4CFQA

Ca-bound truncated (delta13c) and c3s, c81s and c86s mutated s100a4 complexed with non-muscle myosin iia
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
85
Chain Sequence
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
molecule keywords PROTEIN S100-A4
total genus 32
structure length 85
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfqA00
1YURA 3PATA 1KFXS 2CCMA 3KEVA 4QJ5B 1B8RA 2L2EA 1D1OA 3CTNA 3LK0A 1AJ4A 3BOWB 1TNXA 3BXKA 3CLNA 2EC6C 1QATA 1YX8A 1UHKA 1S6IA 3VGOA 1GQMA 1B7TY 4YI9A 1KQMB 1QLSA 2LVIA 2JWWA 4JPZB 4OVNF 3VRQA 3EVVA 2GGMA 1XA5A 3DF0B 2LM5A 1SR6B 1QTXA 3AAJA 3PALA 3WXAA 2JU0A 4MBEA 2KI6D 1SY9A 2JRFA 2WOSA 1WLZA 1QXPA 3PSRA 1YTZC 4I5JA 3CR4X 2PRUA 4JQ0D 1DT7B 3ZNIA 4Q04A 1IH0A 4FTGA 4GFTA 3O2PA 4PALA 5KSZA 1F4OA 1R2UA 1JC2A 4OKHA 1NYAA 2M97A 5F6TA 5AERA 5I2OA 1NUBA 4NDDA 4MSPA 4C0JA 1OQPA 2K7CA 1TIZA 2KFHA 4WQ3A 3RLZA 2CT9A 1S5GZ 2EGDA 2JQ6A 2OS8B 4YGDB 3NSKA 1CDMA 1OZOA 1WY9A 3EVUA 2B1UA 1S36A 4PE7A 5JJGA 2BCAA 1F71A 2WC8A 1KCYA 3CWGA 1EG3A 2F2OA 3DVMA 4R1EA 1DTLA 1TNQA 1XK4A 3K21A 3LCPC 2JT0A 1BR1B 4OV2A 1RWYA 4WQ2A 1UWOA 3OB1B 3SIBA 1NWDA 1PVBA 3TS5B 1UHNA 1Y6WA 2BCBA 1DGVA 1SNLA 1BF5A 4DS7A 1A75B 2FCDA 2K8MB 1SCVA 1JWDA 1VRKA 2KHNA 2L4HA 4GPLB 2JXCA 3VRRA 1N65A 1PVAA 3EVRA 3GK2A 4A4CA 2NXQA 2L0PA 2ZFDA 4GUKA 2FCEA 1SL7A 2KAXA 3BUNB 1ZACA 3QRXA 1NCZA 3BUMB 3NSOA 2KAVA 4L9MA 4DIRA 2M8UA 3I5HC 3ZWHA 1CB1A 2JZIA 1SCMC 3KHEA 1JBAA 1FBVA 2KFFA 4XJKB 5JOLA 5I8NA 4ETOA 1CNPA 1QX2A 3FS7A 1MUXA 1BMOA 3IF7A 3SG5A 3IQQA 1FI6A 2LNKA 2ZN8A 1SL9A 3AKAA 2MA2A 4QJ4B 3OP0A 2KI6C 3IQOA 1J1DA 4WRIA 1KK7Z 1OZSA 2BKIB 2LMTA 3WHTB 1CLMA 2BE6A 1YX7A 1M63B 5D69A 2I18A 2SASA 1W7IB 2PALA 1ODBA 1SKTA 1WDCB 1M31A 2TN4A 4PHJA 1F70A 2M3WA 4N1GA 4MVFA 5DKQA 1CM1A 2KBMA 1Y0VH 1B4CA 1IJ6A 1M45A 3MSEB 1AK8A 1XFYO 4PE1A 2LUCA 2L51A 2M1KB 2OPOA 1DJWA 4M2QA 4YBHB 5B8IB 1NP8A 1DMOA 3SJSA 1KWOC 2K7OA 1KFUS 3DF0A 2M7LA 5HKWA 5CSIA 4HSZA 3EK4A 4PHKA 3A8RA 2JTTA 3PN7C 1SCMB 1G33A 3I5HB 2JOJA 2ISDA 4FQOA 2R2IA 2Q91A 4MZJA 3I5FB 4YGCB 1RJVA 1F55A 1TTXA 3GK1A 4GBAA 2L98A 2H61C 1BOCA 2H61A 4I5NB 1NX0A 4PDZA 1CFDA 2AAOA 2BE4A 2V53A 1NIWA 1LKJA 1UUSA 3DVKA 1IQ5A 3EK8A 2K0JA 1E8AA 1KSOA 1AHRA 2ZNEA 3E3RA 1J7RA 4AQIA 1TN4A 2JT8A 2P6BB 2BKHB 1UHJA 1DJIA 2Q4UA 3EK7A 1LA0A 1NPQA 4MN0A 3BOWA 1TCOB 1J1EA 1JFKA 3BUOB 1TNPA 2KAYA 2QACA 4QJ3B 5IBWA 1DJZA 1ALWA 3BYAA 2LANA 1C7VA 4XYNA 2DOQA 1MQ1A 3I5IB 1CKKA 1MHOA 2KSPA 2O5GA 1H4BA 1S3PA 3D0YB 3JTDC 1KFUL 1L2OC 4BY5A 2WCFA 2A4JA 1YVLA 1SMGA 1HQVA 1CDLA 2JXLA 2PVBA 1IQ3A 2ZRTA 2MBXA 1ALVA 1XO5A 3I5FC 4I5LB 1WRZA 2L5XB 1F8HA 2MLFC 1B9AA 1J55A 1S6CA 1EL4A 1PSBA 3BUXB 1TRFA 4NDCA 2HQWA 3FWBA 1FPWA 3O4YA 2M29A 2BECA 4GGFC 1Y1AA 1MF8B 1A2XA 1U5IB 2LVVA 5FYXA 5G08A 1AP4A 1GJYA 3PFVA 3TDZA 5HLOA 1V1FA 2F33A 2VRGA 1BODA 1UURA 2MHHA 1CDNA 3TZ1A 5K89A 1PK0D 3ICBA 5I2LA 2F3YA 2FOTA 3CR2A 2LAPA 5KTYA 1YRUB 4MEWA 1S5GY 1M46A 2PSRA 2BBNA 4A4BA 5HYDA 1JF2A 3NSIA 5KU1A 1NCYA 1QV1A 4PE0A 2CXJA 1B7TZ 3CZTX 2MAZA 3F45A 4HRHA 1BG1A 1J7PA 3SG7A 1RECA 3FWCA 2BCXA 1K9PA 1TCFA 3TUYB 4GNKB 3O6BA 1DJXA 5CSFA 2K61A 3JVTB 4I5KA 1G8IA 2KQ6A 3BUWB 1QASA 3CGAA 2MLEC 3GK4X 3NSLA 5DKNA 3SG3A 1DGUA 1NX3A 4UPGA 3AKBA 3D10A 4YI8A 2JULA 1UP5A 1DF0B 2KGRA 3WNXB 4JWQA 1L2OB 1B8CA 1WLMA 2GV5A 2WNDA 3EKJA 4MRYA 5AEQA 1FW4A 1YUUA 1B8LA 1CTRA 1G4YR 1K95A 1UHIA 5CPVA 4CLNA 2EC6B 2M9GA 2L4IA 3LK1A 1IRJA 2EHBA 4AQJA 2KQYA 2KOTA 1JUOA 1MXLC 2ZN9A 3TUYC 1C7WA 2RGIA 2WCBA 1SBJA 4OCIA 3HCMA 4DCKA 2PMYA 4F0ZB 2QPTA 1BJFA 1CFPA 4ORCB 2E6WA 3SG6A 2K2FA 1PSRA 2E30A 2LLSA 5ER4X 1L7ZA 2NLNA 4NDBA 2K7DA 1AUIB 2O60A 2JNFA 2LE9B 1PRWA 1Q80A 1FF1A 3O78A 2CNPA 3BQ3A 4MZLA 4N5XA 2CTNA 2OTGB 2LVKA 1A03A 4N1FA 3EKHA 3CS1A 1IJ5A 4PHMA 4U8DA 1WDCC 1M39A 1QIVA 1XYDA 2LUXA 1DVIA 2FJUB 1DF0A 1OMDA 1K8UA 3C1VA 3M0WA 1XFUO 1S1EA 3OB2B 1IG5A 2I94A 1K2HA 3KO0A 5HLVA 2Y4QA 1IWQA 3RM1A 1KK7Y 1KWOB 2LVJA 2AMIA 1KQMC 1V1GA 4NQGA 3I5GC 4CFQA 4GGNA 4MLWA 4C0KA 1RK9A 3TDUA 3PN7B 1ZUZA 5CSNA 5DKRA 1FI5A 4AOMA 1SW8A 1LVCD 3PLFB 5HKYA 2HF5A 2H2KA 2Y5IA 5PALA 1K96A 3CR5X 1K90D 3I5IC 1NCXA 3PM8A 1KK8C 1JFJA 3A4UB 5HKZA 4ICBA 2M7NA 1KSMA 2I2RE 2ZRSA 4CIDA 1BR4B 3DVEA 1DJHA 4BY4A 1QIWA 1QS7A 1OE9B 1MXEA 4IL1A 1EG4A 4CPVA 1XFVO 2AUCA 1ZFSA 1TNWA 1MWNA 2K7BA 4HREE 4MRXA 4MZKA 2LLTA 1OSAA 2D8NA 4HRGA 3KPXA 1N2DA 1WRLA 3TS5C 1AJ5A 1SK6D 2G2BA 2Y1NA 1ZOTB 3D0YA 1QV0A 2LHLA 1YRTB 4PE4A 2NCOA 3SIAA 1SPYA 2HQ8A 1K9UA 1LA3A 4USLA 4D1EA 1MR8A 2OS8C 1SYMA 4P5OE 3AAKA 2L50A 3SG4A 2KYFA 2KI4B 2JTZA 3DD4A 1S6JA 1YUTA 2NZ0A 1CFFA 3I5GB 1XFWO 1X02A 1NSHA 4YGAA 2NCPA 1A75A 1RFJA 3OX5A 2LCPA 3DVJA 1KQVA 1RTP1 2PASA 2M0RA 4M2PA 2SCPA 2GGZA 2KGBC 1XK4C 2IS9A 3SG2A 3FIAA 2G9BA 3JVTC 1QVIY 2BL0B 4GAOA 3NXAA 1QLKA 1QX5B 2JC2A 2LHIA 2HPSA 1F54A 2LMVA 3HX4A 4TNCA 1LXFC 1N0YA 1KK8B 3VRNA 1XFZO 1XFXO 1BU3A 1YUSA 1S26D 1DJGA 4YRUA 5GQQC 1DJYA 1CDPA 1BT6A 1JF0A 1H8BA 1JSAA 1PALA 5TNCA 1EXRA 2CBLA 4E68A 1NX2A 2LP2A 4GGFA 1EH2A 5AXIA 1QJTA 3GOFA 1WRKA 1F4QA 2HETA 5D7FA 1K94A 1IGVA 5BPJA 1RROA 1C07A 1J7OA 3LL8B 4ZCVA 1CM4A 1YVHA 3OX6A 1EJ3A 2KNEA 4XJKA 2LP3A 1SR6C 4PHNA 4CFRA 2ZKMX 4ZCUA 2KDHA 2MRDA 2F2PA 1HT9A 2M1UA 2M49B 1CMFA 2WCEA 4M2OA 2JNXA 1OOJA 4PCWA 1B1GA 5AFPA 2COLB 2LMUA 3JTDB 4YGEB 1IKUA 1K9KA 1PULA 1A4PA 2KI4C 2BBMA 1Y1XA 2KFGA 3LLEA 1B47A 4P2YB 1A29A 1QX7A 5AANA 1GGWA 1SL8A 2LLUA 1W7JB 1K93D 2KYCA 1AVSA 1J7QA 2OTGC 2LV7A 3KF9A 1CMGA 1U5IA 1LINA 1YR5A 1GGZA 1Y1UA 2WORA 3WHUB 1NX1A 1OMVA 5J3XA 2JT3A 2Y1MA 4DUQA 1CLLA 3OHMB 2ZNDA 2MJWB 3H4SE 4YGBB 2K2AA 1OMRA 3VRPA 1BLQA 5ER5A 5I2QA 2KBIA 2BL0C 4OR9B 5CSJA 4DRWA 2F3ZA 1KFXL 1XVJA 3TDIA 1TOPA 1CLBA 1QVIZ 2I7AA 4ORAB 2LC5A 3VROA 1CFCA 4ORBB 1R6PA 1ZMZA 1SRAA 2F8PA 1UHHA 2JPTA 4C0LA
