3VB1A

Crystal structure of anopholes gambiae odorant binding protein 20 in open state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
119
Chain Sequence
MTVEQMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGAP005208-PA
publication title A novel mechanism of ligand binding and release in the odorant binding protein 20 from the malaria mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 41
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3vb1A00
2GTEA 3L4AA 3V2LA 2WCMA 2H8VA 3BFBA 3DYEA 2PQLA 3S0BA 3R1VA 3B7AA 2WC6A 3R1OA 2QEHA 3D74A 3N7HA 1QWVA 3D77A 4PT1A 3S0FA 2WCLA 3NHIA 2QDIA 3K1EA 1XFRA 3VB1A 3Q8IA 1GM0A 3QMEA 2WCHA 4JD9A 3BJHA 5EL2A 2L2CA 1DQEA 3R72A 4INXA 3D76A 3FE8A 3CDNA 3NGVA 4INWA 3CZ0A 2WC5A 3S0AA 3B86A 4OZDA 3B87A 2QEVA 3L47A 2QEOA 4F7FA 2P71A 2FJYA 2JPOA 4FQTA 3PJIA 3RZSA 2WCKA 3S0DA 3CZ2A 3CZ1A 3FE9A 2ERBA 1OOGA 2QEBA 1LS8A 3CABA 3D75A 1OOFA 2P70A 1OW4A 3B88A 1OOIX 3BFHA 3BFAA 1C3ZA 1ORGA 2KPHA 5DICA 1TWOA 3DXLA 1C3YA 3R1PA 3DY9A 1P28A 1T14A 3NHTA 3FE6A 3CYZA 3DZTA 1TUJA 3OGNA 3S0GA 3S0EA 2WCJA 1OOHA 3B6XA 3D78A 3L4LA 3D73A
chains in the Genus database with same CATH superfamily
3L4AA 4JQ0D 1K95A 1UP5A 1KWOB 1J7RA 1QXPA 1IKUA 4MRXA 1IH0A 2F33A 3ZWHA 2Y1MA 5I2QA 3A4UB 3O78A 1TNQA 2WC6A 1MXLC 3D74A 4CFQA 2KYFA 1XK4C 3N7HA 3OX6A 4R1EA 1M39A 2HPSA 1S26D 2LC5A 2I2RE 2LMTA 2OPOA 1C07A 1FPWA 1CFPA 1DF0A 3H4SE 3BOWB 1L2OC 3IQQA 2KFFA 3AAJA 2LVIA 2KSPA 3AAKA 1YX7A 4XYNA 4GGNA 3D10A 4I5JA 1RK9A 4NDCA 1WLMA 4HRHA 4JD9A 1QS7A 3BJHA 3CS1A 2M97A 5IBWA 1DQEA 3AKAA 1S5GZ 1TCFA 2COLB 1BOCA 4IL1A 2E6WA 2WOSA 5DKRA 3WNXB 5D3OA 2M7NA 1KCYA 4MN0A 1H4BA 2HETA 2LANA 3HCMA 2LLSA 1S1EA 2EGDA 1B8LA 2BE6A 2H61C 2JTTA 3OHMB 3BUXB 1KSMA 1PRWA 1CLMA 1QIVA 2LUCA 2ZNEA 5ER4X 1AVSA 1NCZA 3B87A 3L47A 2QEOA 2I7AA 2M49B 2P71A 4IJ7A 1MF8B 1VRKA 1QX2A 4PALA 2MJWB 4PDZA 5HLVA 3SS4A 1CKKA 5BPJA 3O4YA 1IJ5A 2JOJA 2JTZA 2A4JA 2LP2A 4YGDB 1JF0A 2WORA 3LK1A 4OV2A 1IQ3A 3S0DA 2NCPA 3CZ1A 4QJ5B 2FCEA 1EL4A 2ERBA 2PMYA 3CABA 1LS8A 2ZN9A 3D75A 1SRAA 1N2DA 3NXAA 3SJSA 1A75A 1Y1AA 3KPXA 2QACA 5G08A 1YX8A 1TRFA 5B8IB 2DOQA 1GGWA 1RFJA 4PCWA 3BFHA 3SG6A 3BFAA 3PM8A 4AQJA 2KI6C 3EKHA 1KWOC 4YRUA 2K61A 3LK0A 2GGZA 2E30A 2F2PA 2PASA 1SY9A 2L5YA 1RWYA 2L51A 3KHEA 3VRQA 1SBJA 3FWBA 1MR8A 1R6PA 1TWOA 1Y0VH 2KYCA 3CR5X 5JOLA 2BL0B 1Y1XA 2AMIA 1U5IB 2EC6B 2ZN8A 1OMVA 1W9ZA 2LVVA 3R1PA 1C3YA 2I18A 2PSRA 1P28A 