SG3A 1SCVA 5AXIA 1MXEA 2A4JA 3AAJA 4FQOA 2JU0A 1YR5A 2EHBA 4MBEA 1KCYA 3DF0B 4QJ5B 1B7TY 1CLBA 1NCYA 3RLZA 1CDMA 1KFXS 3OP0A 1XFUO 1MR8A 4NQGA 3FWCA 3D77A 1L2OB 3DYEA 3DVJA 2Q91A 2ERBA 1K8UA 2HQ8A 2PALA 4M2QA 3MSEB 1XFVO 1YRTB 3K1EA 2BCXA 3SG6A 1TRFA 3CABA 2CXJA 1DMOA 1ALWA 5BPJA 1N2DA 1NPQA 5HYDA 2BL0C 3D74A 5IBWA 4E68A 1RECA 1JFJA 1S6CA 2LUXA 2Y1NA 4DS7A 5J3XA 1PALA 1A29A 1WDCB 5HKWA 1A75A 2KAVA 1OSAA 1EJ3A 5I94A 2CTNA 5FI6A 2JT8A 1DJYA 5I2QA 2JPOA 1ZACA 2KFHA 3AKBA 3BFHA 4WRIA 5AANA 2KLDA 4YGBB 1FI5A 2ZRTA 3E3RA 1DF0A 3IVTA 5ER4X 1IG5A 2L50A 1KSOA 5FI7A 3S0AA 4PHMA 1XVJA 2JC2A 1G8IA 1YUTA 3S0DA 1QV1A 2NCPA 1QWVA 1UHIA 1TUJA 1JWDA 1DEKA 1OMVA 3KPXA 4L9MA 3V2LA 1TTXA 1KSMA 2Q4UA 3D75A 1XA5A 1J7QA 3EVUA 4MZLA 1Y6WA 1B9AA 3SG7A 1ZMZA 4XYNA 2V53A 1SSEB 3QMEA 1L7ZA 1B8CA 3NSIA 3S0EA 1AHRA 1RFJA 2Y1MA 3CWGA 1C3YA 1YVLA 1BR4B 1TN4A 1TNQA 3I5HB 2LMUA 2KBIA 3FWBA 3PN7B 1SL7A 4YRUA 1WRLA 1XYDA 5FYXA 4M2PA 4YI9A 1BLQA 1SYMA 1B47A 1NSHA 4R1EA 2L4HA 5EL2A 1TNPA 3DD4A 3JTDB 1J55A 3NGVA 2OTGC 4I5JA 3B86A 2WCLA 3KEVA 1NCZA 3BUMB 3CTNA 2KGRA 4CPVA 4PHKA 4BY4A 4MRXA 1S5GZ 1IJ5A 1RTP1 3OB1B 1ZUZA 2KSPA 4OKHA 2KDHA 1G4YR 1SCMC 1UHJA 1KWOC 1FI6A 2K7CA 3FE9A 3WXAA 3EK4A 1YUSA 1S5GY 2PQLA 1DJWA 3VRNA 4OCIA 1WLZA 3I5IB 2M7LA 5JJGA 2L4IA 1GJYA 2F2PA 4JKTA 4OZDA 1DTLA 2WOSA 4PDZA 1JFKA 1FBVA 1DT7B 3VGOA 1CFFA 2MRDA 1XFWO 1CLMA 3BUXB 1YTZC 1C7VA 1BMOA 1QV0A 4C0KA 3PALA 1XK4A 3BXKA 2MHHA
chains in the Genus database with same CATH topology
3CZ1A 3RZSA 1ORGA 2QEHA 3D77A 3L4LA 3DYEA 2ERBA 3BFBA 3CDNA 3R72A 3BFAA 3K1EA 1GM0A 3CABA 1DQEA 3D74A 4JD9A 2WC6A 4INXA 3Q8IA 2L2CA 3FE6A 2JPOA 3BFHA 3PJIA 3B87A 3D73A 3S0AA 2P71A 3S0DA 1QWVA 1TUJA 2H8VA 2WC5A 3V2LA 3D75A 4FQTA 3B6XA 3D78A 1TWOA 3S0FA 3QMEA 3S0EA 1OOFA 3NHIA 2QEVA 1C3YA 3B7AA 3CZ0A 4PT1A 2KPHA 1LS8A 3DXLA 3N7HA 4INWA 3OGNA 3DY9A 5EL2A 3S0GA 3NGVA 2FJYA 1C3ZA 2P70A 3B86A 2WCLA 3CYZA 2WCMA 1T14A 3VB1A 2QEBA 3R1VA 3R1PA 2GTEA 1OOGA 3R1OA 3FE9A 3DZTA 1XFRA 2PQLA 1P28A 1OOIX 2QDIA 1OW4A 3CZ2A 3S0BA 2QEOA 3NHTA 2WCHA 4OZDA 1OOHA 2WCKA 3B88A 4F7FA 3D76A 3FE8A 5DICA 2WCJA 3L47A 3BJHA 3L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ1 A;  3RZS A;  1ORG A;  2QEH A;  3D77 A;  3L4L A;  3DYE A;  2ERB