chains in the Genus database with same CATH superfamily
1YURA 3PATA 1KFXS 2CCMA 1ORGA 3KEVA 4QJ5B 1B8RA 2L2EA 1D1OA 3CTNA 3LK0A 1AJ4A 3BOWB 1TNXA 1C3ZA 3BXKA 3CLNA 2EC6C 1QATA 1YX8A 1UHKA 1S6IA 3VGOA 1GQMA 3IVTA 1DC1A 1B7TY 4YI9A 1KQMB 1QLSA 2LVIA 2JWWA 4JPZB 4OVNF 3VRQA 3EVVA 2GGMA 1XA5A 3DF0B 2LM5A 1SR6B 1QTXA 3AAJA 3PALA 3WXAA 2JU0A 4MBEA 1OOFA 2KI6D 1SY9A 2JRFA 2WOSA 1WLZA 1QXPA 3PSRA 1YTZC 4I5JA 3CR4X 2PRUA 4JQ0D 3D78A 3ZNIA 4Q04A 2WCLA 4JD9A 4FTGA 4GFTA 3O2PA 4PALA 5KSZA 1F4OA 1R2UA 1JC2A 4OKHA 1NYAA 2M97A 5F6TA 5AERA 5I2OA 1NUBA 4NDDA 4MSPA 4C0JA 1OQPA 2K7CA 1TIZA 2KFHA 4WQ3A 3RLZA 2CT9A 1S5GZ 2EGDA 2JQ6A 1W9ZA 2OS8B 4YGDB 2WC5A 3NSKA 1CDMA 1OZOA 1WY9A 3EVUA 2B1UA 1S36A 4PE7A 5JJGA 2BCAA 1F71A 2WC8A 1KCYA 3CWGA 1DEKA 1EG3A 2F2OA 3DVMA 4R1EA 1DTLA 1TNQA 1XK4A 3K21A 3LCPC 2JT0A 1BR1B 4INXA 1RWYA 4OV2A 1UWOA 3OB1B 4WQ2A 3SIBA 1NWDA 1PVBA 3TS5B 1UHNA 1Y6WA 2BCBA 1DGVA 1SNLA 1BF5A 4DS7A 1A75B 2FCDA 2K8MB 1SCVA 5FI6A 1JWDA 1VRKA 2KHNA 2L4HA 4GPLB 2JXCA 3VRRA 1N65A 1PVAA 3EVRA 3GK2A 4A4CA 2NXQA 2L0PA 1Z2CB 2ZFDA 4GUKA 2FCEA 1SL7A 2KAXA 3BUNB 1ZACA 3QRXA 3SS3A 1NCZA 3BUMB 3NSOA 2KAVA 4L9MA 4DIRA 2M8UA 3I5HC 3ZWHA 1CB1A 2JZIA 1SCMC 1LS8A 3KHEA 1JBAA 1FBVA 3R72A 2KFFA 4XJKB 5JOLA 5I8NA 4ETOA 1CNPA 2GTEA 1QX2A 3FS7A 1MUXA 1BMOA 3IF7A 3SG5A 2YGUA 3IQQA 3UO9A 3N7HA 1FI6A 2LNKA 2ZN8A 1SL9A 3AKAA 2MA2A 4QJ4B 3OP0A 2KI6C 1OW4A 3IQOA 1J1DA 3L4LA 4WRIA 1KK7Z 1OZSA 2BKIB 2LMTA 3WHTB 1CLMA 2BE6A 1YX7A 1M63B 5D69A 2I18A 2SASA 1W7IB 2PALA 1ODBA 1SKTA 3BFHA 3D73A 1WDCB 1M31A 2K60A 2TN4A 4PHJA 2M3WA 3NGVA 4N1GA 4MVFA 5DKQA 1F70A 1CM1A 2KBMA 3NHTA 1Y0VH 1B4CA 1IJ6A 1M45A 3MSEB 1AK8A 1XFYO 4PE1A 2LUCA 2L51A 2M1KB 2OPOA 1DJWA 4M2QA 4YBHB 5B8IB 1NP8A 1DMOA 3SJSA 1KWOC 2K7OA 1KFUS 3DF0A 2M7LA 5HKWA 5CSIA 4HSZA 3FE8A 1OOHA 3EK4A 3FE6A 4PHKA 3A8RA 2JTTA 1OOIX 3PN7C 1SCMB 1G33A 3I5HB 2JOJA 2ISDA 4FQOA 2R2IA 2Q91A 4MZJA 3I5FB 3S0FA 4YGCB 1RJVA 1F55A 1TTXA 3D74A 3GK1A 2L98A 2H61C 4GBAA 1BOCA 2H61A 4I5NB 1NX0A 3VB1A 4PDZA 1CFDA 2AAOA 5I94A 1QWVA 3D75A 2BE4A 2V53A 1NIWA 1LKJA 1UUSA 3DXLA 3DVKA 1IQ5A 3EK8A 2K0JA 1E8AA 1KSOA 1AHRA 2ZNEA 1T14A 1AP4A 3E3RA 1J7RA 4AQIA 1OOGA 1TN4A 2JT8A 3FE9A 2JPOA 2P6BB 2BKHB 1UHJA 1DJIA 1Z4HA 2KPHA 2Q4UA 3EK7A 3B7AA 1LA0A 1NPQA 4MN0A 3BOWA 1TCOB 1J1EA 1JFKA 1J7PA 3UNWA 4PT1A 3BUOB 2WCJA 1TNPA 2KAYA 2QACA 1SSEB 3R1OA 4QJ3B 5IBWA 1XFRA 1DJZA 1ALWA 3BYAA 2PQLA 2LANA 1C7VA 5EL2A 4XYNA 2L5YA 2DOQA 1MQ1A 3I5IB 1CKKA 1MHOA 2KSPA 2O5GA 1H4BA 1S3PA 3D0YB 3JTDC 1KFUL 1L2OC 4BY5A 2WCFA 2A4JA 1YVLA 1SMGA 1HQVA 1CDLA 2JXLA 2PVBA 1IQ3A 2ZRTA 2MBXA 1ALVA 1XO5A 3I5FC 4I5LB 1WRZA 2L5XB 1F8HA 2MLFC 3BFAA 1B9AA 1J55A 1S6CA 1EL4A 1PSBA 3BUXB 1TRFA 4NDCA 2HQWA 3FWBA 3PJIA 1FPWA 3O4YA 2M29A 2BECA 4GGFC 1Y1AA 1MF8B 1A2XA 1U5IB 2L2CA 2LVVA 5FYXA 5G08A 1GJYA 3PFVA 3TDZA 5HLOA 1V1FA 2F33A 2VRGA 1BODA 1UURA 2MHHA 3RZSA 1CDNA 3TZ1A 5K89A 3R1VA 1PK0D 3S0DA 3ICBA 5I2LA 2F3YA 2FOTA 3CR2A 2LAPA 5KTYA 1YRUB 3SS5A 4MEWA 1S5GY 1M46A 2PSRA 2BBNA 3CABA 2QEVA 1TUJA 4A4BA 3B86A 5HYDA 3L4AA 1JF2A 3NSIA 5KU1A 1NCYA 1QV1A 4PE0A 2CXJA 1B7TZ 3CZTX 2MAZA 3F45A 3L47A 4FQTA 4HRHA 3SG7A 1RECA 1BG1A 3FWCA 1C3YA 2BCXA 1K9PA 1TCFA 3TUYB 4GNKB 3BJHA 3O6BA 1DJXA 5CSFA 2K61A 3JVTB 4I5KA 1G8IA 2KQ6A 2WCKA 1QASA 3BUWB 2MLEC 3CGAA 1P28A 3GK4X 3NSLA 4OZDA 5DKNA 3SG3A 1DGUA 1NX3A 4UPGA 3AKBA 3D10A 4INWA 4YI8A 2JULA 1UP5A 1DF0B 2KGRA 3WNXB 4JWQA 3Q8IA 1L2OB 1B8CA 3CDNA 1WLMA 2GV5A 2WNDA 3EKJA 4MRYA 5AEQA 1IIOA 1FW4A 1YUUA 1B8LA 1CTRA 1G4YR 1K95A 1UHIA 3DYEA 5CPVA 4CLNA 2EC6B 2M9GA 2L4IA 1IH0A 3LK1A 1IRJA 2EHBA 4AQJA 2KQYA 2KOTA 1JUOA 1MXLC 2ZN9A 3TUYC 1C7WA 1TUZA 2RGIA 3D76A 2WCBA 1SBJA 4OCIA 3HCMA 3OGNA 4DCKA 2PMYA 4F0ZB 2QPTA 1BJFA 1CFPA 4ORCB 2E6WA 2P71A 3SG6A 2K2FA 1PSRA 2E30A 2LLSA 5ER4X 1L7ZA 2NLNA 4NDBA 2K7DA 1AUIB 2O60A 2JNFA 5DICA 2LE9B 1PRWA 1Q80A 1FF1A 3O78A 2CNPA 3BQ3A 4MZLA 4N5XA 2CTNA 2OTGB 2LVKA 1A03A 4N1FA 3EKHA 5FI7A 3CS1A 1IJ5A 4PHMA 4U8DA 1WDCC 1M39A 1QIVA 1XYDA 2LUXA 1DVIA 2FJUB 3B88A 1DF0A 1OMDA 1K8UA 3C1VA 3M0WA 1XFUO 1S1EA 3OB2B 1GM0A 1IG5A 2I94A 1K2HA 2PYQA 4F7FA 3KO0A 5HLVA 2Y4QA 1IWQA 3RM1A 1KK7Y 1KWOB 2QEOA 2LVJA 2AMIA 1KQMC 1V1GA 4NQGA 3CYZA 3I5GC 4CFQA 4GGNA 4MLWA 4C0KA 1RK9A 3TDUA 3PN7B 1ZUZA 2P70A 5CSNA 5DKRA 4AOMA 1FI5A 1SW8A 1LVCD 3PLFB 5HKYA 2HF5A 2H2KA 2Y5IA 5PALA 2FJYA 1K96A 3R1PA 3CR5X 1K90D 3I5IC 1NCXA 3PM8A 1KK8C 1JFJA 3A4UB 3S0AA 5HKZA 4ICBA 2M7NA 1KSMA 2I2RE 2ZRSA 4CIDA 1BR4B 3DVEA 1DJHA 4BY4A 1QIWA 1QS7A 1OE9B 1MXEA 3CZ2A 1DELA 1EG4A 4IL1A 4CPVA 1XFVO 1TWOA 2AUCA 1ZFSA 1TNWA 1MWNA 2K7BA 4HREE 4MRXA 4MZKA 2LLTA 1OSAA 2D8NA 4HRGA 3KPXA 1N2DA 1WRLA 4C0LA 3TS5C 1AJ5A 1SK6D 2G2BA 2Y1NA 1ZOTB 3D0YA 3DZTA 1QV0A 2LHLA 1YRTB 4PE4A 2NCOA 3SIAA 1SPYA 3BFBA 3V2LA 2HQ8A 1K9UA 1LA3A 4USLA 4D1EA 1MR8A 2OS8C 2H8VA 2QDIA 1SYMA 4P5OE 4KYNA 3AAKA 2L50A 3SG4A 2KYFA 2KI4B 2JTZA 3DD4A 1S6JA 1YUTA 2NZ0A 1CFFA 3I5GB 1XFWO 3EG5B 1X02A 1NSHA 4YGAA 2NCPA 1A75A 1RFJA 3OX5A 2LCPA 3DVJA 1KQVA 1RTP1 2PASA 2M0RA 4M2PA 2SCPA 2GGZA 2KGBC 