1M31A

Three-dimensional solution structure of apo-mts1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Placental calcium-binding protein
publication title Solution structure of human Mts1 (S100A4) as determined by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 26
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m31A00
2PSRA 1A29A 2SCPA 4PE1A 1RECA 2GGMA 2L0PA 4CFQA 1CFFA 1TOPA 1XFWO 4GFTA 2MAZA 1QLKA 1RFJA 2DOQA 3BUNB 2A4JA 2M7LA 3JVTB 5AXIA 2LLUA 2KFHA 2ZFDA 4XJKB 4YGDB 4MZLA 3I5GC 5GQQC 5JJGA 1KSOA 5CSIA 1NP8A 1S3PA 2F3ZA 2M8UA 4P5OE 5IBWA 1B7TZ 2NCPA 1KQMC 4F0ZB 4XYNA 1J7PA 2BKIB 1Y0VH 1YUTA 3KHEA 5DKQA 5KSZA 1SW8A 3EVVA 3PN7B 3WHUB 4FTGA 3BOWA 2KAXA 1CLMA 3DVKA 1ZOTB 4FQOA 1B7TY 4YBHB 4YGEB 2KBMA 2HF5A 3GK1A 4JQ0D 2ISDA 1GQMA 5FYXA 2ZN8A 3PSRA 2LANA 1RK9A 2LMTA 3ZNIA 1IQ3A 1B8RA 4JPZB 3AAJA 1WY9A 2KNEA 2H61C 1FI5A 1MXEA 1CDPA 2WOSA 3SG4A 2MA2A 2K2FA 1DT7B 1M45A 1L2OC 1RROA 1F55A 4OR9B 3LL8B 1OQPA 1JF2A 1VRKA 1TIZA 2JNXA 5HLVA 1Y1UA 1CM4A 1ZACA 4WQ2A 1SCVA 2K7DA 2MJWB 1M39A 1TCOB 5TNCA 1PVBA 1Y6WA 3OB2B 1EL4A 4C0LA 2JC2A 2WC8A 2F2OA 1XVJA 1PVAA 1OSAA 2GGZA 2CTNA 1MHOA 2NLNA 1S6CA 3OP0A 1AHRA 2M3WA 1QTXA 4PHMA 2NCOA 1NWDA 1OE9B 1LVCD 1KFUS 1F54A 1BU3A 2LUCA 1YRUB 1IRJA 2F33A 3TUYB 2M1KB 3JVTC 1C7WA 3A8RA 1CFCA 2KAVA 1A4PA 5B8IB 3CR4X 2H2KA 2RGIA 2O5GA 3BUOB 3SG3A 3NSLA 1YR5A 4OVNF 1CDMA 3BUWB 2BBNA 1OMDA 1QVIZ 1N2DA 1A03A 1AUIB 2KOTA 4OCIA 1RTP1 3DF0B 2LMUA 1CMGA 2PALA 1BR4B 2BCXA 1J1DA 3PN7C 3GK2A 1KQVA 1J1EA 2WCBA 2KI6C 2LV7A 3NSKA 2LE9B 4IL1A 1DJWA 1BT6A 1M46A 3IQOA 1MUXA 1YRTB 1BMOA 2BE6A 2LMVA 2MHHA 1S36A 1QIWA 2PVBA 1CDLA 5ER5A 1YUSA 2LNKA 2HQ8A 1CFDA 2LC5A 3F45A 2Q91A 1B8LA 4P2YB 2K8MB 3I5HB 1BR1B 1KSMA 1OMVA 2JNFA 1IG5A 5J3XA 2JU0A 2K61A 2L4HA 2KDHA 1SL8A 1DF0B 3BXKA 1A2XA 4ZCUA 1JF0A 4DUQA 2P6BB 1TNQA 1WRZA 1KWOB 1DMOA 3BOWB 2ZRTA 1SBJA 3EKJA 1K9UA 3BUXB 4OKHA 1WRLA 2B1UA 1NPQA 4TNCA 4JWQA 4QJ3B 1DJXA 4GGFA 3KO0A 1QV0A 3PM8A 3FIAA 1GGWA 4I5NB 3VGOA 4D1EA 4AQIA 2M0RA 1K95A 1CB1A 4YGBB 1NX2A 2JT0A 4A4CA 4GBAA 4PHJA 1YX7A 2KFFA 5JOLA 1WLZA 2ZN9A 1PK0D 1LA3A 3TUYC 3CS1A 4YRUA 2EC6B 1M63B 1UURA 2I7AA 1QLSA 1B8CA 2JTZA 2F2PA 5D69A 1DJHA 1DTLA 4MSPA 3HCMA 2ZKMX 4PHNA 1NSHA 2AUCA 3DD4A 4DS7A 3NSOA 1DF0A 4M2QA 1JWDA 3EVRA 4GGFC 2JRFA 1J7RA 2TN4A 3BQ3A 1ZUZA 3LK0A 4GNKB 2MRDA 3EK7A 3IF7A 2SASA 3KEVA 4HREE 1S5GZ 1BJFA 2QPTA 1EJ3A 2JT3A 1XFYO 3GK4X 1QATA 3O4YA 1JBAA 1SR6B 5I2LA 1YX8A 5PALA 2NZ0A 2COLB 1XFXO 3O78A 4BY4A 1KK8B 1S5GY 2OS8B 4N5XA 4ORBB 1SL9A 3I5HC 2MBXA 1R2UA 1PRWA 5AEQA 4HRHA 5CSNA 4CIDA 1UWOA 4DCKA 4MLWA 1BLQA 1JFKA 4WRIA 2Y1MA 1QX2A 1TNWA 5AERA 3AAKA 1XFUO 1K9KA 1KWOC 1TTXA 1SY9A 2AMIA 4ICBA 1IQ5A 2WORA 3NXAA 2LVVA 2BECA 4PHKA 1KK7Z 3EK4A 2IS9A 2VRGA 3GOFA 2L4IA 4I5JA 3TZ1A 4U8DA 1MF8B 2FCDA 2WCFA 1FW4A 1F8HA 1KK7Y 1TN4A 3CR2A 1IWQA 2EC6C 2Y4QA 4ORAB 1PSRA 4PE4A 1QIVA 1PALA 2FOTA 4N1GA 1IJ6A 2E30A 1B9AA 5AANA 2OPOA 1S6JA 4PE7A 2JXCA 2M49B 2Y1NA 3DVMA 4YGCB 3JTDB 4E68A 1AK8A 1N65A 2CCMA 2LP2A 1DJZA 1JUOA 3KPXA 2WCEA 4M2OA 1KFXL 3ZWHA 4MBEA 1SL7A 2M29A 5AFPA 2JOJA 1LKJA 1DJIA 1XK4A 2FCEA 2BE4A 2L51A 1AP4A 4HRGA 3VRQA 2KGRA 1BODA 2CBLA 3KF9A 1DVIA 1F4QA 1HQVA 1NUBA 1QVIY 5CSFA 4AQJA 1K2HA 3CZTX 1A75A 4MZJA 2LM5A 2PMYA 5HKWA 5D7FA 4MN0A 2PASA 1V1GA 2G2BA 2Q4UA 1QXPA 4CLNA 1DJYA 1MR8A 2OTGB 3SG6A 1CM1A 1KK8C 2OS8C 1UHIA 4OV2A 2JULA 2K7CA 1NCZA 1FBVA 3BUMB 1QASA 4M2PA 1AJ5A 1IH0A 4L9MA 2LUXA 1X02A 3PALA 1L7ZA 1DGVA 1IGVA 3TDZA 2LAPA 1E8AA 1TNPA 5CPVA 4I5LB 3SIAA 5BPJA 3WHTB 2M9GA 5KTYA 5I8NA 1EG4A 2JXLA 1EXRA 3D0YA 1XFVO 1YUUA 3IQQA 1H4BA 4DRWA 2V53A 2KFGA 3E3RA 4GUKA 4I5KA 2HPSA 1DGUA 1IJ5A 1ZMZA 4GAOA 2PRUA 1IKUA 1NYAA 1XA5A 1XFZO 3EK8A 1CLLA 3SG5A 2M7NA 3D10A 3CTNA 1EH2A 3WXAA 1UUSA 1ZFSA 3JTDC 4MEWA 4MRYA 2L98A 2JWWA 1FF1A 1K93D 1KFXS 3CGAA 1SK6D 1TNXA 2G9BA 1SRAA 2E6WA 3PFVA 2ZNEA 1ALWA 3SIBA 2KYCA 5I2QA 1BF5A 3SJSA 1K90D 3OX6A 2LCPA 1UHHA 4UPGA 1UP5A 1KFUL 1PSBA 1G33A 2QACA 4N1FA 2K7OA 3CLNA 5HKYA 3NSIA 1U5IA 1C07A 3I5FB 1JSAA 4USLA 4NDDA 3QRXA 3TDIA 3TS5B 3VROA 2LVJA 2H61A 2OTGC 1J55A 4NQGA 1BG1A 2KHNA 4C0JA 3FS7A 1CLBA 3VRPA 2ZRSA 2BKHB 1QS7A 1OOJA 1AJ4A 3FWBA 3LLEA 1UHNA 2BBMA 2L50A 3ICBA 3PLFB 1B1GA 1LA0A 1K94A 1TRFA 3TDUA 1S6IA 2KBIA 1FPWA 2Y5IA 5HLOA 2O60A 2R2IA 3H4SE 5HYDA 1NX0A 2LLTA 1NX3A 3DVEA 1MWNA 2KI4B 1A75B 1J7OA 4ORCB 2I94A 5KU1A 1S1EA 2NXQA 2BL0B 4ZCVA 3K21A 2MLFC 1UHKA 4HSZA 3I5IB 1FI6A 2I2RE 2EHBA 1YVLA 1AVSA 1F4OA 2K0JA 1XO5A 3O2PA 1WDCB 1K9PA 3VRRA 4CFRA 5CSJA 2HQWA 4AOMA 5HKZA 3LK1A 2I18A 1NCXA 1SCMB 1DJGA 4XJKA 1N0YA 2F3YA 1PULA 1R6PA 5F6TA 3VRNA 1YVHA 2WNDA 1B4CA 1J7QA 3LCPC 1BOCA 1G8IA 2JT8A 1K8UA 1LXFC 4BY5A 1CMFA 1QX5B 4DIRA 2KQ6A 1YURA 3RLZA 1HT9A 2EGDA 4ETOA 4Q04A 1F71A 1ALVA 2JPTA 3D0YB 3HX4A 4MVFA 1MXLC 2MLEC 3EVUA 4CPVA 2KSPA 1LINA 1NCYA 1RJVA 2CXJA 3AKBA 4R1EA 4YI8A 5DKRA 2K2AA 2KI6D 3I5FC 4MZKA 1TCFA 3RM1A 3TS5C 4GPLB 2M1UA 3WNXB 1SR6C 2L2EA 1JFJA 3I5GB 5G08A 1RWYA 1JC2A 5ER4X 1OZOA 2JTTA 1CNPA 1Y1XA 1Y1AA 1KQMB 1SKTA 3EKHA 5I2OA 1EG3A 1SPYA 2K7BA 2KYFA 4WQ3A 2BCAA 1V1FA 1ODBA 3PATA 5DKNA 1QX7A 1H8BA 1W7IB 4YI9A 1XK4C 2GV5A 1MQ1A 3M0WA 3OX5A 1CDNA 1SMGA 4C0KA 2LHIA 3OB1B 4NDBA 2LVKA 2BCBA 2KI4C 2FJUB 1CKKA 1G4YR 2JZIA 1Q80A 3C1VA 4PDZA 1U5IB 3O6BA 2HETA 4GGNA 1SYMA 4QJ5B 1F70A 2BL0C 3SG2A 2LP3A 1M31A 3I5IC 2L5XB 3AKAA 5K89A 1QJTA 2KQYA 3OHMB 4NDCA 1GGZA 2AAOA 1WDCC 2LLSA 1XYDA 1UHJA 4PALA 1L2OB 3A4UB 1NX1A 1SCMC 4PE0A 1GJYA 2M97A 4A4BA 1W7JB 4MRXA 2KAYA 1S26D 1OZSA 2CT9A 1KCYA 2ZNDA 1WLMA 1WRKA 3DVJA 4QJ4B 2JQ6A 2CNPA 1B47A 2LHLA 2D8NA 3FWCA 1C7VA 3CWGA 1K96A 3MSEB 1CTRA 1SNLA 2F8PA 1OMRA 1YTZC 2KGBC 3CR5X 3DF0A 1QV1A 4YGAA 1D1OA 4PCWA 1CFPA 3BYAA 2LVIA 3SG7A 1NIWA