A;  3BFB A;  3CDN A;  3R72 A;  3BFA A;  3K1E A;  1GM0 A;  3CAB A;  1DQE A;  3D74 A;  4JD9 A;  2WC6 A;  4INX A;  3Q8I A;  2L2C A;  3FE6 A;  2JPO A;  3BFH A;  3PJI A;  3B87 A;  3D73 A;  3S0A A;  2P71 A;  3S0D A;  1QWV A;  1TUJ A;  2H8V A;  2WC5 A;  3V2L A;  3D75 A;  4FQT A;  3B6X A;  3D78 A;  1TWO A;  3S0F A;  3QME A;  3S0E A;  1OOF A;  3NHI A;  2QEV A;  1C3Y A;  3B7A A;  3CZ0 A;  4PT1 A;  2KPH A;  1LS8 A;  3DXL A;  3N7H A;  4INW A;  3OGN A;  3DY9 A;  5EL2 A;  3S0G A;  3NGV A;  2FJY A;  1C3Z A;  2P70 A;  3B86 A;  2WCL A;  3CYZ A;  2WCM A;  1T14 A;  3VB1 A;  2QEB A;  3R1V A;  3R1P A;  2GTE A;  1OOG A;  3R1O A;  3FE9 A;  3DZT A;  1XFR A;  2PQL A;  1P28 A;  1OOI X;  2QDI A;  1OW4 A;  3CZ2 A;  3S0B A;  2QEO A;  3NHT A;  2WCH A;  4OZD A;  1OOH A;  2WCK A;  3B88 A;  4F7F A;  3D76 A;  3FE8 A;  5DIC A;  2WCJ A;  3L47 A;  3BJH A;  3L4A A; 
#chains in the Genus database with same CATH topology
 1DEL A;  1M31 A;  1QX5 B;  2LM5 A;  3VRO A;  1K2H A;  2LVK A;  2JNF A;  5HKZ A;  2ZN8 A;  4C0L A;  4N1F A;  1OMR A;  2LAP A;  2KGB C;  1Y0V H;  2KAX A;  1ORG A;  2L0P A;  3ZNI A;  2L5X B;  1SR6 B;  2JUL A;  2OPO A;  1A4P A;  1W7I B;  1S3P A;  1K90 D;  1CDP A;  1KK7 Z;  3CDN A;  3R72 A;  3PM2 A;  1C07 A;  1BG1 A;  1MQ1 A;  3TUY B;  1BF5 A;  1W7J B;  2BBM A;  3KO0 A;  1GM0 A;  1OZS A;  5CSI A;  3TS5 B;  1KFU S;  1L2O C;  3WHU B;  1KK7 Y;  4DUQ A;  1F4O A;  2BE6 A;  1H8B A;  1M45 A;  1M63 B;  1B7T Z;  2KQY A;  5AEQ A;  1D1O A;  1M46 A;  1V1G A;  1SKT A;  1UP5 A;  5CSN A;  3EG5 B;  3SG5 A;  1SRA A;  1FW4 A;  1WDC C;  3PFV A;  4MN0 A;  3VRP A;  2P6B B;  2ZRS A;  1K9K A;  4MZK A;  5AFP A;  3B87 A;  2M97 A;  4GGF C;  3BYA A;  3OBV A;  4NDB A;  1SL8 A;  1R6P A;  2AAO A;  5CSJ A;  3A4U B;  1G33 A;  1V1F A;  1BR1 B;  1UHN A;  1YUR A;  2BNX A;  2JTZ A;  3OHM B;  3SS5 A;  4GGN A;  2VRG A;  2EC6 B;  2QPT A;  1IGV A;  1MUX A;  4XJK B;  3UO9 A;  2WC5 A;  2LCP A;  1B1G A;  4JPZ B;  1NUB A;  5F6T A;  1U5I A;  3ICB A;  3OX5 A;  4PHN A;  3O4Y A;  3DVE A;  2K7D A;  5ER5 A;  1JSA A;  2E6W A;  2PAS A;  2I94 A;  3EK8 A;  1RK9 A;  4GUK A;  2ISD A;  4HRG A;  4PE0 A;  5AER A;  1OOF A;  1TCO B;  3KHE A;  3NHI A;  2MLE C;  3B7A A;  1CLL A;  1IQ5 A;  1EXR A;  5TNC A;  