3QMEA 1XK4C 2IS9A 3SG2A 5FI2A 3FIAA 2G9BA 3NHIA 3JVTC 1QVIY 2BL0B 4GAOA 3NXAA 3S0EA 1QLKA 1QX5B 2JC2A 2LHIA 3CZ1A 3S0GA 2HPSA 1F54A 2LMVA 3HX4A 4TNCA 1DT7B 1LXFC 5D3OA 1N0YA 1KK8B 3VRNA 1XFZO 1XFXO 1BU3A 1YUSA 1S26D 1DJGA 4YRUA 5GQQC 1DJYA 2BNXA 2WCHA 1CDPA 1BT6A 1JF0A 1H8BA 1JSAA 1PALA 5TNCA 1EXRA 2CBLA 4E68A 1NX2A 2LP2A 4GGFA 1EH2A 5AXIA 1QJTA 3GOFA 1WRKA 1F4QA 2HETA 5D7FA 1K94A 1IGVA 5BPJA 1RROA 1C07A 3S0BA 1J7OA 3LL8B 4ZCVA 3DY9A 1CM4A 1YVHA 3OX6A 2BAPA 1EJ3A 2KNEA 4XJKA 2LP3A 1SR6C 4PHNA 4CFRA 5HL1A 2ZKMX 4ZCUA 2KDHA 2MRDA 3D77A 2ERBA 2F2PA 2WCMA 1HT9A 2M1UA 2M49B 3PM2A 4IJ7A 3OBVA 1CMFA 2WCEA 4M2OA 2JNXA 1OOJA 4PCWA 1B1GA 5AFPA 2COLB 2LMUA 3JTDB 4YGEB 1IKUA 1K9KA 1PULA 3B87A 1A4PA 2KI4C 2BBMA 1Y1XA 2KFGA 3LLEA 1B47A 2QEBA 4P2YB 1A29A 4JKTA 1QX7A 5AANA 1GGWA 1SL8A 2LLUA 1W7JB 1K93D 2KYCA 1AVSA 1J7QA 2OTGC 2LV7A 3KF9A 1CMGA 1U5IA 1LINA 1YR5A 1GGZA 1Y1UA 2WORA 3WHUB 3B6XA 1NX1A 1OMVA 5J3XA 2JT3A 2Y1MA 4DUQA 1CLLA 3OHMB 2ZNDA 2MJWB 3H4SE 4YGBB 2K2AA 1OMRA 3VRPA 1BLQA 5ER5A 5I2QA 2KBIA 2BL0C 4OR9B 5CSJA 2KLEA 2WC6A 4DRWA 2F3ZA 1KFXL 1XVJA 3O4XA 2KLDA 3TDIA 1TOPA 1DQEA 1CLBA 3K1EA 1QVIZ 2I7AA 4ORAB 2LC5A 3SS4A 3CZ0A 3VROA 1CFCA 4ORBB 1R6PA 1ZMZA 1SRAA 2F8PA 1UHHA 2JPTA 2QEHA
chains in the Genus database with same CATH topology
1YURA 3PATA 1KFXS 2CCMA 3KEVA 4QJ5B 1B8RA 2L2EA 1D1OA 3CTNA 3LK0A 1AJ4A 3BOWB 1TNXA 3BXKA 3CLNA 2EC6C 1QATA 1YX8A 1UHKA 1S6IA 3VGOA 1GQMA 1B7TY 4YI9A 1KQMB 1QLSA 2LVIA 2JWWA 4JPZB 4OVNF 3VRQA 3EVVA 2GGMA 1XA5A 3DF0B 2LM5A 1SR6B 1QTXA 3AAJA 3PALA 3WXAA 2JU0A 4MBEA 2KI6D 1SY9A 2JRFA 2WOSA 1WLZA 1QXPA 3PSRA 1YTZC 4I5JA 3CR4X 2PRUA 4JQ0D 1DT7B 3ZNIA 4Q04A 1IH0A 4FTGA 4GFTA 3O2PA 4PALA 5KSZA 1F4OA 1R2UA 1JC2A 4OKHA 1NYAA 2M97A 5F6TA 5AERA 5I2OA 1NUBA 4NDDA 4MSPA 4C0JA 1OQPA 2K7CA 1TIZA 2KFHA 4WQ3A 3RLZA 2CT9A 1S5GZ 2EGDA 2JQ6A 2OS8B 4YGDB 3NSKA 1CDMA 1OZOA 1WY9A 3EVUA 2B1UA 1S36A 4PE7A 5JJGA 2BCAA 1F71A 2WC8A 1KCYA 3CWGA 1EG3A 2F2OA 3DVMA 4R1EA 1DTLA 1TNQA 1XK4A 3K21A 3LCPC 2JT0A 1BR1B 4OV2A 1RWYA 4WQ2A 1UWOA 3OB1B 3SIBA 1NWDA 1PVBA 3TS5B 1UHNA 1Y6WA 2BCBA 1DGVA 1SNLA 1BF5A 4DS7A 1A75B 2FCDA 2K8MB 1SCVA 1JWDA 1VRKA 2KHNA 2L4HA 4GPLB 2JXCA 3VRRA 1N65A 1PVAA 3EVRA 3GK2A 4A4CA 2NXQA 2L0PA 2ZFDA 4GUKA 2FCEA 1SL7A 2KAXA 3BUNB 1ZACA 3QRXA 1NCZA 3BUMB 3NSOA 2KAVA 4L9MA 4DIRA 2M8UA 3I5HC 3ZWHA 1CB1A 2JZIA 1SCMC 3KHEA 1JBAA 1FBVA 2KFFA 4XJKB 5JOLA 5I8NA 4ETOA 1CNPA 1QX2A 3FS7A 1MUXA 1BMOA 3IF7A 3SG5A 3IQQA 1FI6A 2LNKA 2ZN8A 1SL9A 3AKAA 2MA2A 4QJ4B 3OP0A 2KI6C 3IQOA 1J1DA 4WRIA 1KK7Z 1OZSA 2BKIB 2LMTA 3WHTB 1CLMA 2BE6A 1YX7A 1M63B 5D69A 2I18A 2SASA 1W7IB 2PALA 1ODBA 1SKTA 1WDCB 1M31A 2TN4A 4PHJA 1F70A 2M3WA 4N1GA 4MVFA 5DKQA 1CM1A 2KBMA 1Y0VH 1B4CA 1IJ6A 1M45A 3MSEB 1AK8A 1XFYO 4PE1A 2LUCA 2L51A 2M1KB 2OPOA 1DJWA 4M2QA 4YBHB 5B8IB 1NP8A 1DMOA 3SJSA 1KWOC 2K7OA 1KFUS 3DF0A 2M7LA 5HKWA 5CSIA 4HSZA 3EK4A 4PHKA 3A8RA 2JTTA 3PN7C 1SCMB 1G33A 3I5HB 2JOJA 2ISDA 4FQOA 2R2IA 2Q91A 4MZJA 3I5FB 4YGCB 1RJVA 1F55A 1TTXA 3GK1A 4GBAA 2L98A 2H61C 1BOCA 2H61A 4I5NB 1NX0A 4PDZA 1CFDA 2AAOA 2BE4A 2V53A 1NIWA 1LKJA 1UUSA 3DVKA 1IQ5A 3EK8A 2K0JA 1E8AA 1KSOA 1AHRA 2ZNEA 3E3RA 1J7RA 4AQIA 1TN4A 2JT8A 2P6BB 2BKHB 1UHJA 1DJIA 2Q4UA 3EK7A 1LA0A 1NPQA 4MN0A 3BOWA 1TCOB 1J1EA 1JFKA 3BUOB 1TNPA 2KAYA 2QACA 4QJ3B 5IBWA 1DJZA 1ALWA 3BYAA 2LANA 1C7VA 4XYNA 2DOQA 1MQ1A 3I5IB 1CKKA 1MHOA 2KSPA 2O5GA 1H4BA 1S3PA 3D0YB 3JTDC 1KFUL 1L2OC 4BY5A 2WCFA 2A4JA 1YVLA 1SMGA 1HQVA 1CDLA 2JXLA 2PVBA 1IQ3A 2ZRTA 2MBXA 1ALVA 1XO5A 3I5FC 4I5LB 1WRZA 2L5XB 1F8HA 2MLFC 1B9AA 1J55A 1S6CA 1EL4A 1PSBA 3BUXB 1TRFA 4NDCA 2HQWA 3FWBA 1FPWA 3O4YA 2M29A 2BECA 4GGFC 1Y1AA 1MF8B 1A2XA 1U5IB 2LVVA 5FYXA 5G08A 1AP4A 1GJYA 3PFVA 3TDZA 5HLOA 1V1FA 2F33A 2VRGA 1BODA 1UURA 2MHHA 1CDNA 3TZ1A 5K89A 1PK0D 3ICBA 5I2LA 2F3YA 2FOTA 3CR2A 2LAPA 5KTYA 1YRUB 4MEWA 1S5GY 1M46A 2PSRA 2BBNA 4A4BA 5HYDA 1JF2A 3NSIA 5KU1A 1NCYA 1QV1A 4PE0A 2CXJA 1B7TZ 3CZTX 2MAZA 3F45A 4HRHA 1BG1A 1J7PA 3SG7A 1RECA 3FWCA 2BCXA 1K9PA 1TCFA 3TUYB 4GNKB 3O6BA 1DJXA 5CSFA 2K61A 3JVTB 4I5KA 1G8IA 2KQ6A 3BUWB 1QASA 3CGAA 2MLEC 3GK4X 3NSLA 5DKNA 3SG3A 1DGUA 1NX3A 4UPGA 3AKBA 3D10A 4YI8A 2JULA 1UP5A 1DF0B 2KGRA 3WNXB 4JWQA 1L2OB 1B8CA 1WLMA 2GV5A 2WNDA 3EKJA 4MRYA 5AEQA 1FW4A 1YUUA 1B8LA 1CTRA 1G4YR 1K95A 1UHIA 5CPVA 4CLNA 2EC6B 2M9GA 2L4IA 3LK1A 1IRJA 2EHBA 4AQJA 2KQYA 2KOTA 1JUOA 1MXLC 2ZN9A 3TUYC 1C7WA 2RGIA 2WCBA 1SBJA 4OCIA 3HCMA 4DCKA 2PMYA 4F0ZB 2QPTA 1BJFA 1CFPA 4ORCB 2E6WA 3SG6A 2K2FA 1PSRA 2E30A 2LLSA 5ER4X 1L7ZA 2NLNA 4NDBA 2K7DA 1AUIB 2O60A 2JNFA 2LE9B 1PRWA 1Q80A 1FF1A 3O78A 2CNPA 3BQ3A 4MZLA 4N5XA 2CTNA 2OTGB 2LVKA 1A03A 4N1FA 3EKHA 3CS1A 1IJ5A 4PHMA 4U8DA 1WDCC 1M39A 1QIVA 1XYDA 2LUXA 1DVIA 2FJUB 1DF0A 1OMDA 1K8UA 3C1VA 3M0WA 1XFUO 1S1EA 3OB2B 1IG5A 2I94A 1K2HA 3KO0A 5HLVA 2Y4QA 1IWQA 3RM1A 1KK7Y 1KWOB 2LVJA 2AMIA 1KQMC 1V1GA 4NQGA 3I5GC 4CFQA 4GGNA 4MLWA 4C0KA 1RK9A 3TDUA 3PN7B 1ZUZA 5CSNA 5DKRA 1FI5A 4AOMA 1SW8A 1LVCD 3PLFB 5HKYA 2HF5A 2H2KA 2Y5IA 5PALA 1K96A 3CR5X 1K90D 3I5IC 1NCXA 3PM8A 1KK8C 1JFJA 3A4UB 5HKZA 4ICBA 2M7NA 1KSMA 2I2RE 2ZRSA 4CIDA 1BR4B 3DVEA 1DJHA 4BY4A 1QIWA 1QS7A 1OE9B 1MXEA 4IL1A 1EG4A 4CPVA 1XFVO 2AUCA 1ZFSA 1TNWA 1MWNA 2K7BA 4HREE 4MRXA 4MZKA 2LLTA 1OSAA 2D8NA 4HRGA 3KPXA 1N2DA 1WRLA 3TS5C 1AJ5A 1SK6D 2G2BA 2Y1NA 1ZOTB 3D0YA 1QV0A 2LHLA 1YRTB 4PE4A 2NCOA 3SIAA 1SPYA 2HQ8A 1K9UA 