4GPLB 2K7CA 3FE6A 1KQMB 1TUJA 1Y6WA 1DJGA 2NZ0A 3PLFB 1AK8A 4DUQA 1F8HA 1LA3A 1C7WA 2R2IA 2WNDA 1SCMB 4QJ4B 4WQ2A 2O5GA 3I5IB 1OMRA 1K8UA 1GGZA 1OOHA 1RECA 1YUTA 1TIZA 3UNWA 3OX5A 3PN7B 4A4BA 2K8MB 2BNXA 3TDZA 1QJTA 1DJHA 4WQ3A 2WCMA 4PE4A 1Y1UA 2FOTA 2LMUA 3SIAA 3TDUA 4JPZB 1CM1A 1JF2A 2LHLA 1JWDA 3DVMA 1WLZA 1B7TZ 2BE4A 1LA0A 4ORBB 1C7VA 1EH2A 3BUWB 2QEHA 2P6BB 2LV7A 3OBVA 2Y1NA 1QX7A 1UHHA 2LMVA 4I5KA 4N1GA 4PHJA 5FI7A 3S0FA 1ZMZA 1U5IA 2LCPA 1IGVA 3NHIA 3TUYB 2QDIA 1SCVA 1XFZO 1JFKA 3QRXA 2KGRA 1TTXA 1NIWA 3VROA 3WXAA 1GM0A 1CLLA 4GGFC 4UPGA 3QMEA 1H8BA 2SCPA 1LKJA 4DCKA 2LLTA 1BODA 3GK2A 1J7PA 3CR2A 1JC2A 1S6CA 4MZKA 1AJ5A 2L2CA 3TZ1A 1EG3A 4CPVA 2LAPA 1SNLA 3D76A 3DVJA 3FE8A 4DIRA 2Q4UA 3IVTA 2GGMA 3NGVA 4INWA 3ICBA 1A29A 1GJYA 1YVLA 3CZ0A 3O2PA 1HQVA 1QX5B 1X02A 2NLNA 3S0AA 2KLDA 1QLKA 5CPVA 1JFJA 2LLUA 2M1KB 1EG4A 3B86A 3EVUA 4ORCB 2QEVA 4BY4A 4F7FA 2BL0C 1AUIB 1YURA 2EC6C 2L5XB 1KK7Z 3OP0A 1SR6B 1UHNA 1A75B 4FQTA 3KEVA 2JNFA 1WY9A 1ZUZA 3E3RA 4MLWA 1IQ5A 4MZJA 1L7ZA 3PJIA 4N5XA 4DS7A 2LVKA 4Q04A 4USLA 4OCIA 1Z2CB 1KQMC 2PVBA 3SG2A 2ZFDA 3WHUB 1A2XA 2JRFA 1OOGA 5HYDA 1ALVA 3DVKA 1FI6A 1WDCB 5HL1A 5AERA 1SCMC 3UO9A 3I5IC 2B1UA 1QTXA 2BKIB 3SG4A 3PN7C 1TUZA 4WRIA 1PSRA 1BLQA 4CIDA 1QV1A 1DEKA 2WCEA 2JT8A 3BUNB 1F55A 1BT6A 1WRKA 1DJZA 4MSPA 4PE7A 1PK0D 3RM1A 5CSIA 1F70A 1CM4A 2KPHA 1K9PA 3JVTB 1CB1A 1E8AA 1NWDA 2JNXA 2L2EA 4M2QA 2KAVA 2TN4A 1G4YR 1ZACA 4PE1A 3FS7A 1LINA 5J3XA 2BBNA 3DY9A 3TDIA 2AUCA 4MEWA 4CFRA 3F45A 3EVRA 3TUYC 1V1FA 2M7LA 2BBMA 1V1GA 3O6BA 2SASA 2KHNA 4P5OE 5AFPA 2JC2A 3CYZA 3DZTA 3OGNA 4MZLA 1MUXA 1B1GA 5HLOA 3S0GA 1UWOA 1F71A 5AEQA 3S0EA 1QASA 1OZSA 1QIWA 5PALA 3SG3A 2CT9A 1SL7A 1XFUO 2F3YA 2L50A 2KNEA 1CFFA 2JQ6A 2WCJA 1QV0A 2ZRSA 4GAOA 3B6XA 2M1UA 1OZOA 2KI4B 3FIAA 3EKJA 1TNPA 2GTEA 2KI6D 3V2LA 1SW8A 1YR5A 3BFBA 1NCYA 2Y5IA 2VRGA 3GK4X 4PHMA 1DGVA 1JUOA 1RTP1 3S0BA 4OVNF 4C0LA 1A4PA 1SPYA 1ZOTB 5DKNA 1CDNA 3R1VA 4OKHA 2KBMA 4DRWA 4CLNA 1M31A 1SR6C 3R1OA 2ZRTA 2JWWA 3A8RA 4AQIA 1K9UA 1QWVA 3D77A 3NSIA 1LVCD 2LM5A 4C0KA 5KU1A 3I5HB 4PT1A 1FI5A 3AKBA 1ZFSA 2M0RA 4XJKA 2LP3A 3PATA 3K1EA 5K89A 2I94A 1XFRA 5AANA 5ER5A 1DT7B 1B4CA 1MXEA 2HQ8A 4GFTA 1WDCC 2WCHA 2LHIA 1YRUB 1XFXO 2QPTA 4HSZA 1S36A 1F4OA 5EL2A 1OSAA 3NSKA 3R72A 4INXA 2OS8B 4YGAA 1G33A 1UHKA 4M2OA 1DC1A 1A03A 2BCAA 1BG1A 2CCMA 3VRRA 1PALA 1UURA 4N1FA 4D1EA 2GV5A 5CSJA 4ETOA 1BR1B 4YGCB 2K60A 3SS5A 1YTZC 