1NIW A;  3TDZ A;  4PT1 A;  2MJW B;  2KPH A;  1SY9 A;  2K8M B;  3DXL A;  3AAK A;  3N7H A;  1QLK A;  3NSO A;  2H61 C;  4MEW A;  2WCE A;  1GGW A;  2COL B;  3I5F B;  3LK1 A;  4YGD B;  1CM4 A;  3I5H C;  4HRH A;  2KI6 D;  3O78 A;  5HLV A;  2B1U A;  3PN7 C;  1C3Z A;  2P70 A;  3GK4 X;  4YI8 A;  2NZ0 A;  1E8A A;  1CDN A;  1CFP A;  3H4S E;  2E30 A;  1NWD A;  1TNW A;  2F3Z A;  4YBH B;  1NX2 A;  3JTD C;  2QEB A;  3R1V A;  1EL4 A;  2IS9 A;  2ZNE A;  1IWQ A;  4PE4 A;  2MLF C;  2M29 A;  1BU3 A;  1K96 A;  3BOW A;  1XFR A;  4NDC A;  2PSR A;  1QJT A;  1OOI X;  1KQM B;  2GV5 A;  2QDI A;  3EK7 A;  3CZ2 A;  3IQQ A;  4ZCU A;  2K0J A;  1LA3 A;  1NX3 A;  2O5G A;  2QEO A;  4I5K A;  1B8R A;  2ZFD A;  2FCE A;  1NX1 A;  1OOH A;  3A8R A;  2ZN9 A;  2ZKM X;  1MF8 B;  2D8N A;  2KLE A;  3I5G B;  1UUS A;  1SNL A;  2K61 A;  2WCJ A;  2LVJ A;  1YX7 A;  3I5I C;  1UHK A;  3WNX B;  1KK8 B;  2LUC A;  1A75 B;  1S36 A;  2CNP A;  1DC1 A;  1Q80 A;  1H4B A;  3L4A A;  1F4Q A;  1EG3 A;  4D1E A;  1K95 A;  1BT6 A;  2K7O A;  1NP8 A;  4MSP A;  4GAO A;  2MA2 A;  2HPS A;  1K93 D;  1CFD A;  1UUR A;  2KI4 B;  1DF0 B;  2LVI A;  1Y1A A;  2QEH A;  1QLS A;  2NLN A;  1SMG A;  3D10 A;  3HX4 A;  1FPW A;  1NCX A;  3DVK A;  3BFB A;  2DOQ A;  2M9G A;  1A03 A;  3BFA A;  2K2A A;  2LLT A;  1UWO A;  2JNX A;  4PAL A;  2KI6 C;  1M39 A;  1SR6 C;  1CNP A;  1Y1U A;  4UPG A;  1UHH A;  1W9Z A;  4JD9 A;  1WY9 A;  2KBM A;  2WC6 A;  4P2Y B;  1XFX O;  1AJ5 A;  3TUY C;  1J1D A;  1J7O A;  4INX A;  4CID A;  1KQV A;  2AMI A;  3TS5 C;  2YGU A;  1CFC A;  2LNK A;  2G9B A;  1NYA A;  2M1U A;  1LKJ A;  2WND A;  3RM1 A;  1QIW A;  3NXA A;  3AKA A;  3DF0 A;  1ZOT B;  2BAP A;  2F33 A;  4DRW A;  2KNE A;  3PJI A;  1AVS A;  1Y1X A;  3FS7 A;  2P71 A;  3BUO B;  1PVA A;  1F70 A;  1F54 A;  1QXP A;  1HQV A;  3K21 A;  4MLW A;  2H8V A;  1ALV A;  1DJI A;  2M1K B;  3NSL A;  1AJ4 A;  4CFQ A;  3QRX A;  1JF2 A;  1KWO B;  1CKK A;  2WOR A;  2LP2 A;  4P5O E;  3VRR A;  3GK2 A;  2JT0 A;  4A4C A;  3B6X A;  2Y4Q A;  1K9P A;  1EH2 A;  5KSZ A;  3D78 A;  2EC6 C;  5FI2 A;  1GGZ A;  1QS7 A;  1RRO A;  2KFF A;  1DJZ A;  3CZT X;  4GGF A;  4ORA B;  4QJ3 B;  5I2L A;  2WC8 A;  2JZI A;  2QEV A;  1CDL A;  5I8N A;  1SPY A;  2GGM A;  1JBA A;  2LLU