1LA3A 4USLA 4D1EA 1MR8A 2OS8C 1SYMA 4P5OE 3AAKA 2L50A 3SG4A 2KYFA 2KI4B 2JTZA 3DD4A 1S6JA 1YUTA 2NZ0A 1CFFA 3I5GB 1XFWO 1X02A 1NSHA 4YGAA 2NCPA 1A75A 1RFJA 3OX5A 2LCPA 3DVJA 1KQVA 1RTP1 2PASA 2M0RA 4M2PA 2SCPA 2GGZA 2KGBC 1XK4C 2IS9A 3SG2A 3FIAA 2G9BA 3JVTC 1QVIY 2BL0B 4GAOA 3NXAA 1QLKA 1QX5B 2JC2A 2LHIA 2HPSA 1F54A 2LMVA 3HX4A 4TNCA 1LXFC 1N0YA 1KK8B 3VRNA 1XFZO 1XFXO 1BU3A 1YUSA 1S26D 1DJGA 4YRUA 5GQQC 1DJYA 1CDPA 1BT6A 1JF0A 1H8BA 1JSAA 1PALA 5TNCA 1EXRA 2CBLA 4E68A 1NX2A 2LP2A 4GGFA 1EH2A 5AXIA 1QJTA 3GOFA 1WRKA 1F4QA 2HETA 5D7FA 1K94A 1IGVA 5BPJA 1RROA 1C07A 1J7OA 3LL8B 4ZCVA 1CM4A 1YVHA 3OX6A 1EJ3A 2KNEA 4XJKA 2LP3A 1SR6C 4PHNA 4CFRA 2ZKMX 4ZCUA 2KDHA 2MRDA 2F2PA 1HT9A 2M1UA 2M49B 1CMFA 2WCEA 4M2OA 2JNXA 1OOJA 4PCWA 1B1GA 5AFPA 2COLB 2LMUA 3JTDB 4YGEB 1IKUA 1K9KA 1PULA 1A4PA 2KI4C 2BBMA 1Y1XA 2KFGA 3LLEA 1B47A 4P2YB 1A29A 1QX7A 5AANA 1GGWA 1SL8A 2LLUA 1W7JB 1K93D 2KYCA 1AVSA 1J7QA 2OTGC 2LV7A 3KF9A 1CMGA 1U5IA 1LINA 1YR5A 1GGZA 1Y1UA 2WORA 3WHUB 1NX1A 1OMVA 5J3XA 2JT3A 2Y1MA 4DUQA 1CLLA 3OHMB 2ZNDA 2MJWB 3H4SE 4YGBB 2K2AA 1OMRA 3VRPA 1BLQA 5ER5A 5I2QA 2KBIA 2BL0C 4OR9B 5CSJA 4DRWA 2F3ZA 1KFXL 1XVJA 3TDIA 1TOPA 1CLBA 1QVIZ 2I7AA 4ORAB 2LC5A 3VROA 1CFCA 4ORBB 1R6PA 1ZMZA 1SRAA 2F8PA 1UHHA 2JPTA 4C0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUR A;  3PAT A;  1KFX S;  2CCM A;  3KEV A;  4QJ5 B;  1B8R A;  2L2E A;  1D1O A;  3CTN A;  3LK0 A;  1AJ4 A;  3BOW B;  1TNX A;  3BXK A;  3CLN A;  2EC6 C;  1QAT A;  1YX8 A;  1UHK A;  1S6I A;  3VGO A;  1GQM A;  1B7T Y;  4YI9 A;  1KQM B;  1QLS A;  2LVI A;  2JWW A;  4JPZ B;  4OVN F;  3VRQ A;  3EVV A;  2GGM A;  1XA5 A;  3DF0 B;  2LM5 A;  1SR6 B;  1QTX A;  3AAJ A;  3PAL A;  3WXA A;  2JU0 A;  4MBE A;  2KI6 D;  1SY9 A;  2JRF A;  2WOS A;  1WLZ A;  1QXP A;  3PSR A;  1YTZ C;  4I5J A;  3CR4 X;  2PRU A;  4JQ0 D;  1DT7 B;  3ZNI A;  4Q04 A;  1IH0 A;  4FTG A;  4GFT A;  3O2P A;  4PAL A;  5KSZ A;  1F4O A;  1R2U A;  1JC2 A;  4OKH A;  1NYA A;  2M97 A;  5F6T A;  5AER A;  5I2O A;  1NUB A;  4NDD A;  4MSP A;  4C0J A;  1OQP A;  2K7C A;  1TIZ A;  2KFH A;  4WQ3 A;  3RLZ A;  2CT9 A;  1S5G Z;  2EGD A;  2JQ6 A;  2OS8 B;  4YGD B;  3NSK A;  1CDM A;  1OZO A;  1WY9 A;  3EVU A;  2B1U A;  1S36 A;  4PE7 A;  5JJG A;  2BCA A;  1F71 A;  2WC8 A;  1KCY A;  3CWG A;  1EG3 A;  2F2O A;  3DVM A;  4R1E A;  1DTL A;  1TNQ A;  1XK4 A;  3K21 A;  3LCP C;  2JT0 A;  1BR1 B;  4OV2 A;  1RWY A;  4WQ2 A;  1UWO A;  3OB1 B;  3SIB A;  1NWD A;  1PVB A;  3TS5 B;  1UHN A;  1Y6W A;  2BCB A;  1DGV A;  1SNL A;  1BF5 A;  4DS7 A;  1A75 B;  2FCD A;  2K8M B;  1SCV A;  1JWD A;  1VRK A;  2KHN A;  2L4H A;  4GPL B;  2JXC A;  3VRR A;  1N65 A;  1PVA A;  3EVR A;  3GK2 A;  4A4C A;  2NXQ A;  2L0P A;  2ZFD A;  4GUK A;  2FCE A;  1SL7 A;  2KAX A;  3BUN B;  1ZAC A;  3QRX A;  1NCZ A;  3BUM B;  3NSO A;  2KAV A;  4L9M A;  4DIR A;  2M8U A;  3I5H C;  3ZWH A;  1CB1 A;  2JZI A;  1SCM C;  3KHE A;  1JBA A;  1FBV A;  2KFF A;  4XJK B;  5JOL A;  5I8N A;  4ETO A;  1CNP A;  1QX2 A;  3FS7 A;  1MUX A;  1BMO A;  3IF7 A;  3SG5 A;  3IQQ A;  1FI6 A;  2LNK A;  2ZN8 A;  1SL9 A;  3AKA A;  2MA2 A;  4QJ4 B;  3OP0 A;  2KI6 C;  3IQO A;  1J1D A;  4WRI A;  1KK7 Z;  1OZS A;  2BKI B;  2LMT A;  3WHT B;  1CLM A;  2BE6 A;  1YX7 A;  1M63 B;  5D69 A;  2I18 A;  2SAS A;  1W7I B;  2PAL A;  1ODB A;  1SKT A;  1WDC B;  1M31 A;  2TN4 A;  4PHJ A;  1F70 A;  2M3W A;  4N1G A;  4MVF A;  5DKQ A;  1CM1 A;  2KBM A;  1Y0V H;  1B4C A;  1IJ6 A;  1M45 A;  3MSE B;  1AK8 A;  1XFY O;  4PE1 A;  2LUC A;  2L51 A;  2M1K B;  2OPO A;  1DJW A;  4M2Q A;  4YBH B;  5B8I B;  1NP8 A;  1DMO A;  3SJS A;  1KWO C;  2K7O A;  1KFU S;  3DF0 A;  2M7L A;  5HKW A;  5CSI A;  4HSZ A;  3EK4 A;  4PHK A;  3A8R A;  2JTT A;  3PN7 C;  1SCM B;  1G33 A;  3I5H B;  2JOJ A;  2ISD A;  4FQO A;  2R2I A;  2Q91 A;  4MZJ A;  3I5F B;  4YGC B;  1RJV A;  1F55 A;  1TTX A;  3GK1 A;  4GBA A;  2L98 A;  2H61 C;  1BOC A;  2H61 A;  4I5N B;  1NX0 A;  4PDZ A;  1CFD A;  2AAO A;  2BE4 A;  2V53 A;  1NIW A;  1LKJ A;  1UUS A;  3DVK A;  1IQ5 A;  3EK8 A;  2K0J A;  1E8A A;  1KSO A;  1AHR A;  2ZNE A;  3E3R A;  1J7R A;  4AQI A;  1TN4 A;  2JT8 A;  2P6B B;  2BKH B;  1UHJ A;  1DJI A;  2Q4U A;  3EK7 A;  1LA0 A;  1NPQ A;  4MN0 A;  3BOW A;  1TCO B;  1J1E A;  1JFK A;  3BUO B;  1TNP A;  2KAY A;  2QAC A;  4QJ3 B;  5IBW A;  1DJZ A;  1ALW A;  3BYA A;  2LAN A;  1C7V A;  4XYN A;  2DOQ A;  1MQ1 A;  3I5I B;  1CKK A;  1MHO A;  2KSP A;  2O5G A;  1H4B A;  1S3P A;  3D0Y B;  3JTD C;  1KFU L;  1L2O C;  4BY5 A;  2WCF A;  2A4J A;  1YVL A;  1SMG A;  1HQV A;  1CDL A;  2JXL A;  2PVB A;  1IQ3 A;  2ZRT A;  2MBX A;  1ALV A;  1XO5 A;  3I5F C;  4I5L B;  1WRZ A;  2L5X B;  1F8H A;  2MLF C;  1B9A A;  1J55 A;  1S6C A;  1EL4 A;  1PSB A;  3BUX B;  1TRF A;  4NDC A;  2HQW A;  3FWB A;  1FPW A;  3O4Y A;  2M29 A;  2BEC A;  4GGF C;  1Y1A A;  1MF8 B;  1A2X A;  1U5I B;  2LVV A;  5FYX A;  5G08 A;  1AP4 A;  1GJY A;  3PFV A;  3TDZ A;  5HLO A;  1V1F A;  2F33 A;  2VRG A;  1BOD A;  1UUR A;  2MHH A;  1CDN A;  3TZ1 A;  5K89 A;  1PK0 D;  3ICB A;  5I2L A;  2F3Y A;  2FOT A;  3CR2 A;  2LAP A;  5KTY A;  1YRU B;  4MEW A;  1S5G Y;  1M46 A;  2PSR A;  2BBN A;  4A4B A;  5HYD A;  1JF2 A;  3NSI A;  5KU1 A;  1NCY A;  1QV1 A;  4PE0 A;  2CXJ A;  1B7T Z;  3CZT X;  2MAZ A;  3F45 A;  4HRH A;  1BG1 A;  1J7P A;  3SG7 A;  1REC A;  3FWC A;  2BCX A;  