3FWCA

Sac3:sus1:cdc31 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
SELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, transcription
molecule keywords Cell division control protein 31
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 41
structure length 145
sequence length 145
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fwcA01
2K7BA 1RWYA 1S5GY 1Y6WA 1QV1A 1K93D 5DKRA 4CFQA 1LINA 1MXLC 2JULA 1Y1UA 1TRFA 1CDPA 1NX3A 1UP5A 3DF0A 4QJ5B 1DGUA 3EVUA 2EGDA 2WC8A 4PHKA 2JNFA 1DF0A 1K9PA 1BU3A 3FWBA 4ORAB 1A29A 1CKKA 1SNLA 5D7FA 1RJVA 1S5GZ 4YRUA 1JWDA 1K90D 4I5JA 1MF8B 2ISDA 3BOWA 2KBMA 2RGIA 5CPVA 2BCXA 3VROA 1C07A 1LVCD 1KWOC 2KGBC 1NUBA 5AANA 3GK1A 3AKBA 1IJ6A 2BBMA 2E6WA 1IQ5A 2H2KA 4HREE 1OQPA 3PM8A 3HX4A 1DJZA 4I5LB 5G08A 4N1FA 3IQQA 2LVVA 4GBAA 1QIVA 2L50A 1IQ3A 1CDLA 1J1EA 2CTNA 1K96A 2GGZA 3JVTB 1CMGA 2JNXA 1TNQA 1BOCA 5I2QA 3I5GB 1NCYA 2QACA 1CMFA 5CSNA 5ER4X 1GJYA 3M0WA 3OB1B 1UHKA 1LKJA 3JTDC 2AUCA 1QLKA 1A75B 2M29A 1F70A 3BUXB 3PFVA 3DD4A 1F54A 2M49B 1YRTB 1N65A 2VRGA 1XK4A 3GK2A 1S26D 2Y4QA 2JRFA 1ODBA 4JPZB 3TDIA 2PASA 1CM1A 1PK0D 1VRKA 3SIAA 2JWWA 3RLZA 1YUTA 2NCPA 1DVIA 1UHIA 4IL1A 5AEQA 1B47A 1UURA 2OS8B 3DVMA 1QATA 3TUYC 1H4BA 2K2FA 4QJ3B 2SASA 1ALVA 1Y1AA 1NCZA 3DVEA 1XFXO 4N1GA 2KFFA 2M7NA 2BCBA 2KNEA 4F0ZB 2A4JA 1DF0B 4PHJA 1NYAA 3EK4A 1CDNA 1J7RA 3C1VA 2M9GA 2JQ6A 3SG6A 3TDUA 1AP4A 1OMVA 1A2XA 2Y1NA 4PDZA 5CSFA 2I18A 3LK1A 5I2OA 1LA0A 2LP2A 1LXFC 3BUOB 3BOWB 1ZFSA 3SG3A 1TCFA 3O2PA 1NWDA 2IS9A 5I8NA 1PRWA 1SL9A 3AKAA 4R1EA 2L2EA 4TNCA 2JU0A 3KPXA 3CR2A 4HRGA 2WCFA 1DJGA 1KSMA 2LHLA 3TS5C 2LM5A 4ORCB 3CR5X 3SG7A 1ZMZA 1B8RA 4M2QA 1YX7A 2TN4A 2BL0C 2NLNA 1K8UA 3I5HC 1AJ5A 4A4BA 1PVAA 1XA5A 3EK8A 2ZNDA 1XFUO 4P5OE 1DMOA 3SG2A 1W7JB 4A4CA 2M97A 2KHNA 1SK6D 2I7AA 3O78A 1QVIZ 4YGCB 3HCMA 2KAVA 2WOSA 1B7TY 1QX7A 3GK4X 1AHRA 2K0JA 4QJ4B 1F4OA 1MQ1A 2P6BB 3BUWB 4BY4A 2I2RE 3NXAA 1TOPA 4MLWA 5CSIA 3ZNIA 1S6CA 1QX5B 2GV5A 1M31A 1B8LA 1RK9A 1SKTA 3PLFB 4GFTA 2ZFDA 3NSKA 2PALA 2KGRA 1DTLA 1RFJA 2R2IA 2H61C 1HT9A 1BF5A 3GOFA 4P2YB 2M1KB 1RROA 4HRHA 1SCMB 3I5FB 2JTZA 2JZIA 1BLQA 4PE4A 1XO5A 3FIAA 2GGMA 3BUMB 1DJHA 1PSRA 1MUXA 2MBXA 1BODA 2EC6C 1AVSA 3F45A 1KK7Y 1BJFA 1SRAA 2HQWA 2K8MB 3CTNA 3FS7A 3CLNA 3NSOA 4OKHA 4YBHB 5KSZA 1OZSA 1OE9B 1WY9A 4GPLB 1JF2A 3SIBA 3ICBA 2LVIA 3DVKA 2K61A 1JFKA 3CR4X 3O6BA 1WRKA 3LK0A 1JSAA 1F8HA 1CLMA 4NQGA 3BXKA 2OTGC 4I5NB 2LLTA 3K21A 4YGDB 4CPVA 2MAZA 2D8NA 5GQQC 1KFXS 4JWQA 2B1UA 2L51A 1ZUZA 4PE0A 3LL8B 1NP8A 1QX2A 4OR9B 1ZOTB 1B4CA 3OB2B 1KWOB 4M2PA 2L98A 5DKQA 5HLVA 5PALA 5F6TA 1E8AA 1L2OB 2LLUA 2O5GA 4MBEA 3VRNA 4UPGA 1BT6A 2F3YA 2L4HA 1JC2A 5KU1A 4AOMA 4YGEB 1XVJA 2HPSA 1WDCB 4GUKA 2HQ8A 1W7IB 5HKWA 4MZKA 2JXCA 2M3WA 3BQ3A 1TNXA 2DOQA 2JT8A 1DGVA 1CLLA 2LVKA 2I94A 3PATA 1GGWA 1GQMA 1CFFA 1RTP1 2L0PA 4I5KA 1X02A 1SMGA 4XJKA 3BYAA 2E30A 3JTDB 5CSJA 4DIRA 1DJYA 2LP3A 4AQJA 5K89A 3A8RA 2Q4UA 3DF0B 3WHUB 2KI4C 2KSPA 4MZJA 1KFUS 2K7CA 2ZNEA 4PHNA 1KK8C 1KQMB 1NCXA 2BKIB 1QXPA 1PSBA 2LANA 1QLSA 1SL7A 4YGBB 1XFVO 1M39A 2LNKA 1B1GA 1S3PA 1DJXA 1Q80A 5ER5A 2WCEA 3PN7B 2M0RA 1WLZA 3D0YA 1M45A 5BPJA 1YURA 2BECA 2LCPA 2H61A 4NDBA 2Q91A 3CWGA 1FF1A 2K7OA 1CM4A 1NSHA 1NPQA 1WRLA 2JT0A 1EJ3A 2KFHA 1V1FA 1BG1A 4MRXA 1JF0A 2ZN8A 4FQOA 3WNXB 1G4YR 1F4QA 1AJ4A 5DKNA 4CLNA 3EK7A 1JFJA 1AK8A 3I5IC 4NDDA 2KBIA 2LV7A 1F55A 1MR8A 4USLA 3NSIA 1NIWA 1FW4A 3LLEA 4WRIA 5JJGA 1EL4A 1QIWA 1TTXA 1BMOA 3EVVA 4ETOA 5HLOA 4PCWA 1QTXA 1TIZA 4MEWA 1FI5A 1A4PA 1MWNA 2MHHA 2PMYA 4PHMA 4MSPA 5D69A 2OPOA 1KSOA 4NDCA 1V1GA 1CTRA 1R6PA 1TCOB 2LMTA 1XFZO 1G33A 4E68A 1J1DA 1J55A 1SR6C 1UHJA 1NX0A 5TNCA 3AAJA 3OHMB 2K2AA 3EKHA 1S1EA 2ZRSA 2QPTA 3VRRA 2BL0B 3I5HB 3SG5A 1OZOA 1NX1A 3OX6A 1B8CA 1OSAA 3KHEA 1UWOA 2LE9B 1OOJA 4FTGA 4XJKB 2BBNA 2L5XB 1CNPA 1CLBA 3WHTB 2LLSA 1N0YA 2COLB 2JPTA 4M2OA 1B7TZ 2KYFA 1D1OA 1K94A 4DRWA 1EG3A 3SJSA 1PVBA 1SCMC 2KAYA 3I5FC 3OX5A 1Y1XA 3O4YA 2F2OA 1JBAA 2LHIA 5I2LA 2CCMA 4YI8A 2KI6C 3D0YB 1YVLA 2BKHB 2KYCA 1WRZA 1SW8A 1S6JA 1YUUA 2ZRTA 1K9KA 2MRDA 1AUIB 1XFYO 3TZ1A 4ICBA 4MZLA 2BE6A 1PALA 2M1UA 3A4UB 1SPYA 2ZN9A 1F71A 4GGFC 4DCKA 2L4IA 1YVHA 2EC6B 1IJ5A 1UHHA 1K2HA 1IRJA 1KK7Z 1S36A 4HSZA 3RM1A 1B9AA 1M63B 1CB1A 1CFCA 4Q04A 2MA2A 5FYXA 1YTZC 4L9MA 4CIDA 4CFRA 1KQVA 2AAOA 3VRQA 4C0JA 1CFPA 2JXLA 2MLFC 3JVTC 3CS1A 5HKZA 2LUXA 1ZACA 3I5GC 2JOJA 2CT9A 2OTGB 1L2OC 1YX8A 3IF7A 1DT7B 1KFXL 1CFDA 2LUCA 1BR1B 1J7OA 1MHOA 1XFWO 1QV0A 1WDCC 1J7QA 1TNPA 1IGVA 2KQ6A 4PE7A 1QASA 3FWCA 1G8IA 2F3ZA 2CXJA 2M8UA 1S6IA 1EG4A 2V53A 4YGAA 2MJWB 2M7LA 2K7DA 1OMRA 2G9BA 2KI6D 2AMIA 2F8PA 4PALA 1YR5A 5HKYA 3WXAA 2FJUB 3VRPA 4YI9A 1K9UA 2CNPA 2OS8C 1U5IA 2WNDA 2Y1MA 1Y0VH 3NSLA 4U8DA 5AFPA 2WCBA 1PULA 1UHNA 2JC2A 2FOTA 1ALWA 1IH0A 2JT3A 2EHBA 3AAKA 1K95A 4AQIA 1KQMC 2LAPA 2KQYA 3KEVA 5IBWA 2G2BA 4GAOA 2KOTA 4WQ3A 3TUYB 2F2PA 1L7ZA 4DUQA 3PN7C 1UUSA 1SCVA 4N5XA 2JTTA 4ZCUA 1SBJA 2KI4B 2BE4A 1KFUL 1YRUB 5KTYA 1YUSA 1M46A 1DJIA 1KCYA 1FBVA 1H8BA 1J7PA 1KK8B 4OVNF 1A03A 1R2UA 1C7VA 2WORA 2SCPA 1CDMA 4DS7A 3VGOA 2Y5IA 3OP0A 3PSRA 4ORBB 2HF5A 2FCDA 5JOLA 3PALA 3EKJA 2MLEC 1TN4A 3KO0A 2PSRA 4GGFA 2NXQA 1C7WA 2F33A 4OV2A 4XYNA 3D10A 1TNWA 3LCPC 3KF9A 3TS5B 2LMVA 3H4SE 1QJTA 3I5IB 2BCAA 4WQ2A 4ZCVA 4MRYA 1GGZA 1NX2A 1IG5A 1QVIY 1IKUA 4MN0A 2LC5A 1DJWA 4C0KA 1FI6A 3E3RA 2ZKMX 4GGNA 1RECA 1FPWA 1SYMA 1EH2A 1MXEA 1JUOA 1XK4C 1SY9A 4MVFA 1IWQA 2HETA 3MSEB 3QRXA 5B8IB 2KAXA 5AERA 2LMUA 1WLMA 1BR4B 3CGAA 3CZTX 3TDZA 2O60A 2KDHA 1XYDA 1OMDA 3SG4A 4GNKB 4C0LA 5HYDA 4JQ0D 3ZWHA 1QS7A 1U5IB 1SR6B 3IQOA 1A75A 5J3XA 4D1EA 2KFGA 2NCOA 2NZ0A 1HQVA 1LA3A 1N2DA 1SL8A 2LVJA 3EVRA 4OCIA 4PE1A 3DVJA 2FCEA 1EXRA 2CBLA 3BUNB 5AXIA 2PRUA 2PVBA 4BY5A