A;  1CMG A;  1GQM A;  4USL A;  2I18 A;  1YX8 A;  2FCD A;  3OGN A;  4OR9 B;  3DY9 A;  1S6I A;  4WQ3 A;  3SJS A;  2L5Y A;  3S0G A;  3CGA A;  4A4B A;  1WRK A;  4I5N B;  5G08 A;  4N5X A;  4ZCV A;  4U8D A;  3KF9 A;  3CYZ A;  2M3W A;  3LLE A;  4GFT A;  3I5F C;  4GBA A;  2WCM A;  1T14 A;  1DJG A;  1AK8 A;  1IJ6 A;  2CBL A;  3VB1 A;  2M7N A;  2LLS A;  3JVT B;  2F3Y A;  3CLN A;  5JOL A;  3TDU A;  5DKR A;  3OB2 B;  1OOG A;  4OV2 A;  1PRW A;  3R1O A;  2PYQ A;  2JXC A;  1LA0 A;  2H61 A;  5DKN A;  5GQQ C;  1P28 A;  3VRQ A;  2ZND A;  1HT9 A;  2NCO A;  2OS8 B;  3S0B A;  1OW4 A;  1K9U A;  2JQ6 A;  3EVR A;  3EKH A;  1XFZ O;  4NDD A;  2LVV A;  4CLN A;  5KTY A;  1J7P A;  1JUO A;  1Z2C B;  2I7A A;  1ZFS A;  2WCH A;  4AQI A;  2HQW A;  2H2K A;  2WCK A;  3B88 A;  1KQM C;  4F7F A;  3FE8 A;  4JWQ A;  1R2U A;  1Z4H A;  2PMY A;  1N65 A;  2SAS A;  2LE9 B;  4ORB B;  5DIC A;  4AQJ A;  4C0J A;  2LHL A;  3BJH A;  1IIO A;  2M49 B;  3CS1 A;  3EVV A;  2BKH B;  3LL8 B;  2O60 A;  1TIZ A;  5HKY A;  4YGC B;  1QAT A;  1QVI Z;  2JT3 A;  4KYN A;  1JC2 A;  3CR2 A;  2GGZ A;  3I5G C;  4ICB A;  1FF1 A;  1OMD A;  1EG4 A;  3CZ1 A;  3RZS A;  1LVC D;  2KAY A;  3SS3 A;  1J7R A;  1KK8 C;  2LV7 A;  3TDI A;  3GK1 A;  1NX0 A;  3SIB A;  3CR4 X;  4FTG A;  1QVI Y;  1AP4 A;  1WLM A;  2F2O A;  2WCB A;  2BL0 B;  3L4L A;  1CB1 A;  5DKQ A;  4M2O A;  4MRY A;  2R2I A;  3O2P A;  1DQE A;  2KYC A;  2K2F A;  2KI4 C;  5D7F A;  1MWN A;  3PAT A;  3ZWH A;  1U5I B;  1QTX A;  1WRZ A;  1IQ3 A;  1PUL A;  2AUC A;  1MXL C;  1QAS A;  1IKU A;  1QX2 A;  3BQ3 A;  1MHO A;  2SCP A;  1F71 A;  2G2B A;  3GOF A;  2Y5I A;  1BOC A;  2HET A;  5I2O A;  2EGD A;  1SW8 A;  1RWY A;  3Q8I A;  3EKJ A;  2L2C A;  1S26 D;  2JWW A;  3FE6 A;  1LXF C;  4HSZ A;  4N1G A;  2LC5 A;  3LCP C;  3TZ1 A;  4AOM A;  2JXL A;  1RJV A;  2L98 A;  4IL1 A;  5CPV A;  2K7B A;  2QAC A;  1CMF A;  3NSK A;  2LAN A;  2BEC A;  1JF0 A;  1N0Y A;  3OX6 A;  3D73 A;  1YVH A;  2KHN A;  4HRE E;  1PVB A;  5D69 A;  1DVI A;  2JRF A;  3BUW B;  2I2R E;  2M8U A;  3O4X A;  2K60 A;  3SG2 A;  3UNW A;  3PSR A;  4F0Z B;  5HLO A;  4DIR A;  3PM8 A;  1IRJ A;  1QIV A;  3C1V A;  1F55 A;  1F8H A;  2BCA A;  4PCW A;  5B8I B;  2KYF A;  3FIA A;  2F8P A;  2KFG A;  4FQT A;  