chains in the Genus database with same CATH superfamily
4F7FA 2PSRA 1A29A 2SCPA 4PE1A 1RECA 2GGMA 3DY9A 3PJIA 2L0PA 4CFQA 1CFFA 1TOPA 1OW4A 1XFWO 4GFTA 3CYZA 2MAZA 1QLKA 1RFJA 2DOQA 3BUNB 2A4JA 2M7LA 3JVTB 5AXIA 2LLUA 2KFHA 2ZFDA 4XJKB 4YGDB 4MZLA 3I5GC 5GQQC 5JJGA 1KSOA 5CSIA 1NP8A 3NGVA 3B6XA 1S3PA 3CZ0A 2F3ZA 2M8UA 4P5OE 5IBWA 1B7TZ 2NCPA 1KQMC 4F0ZB 4XYNA 1J7PA 2BKIB 1Y0VH 1YUTA 3KHEA 5DKQA 5KSZA 1ORGA 1SW8A 3EVVA 3PN7B 3WHUB 4FTGA 3BOWA 2KAXA 1CLMA 3DVKA 1ZOTB 4FQOA 1B7TY 4YBHB 4YGEB 2KBMA 2HF5A 3GK1A 4JQ0D 2ISDA 1GQMA 5FYXA 2ZN8A 2PQLA 3PSRA 3CZ2A 2LANA 1RK9A 2LMTA 3ZNIA 5D3OA 1B8RA 1IQ3A 4JPZB 3AAJA 1WY9A 2KNEA 2H61C 1FI5A 1MXEA 1CDPA 2WOSA 3SG4A 2MA2A 2K2FA 1DT7B 1M45A 1L2OC 1RROA 1F55A 4INXA 5DICA 4OR9B 3S0DA 2FJYA 1QWVA 3LL8B 1OQPA 1JF2A 1VRKA 1TIZA 2JNXA 5HLVA 1TUZA 1Y1UA 1CM4A 1ZACA 3FE8A 1SCVA 2K7DA 4WQ2A 2MJWB 1M39A 1TCOB 5TNCA 1PVBA 1Y6WA 3OB2B 1EL4A 4C0LA 2JC2A 2WC8A 2F2OA 1XVJA 1PVAA 1OSAA 2GGZA 2CTNA 3L4LA 1MHOA 2NLNA 5EL2A 1S6CA 3OP0A 1AHRA 2M3WA 2KPHA 1QTXA 4PHMA 3SS5A 2NCOA 1NWDA 1OE9B 1LVCD 1KFUS 1F54A 1BU3A 2LUCA 1W9ZA 1YRUB 1IRJA 2F33A 3TUYB 2M1KB 3JVTC 1C7WA 3A8RA 3BFAA 2KAVA 1A4PA 5B8IB 1CFCA 3CR4X 2H2KA 2RGIA 2O5GA 3BUOB 3L47A 3SG3A 3NSLA 1YR5A 4OVNF 1CDMA 3R1PA 1XFRA 3BUWB 2BBNA 1OMDA 1QVIZ 1N2DA 1A03A 1AUIB 2KOTA 4OZDA 4OCIA 1RTP1 3DF0B 2LMUA 1CMGA 2PALA 1BR4B 2BCXA 1J1DA 3PN7C 3GK2A 1SSEB 1KQVA 2QEBA 1J1EA 4IJ7A 2WCBA 2KI6C 2YGUA 2LV7A 3NSKA 2LE9B 4IL1A 1DJWA 1BT6A 1M46A 3IQOA 1MUXA 1YRTB 1BMOA 2BE6A 2LMVA 3B7AA 3R72A 2MHHA 1S36A 1QIWA 2PVBA 1CDLA 5ER5A 1YUSA 2LNKA 2HQ8A 5FI7A 1CFDA 2LC5A 3F45A 2Q91A 1B8LA 4P2YB 2K8MB 3I5HB 1BR1B 1KSMA 1OMVA 2JNFA 1IG5A 5J3XA 2JU0A 2K61A 2L4HA 2KDHA 1SL8A 1DF0B 1C3YA 3BXKA 1A2XA 4ZCUA 1JF0A 4DUQA 2P6BB 1TNQA 1WRZA 4JKTA 3B87A 1KWOB 1DMOA 3BOWB 2ZRTA 1SBJA 3EKJA 1K9UA 3BUXB 4OKHA 1WRLA 2B1UA 1NPQA 4TNCA 4JWQA 4QJ3B 3RZSA 1DJXA 4GGFA 3KO0A 1QV0A 3PM8A 3FIAA 1GGWA 4I5NB 3VGOA 4D1EA 4AQIA 2M0RA 1K95A 3BJHA 1CB1A 4YGBB 2P71A 1NX2A 2JT0A 4A4CA 4GBAA 4PHJA 1YX7A 2KFFA 5JOLA 1WLZA 2ZN9A 1PK0D 3S0GA 1LA3A 3TUYC 1DQEA 3CS1A 4YRUA 2EC6B 2JPOA 1M63B 1UURA 2I7AA 3O4XA 2QEOA 3NHIA 1QLSA 1B8CA 2JTZA 2BAPA 2F2PA 5D69A 1DJHA 1DTLA 2WC5A 4MSPA 3HCMA 2ZKMX 3EG5B 4PHNA 1NSHA 2AUCA 3DD4A 4DS7A 2P70A 1DF0A 3NSOA 4M2QA 1JWDA 3D76A 3EVRA 4GGFC 2JRFA 1J7RA 2TN4A 3BQ3A 1ZUZA 3LK0A 3SS3A 4GNKB 2MRDA 3EK7A 3IF7A 2SASA 3KEVA 4HREE 1S5GZ 1BJFA 2QPTA 2WCKA 1EJ3A 2JT3A 1XFYO 2GTEA 3GK4X 1QATA 3O4YA 1JBAA 1SR6B 5I2LA 1YX8A 5PALA 2NZ0A 2COLB 1XFXO 3O78A 4BY4A 1KK8B 1S5GY 2OS8B 4N5XA 4ORBB 3S0FA 1SL9A 3I5HC 2MBXA 1R2UA 1PRWA 5AEQA 4HRHA 5CSNA 4CIDA 1UWOA 2L2CA 4DCKA 4MLWA 1BLQA 1JFKA 3CABA 4WRIA 2Y1MA 1QX2A 3IVTA 1TNWA 5AERA 3AAKA 1XFUO 1K9KA 1KWOC 1TTXA 1SY9A 2AMIA 3PM2A 4ICBA 1IQ5A 2WORA 3D77A 3NXAA 2LVVA 1T14A 2WC6A 2BECA 4PHKA 1KK7Z 3UNWA 1P28A 3EK4A 2QDIA 2IS9A 2VRGA 3GOFA 2L4IA 2PYQA 4I5JA 3TZ1A 4U8DA 1MF8B 2FCDA 2WCFA 1FW4A 1F8HA 1KK7Y 1TN4A 2WCLA 3CR2A 1IWQA 3DZTA 2EC6C 2Y4QA 4ORAB 1PSRA 4PE4A 1QIVA 1PALA 2FOTA 4N1GA 1IJ6A 2E30A 5FI2A 3UO9A 1B9AA 5AANA 2OPOA 1IIOA 1S6JA 4PE7A 2JXCA 2M49B 2Y1NA 3DVMA 3OGNA 3JTDB 4YGCB 4E68A 1AK8A 1N65A 2CCMA 2LP2A 1DJZA 1JUOA 3KPXA 2WCEA 4M2OA 1KFXL 3ZWHA 4MBEA 1SL7A 2M29A 5AFPA 3DXLA 3BFBA 2JOJA 1LKJA 1OOGA 1DJIA 1XK4A 2FCEA 2BE4A 2L51A 1AP4A 4HRGA 3VRQA 3D73A 2KGRA 1BODA 2CBLA 3KF9A 1DVIA 1F4QA 1HQVA 1NUBA 1QVIY 5CSFA 4AQJA 1GM0A 3CZTX 1A75A 4MZJA 1K2HA 2LM5A 2PMYA 5HKWA 5D7FA 4MN0A 2PASA 1V1GA 2G2BA 2Q4UA 1QXPA 4CLNA 1DJYA 1MR8A 2OTGB 3SG6A 1CM1A 1KK8C 2L5YA 2QEHA 2OS8C 1UHIA 4OV2A 3S0AA 1TWOA 2JULA 2K7CA 1NCZA 1FBVA 3BUMB 1QASA 3Q8IA 4M2PA 1AJ5A 3CZ1A 3B88A 1IH0A 4L9MA 2LUXA 1X02A 1Z2CB 3PALA 1L7ZA 1DGVA 1IGVA 3TDZA 2LAPA 3K1EA 1E8AA 1TNPA 5CPVA 2ERBA 4I5LB 3SIAA 5BPJA 3WHTB 2M9GA 5KTYA 5I8NA 1EG4A 2JXLA 1EXRA 3D0YA 1LS8A 1XFVO 1YUUA 3N7HA 3IQQA 1H4BA 4DRWA 2V53A 2KFGA 3E3RA 4GUKA 4I5KA 2HPSA 1DGUA 1IJ5A 2WCJA 1ZMZA 4GAOA 2PRUA 1IKUA 2KLEA 1NYAA 1XA5A 1XFZO 3EK8A 1CLLA 3SG5A 2M7NA 3D10A 3CTNA 1EH2A 3WXAA 1UUSA 1ZFSA 3JTDC 4MEWA 4MRYA 2L98A 2JWWA 1FF1A 1K93D 1KFXS 3CGAA 1SK6D 3D75A 1TNXA 2G9BA 1SRAA 2E6WA 3PFVA 2ZNEA 1ALWA 3SIBA 2BNXA 2KYCA 5I2QA 1BF5A 3SJSA 1K90D 3OX6A 2LCPA 1UHHA 4UPGA 1UP5A 2K60A 1KFUL 1PSBA 1G33A 2QACA 4N1FA 2K7OA 3CLNA 5HKYA 3S0EA 3NSIA 2WCMA 1U5IA 1C07A 3I5FB 1JSAA 4USLA 4NDDA 3QRXA 3TDIA 3TS5B 1C3ZA 3VROA 2LVJA 3R1OA 2H61A 2OTGC 1J55A 4JD9A 4NQGA 1BG1A 2KHNA 4C0JA 3FS7A 1CLBA 3VRPA 2ZRSA 5HL1A 2BKHB 1QS7A 1OOJA 1AJ4A 3FWBA 3LLEA 1UHNA 2BBMA 1TUJA 2L50A 3FE6A 3ICBA 4INWA 3PLFB 1B1GA 1LA0A 1K94A 1TRFA 3TDUA 1S6IA 2KBIA 1FPWA 4PT1A 2Y5IA 5HLOA 2O60A 2R2IA 3H4SE 1DEKA 1NX0A 5HYDA 2LLTA 1NX3A 3DVEA 1MWNA 2KI4B 1A75B 1J7OA 4ORCB 4KYNA 2I94A 1OOHA 5KU1A 1S1EA 2NXQA 3B86A 1OOIX 2BL0B 3K21A 2MLFC 1UHKA 4HSZA 3I5IB 5FI6A 4ZCVA 1FI6A 2I2RE 2EHBA 1YVLA 1AVSA 1F4OA 2K0JA 3VB1A 1XO5A 3O2PA 3DYEA 1WDCB 1K9PA 3VRRA 4CFRA 5CSJA 2HQWA 4AOMA 5HKZA 1DELA 2I18A 3LK1A 3QMEA 1NCXA 1SCMB 2QEVA 1DJGA 3V2LA 4XJKA 1N0YA 2F3YA 1PULA 1R6PA 3L4AA 