chains in the Genus database with same CATH superfamily
2K7BA 1RWYA 1S5GY 5HL1A 1Y6WA 1QV1A 1K93D 5DKRA 4CFQA 1LINA 1MXLC 2JULA 1Y1UA 4OZDA 1TRFA 1CDPA 1NX3A 1OOGA 1UP5A 3DF0A 4QJ5B 2BNXA 1DGUA 3EVUA 2EGDA 2WC8A 4PHKA 2PYQA 2JNFA 1DF0A 3S0GA 1K9PA 3FE6A 1BU3A 3FWBA 4ORAB 1A29A 1CKKA 3Q8IA 3BFHA 1SNLA 4INWA 5D7FA 3BFBA 1RJVA 2L5YA 1S5GZ 2BAPA 4YRUA 3B86A 1JWDA 1K90D 4I5JA 1MF8B 2ISDA 3BOWA 1GM0A 2KBMA 2RGIA 5CPVA 2BCXA 3VROA 1C07A 1LVCD 1KWOC 2KGBC 1NUBA 5AANA 3GK1A 3AKBA 3CZ0A 1IJ6A 2BBMA 3S0DA 2E6WA 1IQ5A 2H2KA 4HREE 1OQPA 3PM8A 3HX4A 1DJZA 4I5LB 5G08A 2KLEA 2WCHA 4N1FA 3IQQA 2LVVA 4GBAA 1QIVA 2L50A 1IQ3A 3NHTA 1CDLA 1ORGA 4KYNA 1J1EA 2CTNA 1K96A 2GGZA 3JVTB 1CMGA 2JNXA 1TNQA 1BOCA 1TUZA 3I5GB 5I2QA 1NCYA 2QACA 3D76A 3VB1A 1CMFA 5CSNA 5ER4X 1GJYA 3M0WA 3OB1B 1UHKA 3EG5B 1LKJA 3JTDC 2AUCA 1QLKA 1A75B 2M29A 3DZTA 1F70A 3CDNA 3BUXB 3PFVA 3DD4A 3K1EA 1F54A 2M49B 1YRTB 1N65A 2P71A 2VRGA 1XK4A 3CYZA 3D77A 3GK2A 3UNWA 1S26D 2Y4QA 2JRFA 1ODBA 4JPZB 3TDIA 2PASA 1CM1A 1PK0D 1VRKA 3R1VA 3SIAA 2JWWA 3RLZA 1YUTA 2NCPA 1DVIA 1UHIA 4IL1A 5AEQA 1B47A 1UURA 2OS8B 3DVMA 1QATA 3TUYC 1H4BA 2K2FA 4QJ3B 2SASA 1ALVA 1Y1AA 1NCZA 3DVEA 1XFXO 4N1GA 2KFFA 2M7NA 2BCBA 2KNEA 4F0ZB 1Z2CB 5I94A 2A4JA 1DF0B 4PHJA 1NYAA 3EK4A 1CDNA 1J7RA 3C1VA 2M9GA 1DC1A 2JQ6A 3SG6A 3TDUA 1AP4A 1OMVA 1A2XA 2Y1NA 4PDZA 5CSFA 2I18A 3D73A 3LK1A 5I2OA 1TWOA 1LA0A 2LP2A 1LXFC 3BUOB 1C3YA 3BOWB 1ZFSA 3SG3A 3D74A 1TCFA 3O2PA 1NWDA 2IS9A 5I8NA 1PRWA 1SL9A 3AKAA 4R1EA 2L2EA 4TNCA 2JU0A 3SS3A 3KPXA 3CR2A 4HRGA 2WCFA 1DJGA 1KSMA 2LHLA 3TS5C 2LM5A 4ORCB 3CR5X 5DICA 3SG7A 1ZMZA 1B8RA 3IVTA 4M2QA 1YX7A 2TN4A 2BL0C 2NLNA 1K8UA 3I5HC 1AJ5A 4A4BA 1PVAA 1XA5A 3EK8A 2KPHA 2ZNDA 1XFUO 4P5OE 1DMOA 3SG2A 2QDIA 1W7JB 4A4CA 3SS5A 2M97A 2KHNA 1SK6D 2I7AA 3O78A 3OBVA 1QVIZ 4YGCB 3HCMA 5D3OA 2KAVA 2WOSA 1B7TY 1QX7A 1QWVA 3GK4X 1AHRA 2K0JA 3R72A 4QJ4B 1F4OA 1MQ1A 2P6BB 3BUWB 4BY4A 2I2RE 3NXAA 1TOPA 3B88A 4MLWA 5CSIA 3ZNIA 1S6CA 3V2LA 4JD9A 1QX5B 2GV5A 1M31A 1B8LA 1RK9A 3L4LA 1SKTA 3PLFB 4GFTA 2ZFDA 3NSKA 2PALA 4PT1A 2KGRA 3DYEA 1DTLA 1RFJA 2R2IA 2H61C 1HT9A 1BF5A 3GOFA 4P2YB 2M1KB 1RROA 4HRHA 1SCMB 2WCLA 3I5FB 3BFAA 2JTZA 2JZIA 2KLDA 1BLQA 4PE4A 1XO5A 3PM2A 3FIAA 2GGMA 3BUMB 1DJHA 1PSRA 1MUXA 2MBXA 1BODA 2EC6C 1AVSA 4FQTA 3F45A 1KK7Y 1BJFA 1SRAA 2HQWA 2K8MB 3CTNA 3FS7A 3CLNA 3NSOA 4OKHA 2QEBA 4YBHB 5KSZA 1OZSA 1OE9B 1WY9A 4GPLB 1JF2A 3SIBA 3ICBA 2LVIA 3DVKA 2K61A 1JFKA 3CR4X 3O6BA 1WRKA 3LK0A 1JSAA 1F8HA 1CLMA 4NQGA 3BXKA 2OTGC 4I5NB 2LLTA 3K21A 4YGDB 3UO9A 4CPVA 2MAZA 2D8NA 5GQQC 1KFXS 4JWQA 2B1UA 2L51A 3R1PA 1ZUZA 4PE0A 3LL8B 1NP8A 1QX2A 3QMEA 1ZOTB 4OR9B 3OB2B 1KWOB 4M2PA 1B4CA 2L98A 5DKQA 5HLVA 5PALA 5F6TA 1E8AA 1L2OB 1W9ZA 2LLUA 2O5GA 2YGUA 4MBEA 3VRNA 4UPGA 1BT6A 2F3YA 2L4HA 1JC2A 5KU1A 4AOMA 2K60A 4YGEB 1XVJA 2HPSA 1WDCB 4GUKA 2HQ8A 1W7IB 5HKWA 4MZKA 2JXCA 2M3WA 3BQ3A 1TNXA 2DOQA 2JT8A 1DGVA 3D75A 2ERBA 3DXLA 1CLLA 2LVKA 2I94A 3PATA 1T14A 1GGWA 1GQMA 1CFFA 1RTP1 2L0PA 4I5KA 1X02A 1SMGA 4XJKA 3BYAA 2E30A 3JTDB 5CSJA 4DIRA 1DJYA 2LP3A 4AQJA 5K89A 3A8RA 2Q4UA 3DF0B 3WHUB 2FJYA 3FE8A 2KI4C 2KSPA 4MZJA 1KFUS 2K7CA 2ZNEA 4PHNA 1OOFA 1KK8C 1KQMB 1NCXA 2BKIB 1QXPA 1PSBA 2LANA 1QLSA 2WC5A 1DQEA 1SL7A 2QEVA 4YGBB 1XFVO 1M39A 2LNKA 1B1GA 1S3PA 1DJXA 1Q80A 5ER5A 2WCEA 3PN7B 2M0RA 1TUJA 1WLZA 3D0YA 1M45A 5BPJA 1YURA 2BECA 2LCPA 2H61A 4NDBA 2Q91A 3CWGA 1FF1A 2K7OA 1CM4A 1NSHA 1NPQA 1WRLA 2JT0A 1EJ3A 2KFHA 1V1FA 1BG1A 1OW4A 1JF0A 4MRXA 2ZN8A 4FQOA 3WNXB 1G4YR 1F4QA 1AJ4A 5DKNA 4CLNA 3EK7A 1JFJA 1AK8A 3I5IC 4NDDA 2KBIA 2LV7A 1F55A 1MR8A 2WC6A 4USLA 3NSIA 1NIWA 3FE9A 1FW4A 3LLEA 2JPOA 4WRIA 5JJGA 1EL4A 1QIWA 1TTXA 1BMOA 3EVVA 1P28A 4ETOA 5HLOA 4PCWA 1QTXA 1TIZA 4MEWA 1FI5A 1A4PA 1DELA 1MWNA 2MHHA 2PMYA 4PHMA 4MSPA 5D69A 2OPOA 1KSOA 4NDCA 1V1GA 1CTRA 1R6PA 1TCOB 2LMTA 1XFZO 3B7AA 1G33A 3O4XA 4E68A 1J1DA 1J55A 1SR6C 1UHJA 1NX0A 5TNCA 3AAJA 3OHMB 2K2AA 3EKHA 1S1EA 2ZRSA 2QPTA 3VRRA 3S0FA 2BL0B 3I5HB 3SG5A 1OZOA 3N7HA 1NX1A 3OX6A 5FI6A 1B8CA 1OSAA 3KHEA 3DY9A 1UWOA 2LE9B 1OOJA 4FTGA 4XJKB 2BBNA 2L5XB 1CNPA 1CLBA 3L47A 3WHTB 2GTEA 1OOHA 2LLSA 1N0YA 2COLB 1XFRA 2JPTA 4M2OA 1B7TZ 2KYFA 3R1OA 1D1OA 3BJHA 1K94A 2WCMA 4DRWA 1EG3A 1OOIX 3SJSA 1PVBA 1SCMC 2KAYA 3I5FC 3OX5A 1Y1XA 3O4YA 2F2OA 1JBAA 2LHIA 5I2LA 2CCMA 4YI8A 2KI6C 2WCKA 3D0YB 1YVLA 2BKHB 2KYCA 1WRZA 1SW8A 1S6JA 1YUUA 2ZRTA 1K9KA 2MRDA 3CZ2A 3S0EA 1AUIB 1XFYO 3TZ1A 4ICBA 3OGNA 4MZLA 2BE6A 1PALA 2M1UA 3A4UB 1SPYA 2ZN9A 1F71A 4GGFC 4DCKA 2L4IA 4INXA 1YVHA 2EC6B 1IJ5A 1UHHA 1K2HA 1IRJA 1KK7Z 1S36A 3CZ1A 4HSZA 1B9AA 3RM1A 1M63B 3B6XA 1CFCA 1CB1A 4Q04A 2MA2A 5FYXA 1YTZC 4L9MA 4CIDA 4CFRA 1KQVA 2AAOA 3VRQA 4C0JA 1CFPA 2JXLA 2MLFC 2WCJA 3JVTC 3CS1A 5HKZA 2LUXA 1ZACA 3I5GC 2JOJA 2CT9A 3S0BA 2OTGB 1L2OC 1YX8A 1C3ZA 3IF7A 1DT7B 1KFXL 1CFDA 2LUCA 1BR1B 1J7OA 1MHOA 1XFWO 1QV0A 1WDCC 1J7QA 1TNPA 1IGVA 2KQ6A 4PE7A 3S0AA 5FI2A 1QASA 3FWCA 1G8IA 2F3ZA 2P70A 1DEKA 2CXJA 2M8UA 1S6IA 1EG4A 2V53A 3PJIA 4YGAA 2MJWB 2M7LA 2K7DA 1OMRA 2G9BA 2KI6D 3L4AA 