1KFU L;  3LK0 A;  2KQ6 A;  1PSR A;  1TUZ A;  2BE4 A;  2CCM A;  1C7W A;  2LHI A;  1TWO A;  3S0F A;  3M0W A;  4GPL B;  1DGU A;  3D0Y A;  1SBJ A;  1J1E A;  4BY5 A;  2RGI A;  1S6J A;  2PVB A;  3BOW B;  1S1E A;  1OE9 B;  4ETO A;  3CZ0 A;  2NXQ A;  2OTG B;  2JOJ A;  1DGV A;  4CFR A;  1LS8 A;  3F45 A;  5CSF A;  1LIN A;  1DJX A;  1OQP A;  1OOJ A;  1KFX L;  2LMV A;  4INW A;  1B4C A;  1CM1 A;  2MAZ A;  3CR5 X;  4JQ0 D;  1PSB A;  2L51 A;  4DCK A;  2BCB A;  3BUN B;  2L2E A;  1BJF A;  1ODB A;  2FJY A;  2M0R A;  1SL9 A;  4GNK B;  2MBX A;  4IJ7 A;  4XJK A;  1SCM B;  5D3O A;  1TCF A;  3PLF B;  3HCM A;  1YUU A;  1OZO A;  2LP3 A;  4PHJ A;  4YGE B;  2FOT A;  2FJU B;  2TN4 A;  4TNC A;  3SG4 A;  1AUI B;  3R1P A;  1TOP A;  3IQO A;  4WQ2 A;  2GTE A;  3IF7 A;  1XK4 C;  1IH0 A;  1PK0 D;  1VRK A;  4MZJ A;  4PE7 A;  5K89 A;  3DZT A;  4Q04 A;  2CT9 A;  2HF5 A;  5HL1 A;  3WHT B;  2KOT A;  1XFY O;  5PAL A;  3JVT C;  2BBN A;  1B8L A;  1YRU B;  3NHT A;  4MVF A;  4YGA A;  1BOD A;  2JTT A;  1TNX A;  2JPT A;  2PRU A;  1SK6 D;  2WCF A;  1K94 A;  1QX7 A;  3SS4 A;  4ORC B;  5KU1 A;  2OS8 C;  3D76 A;  4OVN F;  2LMT A;  1CTR A;  1A2X A;  4PE1 A;  2BKI B;  1X02 A;  1DJH A;  4I5L B;  3DVM A;  3L47 A;  3O6B A;  4QJ4 B;  1XO5 A;  3D0Y B;  3SIA A;  3SG3 A;  1SCV A;  5AXI A;  1MXE A;  2A4J A;  3AAJ A;  4FQO A;  2JU0 A;  1YR5 A;  2EHB A;  4MBE A;  1KCY A;  3DF0 B;  4QJ5 B;  1B7T Y;  1CLB A;  1NCY A;  3RLZ A;  1CDM A;  1KFX S;  3OP0 A;  1XFU O;  1MR8 A;  4NQG A;  3FWC A;  3D77 A;  1L2O B;  3DYE A;  3DVJ A;  2Q91 A;  2ERB A;  1K8U A;  2HQ8 A;  2PAL A;  4M2Q A;  3MSE B;  1XFV O;  1YRT B;  3K1E A;  2BCX A;  3SG6 A;  1TRF A;  3CAB A;  2CXJ A;  1DMO A;  1ALW A;  5BPJ A;  1N2D A;  1NPQ A;  5HYD A;  2BL0 C;  3D74 A;  5IBW A;  4E68 A;  1REC A;  1JFJ A;  1S6C A;  2LUX A;  2Y1N A;  4DS7 A;  5J3X A;  1PAL A;  1A29 A;  1WDC B;  5HKW A;  1A75 A;  2KAV A;  1OSA A;  1EJ3 A;  5I94 A;  2CTN A;  5FI6 A;  2JT8 A;  1DJY A;  5I2Q A;  2JPO A;  1ZAC A;  2KFH A;  3AKB A;  3BFH A;  4WRI A;  5AAN A;  2KLD A;  4YGB B;  1FI5 A;  2ZRT A;  3E3R A;  1DF0 A;  3IVT A;  5ER4 X;  1IG5 A;  2L50 A;  1KSO A;  5FI7 A;  3S0A A;  4PHM A;  1XVJ A;  2JC2 A;  1G8I A;  1YUT A;  3S0D A;  1QV1 A;  2NCP A;  1QWV A;  