5F6TA 3VRNA 1YVHA 2WNDA 1B4CA 1J7QA 3LCPC 1BOCA 1G8IA 2JT8A 1K8UA 1LXFC 4BY5A 1CMFA 1QX5B 4DIRA 2KQ6A 1YURA 3RLZA 1HT9A 2KLDA 2EGDA 4ETOA 4Q04A 1F71A 1ALVA 2JPTA 3D0YB 3HX4A 4MVFA 1DC1A 1MXLC 3SS4A 2MLEC 3EVUA 4CPVA 2KSPA 1LINA 1NCYA 1RJVA 2CXJA 3AKBA 4R1EA 4YI8A 5DKRA 2K2AA 2KI6D 3I5FC 2WCHA 4MZKA 1TCFA 3RM1A 3D74A 3TS5C 4GPLB 2M1UA 3WNXB 1SR6C 2L2EA 1JFJA 3I5GB 5G08A 1RWYA 1JC2A 5ER4X 1OZOA 2JTTA 1CNPA 1Y1XA 1Y1AA 3NHTA 2H8VA 1KQMB 1SKTA 3EKHA 5I2OA 1EG3A 1SPYA 2K7BA 2KYFA 4WQ3A 2BCAA 1V1FA 1ODBA 3BFHA 3PATA 5DKNA 1QX7A 4FQTA 1H8BA 1W7IB 4YI9A 1XK4C 2GV5A 1MQ1A 3M0WA 3OX5A 3S0BA 1SMGA 3FE9A 1CDNA 4C0KA 2LHIA 3OB1B 4NDBA 2LVKA 2BCBA 2KI4C 2FJUB 1CKKA 1G4YR 2JZIA 1Q80A 3C1VA 1OOFA 4PDZA 1U5IB 3O6BA 2HETA 4GGNA 1SYMA 4QJ5B 1F70A 1Z4HA 2BL0C 3SG2A 2LP3A 1M31A 5I94A 3I5IC 3OBVA 2L5XB 3AKAA 5K89A 1QJTA 2KQYA 3OHMB 4NDCA 3R1VA 1GGZA 2AAOA 1WDCC 2LLSA 1XYDA 1UHJA 4PALA 1L2OB 3A4UB 1NX1A 1SCMC 4PE0A 1GJYA 2M97A 4A4BA 1W7JB 4MRXA 2KAYA 1S26D 1OZSA 2CT9A 1KCYA 2ZNDA 1WLMA 1WRKA 3DVJA 4QJ4B 2JQ6A 2CNPA 1B47A 2LHLA 3D78A 2D8NA 3FWCA 1C7VA 3CWGA 1K96A 3MSEB 1CTRA 1SNLA 2F8PA 1OMRA 1YTZC 2KGBC 3CR5X 3DF0A 3CDNA 1QV1A 4YGAA 1D1OA 4PCWA 1CFPA 3BYAA 2LVIA 3SG7A 1NIWA
chains in the Genus database with same CATH topology
2PSRA 1A29A 2SCPA 4PE1A 1RECA 2GGMA 2L0PA 4CFQA 1CFFA 1TOPA 1XFWO 4GFTA 2MAZA 1QLKA 1RFJA 2DOQA 3BUNB 2A4JA 2M7LA 3JVTB 5AXIA 2LLUA 2KFHA 2ZFDA 4XJKB 4YGDB 4MZLA 3I5GC 5GQQC 5JJGA 1KSOA 5CSIA 1NP8A 1S3PA 2F3ZA 2M8UA 4P5OE 5IBWA 1B7TZ 2NCPA 1KQMC 4F0ZB 4XYNA 1J7PA 2BKIB 1Y0VH 1YUTA 3KHEA 5DKQA 5KSZA 1SW8A 3EVVA 3PN7B 3WHUB 4FTGA 3BOWA 2KAXA 1CLMA 3DVKA 1ZOTB 4FQOA 1B7TY 4YBHB 4YGEB 2KBMA 2HF5A 3GK1A 4JQ0D 2ISDA 1GQMA 5FYXA 2ZN8A 3PSRA 2LANA 1RK9A 2LMTA 3ZNIA 1IQ3A 1B8RA 4JPZB 3AAJA 1WY9A 2KNEA 2H61C 1FI5A 1MXEA 1CDPA 2WOSA 3SG4A 2MA2A 2K2FA 1DT7B 1M45A 1L2OC 1RROA 1F55A 4OR9B 3LL8B 1OQPA 1JF2A 1VRKA 1TIZA 2JNXA 5HLVA 1Y1UA 1CM4A 1ZACA 4WQ2A 1SCVA 2K7DA 2MJWB 1M39A 1TCOB 5TNCA 1PVBA 1Y6WA 3OB2B 1EL4A 4C0LA 2JC2A 2WC8A 2F2OA 1XVJA 1PVAA 1OSAA 2GGZA 2CTNA 1MHOA 2NLNA 1S6CA 3OP0A 1AHRA 2M3WA 1QTXA 4PHMA 2NCOA 1NWDA 1OE9B 1LVCD 1KFUS 1F54A 1BU3A 2LUCA 1YRUB 1IRJA 2F33A 3TUYB 2M1KB 3JVTC 1C7WA 3A8RA 1CFCA 2KAVA 1A4PA 5B8IB 3CR4X 2H2KA 2RGIA 2O5GA 3BUOB 3SG3A 3NSLA 1YR5A 4OVNF 1CDMA 3BUWB 2BBNA 1OMDA 1QVIZ 1N2DA 1A03A 1AUIB 2KOTA 4OCIA 1RTP1 3DF0B 2LMUA 1CMGA 2PALA 1BR4B 2BCXA 1J1DA 3PN7C 3GK2A 1KQVA 1J1EA 2WCBA 2KI6C 2LV7A 3NSKA 2LE9B 4IL1A 1DJWA 1BT6A 1M46A 3IQOA 1MUXA 1YRTB 1BMOA 2BE6A 2LMVA 2MHHA 1S36A 1QIWA 2PVBA 1CDLA 5ER5A 1YUSA 2LNKA 2HQ8A 1CFDA 2LC5A 3F45A 2Q91A 1B8LA 4P2YB 2K8MB 3I5HB 1BR1B 1KSMA 1OMVA 2JNFA 1IG5A 5J3XA 2JU0A 2K61A 2L4HA 2KDHA 1SL8A 1DF0B 3BXKA 1A2XA 4ZCUA 1JF0A 4DUQA 2P6BB 1TNQA 1WRZA 1KWOB 1DMOA 3BOWB 2ZRTA 1SBJA 3EKJA 1K9UA 3BUXB 4OKHA 1WRLA 2B1UA 1NPQA 4TNCA 4JWQA 4QJ3B 1DJXA 4GGFA 3KO0A 1QV0A 3PM8A 3FIAA 1GGWA 4I5NB 3VGOA 4D1EA 4AQIA 2M0RA 1K95A 1CB1A 4YGBB 1NX2A 2JT0A 4A4CA 4GBAA 4PHJA 1YX7A 2KFFA 5JOLA 1WLZA 2ZN9A 1PK0D 1LA3A 3TUYC 3CS1A 4YRUA 2EC6B 1M63B 1UURA 2I7AA 1QLSA 1B8CA 2JTZA 2F2PA 5D69A 1DJHA 1DTLA 4MSPA 3HCMA 2ZKMX 4PHNA 1NSHA 2AUCA 3DD4A 4DS7A 3NSOA 1DF0A 4M2QA 1JWDA 3EVRA 4GGFC 2JRFA 1J7RA 2TN4A 3BQ3A 1ZUZA 3LK0A 4GNKB 2MRDA 3EK7A 3IF7A 2SASA 3KEVA 4HREE 1S5GZ 1BJFA 2QPTA 1EJ3A 2JT3A 1XFYO 3GK4X 1QATA 3O4YA 1JBAA 1SR6B 5I2LA 1YX8A 5PALA 2NZ0A 2COLB 1XFXO 3O78A 4BY4A 1KK8B 1S5GY 2OS8B 4N5XA 4ORBB 1SL9A 3I5HC 2MBXA 1R2UA 1PRWA 5AEQA 4HRHA 5CSNA 4CIDA 1UWOA 4DCKA 4MLWA 1BLQA 1JFKA 4WRIA 2Y1MA 1QX2A 1TNWA 5AERA 3AAKA 1XFUO 1K9KA 1KWOC 1TTXA 1SY9A 2AMIA 4ICBA 1IQ5A 2WORA 3NXAA 2LVVA 2BECA 4PHKA 1KK7Z 3EK4A 2IS9A 2VRGA 3GOFA 2L4IA 4I5JA 3TZ1A 4U8DA 1MF8B 2FCDA 2WCFA 1FW4A 1F8HA 1KK7Y 1TN4A 3CR2A 1IWQA 2EC6C 2Y4QA 4ORAB 1PSRA 4PE4A 1QIVA 1PALA 2FOTA 4N1GA 1IJ6A 2E30A 1B9AA 5AANA 2OPOA 1S6JA 4PE7A 2JXCA 2M49B 2Y1NA 3DVMA 4YGCB 3JTDB 4E68A 1AK8A 1N65A 2CCMA 2LP2A 1DJZA 1JUOA 3KPXA 2WCEA 4M2OA 1KFXL 3ZWHA 4MBEA 1SL7A 2M29A 5AFPA 2JOJA 1LKJA 1DJIA 1XK4A 2FCEA 2BE4A 2L51A 1AP4A 4HRGA 3VRQA 2KGRA 1BODA 2CBLA 3KF9A 1DVIA 1F4QA 1HQVA 1NUBA 1QVIY 5CSFA 4AQJA 1K2HA 3CZTX 1A75A 4MZJA 2LM5A 2PMYA 5HKWA 5D7FA 4MN0A 2PASA 1V1GA 2G2BA 2Q4UA 1QXPA 4CLNA 1DJYA 1MR8A 2OTGB 3SG6A 1CM1A 1KK8C 2OS8C 1UHIA 4OV2A 2JULA 2K7CA 1NCZA 1FBVA 3BUMB 1QASA 4M2PA 1AJ5A 1IH0A 4L9MA 2LUXA 1X02A 3PALA 1L7ZA 1DGVA 1IGVA 3TDZA 2LAPA 1E8AA 1TNPA 5CPVA 4I5LB 3SIAA 5BPJA 3WHTB 2M9GA 5KTYA 5I8NA 1EG4A 2JXLA 1EXRA 3D0YA 1XFVO 1YUUA 3IQQA 1H4BA 4DRWA 2V53A 2KFGA 3E3RA 4GUKA 4I5KA 2HPSA 1DGUA 1IJ5A 1ZMZA 4GAOA 2PRUA 1IKUA 1NYAA 1XA5A 1XFZO 3EK8A 1CLLA 3SG5A 2M7NA 3D10A 3CTNA 1EH2A 3WXAA 1UUSA 1ZFSA 3JTDC 4MEWA 4MRYA 2L98A 2JWWA 1FF1A 1K93D 1KFXS 3CGAA 1SK6D 1TNXA 2G9BA 1SRAA 2E6WA 3PFVA 2ZNEA 1ALWA 3SIBA 2KYCA 5I2QA 1BF5A 3SJSA 1K90D 3OX6A 2LCPA 1UHHA 4UPGA 1UP5A 1KFUL 1PSBA 1G33A 2QACA 4N1FA 2K7OA 3CLNA 5HKYA 3NSIA 1U5IA 1C07A 3I5FB 1JSAA 4USLA 4NDDA 3QRXA 3TDIA 3TS5B 3VROA 2LVJA 2H61A 2OTGC 1J55A 4NQGA 1BG1A 2KHNA 4C0JA 3FS7A 1CLBA 3VRPA 2ZRSA 2BKHB 1QS7A 1OOJA 1AJ4A 3FWBA 3LLEA 1UHNA 2BBMA 2L50A 3ICBA 3PLFB 1B1GA 1LA0A 1K94A 1TRFA 3TDUA 1S6IA 2KBIA 1FPWA 2Y5IA 5HLOA 2O60A 2R2IA 3H4SE 5HYDA 1NX0A 2LLTA 1NX3A 3DVEA 1MWNA 2KI4B 1A75B 1J7OA 4ORCB 2I94A 5KU1A 1S1EA 2NXQA 2BL0B 4ZCVA 3K21A 2MLFC 1UHKA 4HSZA 3I5IB 1FI6A 2I2RE 2EHBA 