1K9P A;  1TCF A;  3TUY B;  4GNK B;  3O6B A;  1DJX A;  5CSF A;  2K61 A;  3JVT B;  4I5K A;  1G8I A;  2KQ6 A;  3BUW B;  1QAS A;  3CGA A;  2MLE C;  3GK4 X;  3NSL A;  5DKN A;  3SG3 A;  1DGU A;  1NX3 A;  4UPG A;  3AKB A;  3D10 A;  4YI8 A;  2JUL A;  1UP5 A;  1DF0 B;  2KGR A;  3WNX B;  4JWQ A;  1L2O B;  1B8C A;  1WLM A;  2GV5 A;  2WND A;  3EKJ A;  4MRY A;  5AEQ A;  1FW4 A;  1YUU A;  1B8L A;  1CTR A;  1G4Y R;  1K95 A;  1UHI A;  5CPV A;  4CLN A;  2EC6 B;  2M9G A;  2L4I A;  3LK1 A;  1IRJ A;  2EHB A;  4AQJ A;  2KQY A;  2KOT A;  1JUO A;  1MXL C;  2ZN9 A;  3TUY C;  1C7W A;  2RGI A;  2WCB A;  1SBJ A;  4OCI A;  3HCM A;  4DCK A;  2PMY A;  4F0Z B;  2QPT A;  1BJF A;  1CFP A;  4ORC B;  2E6W A;  3SG6 A;  2K2F A;  1PSR A;  2E30 A;  2LLS A;  5ER4 X;  1L7Z A;  2NLN A;  4NDB A;  2K7D A;  1AUI B;  2O60 A;  2JNF A;  2LE9 B;  1PRW A;  1Q80 A;  1FF1 A;  3O78 A;  2CNP A;  3BQ3 A;  4MZL A;  4N5X A;  2CTN A;  2OTG B;  2LVK A;  1A03 A;  4N1F A;  3EKH A;  3CS1 A;  1IJ5 A;  4PHM A;  4U8D A;  1WDC C;  1M39 A;  1QIV A;  1XYD A;  2LUX A;  1DVI A;  2FJU B;  1DF0 A;  1OMD A;  1K8U A;  3C1V A;  3M0W A;  1XFU O;  1S1E A;  3OB2 B;  1IG5 A;  2I94 A;  1K2H A;  3KO0 A;  5HLV A;  2Y4Q A;  1IWQ A;  3RM1 A;  1KK7 Y;  1KWO B;  2LVJ A;  2AMI A;  1KQM C;  1V1G A;  4NQG A;  3I5G C;  4CFQ A;  4GGN A;  4MLW A;  4C0K A;  1RK9 A;  3TDU A;  3PN7 B;  1ZUZ A;  5CSN A;  5DKR A;  1FI5 A;  4AOM A;  1SW8 A;  1LVC D;  3PLF B;  5HKY A;  2HF5 A;  2H2K A;  2Y5I A;  5PAL A;  1K96 A;  3CR5 X;  1K90 D;  3I5I C;  1NCX A;  3PM8 A;  1KK8 C;  1JFJ A;  3A4U B;  5HKZ A;  4ICB A;  2M7N A;  1KSM A;  2I2R E;  2ZRS A;  4CID A;  1BR4 B;  3DVE A;  1DJH A;  4BY4 A;  1QIW A;  1QS7 A;  1OE9 B;  1MXE A;  4IL1 A;  1EG4 A;  4CPV A;  1XFV O;  2AUC A;  1ZFS A;  1TNW A;  1MWN A;  2K7B A;  4HRE E;  4MRX A;  4MZK A;  2LLT A;  1OSA A;  2D8N A;  4HRG A;  3KPX A;  1N2D A;  1WRL A;  3TS5 C;  1AJ5 A;  1SK6 D;  2G2B A;  2Y1N A;  1ZOT B;  3D0Y A;  1QV0 A;  2LHL A;  1YRT B;  4PE4 A;  2NCO A;  3SIA A;  1SPY A;  2HQ8 A;  1K9U A;  1LA3 A;  4USL A;  4D1E A;  1MR8 A;  2OS8 C;  1SYM A;  4P5O E;  3AAK A;  2L50 A;  3SG4 A;  2KYF A;  2KI4 B;  2JTZ A;  3DD4 A;  1S6J A;  1YUT A;  2NZ0 A;  1CFF A;  3I5G B;  1XFW O;  1X02 A;  1NSH A;  4YGA A;  2NCP A;  1A75 A;  1RFJ A;  3OX5 A;  2LCP A;  3DVJ A;  1KQV A;  1RTP 1;  2PAS A;  2M0R A;  4M2P A;  2SCP A;  2GGZ A;  2KGB C;  1XK4 C;  2IS9 A;  3SG2 A;  3FIA A;  2G9B A;  3JVT C;  1QVI Y;  2BL0 B;  4GAO A;  3NXA A;  1QLK A;  1QX5 B;  2JC2 A;  2LHI A;  2HPS A;  1F54 A;  2LMV A;  3HX4 A;  4TNC A;  1LXF C;  1N0Y A;  1KK8 B;  3VRN A;  1XFZ O;  1XFX O;  1BU3 A;  1YUS A;  1S26 D;  1DJG A;  4YRU A;  5GQQ C;  1DJY A;  1CDP A;  1BT6 A;  1JF0 A;  1H8B A;  1JSA A;  1PAL A;  5TNC A;  1EXR A;  2CBL A;  4E68 A;  1NX2 A;  2LP2 A;  4GGF A;  1EH2 A;  5AXI A;  1QJT A;  3GOF A;  1WRK A;  1F4Q A;  2HET A;  5D7F A;  1K94 A;  1IGV A;  5BPJ A;  1RRO A;  1C07 A;  1J7O A;  3LL8 B;  4ZCV A;  1CM4 A;  1YVH A;  3OX6 A;  1EJ3 A;  2KNE A;  4XJK A;  2LP3 A;  1SR6 C;  4PHN A;  4CFR A;  2ZKM X;  4ZCU A;  2KDH A;  2MRD A;  2F2P A;  1HT9 A;  2M1U A;  2M49 B;  1CMF A;  2WCE A;  4M2O A;  2JNX A;  1OOJ A;  4PCW A;  1B1G A;  5AFP A;  2COL B;  2LMU A;  3JTD B;  4YGE B;  1IKU A;  1K9K A;  1PUL A;  1A4P A;  2KI4 C;  2BBM A;  1Y1X A;  2KFG A;  3LLE A;  1B47 A;  4P2Y B;  1A29 A;  1QX7 A;  5AAN A;  1GGW A;  1SL8 A;  2LLU A;  1W7J B;  1K93 D;  2KYC A;  1AVS A;  1J7Q A;  2OTG C;  2LV7 A;  3KF9 A;  1CMG A;  1U5I A;  1LIN A;  1YR5 A;  1GGZ A;  1Y1U A;  2WOR A;  3WHU B;  1NX1 A;  1OMV A;  5J3X A;  2JT3 A;  2Y1M A;  4DUQ A;  1CLL A;  3OHM B;  2ZND A;  2MJW B;  3H4S E;  4YGB B;  2K2A A;  1OMR A;  3VRP A;  1BLQ A;  5ER5 A;  5I2Q A;  2KBI A;  2BL0 C;  4OR9 B;  5CSJ A;  4DRW A;  2F3Z A;  1KFX L;  1XVJ A;  3TDI A;  1TOP A;  1CLB A;  1QVI Z;  2I7A A;  4ORA B;  2LC5 A;  3VRO A;  1CFC A;  4ORB B;  1R6P A;  1ZMZ A;  1SRA A;  2F8P A;  1UHH A;  2JPT A;  4C0L A; 
#chains in the Genus database with same CATH topology
 1YUR A;  3PAT A;  1KFX S;  2CCM A;  1ORG A;  3KEV A;  4QJ5 B;  1B8R A;  2L2E A;  1D1O A;  3CTN A;  3LK0 A;  1AJ4 A;  3BOW B;  1TNX A;  1C3Z A;  3BXK A;  3CLN A;  2EC6 C;  1QAT A;  1YX8 A;  1UHK A;  1S6I A;  3VGO A;  1GQM A;  3IVT A;  1DC1 A;  1B7T Y;  4YI9 A;  1KQM B;  1QLS A;  2LVI A;  2JWW A;  4JPZ B;  4OVN F;  3VRQ A;  3EVV A;  2GGM A;  1XA5 A;  3DF0 B;  2LM5 A;  1SR6 B;  1QTX A;  3AAJ A;  3PAL A;  3WXA A;  2JU0 A;  4MBE A;  1OOF A;  2KI6 D;  1SY9 A;  2JRF A;  2WOS A;  1WLZ A;  1QXP A;  3PSR A;  1YTZ C;  4I5J A;  3CR4 X;  2PRU A;  4JQ0 D;  3D78 A;  3ZNI A;  4Q04 A;  2WCL A;  4JD9 A;  4FTG A;  4GFT A;  3O2P A;  4PAL A;  5KSZ A;  1F4O A;  1R2U A;  1JC2 A;  4OKH A;  1NYA A;  2M97 A;  5F6T A;  5AER A;  5I2O A;  1NUB A;  4NDD A;  4MSP A;  4C0J A;  1OQP A;  2K7C A;  1TIZ A;  2KFH A;  4WQ3 A;  3RLZ A;  2CT9 A;  1S5G Z;  2EGD A;  2JQ6 A;  1W9Z A;  2OS8 B;  4YGD B;  2WC5 A;  3NSK A;  1CDM A;  1OZO A;  1WY9 A;  3EVU A;  2B1U A;  1S36 A;  4PE7 A;  5JJG A;  2BCA A;  1F71 A;  2WC8 A;  1KCY A;  3CWG A;  1DEK A;  1EG3 A;  2F2O A;  3DVM A;  4R1E A;  1DTL A;  1TNQ A;  1XK4 A;  3K21 A;  3LCP C;  2JT0 A;  1BR1 B;  4INX A;  1RWY A;  4OV2 A;  1UWO A;  3OB1 B;  4WQ2 A;  3SIB A;  1NWD A;  1PVB A;  3TS5 B;  1UHN A;  1Y6W A;  2BCB A;  1DGV A;  1SNL A;  1BF5 A;  4DS7 