2RGIA 1KFXS 3BYAA 3JVTC 1CFCA 1XVJA 3PSRA 3TS5B 1KK8B 2K7DA 1CDPA 1G8IA 2F3ZA 3EK4A 1S5GY 2H2KA 2FJYA 2G9BA 2JPOA 1W7IB 1EXRA 4YI9A 5FI2A 4F0ZB 1JBAA 1DMOA 3RZSA 1KFXL 1MQ1A 1OQPA 4U8DA 3DVEA 1DTLA 1YUSA 1OE9B 1TOPA 1J1EA 3D0YA 2MLEC 4YI8A 1AP4A 1SL8A 3FE9A 1UUSA 2O60A 2JXCA 2V53A 1XK4A 1BMOA 1NP8A 2JULA 3PFVA 4YGEB 1KSOA 2KFGA 1OOFA 1JSAA 2KQ6A 2IS9A 2L0PA 1NX1A 2P70A 1M45A 1SKTA 5KTYA 2L4HA 1DVIA 1OW4A 2KI4C 3C1VA 3K21A 1WRZA 1XFYO 1OOIX 3M0WA 4JKTA 4MBEA 3VRPA 1K93D 1C3ZA 2PALA 2LUXA 2JU0A 2K0JA 3CZTX 3CLNA 1K2HA 1NX3A 1ORGA 2KFHA 4YGBB 1PSBA 2MAZA 1M63B 4NDDA 5D7FA 1BR4B 1XFWO 3EK7A 4PHNA 1DJXA 3DF0B 5HKYA 1BU3A 1K90D 4MRYA 1IG5A 4M2PA 2KDHA 2FCDA 1KFUL 5HKWA 5CSFA 3I5HC 3VGOA 3I5GB 3CGAA 4OR9B 3BQ3A 1K94A 2H61A 1OOJA 3I5FB 2K2AA 2KAXA 2BCXA 1ALWA 2NXQA 5TNCA 5I8NA 1CMGA 3CR4X 3OB2B 5D69A 1OMDA 1TN4A 2L98A 1YVHA 4FQOA 2OS8C 3SIBA 2WC8A 4NDBA 2BKHB 1YRTB 4GNKB 2PRUA 4BY5A 2ZKMX 2Q91A 4P2YB 2JZIA 3LCPC 4I5NB 4HREE 1Q80A 5DKQA 1QLSA 1K96A 3L4LA 2NCOA 3SS3A 1F54A 4ZCUA 2LNKA 2LE9B 3EG5B 1SSEB 2BCBA 1QVIY 2EHBA 2H8VA 4MVFA 2MBXA 1FW4A 3DYEA 2PQLA 1J55A 4XJKB 4C0JA 2YGUA 4TNCA 4GBAA 3TS5C 1KK8C 2MRDA 3B7AA 1IRJA 1XFVO 2F2OA 1RROA 2WCFA 1CDMA 4A4CA 2M8UA 3DF0A 2MA2A 1IJ6A 5I2LA 1NSHA 1UHIA 2OTGB 2JXLA 3NSOA 2K7OA 2BAPA 2M9GA 2WCLA 2MHHA 2G2BA 1AHRA 1S6IA 3MSEB 4GUKA 1MHOA 2JPTA 5I2OA 1S6JA 1NX0A 3VB1A 3JTDB 3Q8IA 3PALA 1SYMA 1IWQA 2M3WA 3WHTB 1DELA 1B7TY 2CXJA 2KBIA 3GK1A 2HQWA 2M29A 1KQVA 2D8NA 5CSNA 1TNWA 1NX2A 4NQGA 1M46A 1XYDA 3BOWA 2F8PA 4ZCVA 1XO5A 3CDNA 1CMFA 1BJFA 2CTNA 3VRNA 1B47A 1NYAA 2BECA 2MLFC 3SG7A 2WC5A 3O4XA 1IIOA 2LVJA 1LXFC 1FF1A 4ORAB 4OZDA 1MWNA 2WCBA 1QATA 3D0YB 1DJIA 3PM2A 2CNPA 3IQOA 4FTGA 1B9AA 4PE0A 3SG5A 1BF5A 2Y4QA 2ISDA 3ZNIA 1FBVA 3I5GC 1WRLA 1CTRA 5JJGA 4L9MA 3DD4A 3I5FC 2WCKA 5I94A 1CDLA 1F4QA 3CZ2A 1RJVA 1L2OB 2QEBA 5HKZA 5KSZA 2KQYA 1NUBA 2K7BA 5FI6A 1PVBA 2PYQA 2JT3A 3BUMB 1R2UA 1DJWA 1TCOB 4E68A 1QVIZ 1KK7Y 4KYNA 3NSLA 2FJUB 1HT9A 1J7OA 3HX4A 1DGUA 1EJ3A 1ODBA 3B88A 3GOFA 1AJ4A 3LL8B 2AAOA 3BXKA 4I5LB 5AXIA 1B8CA 4AOMA 1TNXA 3IF7A 3KF9A 4GGFA 1SMGA 5F6TA 3OB1B 1NPQA 2KOTA 1PVAA 1UHJA 1SL9A 5DICA 5GQQC 1S3PA 1J1DA 1NCXA 4JWQA 3DXLA 1DF0B 3CWGA 1GQMA 2OTGC 1N65A 4HRGA 1SK6D 1T14A 3NHTA 1CNPA 1J7QA 2CBLA 1PULA 3JTDC 2HF5A 1Z4HA 1CLBA 1DJYA 2KGBC 1B8RA 2KLEA 2L4IA 1KFUS 1K9KA 2K2FA 2ZNDA 4ICBA 4PHKA 4QJ3B 1XA5A 1W7JB 3LLEA 3EK8A 1D1OA 4YBHB 3EVVA 1YUUA 1N0YA 1CFDA 3BUOB 3CTNA 5FYXA 2JT0A 3RLZA 2KAYA 3D78A 3FWCA 3D73A 3KO0A
