3V2LA

Structure of anopheles gambiae odorant binding protein 20 bound to polyethylene glycol
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
120
structure length
120
Chain Sequence
MTVEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGAP005208-PA
publication title A novel mechanism of ligand binding and release in the odorant binding protein 20 from the malaria mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 42
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3v2lA00
3VB1A 1OOIX 5DICA 3OGNA 3QMEA 3B88A 2PQLA 1TWOA 3B6XA 3V2LA 4PT1A 4OZDA 1T14A 3D74A 4JD9A 2QEOA 3CZ0A 3S0BA 2H8VA 3B86A 3CYZA 3BFAA 3NHTA 3D75A 3D73A 4INWA 1GM0A 3FE8A 3FE9A 1QWVA 2P70A 1DQEA 3BFHA 2JPOA 1LS8A 3Q8IA 3NGVA 3S0DA 3S0FA 3R1VA 3S0GA 2QEBA 2FJYA 3L4AA 3FE6A 3S0EA 3BFBA 2WCMA 2WCLA 2QEHA 1ORGA 1OOFA 2WC6A 3S0AA 5EL2A 3K1EA 1TUJA 1C3ZA 2WCJA 3DXLA 1OOGA 3N7HA 2ERBA 3R72A 1XFRA 2WC5A 4F7FA 3D77A 3D78A 2L2CA 2WCHA 3DYEA 4INXA 1P28A 3PJIA 3RZSA 1OOHA 1C3YA 3CZ1A 3CABA 2WCKA 3D76A 4FQTA 3B87A 1OW4A 2GTEA 2QEVA 3R1PA 3L47A 3CDNA 3BJHA 3DY9A 2KPHA 3R1OA 3CZ2A 3B7AA 2P71A 3DZTA 3L4LA 2QDIA 3NHIA
chains in the Genus database with same CATH superfamily
4AOMA 1TIZA 3CGAA 4OR9B 1IH0A 2LUCA 2HQ8A 3VB1A 2A4JA 1SL8A 2EC6B 3FIAA 3LCPC 4CFQA 3CTNA 5AFPA 2PSRA 1TWOA 2LANA 1YVLA 1SR6B 4OZDA 3SG6A 1CDNA 4XJKB 1DJZA 1DJWA 2QEOA 1IIOA 1RK9A 4YGCB 1G4YR 3FS7A 4IJ7A 3IVTA 1KK8C 2K61A 1N0YA 1SL7A 2BKHB 3B86A 2CT9A 2KLEA 3CYZA 3WHTB 4PE0A 3I5IC 3WHUB 5FI2A 2KAXA 1BOCA 1KSOA 3I5GC 2WOSA 3D73A 1QX5B 1WLZA 2NXQA 4CLNA 3ZNIA 4INWA 1OSAA 1ZUZA 2K0JA 1MUXA 3BXKA 3DVEA 1ZMZA 2GV5A 3EKHA 4GGFC 1FPWA 2F3YA 2WCFA 3BOWA 1TTXA 5AEQA 2JTTA 1R6PA 1B9AA 1IQ3A 1LINA 1B8CA 4I5NB 1NCZA 1LS8A 2IS9A 2K60A 2LM5A 3Q8IA 1XK4A 2Y1MA 1PRWA 4I5JA 4YI8A 3NGVA 1DMOA 3S0FA 3R1VA 4OKHA 3JTDC 3UO9A 4CFRA 1A75A 1QATA 2QEBA 1EL4A 4PHKA 2FJYA 2ZFDA 3S0EA 1OZOA 1W7IB 