1YVLA 1AVSA 1F4OA 2K0JA 1XO5A 3O2PA 1WDCB 1K9PA 3VRRA 4CFRA 5CSJA 2HQWA 4AOMA 5HKZA 3LK1A 2I18A 1NCXA 1SCMB 1DJGA 4XJKA 1N0YA 2F3YA 1PULA 1R6PA 5F6TA 3VRNA 1YVHA 2WNDA 1B4CA 1J7QA 3LCPC 1BOCA 1G8IA 2JT8A 1K8UA 1LXFC 4BY5A 1CMFA 1QX5B 4DIRA 2KQ6A 1YURA 3RLZA 1HT9A 2EGDA 4ETOA 4Q04A 1F71A 1ALVA 2JPTA 3D0YB 3HX4A 4MVFA 1MXLC 2MLEC 3EVUA 4CPVA 2KSPA 1LINA 1NCYA 1RJVA 2CXJA 3AKBA 4R1EA 4YI8A 5DKRA 2K2AA 2KI6D 3I5FC 4MZKA 1TCFA 3RM1A 3TS5C 4GPLB 2M1UA 3WNXB 1SR6C 2L2EA 1JFJA 3I5GB 5G08A 1RWYA 1JC2A 5ER4X 1OZOA 2JTTA 1CNPA 1Y1XA 1Y1AA 1KQMB 1SKTA 3EKHA 5I2OA 1EG3A 1SPYA 2K7BA 2KYFA 4WQ3A 2BCAA 1V1FA 1ODBA 3PATA 5DKNA 1QX7A 1H8BA 1W7IB 4YI9A 1XK4C 2GV5A 1MQ1A 3M0WA 3OX5A 1CDNA 1SMGA 4C0KA 2LHIA 3OB1B 4NDBA 2LVKA 2BCBA 2KI4C 2FJUB 1CKKA 1G4YR 2JZIA 1Q80A 3C1VA 4PDZA 1U5IB 3O6BA 2HETA 4GGNA 1SYMA 4QJ5B 1F70A 2BL0C 3SG2A 2LP3A 1M31A 3I5IC 2L5XB 3AKAA 5K89A 1QJTA 2KQYA 3OHMB 4NDCA 1GGZA 2AAOA 1WDCC 2LLSA 1XYDA 1UHJA 4PALA 1L2OB 3A4UB 1NX1A 1SCMC 4PE0A 1GJYA 2M97A 4A4BA 1W7JB 4MRXA 2KAYA 1S26D 1OZSA 2CT9A 1KCYA 2ZNDA 1WLMA 1WRKA 3DVJA 4QJ4B 2JQ6A 2CNPA 1B47A 2LHLA 2D8NA 3FWCA 1C7VA 3CWGA 1K96A 3MSEB 1CTRA 1SNLA 2F8PA 1OMRA 1YTZC 2KGBC 3CR5X 3DF0A 1QV1A 4YGAA 1D1OA 4PCWA 1CFPA 3BYAA 2LVIA 3SG7A 1NIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PSR A;  1A29 A;  2SCP A;  4PE1 A;  1REC A;  2GGM A;  2L0P A;  4CFQ A;  1CFF A;  1TOP A;  1XFW O;  4GFT A;  2MAZ A;  1QLK A;  1RFJ A;  2DOQ A;  3BUN B;  2A4J A;  2M7L A;  3JVT B;  5AXI A;  2LLU A;  2KFH A;  2ZFD A;  4XJK B;  4YGD B;  4MZL A;  3I5G C;  5GQQ C;  5JJG A;  1KSO A;  5CSI A;  1NP8 A;  1S3P A;  2F3Z A;  2M8U A;  4P5O E;  5IBW A;  1B7T Z;  2NCP A;  1KQM C;  4F0Z B;  4XYN A;  1J7P A;  2BKI B;  1Y0V H;  1YUT A;  3KHE A;  5DKQ A;  5KSZ A;  1SW8 A;  3EVV A;  3PN7 B;  3WHU B;  4FTG A;  3BOW A;  2KAX A;  1CLM A;  3DVK A;  1ZOT B;  4FQO A;  1B7T Y;  4YBH B;  4YGE B;  2KBM A;  2HF5 A;  3GK1 A;  4JQ0 D;  2ISD A;  1GQM A;  5FYX A;  2ZN8 A;  3PSR A;  2LAN A;  1RK9 A;  2LMT A;  3ZNI A;  1IQ3 A;  1B8R A;  4JPZ B;  3AAJ A;  1WY9 A;  2KNE A;  2H61 C;  1FI5 A;  1MXE A;  1CDP A;  2WOS A;  3SG4 A;  2MA2 A;  2K2F A;  1DT7 B;  1M45 A;  1L2O C;  1RRO A;  1F55 A;  4OR9 B;  3LL8 B;  1OQP A;  1JF2 A;  1VRK A;  1TIZ A;  2JNX A;  5HLV A;  1Y1U A;  1CM4 A;  1ZAC A;  4WQ2 A;  1SCV A;  2K7D A;  2MJW B;  1M39 A;  1TCO B;  5TNC A;  1PVB A;  1Y6W A;  3OB2 B;  1EL4 A;  4C0L A;  2JC2 A;  2WC8 A;  2F2O A;  1XVJ A;  1PVA A;  1OSA A;  2GGZ A;  2CTN A;  1MHO A;  2NLN A;  1S6C A;  3OP0 A;  1AHR A;  2M3W A;  1QTX A;  4PHM A;  2NCO A;  1NWD A;  1OE9 B;  1LVC D;  1KFU S;  1F54 A;  1BU3 A;  2LUC A;  1YRU B;  1IRJ A;  2F33 A;  3TUY B;  2M1K B;  3JVT C;  1C7W A;  3A8R A;  1CFC A;  2KAV A;  1A4P A;  5B8I B;  3CR4 X;  2H2K A;  2RGI A;  2O5G A;  3BUO B;  3SG3 A;  3NSL A;  1YR5 A;  4OVN F;  1CDM A;  3BUW B;  2BBN A;  1OMD A;  1QVI Z;  1N2D A;  1A03 A;  1AUI B;  2KOT A;  4OCI A;  1RTP 1;  3DF0 B;  2LMU A;  1CMG A;  2PAL A;  1BR4 B;  2BCX A;  1J1D A;  3PN7 C;  3GK2 A;  1KQV A;  1J1E A;  2WCB A;  2KI6 C;  2LV7 A;  3NSK A;  2LE9 B;  4IL1 A;  1DJW A;  1BT6 A;  1M46 A;  3IQO A;  1MUX A;  1YRT B;  1BMO A;  2BE6 A;  2LMV A;  2MHH A;  1S36 A;  1QIW A;  2PVB A;  1CDL A;  5ER5 A;  1YUS A;  2LNK A;  2HQ8 A;  1CFD A;  2LC5 A;  3F45 A;  2Q91 A;  1B8L A;  4P2Y B;  2K8M B;  3I5H B;  1BR1 B;  1KSM A;  1OMV A;  2JNF A;  1IG5 A;  5J3X A;  2JU0 A;  2K61 A;  2L4H A;  2KDH A;  1SL8 A;  1DF0 B;  3BXK A;  1A2X A;  4ZCU A;  1JF0 A;  4DUQ A;  2P6B B;  1TNQ A;  1WRZ A;  1KWO B;  1DMO A;  3BOW B;  2ZRT A;  1SBJ A;  3EKJ A;  1K9U A;  3BUX B;  4OKH A;  1WRL A;  2B1U A;  1NPQ A;  4TNC A;  4JWQ A;  4QJ3 B;  1DJX A;  4GGF A;  3KO0 A;  1QV0 A;  3PM8 A;  3FIA A;  1GGW A;  4I5N B;  3VGO A;  4D1E A;  4AQI A;  2M0R A;  1K95 A;  1CB1 A;  4YGB B;  1NX2 A;  2JT0 A;  4A4C A;  4GBA A;  4PHJ A;  1YX7 A;  2KFF A;  5JOL A;  1WLZ A;  2ZN9 A;  1PK0 D;  1LA3 A;  3TUY C;  3CS1 A;  4YRU A;  2EC6 B;  1M63 B;  1UUR A;  2I7A A;  1QLS A;  1B8C A;  2JTZ A;  2F2P A;  5D69 A;  1DJH A;  1DTL A;  4MSP A;  3HCM A;  2ZKM X;  4PHN A;  1NSH A;  2AUC A;  3DD4 A;  4DS7 A;  3NSO A;  1DF0 A;  4M2Q A;  1JWD A;  3EVR A;  4GGF C;  2JRF A;  1J7R A;  2TN4 A;  3BQ3 A;  1ZUZ A;  3LK0 A;  4GNK B;  2MRD A;  3EK7 A;  3IF7 A;  2SAS A;  3KEV A;  4HRE E;  1S5G Z;  1BJF A;  2QPT A;  1EJ3 A;  2JT3 A;  1XFY O;  3GK4 X;  1QAT A;  3O4Y A;  1JBA A;  1SR6 B;  5I2L A;  1YX8 A;  5PAL A;  2NZ0 A;  2COL B;  1XFX O;  3O78 A;  4BY4 A;  1KK8 B;  1S5G Y;  2OS8 B;  4N5X A;  4ORB B;  1SL9 A;  3I5H C;  2MBX A;  1R2U A;  1PRW A;  5AEQ A;  4HRH A;  5CSN A;  4CID A;  1UWO A;  4DCK A;  4MLW A;  1BLQ A;  1JFK A;  4WRI A;  2Y1M A;  1QX2 A;  1TNW A;  5AER A;  3AAK A;  1XFU O;  1K9K A;  1KWO C;  1TTX A;  1SY9 A;  2AMI A;  4ICB A;  1IQ5 A;  2WOR A;  3NXA A;  2LVV A;  2BEC A;  4PHK A;  1KK7 Z;  3EK4 A;  2IS9 A;  2VRG A;  3GOF A;  2L4I A;  4I5J A;  3TZ1 A;  4U8D A;  1MF8 B;  2FCD A;  2WCF A;  1FW4 A;  1F8H A;  1KK7 Y;  1TN4 A;  3CR2 A;  1IWQ A;  2EC6 C;  2Y4Q A;  4ORA B;  1PSR A;  4PE4 A;  1QIV A;  1PAL A;  2FOT A;  4N1G A;  1IJ6 A;  2E30 A;  1B9A A;  5AAN A;  2OPO A;  1S6J A;  4PE7 A;  2JXC A;  2M49 B;  2Y1N A;  3DVM A;  4YGC B;  3JTD B;  4E68 A;  1AK8 A;  1N65 A;  2CCM A;  2LP2 A;  1DJZ A;  1JUO A;  3KPX A;  2WCE A;  4M2O A;  1KFX L;  