chains in the Genus database with same CATH topology
2GTEA 3L4AA 3V2LA 2WCMA 2H8VA 3BFBA 3DYEA 2PQLA 3S0BA 3R1VA 3B7AA 2WC6A 3R1OA 2QEHA 3D74A 3N7HA 1QWVA 3D77A 4PT1A 3S0FA 2WCLA 3NHIA 2QDIA 3K1EA 1XFRA 3VB1A 3Q8IA 1GM0A 3QMEA 2WCHA 4JD9A 3BJHA 5EL2A 2L2CA 1DQEA 3R72A 4INXA 3D76A 3FE8A 3CDNA 3NGVA 4INWA 3CZ0A 2WC5A 3S0AA 3B86A 4OZDA 3B87A 2QEVA 3L47A 2QEOA 4F7FA 2P71A 2FJYA 2JPOA 4FQTA 3PJIA 3RZSA 2WCKA 3S0DA 3CZ2A 3CZ1A 3FE9A 2ERBA 1OOGA 2QEBA 1LS8A 3CABA 3D75A 1OOFA 2P70A 1OW4A 3B88A 1OOIX 3BFHA 3BFAA 1C3ZA 1ORGA 2KPHA 5DICA 1TWOA 3DXLA 1C3YA 3R1PA 3DY9A 1P28A 1T14A 3NHTA 3FE6A 3CYZA 3DZTA 1TUJA 3OGNA 3S0GA 3S0EA 2WCJA 1OOHA 3B6XA 3D78A 3L4LA 3D73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  3L4A A;  3V2L A;  2WCM A;  2H8V A;  3BFB A;  3DYE A;  2PQL A;  3S0B A;  3R1V A;  3B7A A;  2WC6 A;  3R1O A;  2QEH A;  3D74 A;  3N7H A;  1QWV A;  3D77 A;  4PT1 A;  3S0F A;  2WCL A;  3NHI A;  2QDI A;  3K1E A;  1XFR A;  3VB1 A;  3Q8I A;  1GM0 A;  3QME A;  2WCH A;  4JD9 A;  3BJH A;  5EL2 A;  2L2C A;  1DQE A;  3R72 A;  4INX A;  3D76 A;  3FE8 A;  3CDN A;  3NGV A;  4INW A;  3CZ0 A;  2WC5 A;  3S0A A;  3B86 A;  4OZD A;  3B87 A;  2QEV A;  3L47 A;  2QEO A;  4F7F A;  2P71 A;  2FJY A;  2JPO A;  4FQT A;  3PJI A;  3RZS A;  2WCK A;  3S0D A;  3CZ2 A;  3CZ1 A;  3FE9 A;  2ERB A;  1OOG A;  2QEB A;  1LS8 A;  3CAB A;  3D75 A;  1OOF A;  2P70 A;  1OW4 A;  3B88 A;  1OOI X;  3BFH A;  3BFA A;  1C3Z A;  1ORG A;  2KPH A;  5DIC A;  1TWO A;  3DXL A;  1C3Y A;  3R1P A;  3DY9 A;  1P28 A;  1T14 A;  3NHT A;  3FE6 A;  3CYZ A;  3DZT A;  1TUJ A;  3OGN A;  3S0G A;  3S0E A;  2WCJ A;  1OOH A;  3B6X A;  3D78 A;  3L4L A;  3D73 A; 
#chains in the Genus database with same CATH topology
 3L4A A;  4JQ0 D;  1K95 A;  1UP5 A;  1KWO B;  1J7R A;  1QXP A;  1IKU A;  4MRX A;  1IH0 A;  2F33 A;  3ZWH A;  2Y1M A;  5I2Q A;  3A4U B;  3O78 A;  1TNQ A;  2WC6 A;  1MXL C;  3D74 A;  4CFQ A;  2KYF A;  1XK4 C;  3N7H A;  3OX6 A;  4R1E A;  1M39 A;  2HPS A;  1S26 D;  2LC5 A;  2I2R E;  2LMT A;  2OPO A;  1C07 A;  1FPW A;  1CFP A;  1DF0 A;  3H4S E;  3BOW B;  1L2O C;  3IQQ A;  2KFF A;  3AAJ A;  2LVI A;  2KSP A;  3AAK A;  1YX7 A;  4XYN A;  4GGN A;  3D10 A;  4I5J A;  1RK9 A;  4NDC A;  1WLM A;  4HRH A;  4JD9 A;  1QS7 A;  3BJH A;  3CS1 A;  2M97 A;  5IBW A;  1DQE A;  3AKA A;  1S5G Z;  1TCF A;  2COL