3SG2A 2MAZA 2BKIB 3BFBA 1FI5A 1XA5A 1DT7B 1YUSA 4PE1A 2AUCA 1CLLA 2CNPA 3D0YB 2WCLA 5HLOA 2BCBA 4OVNF 2RGIA 4DIRA 1XFZO 1EJ3A 3EVVA 2KNEA 2R2IA 3IQOA 5EL2A 1M46A 1WY9A 2L4HA 1C3ZA 2WCJA 1TN4A 2JC2A 3R72A 5CSFA 1Y6WA 2WC5A 4YI9A 1KQMC 3D78A 5I94A 1CFPA 3KHEA 5DKRA 1KK7Y 4MRXA 2EC6C 1B7TY 1NUBA 2K7BA 3CS1A 3UNWA 2L2CA 2FOTA 3QRXA 2K2FA 2ISDA 4ICBA 2Y4QA 3RM1A 3SG3A 5ER4X 1ZACA 1XVJA 1P28A 1SR6C 1TNWA 3FWCA 3PFVA 2JT3A 1C7WA 1GGWA 1PSRA 1Q80A 3OX6A 1PALA 2HPSA 3PALA 4AQIA 3DVMA 1EH2A 2KI6C 3C1VA 5ER5A 1OW4A 2MJWB 3SIAA 2HF5A 3GK2A 4WRIA 3BQ3A 1S26D 2QEVA 1CLMA 1AJ4A 2O60A 2KDHA 5HYDA 1DF0A 4MZLA 2M49B 3R1PA 4NDBA 2M1UA 1NX2A 3BYAA 4GGNA 4JQ0D 1CFFA 4A4CA 4R1EA 1WRKA 4E68A 1UHKA 1KQVA 3RLZA 3DY9A 4OCIA 5FI6A 1XFWO 1ODBA 1BR1B 2WNDA 4NQGA 1CKKA 1YUUA 2LVVA 1M45A 2YGUA 2LAPA 2AAOA 3DZTA 1QX7A 1J1DA 4ZCVA 1M31A 2Q91A 3AKAA 1N65A 1SW8A 3H4SE 1SY9A 2LMUA 5PALA 2BCAA 5DICA 2PALA 3OGNA 1K93D 2PYQA 2I2RE 1KFUL 1V1FA 3V2LA 5CSJA 2LMVA 4DRWA 1N2DA 1T14A 2EHBA 2Y5IA 3KF9A 1A29A 1IWQA 1DELA 2K8MB 2KBIA 5KTYA 2M0RA 1ALWA 2KFFA 2PASA 2H61C 5TNCA 2F8PA 2K7OA 1NYAA 2MBXA 1DJXA 1BLQA 1NX3A 2NCPA 1S3PA 2M97A 1TNPA 2BBMA 2CBLA 2L4IA 2ZKMX 3TS5B 5AERA 4HSZA 1BR4B 2F3ZA 1GM0A 1G33A 3FE8A 1DJHA 1AVSA 1D1OA 2LLUA 3OB2B 1QWVA 2P70A 1DQEA 2CXJA 1K9UA 2SCPA 3SS4A 1QS7A 2L2EA 1DGUA 1B8LA 4YRUA 1XO5A 3A8RA 3GK1A 3MSEB 1MXEA 4QJ3B 1CM1A 2KBMA 3OX5A 5IBWA 3CLNA 2KI4B 1KSMA 3CR5X 4PE4A 4U8DA 5FI7A 1C07A 1NX0A 2Q4UA 1NIWA 1K90D 4A4BA 2M29A 2WCMA 3PLFB 1Z4HA 1BJFA 5KU1A 4YGEB 1NP8A 1F4OA 1XYDA 1LKJA 1LVCD 2QEHA 3SIBA 2LUXA 1S5GY 1JF0A 2WC6A 4C0LA 5I2OA 3EK8A 3E3RA 2BAPA 1CDPA 3GOFA 4JWQA 2QACA 1NX1A 4N5XA 3NSLA 3OB1B 3TDIA 1SNLA 2OPOA 1SK6D 5B8IB 3IQQA 1UURA 2LCPA 2O5GA 1SCVA 4MBEA 4P2YB 1TCFA 4PHNA 2NZ0A 2ZN9A 4M2OA 3EG5B 1U5IA 3I5HB 1HT9A 1M39A 4MN0A 3BUOB 5KSZA 2K7DA 4GFTA 3DVKA 1L7ZA 1JSAA 3TDUA 3VRPA 1F71A 1BMOA 2MRDA 1WRLA 3DF0B 1C3YA 