3ZWH A;  4MBE A;  1SL7 A;  2M29 A;  5AFP A;  2JOJ A;  1LKJ A;  1DJI A;  1XK4 A;  2FCE A;  2BE4 A;  2L51 A;  1AP4 A;  4HRG A;  3VRQ A;  2KGR A;  1BOD A;  2CBL A;  3KF9 A;  1DVI A;  1F4Q A;  1HQV A;  1NUB A;  1QVI Y;  5CSF A;  4AQJ A;  1K2H A;  3CZT X;  1A75 A;  4MZJ A;  2LM5 A;  2PMY A;  5HKW A;  5D7F A;  4MN0 A;  2PAS A;  1V1G A;  2G2B A;  2Q4U A;  1QXP A;  4CLN A;  1DJY A;  1MR8 A;  2OTG B;  3SG6 A;  1CM1 A;  1KK8 C;  2OS8 C;  1UHI A;  4OV2 A;  2JUL A;  2K7C A;  1NCZ A;  1FBV A;  3BUM B;  1QAS A;  4M2P A;  1AJ5 A;  1IH0 A;  4L9M A;  2LUX A;  1X02 A;  3PAL A;  1L7Z A;  1DGV A;  1IGV A;  3TDZ A;  2LAP A;  1E8A A;  1TNP A;  5CPV A;  4I5L B;  3SIA A;  5BPJ A;  3WHT B;  2M9G A;  5KTY A;  5I8N A;  1EG4 A;  2JXL A;  1EXR A;  3D0Y A;  1XFV O;  1YUU A;  3IQQ A;  1H4B A;  4DRW A;  2V53 A;  2KFG A;  3E3R A;  4GUK A;  4I5K A;  2HPS A;  1DGU A;  1IJ5 A;  1ZMZ A;  4GAO A;  2PRU A;  1IKU A;  1NYA A;  1XA5 A;  1XFZ O;  3EK8 A;  1CLL A;  3SG5 A;  2M7N A;  3D10 A;  3CTN A;  1EH2 A;  3WXA A;  1UUS A;  1ZFS A;  3JTD C;  4MEW A;  4MRY A;  2L98 A;  2JWW A;  1FF1 A;  1K93 D;  1KFX S;  3CGA A;  1SK6 D;  1TNX A;  2G9B A;  1SRA A;  2E6W A;  3PFV A;  2ZNE A;  1ALW A;  3SIB A;  2KYC A;  5I2Q A;  1BF5 A;  3SJS A;  1K90 D;  3OX6 A;  2LCP A;  1UHH A;  4UPG A;  1UP5 A;  1KFU L;  1PSB A;  1G33 A;  2QAC A;  4N1F A;  2K7O A;  3CLN A;  5HKY A;  3NSI A;  1U5I A;  1C07 A;  3I5F B;  1JSA A;  4USL A;  4NDD A;  3QRX A;  3TDI A;  3TS5 B;  3VRO A;  2LVJ A;  2H61 A;  2OTG C;  1J55 A;  4NQG A;  1BG1 A;  2KHN A;  4C0J A;  3FS7 A;  1CLB A;  3VRP A;  2ZRS A;  2BKH B;  1QS7 A;  1OOJ A;  1AJ4 A;  3FWB A;  3LLE A;  1UHN A;  2BBM A;  2L50 A;  3ICB A;  3PLF B;  1B1G A;  1LA0 A;  1K94 A;  1TRF A;  3TDU A;  1S6I A;  2KBI A;  1FPW A;  2Y5I A;  5HLO A;  2O60 A;  2R2I A;  3H4S E;  5HYD A;  1NX0 A;  2LLT A;  1NX3 A;  3DVE A;  1MWN A;  2KI4 B;  1A75 B;  1J7O A;  4ORC B;  2I94 A;  5KU1 A;  1S1E A;  2NXQ A;  2BL0 B;  4ZCV A;  3K21 A;  2MLF C;  1UHK A;  4HSZ A;  3I5I B;  1FI6 A;  2I2R E;  2EHB A;  1YVL A;  1AVS A;  1F4O A;  2K0J A;  1XO5 A;  3O2P A;  1WDC B;  1K9P A;  3VRR A;  4CFR A;  5CSJ A;  2HQW A;  4AOM A;  5HKZ A;  3LK1 A;  2I18 A;  1NCX A;  1SCM B;  1DJG A;  4XJK A;  1N0Y A;  2F3Y A;  1PUL A;  1R6P A;  5F6T A;  3VRN A;  1YVH A;  2WND A;  1B4C A;  1J7Q A;  3LCP C;  1BOC A;  1G8I A;  2JT8 A;  1K8U A;  1LXF C;  4BY5 A;  1CMF A;  1QX5 B;  4DIR A;  2KQ6 A;  1YUR A;  3RLZ A;  1HT9 A;  2EGD A;  4ETO A;  4Q04 A;  1F71 A;  1ALV A;  2JPT A;  3D0Y B;  3HX4 A;  4MVF A;  1MXL C;  2MLE C;  3EVU A;  4CPV A;  2KSP A;  1LIN A;  1NCY A;  1RJV A;  2CXJ A;  3AKB A;  4R1E A;  4YI8 A;  5DKR A;  2K2A A;  2KI6 D;  3I5F C;  4MZK A;  1TCF A;  3RM1 A;  3TS5 C;  4GPL B;  2M1U A;  3WNX B;  1SR6 C;  2L2E A;  1JFJ A;  3I5G B;  5G08 A;  1RWY A;  1JC2 A;  5ER4 X;  1OZO A;  2JTT A;  1CNP A;  1Y1X A;  1Y1A A;  1KQM B;  1SKT A;  3EKH A;  5I2O A;  1EG3 A;  1SPY A;  2K7B A;  2KYF A;  4WQ3 A;  2BCA A;  1V1F A;  1ODB A;  3PAT A;  5DKN A;  1QX7 A;  1H8B A;  1W7I B;  4YI9 A;  1XK4 C;  2GV5 A;  1MQ1 A;  3M0W A;  3OX5 A;  1CDN A;  1SMG A;  4C0K A;  2LHI A;  3OB1 B;  4NDB A;  2LVK A;  2BCB A;  2KI4 C;  2FJU B;  1CKK A;  1G4Y R;  2JZI A;  1Q80 A;  3C1V A;  4PDZ A;  1U5I B;  3O6B A;  2HET A;  4GGN A;  1SYM A;  4QJ5 B;  1F70 A;  2BL0 C;  3SG2 A;  2LP3 A;  1M31 A;  3I5I C;  2L5X B;  3AKA A;  5K89 A;  1QJT A;  2KQY A;  3OHM B;  4NDC A;  1GGZ A;  2AAO A;  1WDC C;  2LLS A;  1XYD A;  1UHJ A;  4PAL A;  1L2O B;  3A4U B;  1NX1 A;  1SCM C;  4PE0 A;  1GJY A;  2M97 A;  4A4B A;  1W7J B;  4MRX A;  2KAY A;  1S26 D;  1OZS A;  2CT9 A;  1KCY A;  2ZND A;  1WLM A;  1WRK A;  3DVJ A;  4QJ4 B;  2JQ6 A;  2CNP A;  1B47 A;  2LHL A;  2D8N A;  3FWC A;  1C7V A;  3CWG A;  1K96 A;  3MSE B;  1CTR A;  1SNL A;  2F8P A;  1OMR A;  1YTZ C;  2KGB C;  3CR5 X;  3DF0 A;  1QV1 A;  4YGA A;  1D1O A;  4PCW A;  1CFP A;  3BYA A;  2LVI A;  3SG7 A;  1NIW A; 
#chains in the Genus database with same CATH topology
 4F7F A;  2PSR A;  1A29 A;  2SCP A;  4PE1 A;  1REC A;  2GGM A;  3DY9 A;  3PJI A;  2L0P A;  4CFQ A;  1CFF A;  1TOP A;  1OW4 A;  1XFW O;  4GFT A;  3CYZ A;  2MAZ A;  1QLK A;  1RFJ A;  2DOQ A;  3BUN B;  2A4J A;  2M7L A;  3JVT B;  5AXI A;  2LLU A;  2KFH A;  2ZFD A;  4XJK B;  4YGD B;  4MZL A;  3I5G C;  5GQQ C;  5JJG A;  1KSO A;  5CSI A;  1NP8 A;  3NGV A;  3B6X A;  1S3P A;  3CZ0 A;  2F3Z A;  2M8U A;  4P5O E;  5IBW A;  1B7T Z;  2NCP A;  1KQM C;  4F0Z B;  4XYN A;  1J7P A;  2BKI B;  1Y0V H;  1YUT A;  3KHE A;  5DKQ A;  5KSZ A;  1ORG A;  1SW8 A;  3EVV A;  3PN7 B;  3WHU B;  4FTG A;  3BOW A;  2KAX A;  1CLM A;  3DVK A;  1ZOT B;  4FQO A;  1B7T Y;  4YBH B;  4YGE B;  2KBM A;  2HF5 A;  3GK1 A;  4JQ0 D;  2ISD A;  1GQM A;  5FYX A;  2ZN8 A;  2PQL A;  3PSR A;  3CZ2 A;  2LAN A;  1RK9 A;  2LMT A;  3ZNI A;  5D3O A;  1B8R A;  1IQ3 A;  4JPZ B;  3AAJ A;  1WY9 A;  2KNE A;  2H61 C;  1FI5 A;  1MXE A;  1CDP A;  2WOS A;  3SG4 A;  2MA2 A;  2K2F A;  1DT7 B;  1M45 A;  1L2O C;  1RRO A;  1F55 A;  4INX A;  5DIC A;  4OR9 B;  3S0D A;  2FJY A;  1QWV A;  3LL8 B;  1OQP A;  1JF2 A;  1VRK A;  1TIZ A;  2JNX A;  5HLV A;  1TUZ A;  1Y1U A;  1CM4 A;  1ZAC A;  3FE8 A;  1SCV A;  2K7D A;  4WQ2 A;  2MJW B;  1M39 A;  1TCO B;  5TNC A;  1PVB A;  1Y6W A;  3OB2 B;  1EL4 A;  4C0L A;  2JC2 A;  2WC8 A;  2F2O A;  1XVJ A;  