A;  1A75 B;  2FCD A;  2K8M B;  1SCV A;  5FI6 A;  1JWD A;  1VRK A;  2KHN A;  2L4H A;  4GPL B;  2JXC A;  3VRR A;  1N65 A;  1PVA A;  3EVR A;  3GK2 A;  4A4C A;  2NXQ A;  2L0P A;  1Z2C B;  2ZFD A;  4GUK A;  2FCE A;  1SL7 A;  2KAX A;  3BUN B;  1ZAC A;  3QRX A;  3SS3 A;  1NCZ A;  3BUM B;  3NSO A;  2KAV A;  4L9M A;  4DIR A;  2M8U A;  3I5H C;  3ZWH A;  1CB1 A;  2JZI A;  1SCM C;  1LS8 A;  3KHE A;  1JBA A;  1FBV A;  3R72 A;  2KFF A;  4XJK B;  5JOL A;  5I8N A;  4ETO A;  1CNP A;  2GTE A;  1QX2 A;  3FS7 A;  1MUX A;  1BMO A;  3IF7 A;  3SG5 A;  2YGU A;  3IQQ A;  3UO9 A;  3N7H A;  1FI6 A;  2LNK A;  2ZN8 A;  1SL9 A;  3AKA A;  2MA2 A;  4QJ4 B;  3OP0 A;  2KI6 C;  1OW4 A;  3IQO A;  1J1D A;  3L4L A;  4WRI A;  1KK7 Z;  1OZS A;  2BKI B;  2LMT A;  3WHT B;  1CLM A;  2BE6 A;  1YX7 A;  1M63 B;  5D69 A;  2I18 A;  2SAS A;  1W7I B;  2PAL A;  1ODB A;  1SKT A;  3BFH A;  3D73 A;  1WDC B;  1M31 A;  2K60 A;  2TN4 A;  4PHJ A;  2M3W A;  3NGV A;  4N1G A;  4MVF A;  5DKQ A;  1F70 A;  1CM1 A;  2KBM A;  3NHT A;  1Y0V H;  1B4C A;  1IJ6 A;  1M45 A;  3MSE B;  1AK8 A;  1XFY O;  4PE1 A;  2LUC A;  2L51 A;  2M1K B;  2OPO A;  1DJW A;  4M2Q A;  4YBH B;  5B8I B;  1NP8 A;  1DMO A;  3SJS A;  1KWO C;  2K7O A;  1KFU S;  3DF0 A;  2M7L A;  5HKW A;  5CSI A;  4HSZ A;  3FE8 A;  1OOH A;  3EK4 A;  3FE6 A;  4PHK A;  3A8R A;  2JTT A;  1OOI X;  3PN7 C;  1SCM B;  1G33 A;  3I5H B;  2JOJ A;  2ISD A;  4FQO A;  2R2I A;  2Q91 A;  4MZJ A;  3I5F B;  3S0F A;  4YGC B;  1RJV A;  1F55 A;  1TTX A;  3D74 A;  3GK1 A;  2L98 A;  2H61 C;  4GBA A;  1BOC A;  2H61 A;  4I5N B;  1NX0 A;  3VB1 A;  4PDZ A;  1CFD A;  2AAO A;  5I94 A;  1QWV A;  3D75 A;  2BE4 A;  2V53 A;  1NIW A;  1LKJ A;  1UUS A;  3DXL A;  3DVK A;  1IQ5 A;  3EK8 A;  2K0J A;  1E8A A;  1KSO A;  1AHR A;  2ZNE A;  1T14 A;  1AP4 A;  3E3R A;  1J7R A;  4AQI A;  1OOG A;  1TN4 A;  2JT8 A;  3FE9 A;  2JPO A;  2P6B B;  2BKH B;  1UHJ A;  1DJI A;  1Z4H A;  2KPH A;  2Q4U A;  3EK7 A;  3B7A A;  1LA0 A;  1NPQ A;  4MN0 A;  3BOW A;  1TCO B;  1J1E A;  1JFK A;  1J7P A;  3UNW A;  4PT1 A;  3BUO B;  2WCJ A;  1TNP A;  2KAY A;  2QAC A;  1SSE B;  3R1O A;  4QJ3 B;  5IBW A;  1XFR A;  1DJZ A;  1ALW A;  3BYA A;  2PQL A;  2LAN A;  1C7V A;  5EL2 A;  4XYN A;  2L5Y A;  2DOQ A;  1MQ1 A;  3I5I B;  1CKK A;  1MHO A;  2KSP A;  2O5G A;  1H4B A;  1S3P A;  3D0Y B;  3JTD C;  1KFU L;  1L2O C;  4BY5 A;  2WCF A;  2A4J A;  1YVL A;  1SMG A;  1HQV A;  1CDL A;  2JXL A;  2PVB A;  1IQ3 A;  2ZRT A;  2MBX A;  1ALV A;  1XO5 A;  3I5F C;  4I5L B;  1WRZ A;  2L5X B;  1F8H A;  2MLF C;  3BFA A;  1B9A A;  1J55 A;  1S6C A;  1EL4 A;  1PSB A;  3BUX B;  1TRF A;  4NDC A;  2HQW A;  3FWB A;  3PJI A;  1FPW A;  3O4Y A;  2M29 A;  2BEC A;  4GGF C;  1Y1A A;  1MF8 B;  1A2X A;  1U5I B;  2L2C A;  2LVV A;  5FYX A;  5G08 A;  1GJY A;  3PFV A;  3TDZ A;  5HLO A;  1V1F A;  2F33 A;  2VRG A;  1BOD A;  1UUR A;  2MHH A;  3RZS A;  1CDN A;  3TZ1 A;  5K89 A;  3R1V A;  1PK0 D;  3S0D A;  3ICB A;  5I2L A;  2F3Y A;  2FOT A;  3CR2 A;  2LAP A;  5KTY A;  1YRU B;  3SS5 A;  4MEW A;  1S5G Y;  1M46 A;  2PSR A;  2BBN A;  3CAB A;  2QEV A;  1TUJ A;  4A4B A;  3B86 A;  5HYD A;  3L4A A;  1JF2 A;  3NSI A;  5KU1 A;  1NCY A;  1QV1 A;  4PE0 A;  2CXJ A;  1B7T Z;  3CZT X;  2MAZ A;  3F45 A;  3L47 A;  4FQT A;  4HRH A;  3SG7 A;  1REC A;  1BG1 A;  3FWC A;  1C3Y A;  2BCX A;  1K9P A;  1TCF A;  3TUY B;  4GNK B;  3BJH A;  3O6B A;  1DJX A;  5CSF A;  2K61 A;  3JVT B;  4I5K A;  1G8I A;  2KQ6 A;  2WCK A;  1QAS A;  3BUW B;  2MLE C;  3CGA A;  1P28 A;  3GK4 X;  3NSL A;  4OZD A;  5DKN A;  3SG3 A;  1DGU A;  1NX3 A;  4UPG A;  3AKB A;  3D10 A;  4INW A;  4YI8 A;  2JUL A;  1UP5 A;  1DF0 B;  2KGR A;  3WNX B;  4JWQ A;  3Q8I A;  1L2O B;  1B8C A;  3CDN A;  1WLM A;  2GV5 A;  2WND A;  3EKJ A;  4MRY A;  5AEQ A;  1IIO A;  1FW4 A;  1YUU A;  1B8L A;  1CTR A;  1G4Y R;  1K95 A;  1UHI A;  3DYE A;  5CPV A;  4CLN A;  2EC6 B;  2M9G A;  2L4I A;  1IH0 A;  3LK1 A;  1IRJ A;  2EHB A;  4AQJ A;  2KQY A;  2KOT A;  1JUO A;  1MXL C;  2ZN9 A;  3TUY C;  1C7W A;  1TUZ A;  2RGI A;  3D76 A;  2WCB A;  1SBJ A;  4OCI A;  3HCM A;  3OGN A;  4DCK A;  2PMY A;  4F0Z B;  2QPT A;  1BJF A;  1CFP A;  4ORC B;  2E6W A;  2P71 A;  3SG6 A;  2K2F A;  1PSR A;  2E30 A;  2LLS A;  5ER4 X;  1L7Z A;  2NLN A;  4NDB A;  2K7D A;  1AUI B;  2O60 A;  2JNF A;  5DIC A;  2LE9 B;  1PRW A;  1Q80 A;  1FF1 A;  3O78 A;  2CNP A;  3BQ3 A;  4MZL A;  4N5X A;  2CTN A;  2OTG B;  2LVK A;  1A03 A;  4N1F A;  3EKH A;  5FI7 A;  3CS1 A;  1IJ5 A;  4PHM A;  4U8D A;  1WDC C;  1M39 A;  1QIV A;  1XYD A;  2LUX A;  1DVI A;  2FJU B;  3B88 A;  1DF0 A;  1OMD A;  1K8U A;  3C1V A;  3M0W A;  1XFU O;  1S1E A;  3OB2 B;  1GM0 A;  1IG5 A;  2I94 A;  1K2H A;  2PYQ A;  4F7F A;  3KO0 A;  5HLV A;  2Y4Q A;  1IWQ A;  3RM1 A;  1KK7 Y;  1KWO B;  2QEO A;  2LVJ A;  2AMI A;  1KQM C;  1V1G A;  4NQG A;  3CYZ A;  3I5G C;  4CFQ A;  4GGN A;  4MLW A;  4C0K A;  1RK9 A;  3TDU A;  3PN7 B;  1ZUZ A;  2P70 A;  5CSN A;  5DKR A;  4AOM A;  1FI5 A;  1SW8 A;  1LVC D;  3PLF B;  5HKY A;  2HF5 A;  2H2K A;  2Y5I A;  5PAL A;  2FJY A;  1K96 A;  3R1P A;  3CR5 X;  1K90 D;  3I5I C;  1NCX A;  3PM8 A;  1KK8 C;  1JFJ A;  3A4U B;  3S0A A;  5HKZ A;  4ICB A;  2M7N A;  1KSM A;  2I2R E;  2ZRS A;  4CID A;  1BR4 B;  3DVE A;  1DJH A;  4BY4 A;  1QIW A;  1QS7 A;  1OE9 B;  1MXE A;  3CZ2 A;  1DEL A;  1EG4 A;  4IL1 A;  4CPV A;  1XFV