2AMIA 2F8PA 4PALA 1YR5A 5HKYA 2H8VA 3WXAA 2FJUB 3VRPA 2PQLA 4YI9A 1K9UA 2CNPA 2OS8C 1U5IA 2L2CA 2WNDA 2Y1MA 1Y0VH 3NSLA 4U8DA 5AFPA 2WCBA 1PULA 1UHNA 2JC2A 2FOTA 1ALWA 1IH0A 2JT3A 2EHBA 2QEOA 1K95A 3AAKA 4AQIA 1KQMC 2LAPA 2KQYA 3KEVA 5IBWA 2G2BA 4GAOA 2KOTA 3NHIA 4WQ3A 3TUYB 2F2PA 1L7ZA 4DUQA 3PN7C 1UUSA 1SCVA 4N5XA 2JTTA 4ZCUA 1SBJA 2KI4B 1YRUB 1KFUL 2BE4A 5KTYA 1YUSA 1M46A 1DJIA 1KCYA 1FBVA 1H8BA 1J7PA 1KK8B 3CABA 4OVNF 3D78A 1A03A 1R2UA 1Z4HA 1C7VA 2WORA 2SCPA 1CDMA 4DS7A 3VGOA 2Y5IA 3OP0A 3PSRA 4ORBB 2HF5A 1LS8A 2FCDA 5FI7A 5JOLA 1SSEB 3PALA 3EKJA 2MLEC 1TN4A 3KO0A 2PSRA 5EL2A 4GGFA 2NXQA 1C7WA 2F33A 4OV2A 4XYNA 3NGVA 1IIOA 3D10A 1TNWA 3LCPC 3KF9A 3TS5B 2LMVA 3H4SE 1QJTA 3I5IB 2BCAA 4WQ2A 4ZCVA 4MRYA 3B87A 1GGZA 1NX2A 1IG5A 1QVIY 1IKUA 4MN0A 2QEHA 2LC5A 1DJWA 4C0KA 1FI6A 3E3RA 2ZKMX 4GGNA 1RECA 1FPWA 1SYMA 3RZSA 1MXEA 1EH2A 1JUOA 1XK4C 1SY9A 4MVFA 1IWQA 2HETA 3MSEB 3QRXA 5B8IB 2KAXA 4IJ7A 2LMUA 5AERA 1WLMA 1BR4B 3CGAA 3CZTX 3TDZA 2O60A 2KDHA 1XYDA 1OMDA 3SG4A 4GNKB 4C0LA 5HYDA 4JQ0D 3ZWHA 1QS7A 1U5IB 1SR6B 3IQOA 1A75A 3SS4A 5J3XA 4D1EA 2KFGA 2NCOA 2NZ0A 1HQVA 1LA3A 1N2DA 1SL8A 2LVJA 3EVRA 4OCIA 4PE1A 4F7FA 3DVJA 2FCEA 1EXRA 2CBLA 3BUNB 5AXIA 2PRUA 2PVBA 4JKTA 4BY5A
chains in the Genus database with same CATH topology
2K7BA 1RWYA 1S5GY 1Y6WA 1QV1A 1K93D 5DKRA 4CFQA 1LINA 1MXLC 2JULA 1Y1UA 1TRFA 1CDPA 1NX3A 1UP5A 3DF0A 4QJ5B 1DGUA 3EVUA 2EGDA 2WC8A 4PHKA 2JNFA 1DF0A 1K9PA 1BU3A 3FWBA 4ORAB 1A29A 1CKKA 1SNLA 5D7FA 1RJVA 1S5GZ 4YRUA 1JWDA 1K90D 4I5JA 1MF8B 2ISDA 3BOWA 2KBMA 2RGIA 5CPVA 2BCXA 3VROA 1C07A 1LVCD 1KWOC 2KGBC 1NUBA 5AANA 3GK1A 3AKBA 1IJ6A 2BBMA 2E6WA 1IQ5A 2H2KA 4HREE 1OQPA 3PM8A 3HX4A 1DJZA 4I5LB 5G08A 4N1FA 3IQQA 2LVVA 4GBAA 1QIVA 2L50A 1IQ3A 1CDLA 1J1EA 2CTNA 1K96A 2GGZA 3JVTB 1CMGA 2JNXA 1TNQA 1BOCA 5I2QA 3I5GB 1NCYA 2QACA 1CMFA 5CSNA 5ER4X 1GJYA 3M0WA 3OB1B 1UHKA 1LKJA 3JTDC 2AUCA 1QLKA 1A75B 2M29A 1F70A 3BUXB 3PFVA 3DD4A 1F54A 2M49B 1YRTB 1N65A 2VRGA 1XK4A 3GK2A 1S26D 2Y4QA 2JRFA 1ODBA 4JPZB 3TDIA 2PASA 1CM1A 1PK0D 1VRKA 3SIAA 2JWWA 3RLZA 1YUTA 2NCPA 1DVIA 1UHIA 4IL1A 5AEQA 1B47A 1UURA 2OS8B 3DVMA 1QATA 3TUYC 1H4BA 2K2FA 4QJ3B 2SASA 1ALVA 1Y1AA 1NCZA 3DVEA 1XFXO 4N1GA 2KFFA 2M7NA 2BCBA 2KNEA 4F0ZB 2A4JA 1DF0B 4PHJA 1NYAA 3EK4A 1CDNA 1J7RA 3C1VA 2M9GA 2JQ6A 3SG6A 3TDUA 1AP4A 1OMVA 1A2XA 2Y1NA 4PDZA 5CSFA 2I18A 3LK1A 5I2OA 1LA0A 2LP2A 1LXFC 3BUOB 3BOWB 1ZFSA 3SG3A 1TCFA 3O2PA 1NWDA 2IS9A 5I8NA 1PRWA 1SL9A 3AKAA 4R1EA 2L2EA 4TNCA 2JU0A 3KPXA 3CR2A 4HRGA 2WCFA 1DJGA 1KSMA 2LHLA 3TS5C 2LM5A 4ORCB 3CR5X 3SG7A 1ZMZA 1B8RA 4M2QA 1YX7A 2TN4A 2BL0C 2NLNA 1K8UA 3I5HC 1AJ5A 4A4BA 1PVAA 1XA5A 3EK8A 2ZNDA 1XFUO 4P5OE 1DMOA 3SG2A 1W7JB 4A4CA 2M97A 2KHNA 1SK6D 2I7AA 3O78A 1QVIZ 4YGCB 3HCMA 2KAVA 2WOSA 1B7TY 1QX7A 3GK4X 1AHRA 2K0JA 4QJ4B 1F4OA 1MQ1A 2P6BB 3BUWB 4BY4A 2I2RE 3NXAA 1TOPA 4MLWA 5CSIA 3ZNIA 1S6CA 1QX5B 2GV5A 1M31A 1B8LA 1RK9A 1SKTA 3PLFB 4GFTA 2ZFDA 3NSKA 2PALA 2KGRA 1DTLA 1RFJA 2R2IA 2H61C 1HT9A 1BF5A 3GOFA 4P2YB 2M1KB 1RROA 4HRHA 1SCMB 3I5FB 2JTZA 2JZIA 1BLQA 4PE4A 1XO5A 3FIAA 2GGMA 3BUMB 1DJHA 1PSRA 1MUXA 2MBXA 1BODA 2EC6C 1AVSA 3F45A 1KK7Y 1BJFA 1SRAA 2HQWA 2K8MB 3CTNA 3FS7A 3CLNA 3NSOA 4OKHA 4YBHB 5KSZA 1OZSA 1OE9B 1WY9A 4GPLB 1JF2A 3SIBA 3ICBA 2LVIA 3DVKA 2K61A 1JFKA 3CR4X 3O6BA 1WRKA 3LK0A 1JSAA 1F8HA 1CLMA 4NQGA 3BXKA 2OTGC 4I5NB 2LLTA 3K21A 4YGDB 4CPVA 2MAZA 2D8NA 5GQQC 1KFXS 4JWQA 2B1UA 2L51A 1ZUZA 4PE0A 3LL8B 1NP8A 1QX2A 4OR9B 1ZOTB 1B4CA 3OB2B 1KWOB 4M2PA 2L98A 5DKQA 5HLVA 5PALA 5F6TA 1E8AA 1L2OB 2LLUA 2O5GA 4MBEA 3VRNA 4UPGA 1BT6A 2F3YA 2L4HA 1JC2A 5KU1A 4AOMA 4YGEB 1XVJA 2HPSA 1WDCB 4GUKA 2HQ8A 1W7IB 5HKWA 4MZKA 2JXCA 2M3WA 3BQ3A 1TNXA 2DOQA 2JT8A 1DGVA 1CLLA 2LVKA 2I94A 3PATA 1GGWA 1GQMA 1CFFA 1RTP1 2L0PA 4I5KA 1X02A 1SMGA 4XJKA 3BYAA 2E30A 3JTDB 5CSJA 4DIRA 1DJYA 2LP3A 4AQJA 5K89A 3A8RA 2Q4UA 3DF0B 3WHUB 2KI4C 2KSPA 4MZJA 1KFUS 2K7CA 2ZNEA 4PHNA 1KK8C 1KQMB 1NCXA 2BKIB 1QXPA 1PSBA 2LANA 1QLSA 1SL7A 4YGBB 1XFVO 1M39A 2LNKA 1B1GA 1S3PA 1DJXA 1Q80A 5ER5A 2WCEA 3PN7B 2M0RA 1WLZA 3D0YA 1M45A 5BPJA 1YURA 2BECA 2LCPA 2H61A 4NDBA 2Q91A 3CWGA 1FF1A 2K7OA 1CM4A 1NSHA 1NPQA 1WRLA 2JT0A 1EJ3A 2KFHA 1V1FA 1BG1A 4MRXA 1JF0A 2ZN8A 4FQOA 3WNXB 1G4YR 1F4QA 1AJ4A 5DKNA 4CLNA 3EK7A 1JFJA 1AK8A 3I5IC 4NDDA 2KBIA 2LV7A 1F55A 1MR8A 4USLA 3NSIA 1NIWA 1FW4A 3LLEA 4WRIA 5JJGA 1EL4A 1QIWA 1TTXA 1BMOA 3EVVA 4ETOA 5HLOA 4PCWA 1QTXA 1TIZA 4MEWA 1FI5A 1A4PA 1MWNA 2MHHA 2PMYA 4PHMA 4MSPA 5D69A 2OPOA 1KSOA 4NDCA 1V1GA 1CTRA 1R6PA 1TCOB 2LMTA 1XFZO 1G33A 4E68A 1J1DA 1J55A 1SR6C 1UHJA 1NX0A 5TNCA 3AAJA 3OHMB 2K2AA 3EKHA 1S1EA 2ZRSA 2QPTA 3VRRA 2BL0B 3I5HB 3SG5A 1OZOA 1NX1A 3OX6A 1B8CA 1OSAA 3KHEA 1UWOA 2LE9B 1OOJA 4FTGA 4XJKB 2BBNA 2L5XB 1CNPA 1CLBA 3WHTB 2LLSA 1N0YA 2COLB 2JPTA 4M2OA 1B7TZ 2KYFA 1D1OA 1K94A 4DRWA 1EG3A 3SJSA 1PVBA 1SCMC 2KAYA 3I5FC 3OX5A 1Y1XA 3O4YA 2F2OA 1JBAA 2LHIA 5I2LA 2CCMA 4YI8A 2KI6C 3D0YB 1YVLA 2BKHB 2KYCA 1WRZA 1SW8A 1S6JA 1YUUA 2ZRTA 1K9KA 2MRDA 1AUIB 1XFYO 3TZ1A 4ICBA 4MZLA 2BE6A 1PALA 2M1UA 3A4UB 1SPYA 2ZN9A 1F71A 4GGFC 4DCKA 2L4IA 1YVHA 2EC6B 1IJ5A 1UHHA 1K2HA 1IRJA 1KK7Z 1S36A 4HSZA 3RM1A 1B9AA 1M63B 1CB1A 1CFCA 4Q04A 2MA2A 5FYXA 1YTZC 4L9MA 4CIDA 4CFRA 1KQVA 2AAOA 3VRQA 4C0JA 1CFPA 2JXLA 2MLFC 3JVTC 3CS1A 5HKZA 2LUXA 1ZACA 3I5GC 2JOJA 2CT9A 2OTGB 1L2OC 1YX8A 3IF7A 1DT7B 1KFXL 1CFDA 2LUCA 