1PVA A;  1OSA A;  2GGZ A;  2CTN A;  3L4L A;  1MHO A;  2NLN A;  5EL2 A;  1S6C A;  3OP0 A;  1AHR A;  2M3W A;  2KPH A;  1QTX A;  4PHM A;  3SS5 A;  2NCO A;  1NWD A;  1OE9 B;  1LVC D;  1KFU S;  1F54 A;  1BU3 A;  2LUC A;  1W9Z A;  1YRU B;  1IRJ A;  2F33 A;  3TUY B;  2M1K B;  3JVT C;  1C7W A;  3A8R A;  3BFA A;  2KAV A;  1A4P A;  5B8I B;  1CFC A;  3CR4 X;  2H2K A;  2RGI A;  2O5G A;  3BUO B;  3L47 A;  3SG3 A;  3NSL A;  1YR5 A;  4OVN F;  1CDM A;  3R1P A;  1XFR A;  3BUW B;  2BBN A;  1OMD A;  1QVI Z;  1N2D A;  1A03 A;  1AUI B;  2KOT A;  4OZD A;  4OCI A;  1RTP 1;  3DF0 B;  2LMU A;  1CMG A;  2PAL A;  1BR4 B;  2BCX A;  1J1D A;  3PN7 C;  3GK2 A;  1SSE B;  1KQV A;  2QEB A;  1J1E A;  4IJ7 A;  2WCB A;  2KI6 C;  2YGU A;  2LV7 A;  3NSK A;  2LE9 B;  4IL1 A;  1DJW A;  1BT6 A;  1M46 A;  3IQO A;  1MUX A;  1YRT B;  1BMO A;  2BE6 A;  2LMV A;  3B7A A;  3R72 A;  2MHH A;  1S36 A;  1QIW A;  2PVB A;  1CDL A;  5ER5 A;  1YUS A;  2LNK A;  2HQ8 A;  5FI7 A;  1CFD A;  2LC5 A;  3F45 A;  2Q91 A;  1B8L A;  4P2Y B;  2K8M B;  3I5H B;  1BR1 B;  1KSM A;  1OMV A;  2JNF A;  1IG5 A;  5J3X A;  2JU0 A;  2K61 A;  2L4H A;  2KDH A;  1SL8 A;  1DF0 B;  1C3Y A;  3BXK A;  1A2X A;  4ZCU A;  1JF0 A;  4DUQ A;  2P6B B;  1TNQ A;  1WRZ A;  4JKT A;  3B87 A;  1KWO B;  1DMO A;  3BOW B;  2ZRT A;  1SBJ A;  3EKJ A;  1K9U A;  3BUX B;  4OKH A;  1WRL A;  2B1U A;  1NPQ A;  4TNC A;  4JWQ A;  4QJ3 B;  3RZS A;  1DJX A;  4GGF A;  3KO0 A;  1QV0 A;  3PM8 A;  3FIA A;  1GGW A;  4I5N B;  3VGO A;  4D1E A;  4AQI A;  2M0R A;  1K95 A;  3BJH A;  1CB1 A;  4YGB B;  2P71 A;  1NX2 A;  2JT0 A;  4A4C A;  4GBA A;  4PHJ A;  1YX7 A;  2KFF A;  5JOL A;  1WLZ A;  2ZN9 A;  1PK0 D;  3S0G A;  1LA3 A;  3TUY C;  1DQE A;  3CS1 A;  4YRU A;  2EC6 B;  2JPO A;  1M63 B;  1UUR A;  2I7A A;  3O4X A;  2QEO A;  3NHI A;  1QLS A;  1B8C A;  2JTZ A;  2BAP A;  2F2P A;  5D69 A;  1DJH A;  1DTL A;  2WC5 A;  4MSP A;  3HCM A;  2ZKM X;  3EG5 B;  4PHN A;  1NSH A;  2AUC A;  3DD4 A;  4DS7 A;  2P70 A;  1DF0 A;  3NSO A;  4M2Q A;  1JWD A;  3D76 A;  3EVR A;  4GGF C;  2JRF A;  1J7R A;  2TN4 A;  3BQ3 A;  1ZUZ A;  3LK0 A;  3SS3 A;  4GNK B;  2MRD A;  3EK7 A;  3IF7 A;  2SAS A;  3KEV A;  4HRE E;  1S5G Z;  1BJF A;  2QPT A;  2WCK A;  1EJ3 A;  2JT3 A;  1XFY O;  2GTE A;  3GK4 X;  1QAT A;  3O4Y A;  1JBA A;  1SR6 B;  5I2L A;  1YX8 A;  5PAL A;  2NZ0 A;  2COL B;  1XFX O;  3O78 A;  4BY4 A;  1KK8 B;  1S5G Y;  2OS8 B;  4N5X A;  4ORB B;  3S0F A;  1SL9 A;  3I5H C;  2MBX A;  1R2U A;  1PRW A;  5AEQ A;  4HRH A;  5CSN A;  4CID A;  1UWO A;  2L2C A;  4DCK A;  4MLW A;  1BLQ A;  1JFK A;  3CAB A;  4WRI A;  2Y1M A;  1QX2 A;  3IVT A;  1TNW A;  5AER A;  3AAK A;  1XFU O;  1K9K A;  1KWO C;  1TTX A;  1SY9 A;  2AMI A;  3PM2 A;  4ICB A;  1IQ5 A;  2WOR A;  3D77 A;  3NXA A;  2LVV A;  1T14 A;  2WC6 A;  2BEC A;  4PHK A;  1KK7 Z;  3UNW A;  1P28 A;  3EK4 A;  2QDI A;  2IS9 A;  2VRG A;  3GOF A;  2L4I A;  2PYQ A;  4I5J A;  3TZ1 A;  4U8D A;  1MF8 B;  2FCD A;  2WCF A;  1FW4 A;  1F8H A;  1KK7 Y;  1TN4 A;  2WCL A;  3CR2 A;  1IWQ A;  3DZT A;  2EC6 C;  2Y4Q A;  4ORA B;  1PSR A;  4PE4 A;  1QIV A;  1PAL A;  2FOT A;  4N1G A;  1IJ6 A;  2E30 A;  5FI2 A;  3UO9 A;  1B9A A;  5AAN A;  2OPO A;  1IIO A;  1S6J A;  4PE7 A;  2JXC A;  2M49 B;  2Y1N A;  3DVM A;  3OGN A;  3JTD B;  4YGC B;  4E68 A;  1AK8 A;  1N65 A;  2CCM A;  2LP2 A;  1DJZ A;  1JUO A;  3KPX A;  2WCE A;  4M2O A;  1KFX L;  3ZWH A;  4MBE A;  1SL7 A;  2M29 A;  5AFP A;  3DXL A;  3BFB A;  2JOJ A;  1LKJ A;  1OOG A;  1DJI A;  1XK4 A;  2FCE A;  2BE4 A;  2L51 A;  1AP4 A;  4HRG A;  3VRQ A;  3D73 A;  2KGR A;  1BOD A;  2CBL A;  3KF9 A;  1DVI A;  1F4Q A;  1HQV A;  1NUB A;  1QVI Y;  5CSF A;  4AQJ A;  1GM0 A;  3CZT X;  1A75 A;  4MZJ A;  1K2H A;  2LM5 A;  2PMY A;  5HKW A;  5D7F A;  4MN0 A;  2PAS A;  1V1G A;  2G2B A;  2Q4U A;  1QXP A;  4CLN A;  1DJY A;  1MR8 A;  2OTG B;  3SG6 A;  1CM1 A;  1KK8 C;  2L5Y A;  2QEH A;  2OS8 C;  1UHI A;  4OV2 A;  3S0A A;  1TWO A;  2JUL A;  2K7C A;  1NCZ A;  1FBV A;  3BUM B;  1QAS A;  3Q8I A;  4M2P A;  1AJ5 A;  3CZ1 A;  3B88 A;  1IH0 A;  4L9M A;  2LUX A;  1X02 A;  1Z2C B;  3PAL A;  1L7Z A;  1DGV A;  1IGV A;  3TDZ A;  2LAP A;  3K1E A;  1E8A A;  1TNP A;  5CPV A;  2ERB A;  4I5L B;  3SIA A;  5BPJ A;  3WHT B;  2M9G A;  5KTY A;  5I8N A;  1EG4 A;  2JXL A;  1EXR A;  3D0Y A;  1LS8 A;  1XFV O;  1YUU A;  3N7H A;  3IQQ A;  1H4B A;  4DRW A;  2V53 A;  2KFG A;  3E3R A;  4GUK A;  4I5K A;  2HPS A;  1DGU A;  1IJ5 A;  2WCJ A;  1ZMZ A;  4GAO A;  2PRU A;  1IKU A;  2KLE A;  1NYA A;  1XA5 A;  1XFZ O;  3EK8 A;  1CLL A;  3SG5 A;  2M7N A;  3D10 A;  3CTN A;  1EH2 A;  3WXA A;  1UUS A;  1ZFS A;  3JTD C;  4MEW A;  4MRY A;  2L98 A;  2JWW A;  1FF1 A;  1K93 D;  1KFX S;  3CGA A;  1SK6 D;  3D75 A;  1TNX A;  2G9B A;  1SRA A;  2E6W A;  3PFV A;  2ZNE A;  1ALW A;  3SIB A;  2BNX A;  2KYC A;  5I2Q A;  1BF5 A;  3SJS A;  1K90 D;  3OX6 A;  2LCP A;  1UHH A;  4UPG A;  1UP5 A;  2K60 A;  1KFU L;  1PSB A;  1G33 A;  2QAC A;  4N1F A;  2K7O A;  3CLN A;  5HKY A;  3S0E A;  3NSI A;  2WCM A;  1U5I A;  1C07 A;  3I5F B;  1JSA A;  4USL A;  4NDD A;  3QRX A;  3TDI A;  3TS5 B;  1C3Z A;  3VRO A;  2LVJ A;  3R1O A;  2H61 A;  2OTG C;  1J55 A;  4JD9 A;  4NQG A;  1BG1 A;  2KHN A;  4C0J A;  3FS7 A;  1CLB A;  3VRP A;  2ZRS A;  5HL1 A;  2BKH B;  1QS7 A;  1OOJ A;  1AJ4 A;  3FWB A;  3LLE A;  1UHN A;  2BBM A;  