4XYNA 2HQWA 1CDLA 2PRUA 3CZ1A 1J1EA 1X02A 1XFYO 1XFVO 1QVIZ 2I18A 2P6BB 1GGZA 2F2OA 5GQQC 2LP3A 2LVKA 2KFGA 1IJ5A 3TS5C 1K2HA 4L9MA 1QV1A 2CTNA 1FW4A 2GTEA 2OS8B 3A4UB 1FBVA 3AAJA 1C7VA 1K95A 4CPVA 2JNXA 2M7LA 2KHNA 2TN4A 3EVRA 3K21A 3EVUA 2L5YA 3CDNA 2G9BA 4GGFA 4IL1A 1ALVA 3TZ1A 2M8UA 5D69A 4BY4A 1J7QA 4CIDA 1Y1XA 5BPJA 1BU3A 1LA3A 1QASA 1RFJA 2ZNEA 1PVAA 1WDCB 2JZIA 1IJ6A 1QLKA 3BUMB 2KI4C 2QDIA 5HKWA 1EG4A 1PULA 4YGBB 5HLVA 5I8NA 1OOIX 2LLSA 1SKTA 3SJSA 1OE9B 1B4CA 4DCKA 3B88A 2PQLA 1F4QA 4ORAB 2MLFC 2JT8A 3WNXB 2LVIA 3BOWB 3D74A 2F2PA 1QLSA 4QJ5B 2FCEA 2KSPA 2E30A 4ETOA 4JKTA 1AJ5A 1XFUO 2M7NA 5J3XA 2KGBC 4MVFA 2JRFA 2JWWA 4P5OE 3SG7A 3KPXA 3BFAA 3PM2A 3SS5A 4MEWA 1NCXA 5DKNA 1OOJA 2EGDA 1A75B 4KYNA 1CM4A 1F70A 1PK0D 1Z2CB 3SS3A 1JF2A 3I5HC 3O4XA 1SCMB 1RECA 2JOJA 3FE9A 2L0PA 4M2QA 3CR4X 4NDDA 2LVJA 2M3WA 2QPTA 4XJKA 4GPLB 1J7PA 2BE4A 1Y0VH 1PVBA 1DEKA 2G2BA 1YX7A 3SG4A 1DVIA 3S0DA 1OMDA 3EK4A 2VRGA 3NXAA 5HKYA 2JTZA 3CR2A 2Y1NA 3FE6A 1OMVA 1WRZA 1LA0A 1DTLA 2BL0B 2LV7A 1H4BA 2OS8C 1K94A 3ICBA 5CPVA 1BODA 3I5FB 1SRAA 2WCEA 1V1GA 3LK0A 3OBVA 1DGVA 1MXLC 1PSBA 2MLEC 3S0AA 2L98A 4BY5A 2OTGB 4DUQA 1A03A 1JFKA 1SMGA 1TUJA 1WDCC 2JU0A 3DXLA 1OOGA 3LL8B 2ERBA 5HKZA 5AXIA 4FTGA 2PMYA 3D77A 1S6JA 3OHMB 4QJ4B 4PDZA 4JPZB 5I2QA 2JULA 1NPQA 5G08A 1M63B 1SSEB 1GJYA 2WCBA 2DOQA 4F0ZB 4UPGA 3NSOA 2WCHA 1S6CA 1RTP1 3DYEA 1DF0B 2BNXA 4WQ2A 4YGDB 2GGMA 4INXA 5I2LA 1F55A 1CTRA 1Y1AA 2M1KB 3EK7A 4GBAA 1QX2A 1S6IA 1UHNA 5F6TA 2I94A 3GK4X 3RZSA 2KOTA 1GQMA 1K9PA 1RWYA 2KAYA 4D1EA 1XK4C 2H61A 2NCOA 1S36A 2FJUB 3VGOA 4FQTA 3B87A 4MZJA 1EXRA 1F54A 1SL9A 1NSHA 3SG5A 1CMGA 3IF7A 1HQVA 1QXPA 1SBJA 5JJGA 1J7OA 3PM8A 3KO0A 2L5XB 1IG5A 3L47A 4ORBB 1SCMC 3HCMA 2MA2A 4I5KA 4I5LB 4M2PA 1ZOTB 1K96A 3BJHA 1KWOB 4GUKA 1YVHA 3PN7B 5CSNA 5HL1A 1BF5A 2JXCA 3NSKA 3VROA 1KK7Z 1B7TZ 5D3OA 3FWBA 4MRYA 1CLBA 2D8NA 4GNKB 2P71A 2L50A 4TNCA 2WORA 