1BR1B 1J7OA 1MHOA 1XFWO 1QV0A 1WDCC 1J7QA 1TNPA 1IGVA 2KQ6A 4PE7A 1QASA 3FWCA 1G8IA 2F3ZA 2CXJA 2M8UA 1S6IA 1EG4A 2V53A 4YGAA 2MJWB 2M7LA 2K7DA 1OMRA 2G9BA 2KI6D 2AMIA 2F8PA 4PALA 1YR5A 5HKYA 3WXAA 2FJUB 3VRPA 4YI9A 1K9UA 2CNPA 2OS8C 1U5IA 2WNDA 2Y1MA 1Y0VH 3NSLA 4U8DA 5AFPA 2WCBA 1PULA 1UHNA 2JC2A 2FOTA 1ALWA 1IH0A 2JT3A 2EHBA 3AAKA 1K95A 4AQIA 1KQMC 2LAPA 2KQYA 3KEVA 5IBWA 2G2BA 4GAOA 2KOTA 4WQ3A 3TUYB 2F2PA 1L7ZA 4DUQA 3PN7C 1UUSA 1SCVA 4N5XA 2JTTA 4ZCUA 1SBJA 2KI4B 2BE4A 1KFUL 1YRUB 5KTYA 1YUSA 1M46A 1DJIA 1KCYA 1FBVA 1H8BA 1J7PA 1KK8B 4OVNF 1A03A 1R2UA 1C7VA 2WORA 2SCPA 1CDMA 4DS7A 3VGOA 2Y5IA 3OP0A 3PSRA 4ORBB 2HF5A 2FCDA 5JOLA 3PALA 3EKJA 2MLEC 1TN4A 3KO0A 2PSRA 4GGFA 2NXQA 1C7WA 2F33A 4OV2A 4XYNA 3D10A 1TNWA 3LCPC 3KF9A 3TS5B 2LMVA 3H4SE 1QJTA 3I5IB 2BCAA 4WQ2A 4ZCVA 4MRYA 1GGZA 1NX2A 1IG5A 1QVIY 1IKUA 4MN0A 2LC5A 1DJWA 4C0KA 1FI6A 3E3RA 2ZKMX 4GGNA 1RECA 1FPWA 1SYMA 1EH2A 1MXEA 1JUOA 1XK4C 1SY9A 4MVFA 1IWQA 2HETA 3MSEB 3QRXA 5B8IB 2KAXA 5AERA 2LMUA 1WLMA 1BR4B 3CGAA 3CZTX 3TDZA 2O60A 2KDHA 1XYDA 1OMDA 3SG4A 4GNKB 4C0LA 5HYDA 4JQ0D 3ZWHA 1QS7A 1U5IB 1SR6B 3IQOA 1A75A 5J3XA 4D1EA 2KFGA 2NCOA 2NZ0A 1HQVA 1LA3A 1N2DA 1SL8A 2LVJA 3EVRA 4OCIA 4PE1A 3DVJA 2FCEA 1EXRA 2CBLA 3BUNB 5AXIA 2PRUA 2PVBA 4BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7B A;  1RWY A;  1S5G Y;  1Y6W A;  1QV1 A;  1K93 D;  5DKR A;  4CFQ A;  1LIN A;  1MXL C;  2JUL A;  1Y1U A;  1TRF A;  1CDP A;  1NX3 A;  1UP5 A;  3DF0 A;  4QJ5 B;  1DGU A;  3EVU A;  2EGD A;  2WC8 A;  4PHK A;  2JNF A;  1DF0 A;  1K9P A;  1BU3 A;  3FWB A;  4ORA B;  1A29 A;  1CKK A;  1SNL A;  5D7F A;  1RJV A;  1S5G Z;  4YRU A;  1JWD A;  1K90 D;  4I5J A;  1MF8 B;  2ISD A;  3BOW A;  2KBM A;  2RGI A;  5CPV A;  2BCX A;  3VRO A;  1C07 A;  1LVC D;  1KWO C;  2KGB C;  1NUB A;  5AAN A;  3GK1 A;  3AKB A;  1IJ6 A;  2BBM A;  2E6W A;  1IQ5 A;  2H2K A;  4HRE E;  1OQP A;  3PM8 A;  3HX4 A;  1DJZ A;  4I5L B;  5G08 A;  4N1F A;  3IQQ A;  2LVV A;  4GBA A;  1QIV A;  2L50 A;  1IQ3 A;  1CDL A;  1J1E A;  2CTN A;  1K96 A;  2GGZ A;  3JVT B;  1CMG A;  2JNX A;  1TNQ A;  1BOC A;  5I2Q A;  3I5G B;  1NCY A;  2QAC A;  1CMF A;  5CSN A;  5ER4 X;  1GJY A;  3M0W A;  3OB1 B;  1UHK A;  1LKJ A;  3JTD C;  2AUC A;  1QLK A;  1A75 B;  2M29 A;  1F70 A;  3BUX B;  3PFV A;  3DD4 A;  1F54 A;  2M49 B;  1YRT B;  1N65 A;  2VRG A;  1XK4 A;  3GK2 A;  1S26 D;  2Y4Q A;  2JRF A;  1ODB A;  4JPZ B;  3TDI A;  2PAS A;  1CM1 A;  1PK0 D;  1VRK A;  3SIA A;  2JWW A;  3RLZ A;  1YUT A;  2NCP A;  1DVI A;  1UHI A;  4IL1 A;  5AEQ A;  1B47 A;  1UUR A;  2OS8 B;  3DVM A;  1QAT A;  3TUY C;  1H4B A;  2K2F A;  4QJ3 B;  2SAS A;  1ALV A;  1Y1A A;  1NCZ A;  3DVE A;  1XFX O;  4N1G A;  2KFF A;  2M7N A;  2BCB A;  2KNE A;  4F0Z B;  2A4J A;  1DF0 B;  4PHJ A;  1NYA A;  3EK4 A;  1CDN A;  1J7R A;  3C1V A;  2M9G A;  2JQ6 A;  3SG6 A;  3TDU A;  1AP4 A;  1OMV A;  1A2X A;  2Y1N A;  4PDZ A;  5CSF A;  2I18 A;  3LK1 A;  5I2O A;  1LA0 A;  2LP2 A;  1LXF C;  3BUO B;  3BOW B;  1ZFS A;  3SG3 A;  1TCF A;  3O2P A;  1NWD A;  2IS9 A;  5I8N A;  1PRW A;  1SL9 A;  3AKA A;  4R1E A;  2L2E A;  4TNC A;  2JU0 A;  3KPX A;  3CR2 A;  4HRG A;  2WCF A;  1DJG A;  1KSM A;  2LHL A;  3TS5 C;  2LM5 A;  4ORC B;  3CR5 X;  3SG7 A;  1ZMZ A;  1B8R A;  4M2Q A;  1YX7 A;  2TN4 A;  2BL0 C;  2NLN A;  1K8U A;  3I5H C;  1AJ5 A;  4A4B A;  1PVA A;  1XA5 A;  3EK8 A;  2ZND A;  1XFU O;  4P5O E;  1DMO A;  3SG2 A;  1W7J B;  4A4C A;  2M97 A;  2KHN A;  1SK6 D;  2I7A A;  3O78 A;  1QVI Z;  4YGC B;  3HCM A;  2KAV A;  2WOS A;  1B7T Y;  1QX7 A;  3GK4 X;  1AHR A;  2K0J A;  4QJ4 B;  1F4O A;  1MQ1 A;  2P6B B;  3BUW B;  4BY4 A;  2I2R E;  3NXA A;  1TOP A;  4MLW A;  5CSI A;  3ZNI A;  1S6C A;  1QX5 B;  2GV5 A;  1M31 A;  1B8L A;  1RK9 A;  1SKT A;  3PLF B;  4GFT A;  2ZFD A;  3NSK A;  2PAL A;  2KGR A;  1DTL A;  1RFJ A;  2R2I A;  2H61 C;  1HT9 A;  1BF5 A;  3GOF A;  4P2Y B;  2M1K B;  1RRO A;  4HRH A;  1SCM B;  3I5F B;  2JTZ A;  2JZI A;  1BLQ A;  4PE4 A;  1XO5 A;  3FIA A;  2GGM A;  3BUM B;  1DJH A;  1PSR A;  1MUX A;  2MBX A;  1BOD A;  2EC6 C;  1AVS A;  3F45 A;  1KK7 Y;  1BJF A;  1SRA A;  2HQW A;  2K8M B;  3CTN A;  3FS7 A;  3CLN A;  3NSO A;  4OKH A;  4YBH B;  5KSZ A;  1OZS A;  1OE9 B;  1WY9 A;  4GPL B;  1JF2 A;  3SIB A;  3ICB A;  2LVI A;  3DVK A;  2K61 A;  1JFK A;  3CR4 X;  3O6B A;  1WRK A;  3LK0 A;  1JSA A;  1F8H A;  1CLM A;  4NQG A;  3BXK A;  2OTG C;  4I5N B;  2LLT A;  3K21 A;  4YGD B;  4CPV A;  2MAZ A;  2D8N A;  5GQQ C;  1KFX S;  4JWQ A;  2B1U A;  2L51 A;  1ZUZ A;  4PE0 A;  3LL8 B;  1NP8 A;  1QX2 A;  4OR9 B;  1ZOT B;  1B4C A;  3OB2 B;  1KWO B;  4M2P A;  2L98 A;  5DKQ A;  5HLV A;  5PAL A;  5F6T A;  1E8A A;  1L2O B;  2LLU A;  2O5G A;  4MBE A;  3VRN A;  4UPG A;  1BT6 A;  2F3Y A;  2L4H A;  1JC2 A;  5KU1 A;  4AOM A;  4YGE B;  1XVJ A;  2HPS A;  1WDC B;  4GUK A;  2HQ8 A;  1W7I B;  5HKW A;  4MZK A;  2JXC A;  2M3W A;  3BQ3 A;  1TNX A;  2DOQ A;  2JT8 A;  1DGV A;  1CLL A;  2LVK A;  2I94 A;  3PAT A;  1GGW A;  1GQM A;  1CFF A;  1RTP 1;  2L0P A;  4I5K A;  1X02 A;  1SMG A;  4XJK A;  3BYA A;  2E30 A;  3JTD B;  5CSJ A;  4DIR A;  1DJY A;  2LP3 A;  4AQJ A;  5K89 A;  3A8R A;  2Q4U A;  3DF0 B;  3WHU B;  2KI4 C;  2KSP A;  4MZJ A;  1KFU S;  2K7C A;  2ZNE A;  4PHN A;  1KK8 C;  1KQM B;  1NCX A;  2BKI B;  1QXP A;  1PSB A;  2LAN A;  1QLS A;  1SL7 A;  4YGB B;  1XFV