1TUJ A;  2L50 A;  3FE6 A;  3ICB A;  4INW A;  3PLF B;  1B1G A;  1LA0 A;  1K94 A;  1TRF A;  3TDU A;  1S6I A;  2KBI A;  1FPW A;  4PT1 A;  2Y5I A;  5HLO A;  2O60 A;  2R2I A;  3H4S E;  1DEK A;  1NX0 A;  5HYD A;  2LLT A;  1NX3 A;  3DVE A;  1MWN A;  2KI4 B;  1A75 B;  1J7O A;  4ORC B;  4KYN A;  2I94 A;  1OOH A;  5KU1 A;  1S1E A;  2NXQ A;  3B86 A;  1OOI X;  2BL0 B;  3K21 A;  2MLF C;  1UHK A;  4HSZ A;  3I5I B;  5FI6 A;  4ZCV A;  1FI6 A;  2I2R E;  2EHB A;  1YVL A;  1AVS A;  1F4O A;  2K0J A;  3VB1 A;  1XO5 A;  3O2P A;  3DYE A;  1WDC B;  1K9P A;  3VRR A;  4CFR A;  5CSJ A;  2HQW A;  4AOM A;  5HKZ A;  1DEL A;  2I18 A;  3LK1 A;  3QME A;  1NCX A;  1SCM B;  2QEV A;  1DJG A;  3V2L A;  4XJK A;  1N0Y A;  2F3Y A;  1PUL A;  1R6P A;  3L4A A;  5F6T A;  3VRN A;  1YVH A;  2WND A;  1B4C A;  1J7Q A;  3LCP C;  1BOC A;  1G8I A;  2JT8 A;  1K8U A;  1LXF C;  4BY5 A;  1CMF A;  1QX5 B;  4DIR A;  2KQ6 A;  1YUR A;  3RLZ A;  1HT9 A;  2KLD A;  2EGD A;  4ETO A;  4Q04 A;  1F71 A;  1ALV A;  2JPT A;  3D0Y B;  3HX4 A;  4MVF A;  1DC1 A;  1MXL C;  3SS4 A;  2MLE C;  3EVU A;  4CPV A;  2KSP A;  1LIN A;  1NCY A;  1RJV A;  2CXJ A;  3AKB A;  4R1E A;  4YI8 A;  5DKR A;  2K2A A;  2KI6 D;  3I5F C;  2WCH A;  4MZK A;  1TCF A;  3RM1 A;  3D74 A;  3TS5 C;  4GPL B;  2M1U A;  3WNX B;  1SR6 C;  2L2E A;  1JFJ A;  3I5G B;  5G08 A;  1RWY A;  1JC2 A;  5ER4 X;  1OZO A;  2JTT A;  1CNP A;  1Y1X A;  1Y1A A;  3NHT A;  2H8V A;  1KQM B;  1SKT A;  3EKH A;  5I2O A;  1EG3 A;  1SPY A;  2K7B A;  2KYF A;  4WQ3 A;  2BCA A;  1V1F A;  1ODB A;  3BFH A;  3PAT A;  5DKN A;  1QX7 A;  4FQT A;  1H8B A;  1W7I B;  4YI9 A;  1XK4 C;  2GV5 A;  1MQ1 A;  3M0W A;  3OX5 A;  3S0B A;  1SMG A;  3FE9 A;  1CDN A;  4C0K A;  2LHI A;  3OB1 B;  4NDB A;  2LVK A;  2BCB A;  2KI4 C;  2FJU B;  1CKK A;  1G4Y R;  2JZI A;  1Q80 A;  3C1V A;  1OOF A;  4PDZ A;  1U5I B;  3O6B A;  2HET A;  4GGN A;  1SYM A;  4QJ5 B;  1F70 A;  1Z4H A;  2BL0 C;  3SG2 A;  2LP3 A;  1M31 A;  5I94 A;  3I5I C;  3OBV A;  2L5X B;  3AKA A;  5K89 A;  1QJT A;  2KQY A;  3OHM B;  4NDC A;  3R1V A;  1GGZ A;  2AAO A;  1WDC C;  2LLS A;  1XYD A;  1UHJ A;  4PAL A;  1L2O B;  3A4U B;  1NX1 A;  1SCM C;  4PE0 A;  1GJY A;  2M97 A;  4A4B A;  1W7J B;  4MRX A;  2KAY A;  1S26 D;  1OZS A;  2CT9 A;  1KCY A;  2ZND A;  1WLM A;  1WRK A;  3DVJ A;  4QJ4 B;  2JQ6 A;  2CNP A;  1B47 A;  2LHL A;  3D78 A;  2D8N A;  3FWC A;  1C7V A;  3CWG A;  1K96 A;  3MSE B;  1CTR A;  1SNL A;  2F8P A;  1OMR A;  1YTZ C;  2KGB C;  3CR5 X;  3DF0 A;  3CDN A;  1QV1 A;  4YGA A;  1D1O A;  4PCW A;  1CFP A;  3BYA A;  2LVI A;  3SG7 A;  1NIW A; 
#chains in the Genus database with same CATH homology
 2PSR A;  1A29 A;  2SCP A;  4PE1 A;  1REC A;  2GGM A;  2L0P A;  4CFQ A;  1CFF A;  1TOP A;  1XFW O;  4GFT A;  2MAZ A;  1QLK A;  1RFJ A;  2DOQ A;  3BUN B;  2A4J A;  2M7L A;  3JVT B;  5AXI A;  2LLU A;  2KFH A;  2ZFD A;  4XJK B;  4YGD B;  4MZL A;  3I5G C;  5GQQ C;  5JJG A;  1KSO A;  5CSI A;  1NP8 A;  1S3P A;  2F3Z A;  2M8U A;  4P5O E;  5IBW A;  1B7T Z;  2NCP A;  1KQM C;  4F0Z B;  4XYN A;  1J7P A;  2BKI B;  1Y0V H;  1YUT A;  3KHE A;  5DKQ A;  5KSZ A;  1SW8 A;  3EVV A;  3PN7 B;  3WHU B;  4FTG A;  3BOW A;  2KAX A;  1CLM A;  3DVK A;  1ZOT B;  4FQO A;  1B7T Y;  4YBH B;  4YGE B;  2KBM A;  2HF5 A;  3GK1 A;  4JQ0 D;  2ISD A;  1GQM A;  5FYX A;  2ZN8 A;  3PSR A;  2LAN A;  1RK9 A;  2LMT A;  3ZNI A;  1IQ3 A;  1B8R A;  4JPZ B;  3AAJ A;  1WY9 A;  2KNE A;  2H61 C;  1FI5 A;  1MXE A;  1CDP A;  2WOS A;  3SG4 A;  2MA2 A;  2K2F A;  1DT7 B;  1M45 A;  1L2O C;  1RRO A;  1F55 A;  4OR9 B;  3LL8 B;  1OQP A;  1JF2 A;  1VRK A;  1TIZ A;  2JNX A;  5HLV A;  1Y1U A;  1CM4 A;  1ZAC A;  4WQ2 A;  1SCV A;  2K7D A;  2MJW B;  1M39 A;  1TCO B;  5TNC A;  1PVB A;  1Y6W A;  3OB2 B;  1EL4 A;  4C0L A;  2JC2 A;  2WC8 A;  2F2O A;  1XVJ A;  1PVA A;  1OSA A;  2GGZ A;  2CTN A;  1MHO A;  2NLN A;  1S6C A;  3OP0 A;  1AHR A;  2M3W A;  1QTX A;  4PHM A;  2NCO A;  1NWD A;  1OE9 B;  1LVC D;  1KFU S;  1F54 A;  1BU3 A;  2LUC A;  1YRU B;  1IRJ A;  2F33 A;  3TUY B;  2M1K B;  3JVT C;  1C7W A;  3A8R A;  1CFC A;  2KAV A;  1A4P A;  5B8I B;  3CR4 X;  2H2K A;  2RGI A;  2O5G A;  3BUO B;  3SG3 A;  3NSL A;  1YR5 A;  4OVN F;  1CDM A;  3BUW B;  2BBN A;  1OMD A;  1QVI Z;  1N2D A;  1A03 A;  1AUI B;  2KOT A;  4OCI A;  1RTP 1;  3DF0 B;  2LMU A;  1CMG A;  2PAL A;  1BR4 B;  2BCX A;  1J1D A;  3PN7 C;  3GK2 A;  1KQV A;  1J1E A;  2WCB A;  2KI6 C;  2LV7 A;  3NSK A;  2LE9 B;  4IL1 A;  1DJW A;  1BT6 A;  1M46 A;  3IQO A;  1MUX A;  1YRT B;  1BMO A;  2BE6 A;  2LMV A;  2MHH A;  1S36 A;  1QIW A;  2PVB A;  1CDL A;  5ER5 A;  1YUS A;  2LNK A;  2HQ8 A;  1CFD A;  2LC5 A;  3F45 A;  2Q91 A;  1B8L A;  4P2Y B;  2K8M B;  3I5H B;  1BR1 B;  1KSM A;  1OMV A;  2JNF A;  1IG5 A;  5J3X A;  2JU0 A;  2K61 A;  2L4H A;  2KDH A;  1SL8 A;  1DF0 B;  3BXK A;  1A2X A;  4ZCU A;  1JF0 A;  4DUQ A;  2P6B B;  1TNQ A;  1WRZ A;  1KWO B;  1DMO A;  3BOW B;  2ZRT A;  1SBJ A;  3EKJ A;  1K9U A;  3BUX B;  4OKH A;  1WRL A;  2B1U A;  1NPQ A;  4TNC A;  4JWQ A;  4QJ3 B;  1DJX A;  4GGF A;  3KO0 A;  1QV0 A;  3PM8 A;  3FIA A;  1GGW A;  4I5N B;  3VGO A;  4D1E A;  4AQI A;  2M0R A;  1K95 A;  1CB1 A;  4YGB B;  1NX2 A;  2JT0 A;  4A4C A;  4GBA A;  4PHJ A;  1YX7 A;  2KFF A;  5JOL A;  1WLZ A;  2ZN9 A;  1PK0 D;  1LA3 A;  3TUY C;  3CS1 A;  4YRU A;  2EC6 B;  1M63 B;  1UUR A;  2I7A