1QTXA 3PSRA 1YR5A 2BL0C 1YRTB 4HRHA 4PHJA 1AK8A 1MF8B 3I5FC 1TUZA 3BUNB 3CWGA 1MWNA 3LLEA 3QMEA 2LHIA 4MSPA 3B6XA 1H8BA 1JUOA 2LNKA 1TRFA 2BBNA 2JXLA 4PT1A 3LK1A 1A2XA 1JFJA 1TOPA 4JD9A 1AHRA 2LP2A 1DJIA 2OTGC 1UWOA 1NCYA 3CZ0A 4ORCB 1CB1A 2B1UA 3S0BA 2BECA 2ZN8A 1BT6A 1MHOA 4NDCA 1K9KA 2H8VA 3TUYB 3VRNA 1CMFA 1QJTA 2JT0A 3NHTA 1B47A 5K89A 2L51A 3JVTB 5AANA 2LHLA 3D75A 4Q04A 1EG3A 2I7AA 1K8UA 2LC5A 3ZWHA 1IQ5A 4GAOA 4PE7A 1DJGA 4YGAA 4C0KA 1L2OB 3BFHA 4PALA 3WXAA 2JPOA 2KAVA 2KI6D 1QIWA 1MR8A 3O78A 1RROA 1TNXA 5CSIA 3PATA 3DVJA 1J55A 3S0GA 4N1GA 1IGVA 3TDZA 2ZRSA 1DC1A 1YRUB 2LMTA 2ZNDA 2LE9B 1OMRA 2KQ6A 3L4AA 4OV2A 2K2AA 1YURA 2E6WA 1IKUA 1G8IA 1JBAA 3VRQA 1FF1A 1U5IB 2HETA 1RJVA 2KQYA 1XFXO 3AKBA 4N1FA 2KLDA 1QVIY 1KFXS 3AAKA 2FCDA 1ORGA 1OOFA 2KFHA 1KWOC 3PN7C 1R2UA 2WC8A 1CFCA 1B8RA 3K1EA 4DS7A 4FQOA 1BG1A 1UHIA 2JQ6A 1S1EA 1AP4A 1KK8B 1W9ZA 3N7HA 1XFRA 4F7FA 2CCMA 1A4PA 1MQ1A 3O2PA 1KFXL 2GGZA 3CZTX 1UP5A 5JOLA 3I5IB 1AUIB 1SYMA 1OZSA 3HX4A 3I5GB 5DKQA 3M0WA 3OP0A 2MHHA 3F45A 2SASA 1ZFSA 2KYCA 3NSIA 2BCXA 4WQ3A 1TCOB 4HRGA 1UHJA 1KFUS 1W7JB 1FI6A 2COLB 1CDMA 1SPYA 3PJIA 1E8AA 1IRJA 1YX8A 2ZRTA 1UUSA 3DD4A 1YUTA 1OOHA 3KEVA 1QIVA 2NLNA 1TNQA 4C0JA 1UHHA 2JNFA 3CABA 2KYFA 2WCKA 3JTDB 3TUYC 1JC2A 2H2KA 4PCWA 1S5GZ 4HREE 3D76A 2JPTA 5D7FA 3L4LA 3O4YA 4ZCUA 3JVTC 4MLWA 2KGRA 3D10A 1J7RA 2K7CA 1NWDA 1YTZC 5FYXA 1LXFC 1Y1UA 2BE6A 1B1GA 2F33A 1L2OC 3BUXB 1OQPA 4AQJA 1F8HA 1JWDA 3D0YA 2LLTA 4PHMA 1CFDA 4USLA 1CNPA 3DF0A 1DJYA 2KPHA 2PVBA 3O6BA 2AMIA 1VRKA 2V53A 4MZKA 2M9GA 3R1OA 3CZ2A 3VRRA 3B7AA 1KCYA 4YBHB 3EKJA 3BUWB 1WLMA 1QV0A 3NHIA 1KQMB
chains in the Genus database with same CATH topology