B;  1BOC A;  4IL1 A;  2E6W A;  2WOS A;  5DKR A;  3WNX B;  5D3O A;  2M7N A;  1KCY A;  4MN0 A;  1H4B A;  2HET A;  2LAN A;  3HCM A;  2LLS A;  1S1E A;  2EGD A;  1B8L A;  2BE6 A;  2H61 C;  2JTT A;  3OHM B;  3BUX B;  1KSM A;  1PRW A;  1CLM A;  1QIV A;  2LUC A;  2ZNE A;  5ER4 X;  1AVS A;  1NCZ A;  3B87 A;  3L47 A;  2QEO A;  2I7A A;  2M49 B;  2P71 A;  4IJ7 A;  1MF8 B;  1VRK A;  1QX2 A;  4PAL A;  2MJW B;  4PDZ A;  5HLV A;  3SS4 A;  1CKK A;  5BPJ A;  3O4Y A;  1IJ5 A;  2JOJ A;  2JTZ A;  2A4J A;  2LP2 A;  4YGD B;  1JF0 A;  2WOR A;  3LK1 A;  4OV2 A;  1IQ3 A;  3S0D A;  2NCP A;  3CZ1 A;  4QJ5 B;  2FCE A;  1EL4 A;  2ERB A;  2PMY A;  3CAB A;  1LS8 A;  2ZN9 A;  3D75 A;  1SRA A;  1N2D A;  3NXA A;  3SJS A;  1A75 A;  1Y1A A;  3KPX A;  2QAC A;  5G08 A;  1YX8 A;  1TRF A;  5B8I B;  2DOQ A;  1GGW A;  1RFJ A;  4PCW A;  3BFH A;  3SG6 A;  3BFA A;  3PM8 A;  4AQJ A;  2KI6 C;  3EKH A;  1KWO C;  4YRU A;  2K61 A;  3LK0 A;  2GGZ A;  2E30 A;  2F2P A;  2PAS A;  1SY9 A;  2L5Y A;  1RWY A;  2L51 A;  3KHE A;  3VRQ A;  1SBJ A;  3FWB A;  1MR8 A;  1R6P A;  1TWO A;  1Y0V H;  2KYC A;  3CR5 X;  5JOL A;  2BL0 B;  1Y1X A;  2AMI A;  1U5I B;  2EC6 B;  2ZN8 A;  1OMV A;  1W9Z A;  2LVV A;  3R1P A;  1C3Y A;  2I18 A;  2PSR A;  1P28 A;  4GPL B;  2K7C A;  3FE6 A;  1KQM B;  1TUJ A;  1Y6W A;  1DJG A;  2NZ0 A;  3PLF B;  1AK8 A;  4DUQ A;  1F8H A;  1LA3 A;  1C7W A;  2R2I A;  2WND A;  1SCM B;  4QJ4 B;  4WQ2 A;  2O5G A;  3I5I B;  1OMR A;  1K8U A;  1GGZ A;  1OOH A;  1REC A;  1YUT A;  1TIZ A;  3UNW A;  3OX5 A;  3PN7 B;  4A4B A;  2K8M B;  2BNX A;  3TDZ A;  1QJT A;  1DJH A;  4WQ3 A;  2WCM A;  4PE4 A;  1Y1U A;  2FOT A;  2LMU A;  3SIA A;  3TDU A;  4JPZ B;  1CM1 A;  1JF2 A;  2LHL A;  1JWD A;  3DVM A;  1WLZ A;  1B7T Z;  2BE4 A;  1LA0 A;  4ORB B;  1C7V A;  1EH2 A;  3BUW B;  2QEH A;  2P6B B;  2LV7 A;  3OBV A;  2Y1N A;  1QX7 A;  1UHH A;  2LMV A;  4I5K A;  4N1G A;  4PHJ A;  5FI7 A;  3S0F A;  1ZMZ A;  1U5I A;  2LCP A;  1IGV A;  3NHI A;  3TUY B;  2QDI A;  1SCV A;  1XFZ O;  1JFK A;  3QRX A;  2KGR A;  1TTX A;  1NIW A;  3VRO A;  3WXA A;  1GM0 A;  1CLL A;  4GGF C;  4UPG A;  3QME A;  1H8B A;  2SCP A;  1LKJ A;  4DCK A;  2LLT A;  1BOD A;  3GK2 A;  1J7P A;  3CR2 A;  1JC2 A;  1S6C A;  4MZK A;  1AJ5 A;  2L2C A;  3TZ1 A;  1EG3 A;  4CPV A;  2LAP A;  1SNL A;  3D76 A;  3DVJ A;  3FE8 A;  4DIR A;  2Q4U A;  3IVT A;  2GGM A;  3NGV A;  4INW A;  3ICB A;  1A29 A;  1GJY A;  1YVL