O;  1M39 A;  2LNK A;  1B1G A;  1S3P A;  1DJX A;  1Q80 A;  5ER5 A;  2WCE A;  3PN7 B;  2M0R A;  1WLZ A;  3D0Y A;  1M45 A;  5BPJ A;  1YUR A;  2BEC A;  2LCP A;  2H61 A;  4NDB A;  2Q91 A;  3CWG A;  1FF1 A;  2K7O A;  1CM4 A;  1NSH A;  1NPQ A;  1WRL A;  2JT0 A;  1EJ3 A;  2KFH A;  1V1F A;  1BG1 A;  4MRX A;  1JF0 A;  2ZN8 A;  4FQO A;  3WNX B;  1G4Y R;  1F4Q A;  1AJ4 A;  5DKN A;  4CLN A;  3EK7 A;  1JFJ A;  1AK8 A;  3I5I C;  4NDD A;  2KBI A;  2LV7 A;  1F55 A;  1MR8 A;  4USL A;  3NSI A;  1NIW A;  1FW4 A;  3LLE A;  4WRI A;  5JJG A;  1EL4 A;  1QIW A;  1TTX A;  1BMO A;  3EVV A;  4ETO A;  5HLO A;  4PCW A;  1QTX A;  1TIZ A;  4MEW A;  1FI5 A;  1A4P A;  1MWN A;  2MHH A;  2PMY A;  4PHM A;  4MSP A;  5D69 A;  2OPO A;  1KSO A;  4NDC A;  1V1G A;  1CTR A;  1R6P A;  1TCO B;  2LMT A;  1XFZ O;  1G33 A;  4E68 A;  1J1D A;  1J55 A;  1SR6 C;  1UHJ A;  1NX0 A;  5TNC A;  3AAJ A;  3OHM B;  2K2A A;  3EKH A;  1S1E A;  2ZRS A;  2QPT A;  3VRR A;  2BL0 B;  3I5H B;  3SG5 A;  1OZO A;  1NX1 A;  3OX6 A;  1B8C A;  1OSA A;  3KHE A;  1UWO A;  2LE9 B;  1OOJ A;  4FTG A;  4XJK B;  2BBN A;  2L5X B;  1CNP A;  1CLB A;  3WHT B;  2LLS A;  1N0Y A;  2COL B;  2JPT A;  4M2O A;  1B7T Z;  2KYF A;  1D1O A;  1K94 A;  4DRW A;  1EG3 A;  3SJS A;  1PVB A;  1SCM C;  2KAY A;  3I5F C;  3OX5 A;  1Y1X A;  3O4Y A;  2F2O A;  1JBA A;  2LHI A;  5I2L A;  2CCM A;  4YI8 A;  2KI6 C;  3D0Y B;  1YVL A;  2BKH B;  2KYC A;  1WRZ A;  1SW8 A;  1S6J A;  1YUU A;  2ZRT A;  1K9K A;  2MRD A;  1AUI B;  1XFY O;  3TZ1 A;  4ICB A;  4MZL A;  2BE6 A;  1PAL A;  2M1U A;  3A4U B;  1SPY A;  2ZN9 A;  1F71 A;  4GGF C;  4DCK A;  2L4I A;  1YVH A;  2EC6 B;  1IJ5 A;  1UHH A;  1K2H A;  1IRJ A;  1KK7 Z;  1S36 A;  4HSZ A;  3RM1 A;  1B9A A;  1M63 B;  1CB1 A;  1CFC A;  4Q04 A;  2MA2 A;  5FYX A;  1YTZ C;  4L9M A;  4CID A;  4CFR A;  1KQV A;  2AAO A;  3VRQ A;  4C0J A;  1CFP A;  2JXL A;  2MLF C;  3JVT C;  3CS1 A;  5HKZ A;  2LUX A;  1ZAC A;  3I5G C;  2JOJ A;  2CT9 A;  2OTG B;  1L2O C;  1YX8 A;  3IF7 A;  1DT7 B;  1KFX L;  1CFD A;  2LUC A;  1BR1 B;  1J7O A;  1MHO A;  1XFW O;  1QV0 A;  1WDC C;  1J7Q A;  1TNP A;  1IGV A;  2KQ6 A;  4PE7 A;  1QAS A;  3FWC A;  1G8I A;  2F3Z A;  2CXJ A;  2M8U A;  1S6I A;  1EG4 A;  2V53 A;  4YGA A;  2MJW B;  2M7L A;  2K7D A;  1OMR A;  2G9B A;  2KI6 D;  2AMI A;  2F8P A;  4PAL A;  1YR5 A;  5HKY A;  3WXA A;  2FJU B;  3VRP A;  4YI9 A;  1K9U A;  2CNP A;  2OS8 C;  1U5I A;  2WND A;  2Y1M A;  1Y0V H;  3NSL A;  4U8D A;  5AFP A;  2WCB A;  1PUL A;  1UHN A;  2JC2 A;  2FOT A;  1ALW A;  1IH0 A;  2JT3 A;  2EHB A;  3AAK A;  1K95 A;  4AQI A;  1KQM C;  2LAP A;  2KQY A;  3KEV A;  5IBW A;  2G2B A;  4GAO A;  2KOT A;  4WQ3 A;  3TUY B;  2F2P A;  1L7Z A;  4DUQ A;  3PN7 C;  1UUS A;  1SCV A;  4N5X A;  2JTT A;  4ZCU A;  1SBJ A;  2KI4 B;  2BE4 A;  1KFU L;  1YRU B;  5KTY A;  1YUS A;  1M46 A;  1DJI A;  1KCY A;  1FBV A;  1H8B A;  1J7P A;  1KK8 B;  4OVN F;  1A03 A;  1R2U A;  1C7V A;  2WOR A;  2SCP A;  1CDM A;  4DS7 A;  3VGO A;  2Y5I A;  3OP0 A;  3PSR A;  4ORB B;  2HF5 A;  2FCD A;  5JOL A;  3PAL A;  3EKJ A;  2MLE C;  1TN4 A;  3KO0 A;  2PSR A;  4GGF A;  2NXQ A;  1C7W A;  2F33 A;  4OV2 A;  4XYN A;  3D10 A;  1TNW A;  3LCP C;  3KF9 A;  3TS5 B;  2LMV A;  3H4S E;  1QJT A;  3I5I B;  2BCA A;  4WQ2 A;  4ZCV A;  4MRY A;  1GGZ A;  1NX2 A;  1IG5 A;  1QVI Y;  1IKU A;  4MN0 A;  2LC5 A;  1DJW A;  4C0K A;  1FI6 A;  3E3R A;  2ZKM X;  4GGN A;  1REC A;  1FPW A;  1SYM A;  1EH2 A;  1MXE A;  1JUO A;  1XK4 C;  1SY9 A;  4MVF A;  1IWQ A;  2HET A;  3MSE B;  3QRX A;  5B8I B;  2KAX A;  5AER A;  2LMU A;  1WLM A;  1BR4 B;  3CGA A;  3CZT X;  3TDZ A;  2O60 A;  2KDH A;  1XYD A;  1OMD A;  3SG4 A;  4GNK B;  4C0L A;  5HYD A;  4JQ0 D;  3ZWH A;  1QS7 A;  1U5I B;  1SR6 B;  3IQO A;  1A75 A;  5J3X A;  4D1E A;  2KFG A;  2NCO A;  2NZ0 A;  1HQV A;  1LA3 A;  1N2D A;  1SL8 A;  2LVJ A;  3EVR A;  4OCI A;  4PE1 A;  3DVJ A;  2FCE A;  1EXR A;  2CBL A;  3BUN B;  5AXI A;  2PRU A;  2PVB A;  4BY5 A; 
#chains in the Genus database with same CATH topology
 2K7B A;  1RWY A;  1S5G Y;  5HL1 A;  1Y6W A;  1QV1 A;  1K93 D;  5DKR A;  4CFQ A;  1LIN A;  1MXL C;  2JUL A;  1Y1U A;  4OZD A;  1TRF A;  1CDP A;  1NX3 A;  1OOG A;  1UP5 A;  3DF0 A;  4QJ5 B;  2BNX A;  1DGU A;  3EVU A;  2EGD A;  2WC8 A;  4PHK A;  2PYQ A;  2JNF A;  1DF0 A;  3S0G A;  1K9P A;  3FE6 A;  1BU3 A;  3FWB A;  4ORA B;  1A29 A;  1CKK A;  3Q8I A;  3BFH A;  1SNL A;  4INW A;  5D7F A;  3BFB A;  1RJV A;  2L5Y A;  1S5G Z;  2BAP A;  4YRU A;  3B86 A;  1JWD A;  1K90 D;  4I5J A;  1MF8 B;  2ISD A;  3BOW A;  1GM0 A;  2KBM A;  2RGI A;  5CPV A;  2BCX A;  3VRO A;  1C07 A;  1LVC D;  1KWO C;  2KGB C;  1NUB A;  5AAN A;  3GK1 A;  3AKB A;  3CZ0 A;  1IJ6 A;  2BBM A;  3S0D A;  2E6W A;  1IQ5 A;  2H2K A;  4HRE E;  1OQP A;  3PM8 A;  3HX4 A;  1DJZ A;  4I5L B;  5G08 A;  2KLE A;  2WCH A;  4N1F A;  3IQQ A;  2LVV A;  4GBA A;  1QIV A;  2L50 A;  1IQ3 A;  3NHT A;  1CDL A;  1ORG A;  4KYN A;  1J1E A;  2CTN A;  1K96 A;  2GGZ A;  3JVT B;  1CMG A;  2JNX A;  1TNQ A;  1BOC A;  1TUZ A;  3I5G B;  5I2Q A;  1NCY A;  2QAC A;  3D76 A;  3VB1 A;  1CMF A;  5CSN A;  5ER4 X;  1GJY A;  3M0W A;  3OB1 B;  1UHK A;  3EG5 B;  1LKJ A;  3JTD C;  2AUC A;  1QLK A;  1A75 B;  2M29 A;  3DZT A;  1F70 A;  3CDN A;  3BUX B;  3PFV A;  3DD4 A;  3K1E A;  1F54 A;  2M49 B;  1YRT B;  1N65 A;  2P71 A;  2VRG A;  1XK4 A;  