A;  1QLS A;  1B8C A;  2JTZ A;  2F2P A;  5D69 A;  1DJH A;  1DTL A;  4MSP A;  3HCM A;  2ZKM X;  4PHN A;  1NSH A;  2AUC A;  3DD4 A;  4DS7 A;  3NSO A;  1DF0 A;  4M2Q A;  1JWD A;  3EVR A;  4GGF C;  2JRF A;  1J7R A;  2TN4 A;  3BQ3 A;  1ZUZ A;  3LK0 A;  4GNK B;  2MRD A;  3EK7 A;  3IF7 A;  2SAS A;  3KEV A;  4HRE E;  1S5G Z;  1BJF A;  2QPT A;  1EJ3 A;  2JT3 A;  1XFY O;  3GK4 X;  1QAT A;  3O4Y A;  1JBA A;  1SR6 B;  5I2L A;  1YX8 A;  5PAL A;  2NZ0 A;  2COL B;  1XFX O;  3O78 A;  4BY4 A;  1KK8 B;  1S5G Y;  2OS8 B;  4N5X A;  4ORB B;  1SL9 A;  3I5H C;  2MBX A;  1R2U A;  1PRW A;  5AEQ A;  4HRH A;  5CSN A;  4CID A;  1UWO A;  4DCK A;  4MLW A;  1BLQ A;  1JFK A;  4WRI A;  2Y1M A;  1QX2 A;  1TNW A;  5AER A;  3AAK A;  1XFU O;  1K9K A;  1KWO C;  1TTX A;  1SY9 A;  2AMI A;  4ICB A;  1IQ5 A;  2WOR A;  3NXA A;  2LVV A;  2BEC A;  4PHK A;  1KK7 Z;  3EK4 A;  2IS9 A;  2VRG A;  3GOF A;  2L4I A;  4I5J A;  3TZ1 A;  4U8D A;  1MF8 B;  2FCD A;  2WCF A;  1FW4 A;  1F8H A;  1KK7 Y;  1TN4 A;  3CR2 A;  1IWQ A;  2EC6 C;  2Y4Q A;  4ORA B;  1PSR A;  4PE4 A;  1QIV A;  1PAL A;  2FOT A;  4N1G A;  1IJ6 A;  2E30 A;  1B9A A;  5AAN A;  2OPO A;  1S6J A;  4PE7 A;  2JXC A;  2M49 B;  2Y1N A;  3DVM A;  4YGC B;  3JTD B;  4E68 A;  1AK8 A;  1N65 A;  2CCM A;  2LP2 A;  1DJZ A;  1JUO A;  3KPX A;  2WCE A;  4M2O A;  1KFX L;  3ZWH A;  4MBE A;  1SL7 A;  2M29 A;  5AFP A;  2JOJ A;  1LKJ A;  1DJI A;  1XK4 A;  2FCE A;  2BE4 A;  2L51 A;  1AP4 A;  4HRG A;  3VRQ A;  2KGR A;  1BOD A;  2CBL A;  3KF9 A;  1DVI A;  1F4Q A;  1HQV A;  1NUB A;  1QVI Y;  5CSF A;  4AQJ A;  1K2H A;  3CZT X;  1A75 A;  4MZJ A;  2LM5 A;  2PMY A;  5HKW A;  5D7F A;  4MN0 A;  2PAS A;  1V1G A;  2G2B A;  2Q4U A;  1QXP A;  4CLN A;  1DJY A;  1MR8 A;  2OTG B;  3SG6 A;  1CM1 A;  1KK8 C;  2OS8 C;  1UHI A;  4OV2 A;  2JUL A;  2K7C A;  1NCZ A;  1FBV A;  3BUM B;  1QAS A;  4M2P A;  1AJ5 A;  1IH0 A;  4L9M A;  2LUX A;  1X02 A;  3PAL A;  1L7Z A;  1DGV A;  1IGV A;  3TDZ A;  2LAP A;  1E8A A;  1TNP A;  5CPV A;  4I5L B;  3SIA A;  5BPJ A;  3WHT B;  2M9G A;  5KTY A;  5I8N A;  1EG4 A;  2JXL A;  1EXR A;  3D0Y A;  1XFV O;  1YUU A;  3IQQ A;  1H4B A;  4DRW A;  2V53 A;  2KFG A;  3E3R A;  4GUK A;  4I5K A;  2HPS A;  1DGU A;  1IJ5 A;  1ZMZ A;  4GAO A;  2PRU A;  1IKU A;  1NYA A;  1XA5 A;  1XFZ O;  3EK8 A;  1CLL A;  3SG5 A;  2M7N A;  3D10 A;  3CTN A;  1EH2 A;  3WXA A;  1UUS A;  1ZFS A;  3JTD C;  4MEW A;  4MRY A;  2L98 A;  2JWW A;  1FF1 A;  1K93 D;  1KFX S;  3CGA A;  1SK6 D;  1TNX A;  2G9B A;  1SRA A;  2E6W A;  3PFV A;  2ZNE A;  1ALW A;  3SIB A;  2KYC A;  5I2Q A;  1BF5 A;  3SJS A;  1K90 D;  3OX6 A;  2LCP A;  1UHH A;  4UPG A;  1UP5 A;  1KFU L;  1PSB A;  1G33 A;  2QAC A;  4N1F A;  2K7O A;  3CLN A;  5HKY A;  3NSI A;  1U5I A;  1C07 A;  3I5F B;  1JSA A;  4USL A;  4NDD A;  3QRX A;  3TDI A;  3TS5 B;  3VRO A;  2LVJ A;  2H61 A;  2OTG C;  1J55 A;  4NQG A;  1BG1 A;  2KHN A;  4C0J A;  3FS7 A;  1CLB A;  3VRP A;  2ZRS A;  2BKH B;  1QS7 A;  1OOJ A;  1AJ4 A;  3FWB A;  3LLE A;  1UHN A;  2BBM A;  2L50 A;  3ICB A;  3PLF B;  1B1G A;  1LA0 A;  1K94 A;  1TRF A;  3TDU A;  1S6I A;  2KBI A;  1FPW A;  2Y5I A;  5HLO A;  2O60 A;  2R2I A;  3H4S E;  5HYD A;  1NX0 A;  2LLT A;  1NX3 A;  3DVE A;  1MWN A;  2KI4 B;  1A75 B;  1J7O A;  4ORC B;  2I94 A;  5KU1 A;  1S1E A;  2NXQ A;  2BL0 B;  4ZCV A;  3K21 A;  2MLF C;  1UHK A;  4HSZ A;  3I5I B;  1FI6 A;  2I2R E;  2EHB A;  1YVL A;  1AVS A;  1F4O A;  2K0J A;  1XO5 A;  3O2P A;  1WDC B;  1K9P A;  3VRR A;  4CFR A;  5CSJ A;  2HQW A;  4AOM A;  5HKZ A;  3LK1 A;  2I18 A;  1NCX A;  1SCM B;  1DJG A;  4XJK A;  1N0Y A;  2F3Y A;  1PUL A;  1R6P A;  5F6T A;  3VRN A;  1YVH A;  2WND A;  1B4C A;  1J7Q A;  3LCP C;  1BOC A;  1G8I A;  2JT8 A;  1K8U A;  1LXF C;  4BY5 A;  1CMF A;  1QX5 B;  4DIR A;  2KQ6 A;  1YUR A;  3RLZ A;  1HT9 A;  2EGD A;  4ETO A;  4Q04 A;  1F71 A;  1ALV A;  2JPT A;  3D0Y B;  3HX4 A;  4MVF A;  1MXL C;  2MLE C;  3EVU A;  4CPV A;  2KSP A;  1LIN A;  1NCY A;  1RJV A;  2CXJ A;  3AKB A;  4R1E A;  4YI8 A;  5DKR A;  2K2A A;  2KI6 D;  3I5F C;  4MZK A;  1TCF A;  3RM1 A;  3TS5 C;  4GPL B;  2M1U A;  3WNX B;  1SR6 C;  2L2E A;  1JFJ A;  3I5G B;  5G08 A;  1RWY A;  1JC2 A;  5ER4 X;  1OZO A;  2JTT A;  1CNP A;  1Y1X A;  1Y1A A;  1KQM B;  1SKT A;  3EKH A;  5I2O A;  1EG3 A;  1SPY A;  2K7B A;  2KYF A;  4WQ3 A;  2BCA A;  1V1F A;  1ODB A;  3PAT A;  5DKN A;  1QX7 A;  1H8B A;  1W7I B;  4YI9 A;  1XK4 C;  2GV5 A;  1MQ1 A;  3M0W A;  3OX5 A;  1CDN A;  1SMG A;  4C0K A;  2LHI A;  3OB1 B;  4NDB A;  2LVK A;  2BCB A;  2KI4 C;  2FJU B;  1CKK A;  1G4Y R;  2JZI A;  1Q80 A;  3C1V A;  4PDZ A;  1U5I B;  3O6B A;  2HET A;  4GGN A;  1SYM A;  4QJ5 B;  1F70 A;  2BL0 C;  3SG2 A;  2LP3 A;  1M31 A;  3I5I C;  2L5X B;  3AKA A;  5K89 A;  1QJT A;  2KQY A;  3OHM B;  4NDC A;  1GGZ A;  2AAO A;  1WDC C;  2LLS A;  1XYD A;  1UHJ A;  4PAL A;  1L2O B;  3A4U B;  1NX1 A;  1SCM C;  4PE0 A;  1GJY A;  2M97 A;  4A4B A;  1W7J B;  4MRX A;  2KAY A;  1S26 D;  1OZS A;  2CT9 A;  1KCY A;  2ZND A;  1WLM A;  1WRK A;  3DVJ A;  4QJ4 B;  2JQ6 A;  2CNP A;  1B47 A;  2LHL A;  2D8N A;  3FWC A;  1C7V A;  3CWG A;  1K96 A;  3MSE B;  1CTR A;  1SNL A;  2F8P A;  1OMR A;  1YTZ C;  2KGB C;  3CR5 X;  3DF0 A;  1QV1 A;  4YGA A;  1D1O A;  4PCW A;  1CFP A;  3BYA A;  2LVI A;  3SG7 A;  1NIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...