3VB1A 1OOIX 5DICA 3OGNA 3QMEA 3B88A 2PQLA 1TWOA 3B6XA 3V2LA 4PT1A 4OZDA 1T14A 3D74A 4JD9A 2QEOA 3CZ0A 3S0BA 2H8VA 3B86A 3CYZA 3BFAA 3NHTA 3D75A 3D73A 4INWA 1GM0A 3FE8A 3FE9A 1QWVA 2P70A 1DQEA 3BFHA 2JPOA 1LS8A 3Q8IA 3NGVA 3S0DA 3S0FA 3R1VA 3S0GA 2QEBA 2FJYA 3L4AA 3FE6A 3S0EA 3BFBA 2WCMA 2WCLA 2QEHA 1ORGA 1OOFA 2WC6A 3S0AA 5EL2A 3K1EA 1TUJA 1C3ZA 2WCJA 3DXLA 1OOGA 3N7HA 2ERBA 3R72A 1XFRA 2WC5A 4F7FA 3D77A 3D78A 2L2CA 2WCHA 3DYEA 4INXA 1P28A 3PJIA 3RZSA 1OOHA 1C3YA 3CZ1A 3CABA 2WCKA 3D76A 4FQTA 3B87A 1OW4A 2GTEA 2QEVA 3R1PA 3L47A 3CDNA 3BJHA 3DY9A 2KPHA 3R1OA 3CZ2A 3B7AA 2P71A 3DZTA 3L4LA 2QDIA 3NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VB1 A;  1OOI X;  5DIC A;  3OGN A;  3QME A;  3B88 A;  2PQL A;  1TWO A;  3B6X A;  3V2L A;  4PT1 A;  4OZD A;  1T14 A;  3D74 A;  4JD9 A;  2QEO A;  3CZ0 A;  3S0B A;  2H8V A;  3B86 A;  3CYZ A;  3BFA A;  3NHT A;  3D75 A;  3D73 A;  4INW A;  1GM0 A;  3FE8 A;  3FE9 A;  1QWV A;  2P70 A;  1DQE A;  3BFH A;  2JPO A;  1LS8 A;  3Q8I A;  3NGV A;  3S0D A;  3S0F A;  3R1V A;  3S0G A;  2QEB A;  2FJY A;  3L4A A;  3FE6 A;  3S0E A;  3BFB A;  2WCM A;  2WCL A;  2QEH A;  1ORG A;  1OOF A;  2WC6 A;  3S0A A;  5EL2 A;  3K1E A;  1TUJ A;  1C3Z A;  2WCJ A;  3DXL A;  1OOG A;  3N7H A;  2ERB A;  3R72 A;  1XFR A;  2WC5 A;  4F7F A;  3D77 A;  3D78 A;  2L2C A;  2WCH A;  3DYE A;  4INX A;  1P28 A;  3PJI A;  3RZS A;  1OOH A;  1C3Y A;  3CZ1 A;  3CAB A;  2WCK A;  3D76 A;  4FQT A;  3B87 A;  1OW4 A;  2GTE A;  2QEV A;  3R1P A;  3L47 A;  3CDN A;  3BJH A;  3DY9 A;  2KPH A;  3R1O A;  3CZ2 A;  3B7A A;  2P71 A;  3DZT A;  3L4L A;  2QDI A;  3NHI A; 
#chains in the Genus database with same CATH topology
 4AOM A;  1TIZ A;  3CGA A;  4OR9 B;  1IH0 A;  2LUC A;  2HQ8 A;  3VB1 A;  2A4J A;  1SL8 A;  2EC6 B;  3FIA A;  3LCP C;  4CFQ A;  3CTN A;  5AFP A;  2PSR A;  1TWO A;  2LAN A;  1YVL A;  1SR6 B;  4OZD A;  3SG6 A;  1CDN A;  4XJK B;  1DJZ A;  1DJW A;  2QEO A;  1IIO A;  1RK9 A;  4YGC B;  1G4Y R;  3FS7 A;  4IJ7 A;  3IVT A;  1KK8 C;  2K61 A;  1N0Y A;  1SL7 A;  2BKH B;  3B86 A;  2CT9 A;  2KLE A;  3CYZ A;  3WHT B;  4PE0 A;  3I5I C;  3WHU B;  