O;  1TWO A;  2AUC A;  1ZFS A;  1TNW A;  1MWN A;  2K7B A;  4HRE E;  4MRX A;  4MZK A;  2LLT A;  1OSA A;  2D8N A;  4HRG A;  3KPX A;  1N2D A;  1WRL A;  4C0L A;  3TS5 C;  1AJ5 A;  1SK6 D;  2G2B A;  2Y1N A;  1ZOT B;  3D0Y A;  3DZT A;  1QV0 A;  2LHL A;  1YRT B;  4PE4 A;  2NCO A;  3SIA A;  1SPY A;  3BFB A;  3V2L A;  2HQ8 A;  1K9U A;  1LA3 A;  4USL A;  4D1E A;  1MR8 A;  2OS8 C;  2H8V A;  2QDI A;  1SYM A;  4P5O E;  4KYN A;  3AAK A;  2L50 A;  3SG4 A;  2KYF A;  2KI4 B;  2JTZ A;  3DD4 A;  1S6J A;  1YUT A;  2NZ0 A;  1CFF A;  3I5G B;  1XFW O;  3EG5 B;  1X02 A;  1NSH A;  4YGA A;  2NCP A;  1A75 A;  1RFJ A;  3OX5 A;  2LCP A;  3DVJ A;  1KQV A;  1RTP 1;  2PAS A;  2M0R A;  4M2P A;  2SCP A;  2GGZ A;  2KGB C;  3QME A;  1XK4 C;  2IS9 A;  3SG2 A;  5FI2 A;  3FIA A;  2G9B A;  3NHI A;  3JVT C;  1QVI Y;  2BL0 B;  4GAO A;  3NXA A;  3S0E A;  1QLK A;  1QX5 B;  2JC2 A;  2LHI A;  3CZ1 A;  3S0G A;  2HPS A;  1F54 A;  2LMV A;  3HX4 A;  4TNC A;  1DT7 B;  1LXF C;  5D3O A;  1N0Y A;  1KK8 B;  3VRN A;  1XFZ O;  1XFX O;  1BU3 A;  1YUS A;  1S26 D;  1DJG A;  4YRU A;  5GQQ C;  1DJY A;  2BNX A;  2WCH A;  1CDP A;  1BT6 A;  1JF0 A;  1H8B A;  1JSA A;  1PAL A;  5TNC A;  1EXR A;  2CBL A;  4E68 A;  1NX2 A;  2LP2 A;  4GGF A;  1EH2 A;  5AXI A;  1QJT A;  3GOF A;  1WRK A;  1F4Q A;  2HET A;  5D7F A;  1K94 A;  1IGV A;  5BPJ A;  1RRO A;  1C07 A;  3S0B A;  1J7O A;  3LL8 B;  4ZCV A;  3DY9 A;  1CM4 A;  1YVH A;  3OX6 A;  2BAP A;  1EJ3 A;  2KNE A;  4XJK A;  2LP3 A;  1SR6 C;  4PHN A;  4CFR A;  5HL1 A;  2ZKM X;  4ZCU A;  2KDH A;  2MRD A;  3D77 A;  2ERB A;  2F2P A;  2WCM A;  1HT9 A;  2M1U A;  2M49 B;  3PM2 A;  4IJ7 A;  3OBV A;  1CMF A;  2WCE A;  4M2O A;  2JNX A;  1OOJ A;  4PCW A;  1B1G A;  5AFP A;  2COL B;  2LMU A;  3JTD B;  4YGE B;  1IKU A;  1K9K A;  1PUL A;  3B87 A;  1A4P A;  2KI4 C;  2BBM A;  1Y1X A;  2KFG A;  3LLE A;  1B47 A;  2QEB A;  4P2Y B;  1A29 A;  4JKT A;  1QX7 A;  5AAN A;  1GGW A;  1SL8 A;  2LLU A;  1W7J B;  1K93 D;  2KYC A;  1AVS A;  1J7Q A;  2OTG C;  2LV7 A;  3KF9 A;  1CMG A;  1U5I A;  1LIN A;  1YR5 A;  1GGZ A;  1Y1U A;  2WOR A;  3WHU B;  3B6X A;  1NX1 A;  1OMV A;  5J3X A;  2JT3 A;  2Y1M A;  4DUQ A;  1CLL A;  3OHM B;  2ZND A;  2MJW B;  3H4S E;  4YGB B;  2K2A A;  1OMR A;  3VRP A;  1BLQ A;  5ER5 A;  5I2Q A;  2KBI A;  2BL0 C;  4OR9 B;  5CSJ A;  2KLE A;  2WC6 A;  4DRW A;  2F3Z A;  1KFX L;  1XVJ A;  3O4X A;  2KLD A;  3TDI A;  1TOP A;  1DQE A;  1CLB A;  3K1E A;  1QVI Z;  2I7A A;  4ORA B;  2LC5 A;  3SS4 A;  3CZ0 A;  3VRO A;  1CFC A;  4ORB B;  1R6P A;  1ZMZ A;  1SRA A;  2F8P A;  1UHH A;  2JPT A;  2QEH A; 
#chains in the Genus database with same CATH homology
 1YUR A;  3PAT A;  1KFX S;  2CCM A;  3KEV A;  4QJ5 B;  1B8R A;  2L2E A;  1D1O A;  3CTN A;  3LK0 A;  1AJ4 A;  3BOW B;  1TNX A;  3BXK A;  3CLN A;  2EC6 C;  1QAT A;  1YX8 A;  1UHK A;  1S6I A;  3VGO A;  1GQM A;  1B7T Y;  4YI9 A;  1KQM B;  1QLS A;  2LVI A;  2JWW A;  4JPZ B;  4OVN F;  3VRQ A;  3EVV A;  2GGM A;  1XA5 A;  3DF0 B;  2LM5 A;  1SR6 B;  1QTX A;  3AAJ A;  3PAL A;  3WXA A;  2JU0 A;  4MBE A;  2KI6 D;  1SY9 A;  2JRF A;  2WOS A;  1WLZ A;  1QXP A;  3PSR A;  1YTZ C;  4I5J A;  3CR4 X;  2PRU A;  4JQ0 D;  1DT7 B;  3ZNI A;  4Q04 A;  1IH0 A;  4FTG A;  4GFT A;  3O2P A;  4PAL A;  5KSZ A;  1F4O A;  1R2U A;  1JC2 A;  4OKH A;  1NYA A;  2M97 A;  5F6T A;  5AER A;  5I2O A;  1NUB A;  4NDD A;  4MSP A;  4C0J A;  1OQP A;  2K7C A;  1TIZ A;  2KFH A;  4WQ3 A;  3RLZ A;  2CT9 A;  1S5G Z;  2EGD A;  2JQ6 A;  2OS8 B;  4YGD B;  3NSK A;  1CDM A;  1OZO A;  1WY9 A;  3EVU A;  2B1U A;  1S36 A;  4PE7 A;  5JJG A;  2BCA A;  1F71 A;  2WC8 A;  1KCY A;  3CWG A;  1EG3 A;  2F2O A;  3DVM A;  4R1E A;  1DTL A;  1TNQ A;  1XK4 A;  3K21 A;  3LCP C;  2JT0 A;  1BR1 B;  4OV2 A;  1RWY A;  4WQ2 A;  1UWO A;  3OB1 B;  3SIB A;  1NWD A;  1PVB A;  3TS5 B;  1UHN A;  1Y6W A;  2BCB A;  1DGV A;  1SNL A;  1BF5 A;  4DS7 A;  1A75 B;  2FCD A;  2K8M B;  1SCV A;  1JWD A;  1VRK A;  2KHN A;  2L4H A;  4GPL B;  2JXC A;  3VRR A;  1N65 A;  1PVA A;  3EVR A;  3GK2 A;  4A4C A;  2NXQ A;  2L0P A;  2ZFD A;  4GUK A;  2FCE A;  1SL7 A;  2KAX A;  3BUN B;  1ZAC A;  3QRX A;  1NCZ A;  3BUM B;  3NSO A;  2KAV A;  4L9M A;  4DIR A;  2M8U A;  3I5H C;  3ZWH A;  1CB1 A;  2JZI A;  1SCM C;  3KHE A;  1JBA A;  1FBV A;  2KFF A;  4XJK B;  5JOL A;  5I8N A;  4ETO A;  1CNP A;  1QX2 A;  3FS7 A;  1MUX A;  1BMO A;  3IF7 A;  3SG5 A;  3IQQ A;  1FI6 A;  2LNK A;  2ZN8 A;  1SL9 A;  3AKA A;  2MA2 A;  4QJ4 B;  3OP0 A;  2KI6 C;  3IQO A;  1J1D A;  4WRI A;  1KK7 Z;  1OZS A;  2BKI B;  2LMT A;  3WHT B;  1CLM A;  2BE6 A;  1YX7 A;  1M63 B;  5D69 A;  2I18 A;  2SAS A;  1W7I B;  2PAL A;  1ODB A;  1SKT A;  1WDC B;  1M31 A;  2TN4 A;  4PHJ A;  1F70 A;  2M3W A;  4N1G A;  4MVF A;  5DKQ A;  1CM1 A;  2KBM A;  1Y0V H;  1B4C A;  1IJ6 A;  1M45 A;  3MSE B;  1AK8 A;  1XFY O;  4PE1 A;  2LUC A;  2L51 A;  2M1K B;  2OPO A;  1DJW A;  4M2Q A;  4YBH B;  5B8I B;  1NP8 A;  1DMO A;  3SJS A;  1KWO C;  2K7O A;  1KFU S;  3DF0 A;  2M7L A;  5HKW A;  5CSI A;  4HSZ A;  3EK4 A;  4PHK A;  3A8R A;  2JTT A;  3PN7 C;  1SCM B;  1G33 A;  3I5H B;  2JOJ A;  2ISD A;  4FQO A;  2R2I A;  2Q91 A;  4MZJ A;  3I5F B;  4YGC B;  1RJV A;  1F55 A;  1TTX A;  3GK1 A;  4GBA A;  2L98 A;  2H61 C;  1BOC A;  2H61 A;  4I5N B;  1NX0 A;  4PDZ A;  1CFD A;  2AAO A;  2BE4 A;  2V53 A;  1NIW A;  1LKJ A;  1UUS A;  