A;  3CZ0 A;  3O2P A;  1HQV A;  1QX5 B;  1X02 A;  2NLN A;  3S0A A;  2KLD A;  1QLK A;  5CPV A;  1JFJ A;  2LLU A;  2M1K B;  1EG4 A;  3B86 A;  3EVU A;  4ORC B;  2QEV A;  4BY4 A;  4F7F A;  2BL0 C;  1AUI B;  1YUR A;  2EC6 C;  2L5X B;  1KK7 Z;  3OP0 A;  1SR6 B;  1UHN A;  1A75 B;  4FQT A;  3KEV A;  2JNF A;  1WY9 A;  1ZUZ A;  3E3R A;  4MLW A;  1IQ5 A;  4MZJ A;  1L7Z A;  3PJI A;  4N5X A;  4DS7 A;  2LVK A;  4Q04 A;  4USL A;  4OCI A;  1Z2C B;  1KQM C;  2PVB A;  3SG2 A;  2ZFD A;  3WHU B;  1A2X A;  2JRF A;  1OOG A;  5HYD A;  1ALV A;  3DVK A;  1FI6 A;  1WDC B;  5HL1 A;  5AER A;  1SCM C;  3UO9 A;  3I5I C;  2B1U A;  1QTX A;  2BKI B;  3SG4 A;  3PN7 C;  1TUZ A;  4WRI A;  1PSR A;  1BLQ A;  4CID A;  1QV1 A;  1DEK A;  2WCE A;  2JT8 A;  3BUN B;  1F55 A;  1BT6 A;  1WRK A;  1DJZ A;  4MSP A;  4PE7 A;  1PK0 D;  3RM1 A;  5CSI A;  1F70 A;  1CM4 A;  2KPH A;  1K9P A;  3JVT B;  1CB1 A;  1E8A A;  1NWD A;  2JNX A;  2L2E A;  4M2Q A;  2KAV A;  2TN4 A;  1G4Y R;  1ZAC A;  4PE1 A;  3FS7 A;  1LIN A;  5J3X A;  2BBN A;  3DY9 A;  3TDI A;  2AUC A;  4MEW A;  4CFR A;  3F45 A;  3EVR A;  3TUY C;  1V1F A;  2M7L A;  2BBM A;  1V1G A;  3O6B A;  2SAS A;  2KHN A;  4P5O E;  5AFP A;  2JC2 A;  3CYZ A;  3DZT A;  3OGN A;  4MZL A;  1MUX A;  1B1G A;  5HLO A;  3S0G A;  1UWO A;  1F71 A;  5AEQ A;  3S0E A;  1QAS A;  1OZS A;  1QIW A;  5PAL A;  3SG3 A;  2CT9 A;  1SL7 A;  1XFU O;  2F3Y A;  2L50 A;  2KNE A;  1CFF A;  2JQ6 A;  2WCJ A;  1QV0 A;  2ZRS A;  4GAO A;  3B6X A;  2M1U A;  1OZO A;  2KI4 B;  3FIA A;  3EKJ A;  1TNP A;  2GTE A;  2KI6 D;  3V2L A;  1SW8 A;  1YR5 A;  3BFB A;  1NCY A;  2Y5I A;  2VRG A;  3GK4 X;  4PHM A;  1DGV A;  1JUO A;  1RTP 1;  3S0B A;  4OVN F;  4C0L A;  1A4P A;  1SPY A;  1ZOT B;  5DKN A;  1CDN A;  3R1V A;  4OKH A;  2KBM A;  4DRW A;  4CLN A;  1M31 A;  1SR6 C;  3R1O A;  2ZRT A;  2JWW A;  3A8R A;  4AQI A;  1K9U A;  1QWV A;  3D77 A;  3NSI A;  1LVC D;  2LM5 A;  4C0K A;  5KU1 A;  3I5H B;  4PT1 A;  1FI5 A;  3AKB A;  1ZFS A;  2M0R A;  4XJK A;  2LP3 A;  3PAT A;  3K1E A;  5K89 A;  2I94 A;  1XFR A;  5AAN A;  5ER5 A;  1DT7 B;  1B4C A;  1MXE A;  2HQ8 A;  4GFT A;  1WDC C;  2WCH A;  2LHI A;  1YRU B;  1XFX O;  2QPT A;  4HSZ A;  1S36 A;  1F4O A;  5EL2 A;  1OSA A;  3NSK A;  3R72 A;  4INX A;  2OS8 B;  4YGA A;  1G33 A;  1UHK A;  4M2O A;  1DC1 A;  1A03 A;  2BCA A;  1BG1 A;  2CCM A;  3VRR A;  1PAL A;  1UUR A;  4N1F A;  4D1E A;  2GV5 A;  5CSJ A;  4ETO A;  