3CYZ A;  3D77 A;  3GK2 A;  3UNW A;  1S26 D;  2Y4Q A;  2JRF A;  1ODB A;  4JPZ B;  3TDI A;  2PAS A;  1CM1 A;  1PK0 D;  1VRK A;  3R1V A;  3SIA A;  2JWW A;  3RLZ A;  1YUT A;  2NCP A;  1DVI A;  1UHI A;  4IL1 A;  5AEQ A;  1B47 A;  1UUR A;  2OS8 B;  3DVM A;  1QAT A;  3TUY C;  1H4B A;  2K2F A;  4QJ3 B;  2SAS A;  1ALV A;  1Y1A A;  1NCZ A;  3DVE A;  1XFX O;  4N1G A;  2KFF A;  2M7N A;  2BCB A;  2KNE A;  4F0Z B;  1Z2C B;  5I94 A;  2A4J A;  1DF0 B;  4PHJ A;  1NYA A;  3EK4 A;  1CDN A;  1J7R A;  3C1V A;  2M9G A;  1DC1 A;  2JQ6 A;  3SG6 A;  3TDU A;  1AP4 A;  1OMV A;  1A2X A;  2Y1N A;  4PDZ A;  5CSF A;  2I18 A;  3D73 A;  3LK1 A;  5I2O A;  1TWO A;  1LA0 A;  2LP2 A;  1LXF C;  3BUO B;  1C3Y A;  3BOW B;  1ZFS A;  3SG3 A;  3D74 A;  1TCF A;  3O2P A;  1NWD A;  2IS9 A;  5I8N A;  1PRW A;  1SL9 A;  3AKA A;  4R1E A;  2L2E A;  4TNC A;  2JU0 A;  3SS3 A;  3KPX A;  3CR2 A;  4HRG A;  2WCF A;  1DJG A;  1KSM A;  2LHL A;  3TS5 C;  2LM5 A;  4ORC B;  3CR5 X;  5DIC A;  3SG7 A;  1ZMZ A;  1B8R A;  3IVT A;  4M2Q A;  1YX7 A;  2TN4 A;  2BL0 C;  2NLN A;  1K8U A;  3I5H C;  1AJ5 A;  4A4B A;  1PVA A;  1XA5 A;  3EK8 A;  2KPH A;  2ZND A;  1XFU O;  4P5O E;  1DMO A;  3SG2 A;  2QDI A;  1W7J B;  4A4C A;  3SS5 A;  2M97 A;  2KHN A;  1SK6 D;  2I7A A;  3O78 A;  3OBV A;  1QVI Z;  4YGC B;  3HCM A;  5D3O A;  2KAV A;  2WOS A;  1B7T Y;  1QX7 A;  1QWV A;  3GK4 X;  1AHR A;  2K0J A;  3R72 A;  4QJ4 B;  1F4O A;  1MQ1 A;  2P6B B;  3BUW B;  4BY4 A;  2I2R E;  3NXA A;  1TOP A;  3B88 A;  4MLW A;  5CSI A;  3ZNI A;  1S6C A;  3V2L A;  4JD9 A;  1QX5 B;  2GV5 A;  1M31 A;  1B8L A;  1RK9 A;  3L4L A;  1SKT A;  3PLF B;  4GFT A;  2ZFD A;  3NSK A;  2PAL A;  4PT1 A;  2KGR A;  3DYE A;  1DTL A;  1RFJ A;  2R2I A;  2H61 C;  1HT9 A;  1BF5 A;  3GOF A;  4P2Y B;  2M1K B;  1RRO A;  4HRH A;  1SCM B;  2WCL A;  3I5F B;  3BFA A;  2JTZ A;  2JZI A;  2KLD A;  1BLQ A;  4PE4 A;  1XO5 A;  3PM2 A;  3FIA A;  2GGM A;  3BUM B;  1DJH A;  1PSR A;  1MUX A;  2MBX A;  1BOD A;  2EC6 C;  1AVS A;  4FQT A;  3F45 A;  1KK7 Y;  1BJF A;  1SRA A;  2HQW A;  2K8M B;  3CTN A;  3FS7 A;  3CLN A;  3NSO A;  4OKH A;  2QEB A;  4YBH B;  5KSZ A;  1OZS A;  1OE9 B;  1WY9 A;  4GPL B;  1JF2 A;  3SIB A;  3ICB A;  2LVI A;  3DVK A;  2K61 A;  1JFK A;  3CR4 X;  3O6B A;  1WRK A;  3LK0 A;  1JSA A;  1F8H A;  1CLM A;  4NQG A;  3BXK A;  2OTG C;  4I5N B;  2LLT A;  3K21 A;  4YGD B;  3UO9 A;  4CPV A;  2MAZ A;  2D8N A;  5GQQ C;  1KFX S;  4JWQ A;  2B1U A;  2L51 A;  3R1P A;  1ZUZ A;  4PE0 A;  3LL8 B;  1NP8 A;  1QX2 A;  3QME A;  1ZOT B;  4OR9 B;  3OB2 B;  1KWO B;  4M2P A;  1B4C A;  2L98 A;  5DKQ A;  5HLV A;  5PAL A;  5F6T A;  1E8A A;  1L2O B;  1W9Z A;  2LLU A;  2O5G A;  2YGU A;  4MBE A;  3VRN A;  4UPG A;  1BT6 A;  2F3Y A;  2L4H A;  1JC2 A;  5KU1 A;  4AOM A;  2K60 A;  4YGE B;  1XVJ A;  2HPS A;  1WDC B;  4GUK A;  2HQ8 A;  1W7I B;  5HKW A;  4MZK A;  2JXC A;  2M3W A;  3BQ3 A;  1TNX A;  2DOQ A;  2JT8 A;  1DGV A;  3D75 A;  2ERB A;  3DXL A;  1CLL A;  2LVK A;  2I94 A;  3PAT A;  1T14 A;  1GGW A;  1GQM A;  1CFF A;  1RTP 1;  2L0P A;  4I5K A;  1X02 A;  1SMG A;  4XJK A;  3BYA A;  2E30 A;  3JTD B;  5CSJ A;  4DIR A;  1DJY A;  2LP3 A;  4AQJ A;  5K89 A;  3A8R A;  2Q4U A;  3DF0 B;  3WHU B;  2FJY A;  3FE8 A;  2KI4 C;  2KSP A;  4MZJ A;  1KFU S;  2K7C A;  2ZNE A;  4PHN A;  1OOF A;  1KK8 C;  1KQM B;  1NCX A;  2BKI B;  1QXP A;  1PSB A;  2LAN A;  1QLS A;  2WC5 A;  1DQE A;  1SL7 A;  2QEV A;  4YGB B;  1XFV O;  1M39 A;  2LNK A;  1B1G A;  1S3P A;  1DJX A;  1Q80 A;  5ER5 A;  2WCE A;  3PN7 B;  2M0R A;  1TUJ A;  1WLZ A;  3D0Y A;  1M45 A;  5BPJ A;  1YUR A;  2BEC A;  2LCP A;  2H61 A;  4NDB A;  2Q91 A;  3CWG A;  1FF1 A;  2K7O A;  1CM4 A;  1NSH A;  1NPQ A;  1WRL A;  2JT0 A;  1EJ3 A;  2KFH A;  1V1F A;  1BG1 A;  1OW4 A;  1JF0 A;  4MRX A;  2ZN8 A;  4FQO A;  3WNX B;  1G4Y R;  1F4Q A;  1AJ4 A;  5DKN A;  4CLN A;  3EK7 A;  1JFJ A;  1AK8 A;  3I5I C;  4NDD A;  2KBI A;  2LV7 A;  1F55 A;  1MR8 A;  2WC6 A;  4USL A;  3NSI A;  1NIW A;  3FE9 A;  1FW4 A;  3LLE A;  2JPO A;  4WRI A;  5JJG A;  1EL4 A;  1QIW A;  1TTX A;  1BMO A;  3EVV A;  1P28 A;  4ETO A;  5HLO A;  4PCW A;  1QTX A;  1TIZ A;  4MEW A;  1FI5 A;  1A4P A;  1DEL A;  1MWN A;  2MHH A;  2PMY A;  4PHM A;  4MSP A;  5D69 A;  2OPO A;  1KSO A;  4NDC A;  1V1G A;  1CTR A;  1R6P A;  1TCO B;  2LMT A;  1XFZ O;  3B7A A;  1G33 A;  3O4X A;  4E68 A;  1J1D A;  1J55 A;  1SR6 C;  1UHJ A;  1NX0 A;  5TNC A;  3AAJ A;  3OHM B;  2K2A A;  3EKH A;  1S1E A;  2ZRS A;  2QPT A;  3VRR A;  3S0F A;  2BL0 B;  3I5H B;  3SG5 A;  1OZO A;  3N7H A;  1NX1 A;  3OX6 A;  5FI6 A;  1B8C A;  1OSA A;  3KHE A;  3DY9 A;  1UWO A;  2LE9 B;  1OOJ A;  4FTG A;  4XJK B;  2BBN A;  2L5X B;  1CNP A;  1CLB A;  3L47 A;  3WHT B;  2GTE A;  1OOH A;  2LLS A;  1N0Y A;  2COL B;  1XFR A;  2JPT A;  4M2O A;  1B7T Z;  2KYF A;  3R1O A;  1D1O A;  3BJH A;  1K94 A;  2WCM A;  4DRW A;  1EG3 A;  1OOI X;  3SJS A;  1PVB A;  1SCM C;  2KAY A;  3I5F C;  3OX5 A;  1Y1X A;  3O4Y A;  2F2O A;  1JBA A;  2LHI A;  5I2L A;  2CCM A;  4YI8 A;  2KI6 C;  2WCK A;  3D0Y B;  1YVL A;  2BKH B;  2KYC A;  1WRZ A;  1SW8 A;  1S6J A;  1YUU A;  2ZRT A;  1K9K A;  2MRD A;  3CZ2 A;  3S0E A;  1AUI B;  1XFY O;  3TZ1 A;  4ICB A;  3OGN A;  4MZL A;  2BE6 A;  1PAL A;  2M1U A;  3A4U B;  1SPY A;  2ZN9 A;  1F71 A;  4GGF C;  4DCK A;  2L4I A;  4INX A;  1YVH A;  2EC6 B;  1IJ5 A;  1UHH