3DVK A;  1IQ5 A;  3EK8 A;  2K0J A;  1E8A A;  1KSO A;  1AHR A;  2ZNE A;  3E3R A;  1J7R A;  4AQI A;  1TN4 A;  2JT8 A;  2P6B B;  2BKH B;  1UHJ A;  1DJI A;  2Q4U A;  3EK7 A;  1LA0 A;  1NPQ A;  4MN0 A;  3BOW A;  1TCO B;  1J1E A;  1JFK A;  3BUO B;  1TNP A;  2KAY A;  2QAC A;  4QJ3 B;  5IBW A;  1DJZ A;  1ALW A;  3BYA A;  2LAN A;  1C7V A;  4XYN A;  2DOQ A;  1MQ1 A;  3I5I B;  1CKK A;  1MHO A;  2KSP A;  2O5G A;  1H4B A;  1S3P A;  3D0Y B;  3JTD C;  1KFU L;  1L2O C;  4BY5 A;  2WCF A;  2A4J A;  1YVL A;  1SMG A;  1HQV A;  1CDL A;  2JXL A;  2PVB A;  1IQ3 A;  2ZRT A;  2MBX A;  1ALV A;  1XO5 A;  3I5F C;  4I5L B;  1WRZ A;  2L5X B;  1F8H A;  2MLF C;  1B9A A;  1J55 A;  1S6C A;  1EL4 A;  1PSB A;  3BUX B;  1TRF A;  4NDC A;  2HQW A;  3FWB A;  1FPW A;  3O4Y A;  2M29 A;  2BEC A;  4GGF C;  1Y1A A;  1MF8 B;  1A2X A;  1U5I B;  2LVV A;  5FYX A;  5G08 A;  1AP4 A;  1GJY A;  3PFV A;  3TDZ A;  5HLO A;  1V1F A;  2F33 A;  2VRG A;  1BOD A;  1UUR A;  2MHH A;  1CDN A;  3TZ1 A;  5K89 A;  1PK0 D;  3ICB A;  5I2L A;  2F3Y A;  2FOT A;  3CR2 A;  2LAP A;  5KTY A;  1YRU B;  4MEW A;  1S5G Y;  1M46 A;  2PSR A;  2BBN A;  4A4B A;  5HYD A;  1JF2 A;  3NSI A;  5KU1 A;  1NCY A;  1QV1 A;  4PE0 A;  2CXJ A;  1B7T Z;  3CZT X;  2MAZ A;  3F45 A;  4HRH A;  1BG1 A;  1J7P A;  3SG7 A;  1REC A;  3FWC A;  2BCX A;  1K9P A;  1TCF A;  3TUY B;  4GNK B;  3O6B A;  1DJX A;  5CSF A;  2K61 A;  3JVT B;  4I5K A;  1G8I A;  2KQ6 A;  3BUW B;  1QAS A;  3CGA A;  2MLE C;  3GK4 X;  3NSL A;  5DKN A;  3SG3 A;  1DGU A;  1NX3 A;  4UPG A;  3AKB A;  3D10 A;  4YI8 A;  2JUL A;  1UP5 A;  1DF0 B;  2KGR A;  3WNX B;  4JWQ A;  1L2O B;  1B8C A;  1WLM A;  2GV5 A;  2WND A;  3EKJ A;  4MRY A;  5AEQ A;  1FW4 A;  1YUU A;  1B8L A;  1CTR A;  1G4Y R;  1K95 A;  1UHI A;  5CPV A;  4CLN A;  2EC6 B;  2M9G A;  2L4I A;  3LK1 A;  1IRJ A;  2EHB A;  4AQJ A;  2KQY A;  2KOT A;  1JUO A;  1MXL C;  2ZN9 A;  3TUY C;  1C7W A;  2RGI A;  2WCB A;  1SBJ A;  4OCI A;  3HCM A;  4DCK A;  2PMY A;  4F0Z B;  2QPT A;  1BJF A;  1CFP A;  4ORC B;  2E6W A;  3SG6 A;  2K2F A;  1PSR A;  2E30 A;  2LLS A;  5ER4 X;  1L7Z A;  2NLN A;  4NDB A;  2K7D A;  1AUI B;  2O60 A;  2JNF A;  2LE9 B;  1PRW A;  1Q80 A;  1FF1 A;  3O78 A;  2CNP A;  3BQ3 A;  4MZL A;  4N5X A;  2CTN A;  2OTG B;  2LVK A;  1A03 A;  4N1F A;  3EKH A;  3CS1 A;  1IJ5 A;  4PHM A;  4U8D A;  1WDC C;  1M39 A;  1QIV A;  1XYD A;  2LUX A;  1DVI A;  2FJU B;  1DF0 A;  1OMD A;  1K8U A;  3C1V A;  3M0W A;  1XFU O;  1S1E A;  3OB2 B;  1IG5 A;  2I94 A;  1K2H A;  3KO0 A;  5HLV A;  2Y4Q A;  1IWQ A;  3RM1 A;  1KK7 Y;  1KWO B;  2LVJ A;  2AMI A;  1KQM C;  1V1G A;  4NQG A;  3I5G C;  4CFQ A;  4GGN A;  4MLW A;  4C0K A;  1RK9 A;  3TDU A;  3PN7 B;  1ZUZ A;  5CSN A;  5DKR A;  1FI5 A;  4AOM A;  1SW8 A;  1LVC D;  3PLF B;  5HKY A;  2HF5 A;  2H2K A;  2Y5I A;  5PAL A;  1K96 A;  3CR5 X;  1K90 D;  3I5I C;  1NCX A;  3PM8 A;  1KK8 C;  1JFJ A;  3A4U B;  5HKZ A;  4ICB A;  2M7N A;  1KSM A;  2I2R E;  2ZRS A;  4CID A;  1BR4 B;  3DVE A;  1DJH A;  4BY4 A;  1QIW A;  1QS7 A;  1OE9 B;  1MXE A;  4IL1 A;  1EG4 A;  4CPV A;  1XFV O;  2AUC A;  1ZFS A;  1TNW A;  1MWN A;  2K7B A;  4HRE E;  4MRX A;  4MZK A;  2LLT A;  1OSA A;  2D8N A;  4HRG A;  3KPX A;  1N2D A;  1WRL A;  3TS5 C;  1AJ5 A;  1SK6 D;  2G2B A;  2Y1N A;  1ZOT B;  3D0Y A;  1QV0 A;  2LHL A;  1YRT B;  4PE4 A;  2NCO A;  3SIA A;  1SPY A;  2HQ8 A;  1K9U A;  1LA3 A;  4USL A;  4D1E A;  1MR8 A;  2OS8 C;  1SYM A;  4P5O E;  3AAK A;  2L50 A;  3SG4 A;  2KYF A;  2KI4 B;  2JTZ A;  3DD4 A;  1S6J A;  1YUT A;  2NZ0 A;  1CFF A;  3I5G B;  1XFW O;  1X02 A;  1NSH A;  4YGA A;  2NCP A;  1A75 A;  1RFJ A;  3OX5 A;  2LCP A;  3DVJ A;  1KQV A;  1RTP 1;  2PAS A;  2M0R A;  4M2P A;  2SCP A;  2GGZ A;  2KGB C;  1XK4 C;  2IS9 A;  3SG2 A;  3FIA A;  2G9B A;  3JVT C;  1QVI Y;  2BL0 B;  4GAO A;  3NXA A;  1QLK A;  1QX5 B;  2JC2 A;  2LHI A;  2HPS A;  1F54 A;  2LMV A;  3HX4 A;  4TNC A;  1LXF C;  1N0Y A;  1KK8 B;  3VRN A;  1XFZ O;  1XFX O;  1BU3 A;  1YUS A;  1S26 D;  1DJG A;  4YRU A;  5GQQ C;  1DJY A;  1CDP A;  1BT6 A;  1JF0 A;  1H8B A;  1JSA A;  1PAL A;  5TNC A;  1EXR A;  2CBL A;  4E68 A;  1NX2 A;  2LP2 A;  4GGF A;  1EH2 A;  5AXI A;  1QJT A;  3GOF A;  1WRK A;  1F4Q A;  2HET A;  5D7F A;  1K94 A;  1IGV A;  5BPJ A;  1RRO A;  1C07 A;  1J7O A;  3LL8 B;  4ZCV A;  1CM4 A;  1YVH A;  3OX6 A;  1EJ3 A;  2KNE A;  4XJK A;  2LP3 A;  1SR6 C;  4PHN A;  4CFR A;  2ZKM X;  4ZCU A;  2KDH A;  2MRD A;  2F2P A;  1HT9 A;  2M1U A;  2M49 B;  1CMF A;  2WCE A;  4M2O A;  2JNX A;  1OOJ A;  4PCW A;  1B1G A;  5AFP A;  2COL B;  2LMU A;  3JTD B;  4YGE B;  1IKU A;  1K9K A;  1PUL A;  1A4P A;  2KI4 C;  2BBM A;  1Y1X A;  2KFG A;  3LLE A;  1B47 A;  4P2Y B;  1A29 A;  1QX7 A;  5AAN A;  1GGW A;  1SL8 A;  2LLU A;  1W7J B;  1K93 D;  2KYC A;  1AVS A;  1J7Q A;  2OTG C;  2LV7 A;  3KF9 A;  1CMG A;  1U5I A;  1LIN A;  1YR5 A;  1GGZ A;  1Y1U A;  2WOR A;  3WHU B;  1NX1 A;  1OMV A;  5J3X A;  2JT3 A;  2Y1M A;  4DUQ A;  1CLL A;  3OHM B;  2ZND A;  2MJW B;  3H4S E;  4YGB B;  2K2A A;  1OMR A;  3VRP A;  1BLQ A;  5ER5 A;  5I2Q A;  2KBI A;  2BL0 C;  4OR9 B;  5CSJ A;  4DRW A;  2F3Z A;  1KFX L;  1XVJ A;  3TDI A;  1TOP A;  1CLB A;  1QVI Z;  2I7A A;  4ORA B;  2LC5 A;  3VRO A;  1CFC A;  4ORB B;  1R6P A;  1ZMZ A;  1SRA A;  2F8P A;  1UHH A;  2JPT A;  4C0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...