1BR1 B;  4YGC B;  2K60 A;  3SS5 A;  1YTZ C;  2RGI A;  1KFX S;  3BYA A;  3JVT C;  1CFC A;  1XVJ A;  3PSR A;  3TS5 B;  1KK8 B;  2K7D A;  1CDP A;  1G8I A;  2F3Z A;  3EK4 A;  1S5G Y;  2H2K A;  2FJY A;  2G9B A;  2JPO A;  1W7I B;  1EXR A;  4YI9 A;  5FI2 A;  4F0Z B;  1JBA A;  1DMO A;  3RZS A;  1KFX L;  1MQ1 A;  1OQP A;  4U8D A;  3DVE A;  1DTL A;  1YUS A;  1OE9 B;  1TOP A;  1J1E A;  3D0Y A;  2MLE C;  4YI8 A;  1AP4 A;  1SL8 A;  3FE9 A;  1UUS A;  2O60 A;  2JXC A;  2V53 A;  1XK4 A;  1BMO A;  1NP8 A;  2JUL A;  3PFV A;  4YGE B;  1KSO A;  2KFG A;  1OOF A;  1JSA A;  2KQ6 A;  2IS9 A;  2L0P A;  1NX1 A;  2P70 A;  1M45 A;  1SKT A;  5KTY A;  2L4H A;  1DVI A;  1OW4 A;  2KI4 C;  3C1V A;  3K21 A;  1WRZ A;  1XFY O;  1OOI X;  3M0W A;  4JKT A;  4MBE A;  3VRP A;  1K93 D;  1C3Z A;  2PAL A;  2LUX A;  2JU0 A;  2K0J A;  3CZT X;  3CLN A;  1K2H A;  1NX3 A;  1ORG A;  2KFH A;  4YGB B;  1PSB A;  2MAZ A;  1M63 B;  4NDD A;  5D7F A;  1BR4 B;  1XFW O;  3EK7 A;  4PHN A;  1DJX A;  3DF0 B;  5HKY A;  1BU3 A;  1K90 D;  4MRY A;  1IG5 A;  4M2P A;  2KDH A;  2FCD A;  1KFU L;  5HKW A;  5CSF A;  3I5H C;  3VGO A;  3I5G B;  3CGA A;  4OR9 B;  3BQ3 A;  1K94 A;  2H61 A;  1OOJ A;  3I5F B;  2K2A A;  2KAX A;  2BCX A;  1ALW A;  2NXQ A;  5TNC A;  5I8N A;  1CMG A;  3CR4 X;  3OB2 B;  5D69 A;  1OMD A;  1TN4 A;  2L98 A;  1YVH A;  4FQO A;  2OS8 C;  3SIB A;  2WC8 A;  4NDB A;  2BKH B;  1YRT B;  4GNK B;  2PRU A;  4BY5 A;  2ZKM X;  2Q91 A;  4P2Y B;  2JZI A;  3LCP C;  4I5N B;  4HRE E;  1Q80 A;  5DKQ A;  1QLS A;  1K96 A;  3L4L A;  2NCO A;  3SS3 A;  1F54 A;  4ZCU A;  2LNK A;  2LE9 B;  3EG5 B;  1SSE B;  2BCB A;  1QVI Y;  2EHB A;  2H8V A;  4MVF A;  2MBX A;  1FW4 A;  3DYE A;  2PQL A;  1J55 A;  4XJK B;  4C0J A;  2YGU A;  4TNC A;  4GBA A;  3TS5 C;  1KK8 C;  2MRD A;  3B7A A;  1IRJ A;  1XFV O;  2F2O A;  1RRO A;  2WCF A;  1CDM A;  4A4C A;  2M8U A;  3DF0 A;  2MA2 A;  1IJ6 A;  5I2L A;  1NSH A;  1UHI A;  2OTG B;  2JXL A;  3NSO A;  2K7O A;  2BAP A;  2M9G A;  2WCL A;  2MHH A;  2G2B A;  1AHR A;  1S6I A;  3MSE B;  4GUK A;  1MHO A;  2JPT A;  5I2O A;  1S6J A;  1NX0 A;  3VB1 A;  3JTD B;  3Q8I A;  3PAL A;  1SYM A;  1IWQ A;  2M3W A;  3WHT B;  1DEL A;  1B7T Y;  2CXJ A;  2KBI A;  3GK1 A;  2HQW A;  2M29 A;  1KQV A;  2D8N A;  5CSN A;  1TNW A;  1NX2 A;  4NQG A;  1M46 A;  1XYD A;  3BOW A;  2F8P A;  4ZCV A;  1XO5 A;  3CDN A;  1CMF A;  1BJF A;  2CTN A;  3VRN A;  1B47 A;  1NYA A;  2BEC