A;  1K2H A;  1IRJ A;  1KK7 Z;  1S36 A;  3CZ1 A;  4HSZ A;  1B9A A;  3RM1 A;  1M63 B;  3B6X A;  1CFC A;  1CB1 A;  4Q04 A;  2MA2 A;  5FYX A;  1YTZ C;  4L9M A;  4CID A;  4CFR A;  1KQV A;  2AAO A;  3VRQ A;  4C0J A;  1CFP A;  2JXL A;  2MLF C;  2WCJ A;  3JVT C;  3CS1 A;  5HKZ A;  2LUX A;  1ZAC A;  3I5G C;  2JOJ A;  2CT9 A;  3S0B A;  2OTG B;  1L2O C;  1YX8 A;  1C3Z A;  3IF7 A;  1DT7 B;  1KFX L;  1CFD A;  2LUC A;  1BR1 B;  1J7O A;  1MHO A;  1XFW O;  1QV0 A;  1WDC C;  1J7Q A;  1TNP A;  1IGV A;  2KQ6 A;  4PE7 A;  3S0A A;  5FI2 A;  1QAS A;  3FWC A;  1G8I A;  2F3Z A;  2P70 A;  1DEK A;  2CXJ A;  2M8U A;  1S6I A;  1EG4 A;  2V53 A;  3PJI A;  4YGA A;  2MJW B;  2M7L A;  2K7D A;  1OMR A;  2G9B A;  2KI6 D;  3L4A A;  2AMI A;  2F8P A;  4PAL A;  1YR5 A;  5HKY A;  2H8V A;  3WXA A;  2FJU B;  3VRP A;  2PQL A;  4YI9 A;  1K9U A;  2CNP A;  2OS8 C;  1U5I A;  2L2C A;  2WND A;  2Y1M A;  1Y0V H;  3NSL A;  4U8D A;  5AFP A;  2WCB A;  1PUL A;  1UHN A;  2JC2 A;  2FOT A;  1ALW A;  1IH0 A;  2JT3 A;  2EHB A;  2QEO A;  1K95 A;  3AAK A;  4AQI A;  1KQM C;  2LAP A;  2KQY A;  3KEV A;  5IBW A;  2G2B A;  4GAO A;  2KOT A;  3NHI A;  4WQ3 A;  3TUY B;  2F2P A;  1L7Z A;  4DUQ A;  3PN7 C;  1UUS A;  1SCV A;  4N5X A;  2JTT A;  4ZCU A;  1SBJ A;  2KI4 B;  1YRU B;  1KFU L;  2BE4 A;  5KTY A;  1YUS A;  1M46 A;  1DJI A;  1KCY A;  1FBV A;  1H8B A;  1J7P A;  1KK8 B;  3CAB A;  4OVN F;  3D78 A;  1A03 A;  1R2U A;  1Z4H A;  1C7V A;  2WOR A;  2SCP A;  1CDM A;  4DS7 A;  3VGO A;  2Y5I A;  3OP0 A;  3PSR A;  4ORB B;  2HF5 A;  1LS8 A;  2FCD A;  5FI7 A;  5JOL A;  1SSE B;  3PAL A;  3EKJ A;  2MLE C;  1TN4 A;  3KO0 A;  2PSR A;  5EL2 A;  4GGF A;  2NXQ A;  1C7W A;  2F33 A;  4OV2 A;  4XYN A;  3NGV A;  1IIO A;  3D10 A;  1TNW A;  3LCP C;  3KF9 A;  3TS5 B;  2LMV A;  3H4S E;  1QJT A;  3I5I B;  2BCA A;  4WQ2 A;  4ZCV A;  4MRY A;  3B87 A;  1GGZ A;  1NX2 A;  1IG5 A;  1QVI Y;  1IKU A;  4MN0 A;  2QEH A;  2LC5 A;  1DJW A;  4C0K A;  1FI6 A;  3E3R A;  2ZKM X;  4GGN A;  1REC A;  1FPW A;  1SYM A;  3RZS A;  1MXE A;  1EH2 A;  1JUO A;  1XK4 C;  1SY9 A;  4MVF A;  1IWQ A;  2HET A;  3MSE B;  3QRX A;  5B8I B;  2KAX A;  4IJ7 A;  2LMU A;  5AER A;  1WLM A;  1BR4 B;  3CGA A;  3CZT X;  3TDZ A;  2O60 A;  2KDH A;  1XYD A;  1OMD A;  3SG4 A;  4GNK B;  4C0L A;  5HYD A;  4JQ0 D;  3ZWH A;  1QS7 A;  1U5I B;  1SR6 B;  3IQO A;  1A75 A;  3SS4 A;  5J3X A;  4D1E A;  2KFG A;  2NCO A;  2NZ0 A;  1HQV A;  1LA3 A;  1N2D A;  1SL8 A;  2LVJ A;  3EVR A;  4OCI A;  4PE1 A;  4F7F A;  3DVJ A;  2FCE A;  1EXR A;  2CBL A;  3BUN B;  5AXI A;  2PRU A;  2PVB A;  4JKT A;  4BY5 A; 
#chains in the Genus database with same CATH homology
 2K7B A;  1RWY A;  1S5G Y;  1Y6W A;  1QV1 A;  1K93 D;  5DKR A;  4CFQ A;  1LIN A;  1MXL C;  2JUL A;  1Y1U A;  1TRF A;  1CDP A;  1NX3 A;  1UP5 A;  3DF0 A;  4QJ5 B;  1DGU A;  3EVU A;  2EGD A;  2WC8 A;  4PHK A;  2JNF A;  1DF0 A;  1K9P A;  1BU3 A;  3FWB A;  4ORA B;  1A29 A;  1CKK A;  1SNL A;  5D7F A;  1RJV A;  1S5G Z;  4YRU A;  1JWD A;  1K90 D;  4I5J A;  1MF8 B;  2ISD A;  3BOW A;  2KBM A;  2RGI A;  5CPV A;  2BCX A;  3VRO A;  1C07 A;  1LVC D;  1KWO C;  2KGB C;  1NUB A;  5AAN A;  3GK1 A;  3AKB A;  1IJ6 A;  2BBM A;  2E6W A;  1IQ5 A;  2H2K A;  4HRE E;  1OQP A;  3PM8 A;  3HX4 A;  1DJZ A;  4I5L B;  5G08 A;  4N1F A;  3IQQ A;  2LVV A;  4GBA A;  1QIV A;  2L50 A;  1IQ3 A;  1CDL A;  1J1E A;  2CTN A;  1K96 A;  2GGZ A;  3JVT B;  1CMG A;  2JNX A;  1TNQ A;  1BOC A;  5I2Q A;  3I5G B;  1NCY A;  2QAC A;  1CMF A;  5CSN A;  5ER4 X;  1GJY A;  3M0W A;  3OB1 B;  1UHK A;  1LKJ A;  3JTD C;  2AUC A;  1QLK A;  1A75 B;  2M29 A;  1F70 A;  3BUX B;  3PFV A;  3DD4 A;  1F54 A;  2M49 B;  1YRT B;  1N65 A;  2VRG A;  1XK4 A;  3GK2 A;  1S26 D;  2Y4Q A;  2JRF A;  1ODB A;  4JPZ B;  3TDI A;  2PAS A;  1CM1 A;  1PK0 D;  1VRK A;  3SIA A;  2JWW A;  3RLZ A;  1YUT A;  2NCP A;  1DVI A;  1UHI A;  4IL1 A;  5AEQ A;  1B47 A;  1UUR A;  2OS8 B;  3DVM A;  1QAT A;  3TUY C;  1H4B A;  2K2F A;  4QJ3 B;  2SAS A;  1ALV A;  1Y1A A;  1NCZ A;  3DVE A;  1XFX O;  4N1G A;  2KFF A;  2M7N A;  2BCB A;  2KNE A;  4F0Z B;  2A4J A;  1DF0 B;  4PHJ A;  1NYA A;  3EK4 A;  1CDN A;  1J7R A;  3C1V A;  2M9G A;  2JQ6 A;  3SG6 A;  3TDU A;  1AP4 A;  1OMV A;  1A2X A;  2Y1N A;  4PDZ A;  5CSF A;  2I18 A;  3LK1 A;  5I2O A;  1LA0 A;  2LP2 A;  1LXF C;  3BUO B;  3BOW B;  1ZFS A;  3SG3 A;  1TCF A;  3O2P A;  1NWD A;  2IS9 A;  5I8N A;  1PRW A;  1SL9 A;  3AKA A;  4R1E A;  2L2E A;  4TNC A;  2JU0 A;  3KPX A;  3CR2 A;  4HRG A;  2WCF A;  1DJG A;  1KSM A;  2LHL A;  3TS5 C;  2LM5 A;  4ORC B;  3CR5 X;  3SG7 A;  1ZMZ A;  1B8R A;  4M2Q A;  1YX7 A;  2TN4 A;  2BL0 C;  2NLN A;  1K8U A;  3I5H C;  1AJ5 A;  4A4B A;  1PVA A;  1XA5 A;  3EK8 A;  2ZND A;  1XFU O;  4P5O E;  1DMO A;  3SG2 A;  1W7J B;  4A4C A;  2M97 A;  2KHN A;  1SK6 D;  2I7A A;  3O78 A;  1QVI Z;  4YGC B;  3HCM A;  2KAV A;  2WOS A;  1B7T Y;  1QX7 A;  3GK4 X;  1AHR A;  2K0J A;  4QJ4 B;  1F4O A;  1MQ1 A;  2P6B B;  3BUW B;  4BY4 A;  2I2R E;  3NXA A;  1TOP A;  4MLW A;  5CSI A;  3ZNI A;  1S6C A;  1QX5 B;  2GV5 A;  1M31 A;  1B8L A;  1RK9 A;  1SKT A;  3PLF B;  4GFT A;  2ZFD A;  3NSK A;  2PAL A;  2KGR A;  1DTL A;  1RFJ A;  2R2I A;  2H61 C;  1HT9 A;  1BF5 A;  3GOF A;  4P2Y B;  2M1K B;  1RRO A;  4HRH A;  1SCM B;  3I5F B;  2JTZ A;  2JZI A;  1BLQ A;  4PE4 A;  1XO5 A;  3FIA A;  2GGM A;  3BUM B;  