1UHI A;  1TUJ A;  1JWD A;  1DEK A;  1OMV A;  3KPX A;  4L9M A;  3V2L A;  1TTX A;  1KSM A;  2Q4U A;  3D75 A;  1XA5 A;  1J7Q A;  3EVU A;  4MZL A;  1Y6W A;  1B9A A;  3SG7 A;  1ZMZ A;  4XYN A;  2V53 A;  1SSE B;  3QME A;  1L7Z A;  1B8C A;  3NSI A;  3S0E A;  1AHR A;  1RFJ A;  2Y1M A;  3CWG A;  1C3Y A;  1YVL A;  1BR4 B;  1TN4 A;  1TNQ A;  3I5H B;  2LMU A;  2KBI A;  3FWB A;  3PN7 B;  1SL7 A;  4YRU A;  1WRL A;  1XYD A;  5FYX A;  4M2P A;  4YI9 A;  1BLQ A;  1SYM A;  1B47 A;  1NSH A;  4R1E A;  2L4H A;  5EL2 A;  1TNP A;  3DD4 A;  3JTD B;  1J55 A;  3NGV A;  2OTG C;  4I5J A;  3B86 A;  2WCL A;  3KEV A;  1NCZ A;  3BUM B;  3CTN A;  2KGR A;  4CPV A;  4PHK A;  4BY4 A;  4MRX A;  1S5G Z;  1IJ5 A;  1RTP 1;  3OB1 B;  1ZUZ A;  2KSP A;  4OKH A;  2KDH A;  1G4Y R;  1SCM C;  1UHJ A;  1KWO C;  1FI6 A;  2K7C A;  3FE9 A;  3WXA A;  3EK4 A;  1YUS A;  1S5G Y;  2PQL A;  1DJW A;  3VRN A;  4OCI A;  1WLZ A;  3I5I B;  2M7L A;  5JJG A;  2L4I A;  1GJY A;  2F2P A;  4JKT A;  4OZD A;  1DTL A;  2WOS A;  4PDZ A;  1JFK A;  1FBV A;  1DT7 B;  3VGO A;  1CFF A;  2MRD A;  1XFW O;  1CLM A;  3BUX B;  1YTZ C;  1C7V A;  1BMO A;  1QV0 A;  4C0K A;  3PAL A;  1XK4 A;  3BXK A;  2MHH A; 
#chains in the Genus database with same CATH homology
 3CZ1 A;  3RZS A;  1ORG A;  2QEH A;  3D77 A;  3L4L A;  3DYE A;  2ERB A;  3BFB A;  3CDN A;  3R72 A;  3BFA A;  3K1E A;  1GM0 A;  3CAB A;  1DQE A;  3D74 A;  4JD9 A;  2WC6 A;  4INX A;  3Q8I A;  2L2C A;  3FE6 A;  2JPO A;  3BFH A;  3PJI A;  3B87 A;  3D73 A;  3S0A A;  2P71 A;  3S0D A;  1QWV A;  1TUJ A;  2H8V A;  2WC5 A;  3V2L A;  3D75 A;  4FQT A;  3B6X A;  3D78 A;  1TWO A;  3S0F A;  3QME A;  3S0E A;  1OOF A;  3NHI A;  2QEV A;  1C3Y A;  3B7A A;  3CZ0 A;  4PT1 A;  2KPH A;  1LS8 A;  3DXL A;  3N7H A;  4INW A;  3OGN A;  3DY9 A;  5EL2 A;  3S0G A;  3NGV A;  2FJY A;  1C3Z A;  2P70 A;  3B86 A;  2WCL A;  3CYZ A;  2WCM A;  1T14 A;  3VB1 A;  2QEB A;  3R1V A;  3R1P A;  2GTE A;  1OOG A;  3R1O A;  3FE9 A;  3DZT A;  1XFR A;  2PQL A;  1P28 A;  1OOI X;  2QDI A;  1OW4 A;  3CZ2 A;  3S0B A;  2QEO A;  3NHT A;  2WCH A;  4OZD A;  1OOH A;  2WCK A;  3B88 A;  4F7F A;  3D76 A;  3FE8 A;  5DIC A;  2WCJ A;  3L47 A;  3BJH A;  3L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...