A;  2MLF C;  3SG7 A;  2WC5 A;  3O4X A;  1IIO A;  2LVJ A;  1LXF C;  1FF1 A;  4ORA B;  4OZD A;  1MWN A;  2WCB A;  1QAT A;  3D0Y B;  1DJI A;  3PM2 A;  2CNP A;  3IQO A;  4FTG A;  1B9A A;  4PE0 A;  3SG5 A;  1BF5 A;  2Y4Q A;  2ISD A;  3ZNI A;  1FBV A;  3I5G C;  1WRL A;  1CTR A;  5JJG A;  4L9M A;  3DD4 A;  3I5F C;  2WCK A;  5I94 A;  1CDL A;  1F4Q A;  3CZ2 A;  1RJV A;  1L2O B;  2QEB A;  5HKZ A;  5KSZ A;  2KQY A;  1NUB A;  2K7B A;  5FI6 A;  1PVB A;  2PYQ A;  2JT3 A;  3BUM B;  1R2U A;  1DJW A;  1TCO B;  4E68 A;  1QVI Z;  1KK7 Y;  4KYN A;  3NSL A;  2FJU B;  1HT9 A;  1J7O A;  3HX4 A;  1DGU A;  1EJ3 A;  1ODB A;  3B88 A;  3GOF A;  1AJ4 A;  3LL8 B;  2AAO A;  3BXK A;  4I5L B;  5AXI A;  1B8C A;  4AOM A;  1TNX A;  3IF7 A;  3KF9 A;  4GGF A;  1SMG A;  5F6T A;  3OB1 B;  1NPQ A;  2KOT A;  1PVA A;  1UHJ A;  1SL9 A;  5DIC A;  5GQQ C;  1S3P A;  1J1D A;  1NCX A;  4JWQ A;  3DXL A;  1DF0 B;  3CWG A;  1GQM A;  2OTG C;  1N65 A;  4HRG A;  1SK6 D;  1T14 A;  3NHT A;  1CNP A;  1J7Q A;  2CBL A;  1PUL A;  3JTD C;  2HF5 A;  1Z4H A;  1CLB A;  1DJY A;  2KGB C;  1B8R A;  2KLE A;  2L4I A;  1KFU S;  1K9K A;  2K2F A;  2ZND A;  4ICB A;  4PHK A;  4QJ3 B;  1XA5 A;  1W7J B;  3LLE A;  3EK8 A;  1D1O A;  4YBH B;  3EVV A;  1YUU A;  1N0Y A;  1CFD A;  3BUO B;  3CTN A;  5FYX A;  2JT0 A;  3RLZ A;  2KAY A;  3D78 A;  3FWC A;  3D73 A;  3KO0 A; 
#chains in the Genus database with same CATH homology
 2GTE A;  3L4A A;  3V2L A;  2WCM A;  2H8V A;  3BFB A;  3DYE A;  2PQL A;  3S0B A;  3R1V A;  3B7A A;  2WC6 A;  3R1O A;  2QEH A;  3D74 A;  3N7H A;  1QWV A;  3D77 A;  4PT1 A;  3S0F A;  2WCL A;  3NHI A;  2QDI A;  3K1E A;  1XFR A;  3VB1 A;  3Q8I A;  1GM0 A;  3QME A;  2WCH A;  4JD9 A;  3BJH A;  5EL2 A;  2L2C A;  1DQE A;  3R72 A;  4INX A;  3D76 A;  3FE8 A;  3CDN A;  3NGV A;  4INW A;  3CZ0 A;  2WC5 A;  3S0A A;  3B86 A;  4OZD A;  3B87 A;  2QEV A;  3L47 A;  2QEO A;  4F7F A;  2P71 A;  2FJY A;  2JPO A;  4FQT A;  3PJI A;  3RZS A;  2WCK A;  3S0D A;  3CZ2 A;  3CZ1 A;  3FE9 A;  2ERB A;  1OOG A;  2QEB A;  1LS8 A;  3CAB A;  3D75 A;  1OOF A;  2P70 A;  1OW4 A;  3B88 A;  1OOI X;  3BFH A;  3BFA A;  1C3Z A;  1ORG A;  2KPH A;  5DIC A;  1TWO A;  3DXL A;  1C3Y A;  3R1P A;  3DY9 A;  1P28 A;  1T14 A;  3NHT A;  3FE6 A;  3CYZ A;  3DZT A;  1TUJ A;  3OGN A;  3S0G A;  3S0E A;  2WCJ A;  1OOH A;  3B6X A;  3D78 A;  3L4L A;  3D73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...