1DJH A;  1PSR A;  1MUX A;  2MBX A;  1BOD A;  2EC6 C;  1AVS A;  3F45 A;  1KK7 Y;  1BJF A;  1SRA A;  2HQW A;  2K8M B;  3CTN A;  3FS7 A;  3CLN A;  3NSO A;  4OKH A;  4YBH B;  5KSZ A;  1OZS A;  1OE9 B;  1WY9 A;  4GPL B;  1JF2 A;  3SIB A;  3ICB A;  2LVI A;  3DVK A;  2K61 A;  1JFK A;  3CR4 X;  3O6B A;  1WRK A;  3LK0 A;  1JSA A;  1F8H A;  1CLM A;  4NQG A;  3BXK A;  2OTG C;  4I5N B;  2LLT A;  3K21 A;  4YGD B;  4CPV A;  2MAZ A;  2D8N A;  5GQQ C;  1KFX S;  4JWQ A;  2B1U A;  2L51 A;  1ZUZ A;  4PE0 A;  3LL8 B;  1NP8 A;  1QX2 A;  4OR9 B;  1ZOT B;  1B4C A;  3OB2 B;  1KWO B;  4M2P A;  2L98 A;  5DKQ A;  5HLV A;  5PAL A;  5F6T A;  1E8A A;  1L2O B;  2LLU A;  2O5G A;  4MBE A;  3VRN A;  4UPG A;  1BT6 A;  2F3Y A;  2L4H A;  1JC2 A;  5KU1 A;  4AOM A;  4YGE B;  1XVJ A;  2HPS A;  1WDC B;  4GUK A;  2HQ8 A;  1W7I B;  5HKW A;  4MZK A;  2JXC A;  2M3W A;  3BQ3 A;  1TNX A;  2DOQ A;  2JT8 A;  1DGV A;  1CLL A;  2LVK A;  2I94 A;  3PAT A;  1GGW A;  1GQM A;  1CFF A;  1RTP 1;  2L0P A;  4I5K A;  1X02 A;  1SMG A;  4XJK A;  3BYA A;  2E30 A;  3JTD B;  5CSJ A;  4DIR A;  1DJY A;  2LP3 A;  4AQJ A;  5K89 A;  3A8R A;  2Q4U A;  3DF0 B;  3WHU B;  2KI4 C;  2KSP A;  4MZJ A;  1KFU S;  2K7C A;  2ZNE A;  4PHN A;  1KK8 C;  1KQM B;  1NCX A;  2BKI B;  1QXP A;  1PSB A;  2LAN A;  1QLS A;  1SL7 A;  4YGB B;  1XFV O;  1M39 A;  2LNK A;  1B1G A;  1S3P A;  1DJX A;  1Q80 A;  5ER5 A;  2WCE A;  3PN7 B;  2M0R A;  1WLZ A;  3D0Y A;  1M45 A;  5BPJ A;  1YUR A;  2BEC A;  2LCP A;  2H61 A;  4NDB A;  2Q91 A;  3CWG A;  1FF1 A;  2K7O A;  1CM4 A;  1NSH A;  1NPQ A;  1WRL A;  2JT0 A;  1EJ3 A;  2KFH A;  1V1F A;  1BG1 A;  4MRX A;  1JF0 A;  2ZN8 A;  4FQO A;  3WNX B;  1G4Y R;  1F4Q A;  1AJ4 A;  5DKN A;  4CLN A;  3EK7 A;  1JFJ A;  1AK8 A;  3I5I C;  4NDD A;  2KBI A;  2LV7 A;  1F55 A;  1MR8 A;  4USL A;  3NSI A;  1NIW A;  1FW4 A;  3LLE A;  4WRI A;  5JJG A;  1EL4 A;  1QIW A;  1TTX A;  1BMO A;  3EVV A;  4ETO A;  5HLO A;  4PCW A;  1QTX A;  1TIZ A;  4MEW A;  1FI5 A;  1A4P A;  1MWN A;  2MHH A;  2PMY A;  4PHM A;  4MSP A;  5D69 A;  2OPO A;  1KSO A;  4NDC A;  1V1G A;  1CTR A;  1R6P A;  1TCO B;  2LMT A;  1XFZ O;  1G33 A;  4E68 A;  1J1D A;  1J55 A;  1SR6 C;  1UHJ A;  1NX0 A;  5TNC A;  3AAJ A;  3OHM B;  2K2A A;  3EKH A;  1S1E A;  2ZRS A;  2QPT A;  3VRR A;  2BL0 B;  3I5H B;  3SG5 A;  1OZO A;  1NX1 A;  3OX6 A;  1B8C A;  1OSA A;  3KHE A;  1UWO A;  2LE9 B;  1OOJ A;  4FTG A;  4XJK B;  2BBN A;  2L5X B;  1CNP A;  1CLB A;  3WHT B;  2LLS A;  1N0Y A;  2COL B;  2JPT A;  4M2O A;  1B7T Z;  2KYF A;  1D1O A;  1K94 A;  4DRW A;  1EG3 A;  3SJS A;  1PVB A;  1SCM C;  2KAY A;  3I5F C;  3OX5 A;  1Y1X A;  3O4Y A;  2F2O A;  1JBA A;  2LHI A;  5I2L A;  2CCM A;  4YI8 A;  2KI6 C;  3D0Y B;  1YVL A;  2BKH B;  2KYC A;  1WRZ A;  1SW8 A;  1S6J A;  1YUU A;  2ZRT A;  1K9K A;  2MRD A;  1AUI B;  1XFY O;  3TZ1 A;  4ICB A;  4MZL A;  2BE6 A;  1PAL A;  2M1U A;  3A4U B;  1SPY A;  2ZN9 A;  1F71 A;  4GGF C;  4DCK A;  2L4I A;  1YVH A;  2EC6 B;  1IJ5 A;  1UHH A;  1K2H A;  1IRJ A;  1KK7 Z;  1S36 A;  4HSZ A;  3RM1 A;  1B9A A;  1M63 B;  1CB1 A;  1CFC A;  4Q04 A;  2MA2 A;  5FYX A;  1YTZ C;  4L9M A;  4CID A;  4CFR A;  1KQV A;  2AAO A;  3VRQ A;  4C0J A;  1CFP A;  2JXL A;  2MLF C;  3JVT C;  3CS1 A;  5HKZ A;  2LUX A;  1ZAC A;  3I5G C;  2JOJ A;  2CT9 A;  2OTG B;  1L2O C;  1YX8 A;  3IF7 A;  1DT7 B;  1KFX L;  1CFD A;  2LUC A;  1BR1 B;  1J7O A;  1MHO A;  1XFW O;  1QV0 A;  1WDC C;  1J7Q A;  1TNP A;  1IGV A;  2KQ6 A;  4PE7 A;  1QAS A;  3FWC A;  1G8I A;  2F3Z A;  2CXJ A;  2M8U A;  1S6I A;  1EG4 A;  2V53 A;  4YGA A;  2MJW B;  2M7L A;  2K7D A;  1OMR A;  2G9B A;  2KI6 D;  2AMI A;  2F8P A;  4PAL A;  1YR5 A;  5HKY A;  3WXA A;  2FJU B;  3VRP A;  4YI9 A;  1K9U A;  2CNP A;  2OS8 C;  1U5I A;  2WND A;  2Y1M A;  1Y0V H;  3NSL A;  4U8D A;  5AFP A;  2WCB A;  1PUL A;  1UHN A;  2JC2 A;  2FOT A;  1ALW A;  1IH0 A;  2JT3 A;  2EHB A;  3AAK A;  1K95 A;  4AQI A;  1KQM C;  2LAP A;  2KQY A;  3KEV A;  5IBW A;  2G2B A;  4GAO A;  2KOT A;  4WQ3 A;  3TUY B;  2F2P A;  1L7Z A;  4DUQ A;  3PN7 C;  1UUS A;  1SCV A;  4N5X A;  2JTT A;  4ZCU A;  1SBJ A;  2KI4 B;  2BE4 A;  1KFU L;  1YRU B;  5KTY A;  1YUS A;  1M46 A;  1DJI A;  1KCY A;  1FBV A;  1H8B A;  1J7P A;  1KK8 B;  4OVN F;  1A03 A;  1R2U A;  1C7V A;  2WOR A;  2SCP A;  1CDM A;  4DS7 A;  3VGO A;  2Y5I A;  3OP0 A;  3PSR A;  4ORB B;  2HF5 A;  2FCD A;  5JOL A;  3PAL A;  3EKJ A;  2MLE C;  1TN4 A;  3KO0 A;  2PSR A;  4GGF A;  2NXQ A;  1C7W A;  2F33 A;  4OV2 A;  4XYN A;  3D10 A;  1TNW A;  3LCP C;  3KF9 A;  3TS5 B;  2LMV A;  3H4S E;  1QJT A;  3I5I B;  2BCA A;  4WQ2 A;  4ZCV A;  4MRY A;  1GGZ A;  1NX2 A;  1IG5 A;  1QVI Y;  1IKU A;  4MN0 A;  2LC5 A;  1DJW A;  4C0K A;  1FI6 A;  3E3R A;  2ZKM X;  4GGN A;  1REC A;  1FPW A;  1SYM A;  1EH2 A;  1MXE A;  1JUO A;  1XK4 C;  1SY9 A;  4MVF A;  1IWQ A;  2HET A;  3MSE B;  3QRX A;  5B8I B;  2KAX A;  5AER A;  2LMU A;  1WLM A;  1BR4 B;  3CGA A;  3CZT X;  3TDZ A;  2O60 A;  2KDH A;  1XYD A;  1OMD A;  3SG4 A;  4GNK B;  4C0L A;  5HYD A;  4JQ0 D;  3ZWH A;  1QS7 A;  1U5I B;  1SR6 B;  3IQO A;  1A75 A;  5J3X A;  4D1E A;  2KFG A;  2NCO A;  2NZ0 A;  1HQV A;  1LA3 A;  1N2D A;  1SL8 A;  2LVJ A;  3EVR A;  4OCI A;  4PE1 A;  3DVJ A;  2FCE A;  1EXR A;  2CBL A;  3BUN B;  5AXI A;  2PRU A;  2PVB A;  4BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...