5FI2 A;  2KAX A;  1BOC A;  1KSO A;  3I5G C;  2WOS A;  3D73 A;  1QX5 B;  1WLZ A;  2NXQ A;  4CLN A;  3ZNI A;  4INW A;  1OSA A;  1ZUZ A;  2K0J A;  1MUX A;  3BXK A;  3DVE A;  1ZMZ A;  2GV5 A;  3EKH A;  4GGF C;  1FPW A;  2F3Y A;  2WCF A;  3BOW A;  1TTX A;  5AEQ A;  2JTT A;  1R6P A;  1B9A A;  1IQ3 A;  1LIN A;  1B8C A;  4I5N B;  1NCZ A;  1LS8 A;  2IS9 A;  2K60 A;  2LM5 A;  3Q8I A;  1XK4 A;  2Y1M A;  1PRW A;  4I5J A;  4YI8 A;  3NGV A;  1DMO A;  3S0F A;  3R1V A;  4OKH A;  3JTD C;  3UO9 A;  4CFR A;  1A75 A;  1QAT A;  2QEB A;  1EL4 A;  4PHK A;  2FJY A;  2ZFD A;  3S0E A;  1OZO A;  1W7I B;  3SG2 A;  2MAZ A;  2BKI B;  3BFB A;  1FI5 A;  1XA5 A;  1DT7 B;  1YUS A;  4PE1 A;  2AUC A;  1CLL A;  2CNP A;  3D0Y B;  2WCL A;  5HLO A;  2BCB A;  4OVN F;  2RGI A;  4DIR A;  1XFZ O;  1EJ3 A;  3EVV A;  2KNE A;  2R2I A;  3IQO A;  5EL2 A;  1M46 A;  1WY9 A;  2L4H A;  1C3Z A;  2WCJ A;  1TN4 A;  2JC2 A;  3R72 A;  5CSF A;  1Y6W A;  2WC5 A;  4YI9 A;  1KQM C;  3D78 A;  5I94 A;  1CFP A;  3KHE A;  5DKR A;  1KK7 Y;  4MRX A;  2EC6 C;  1B7T Y;  1NUB A;  2K7B A;  3CS1 A;  3UNW A;  2L2C A;  2FOT A;  3QRX A;  2K2F A;  2ISD A;  4ICB A;  2Y4Q A;  3RM1 A;  3SG3 A;  5ER4 X;  1ZAC A;  1XVJ A;  1P28 A;  1SR6 C;  1TNW A;  3FWC A;  3PFV A;  2JT3 A;  1C7W A;  1GGW A;  1PSR A;  1Q80 A;  3OX6 A;  1PAL A;  2HPS A;  3PAL A;  4AQI A;  3DVM A;  1EH2 A;  2KI6 C;  3C1V A;  5ER5 A;  1OW4 A;  2MJW B;  3SIA A;  2HF5 A;  3GK2 A;  4WRI A;  3BQ3 A;  1S26 D;  2QEV A;  1CLM A;  1AJ4 A;  2O60 A;  2KDH A;  5HYD A;  1DF0 A;  4MZL A;  2M49 B;  3R1P A;  4NDB A;  2M1U A;  1NX2 A;  3BYA A;  4GGN A;  4JQ0 D;  1CFF A;  4A4C A;  4R1E A;  1WRK A;  4E68 A;  1UHK A;  1KQV A;  3RLZ A;  3DY9 A;  4OCI A;  5FI6 A;  1XFW O;  1ODB A;  1BR1 B;  2WND A;  4NQG A;  1CKK A;  1YUU A;  2LVV A;  1M45 A;  2YGU A;  2LAP A;  2AAO A;  3DZT A;  1QX7 A;  1J1D A;  4ZCV A;  1M31 A;  2Q91 A;  3AKA A;  1N65 A;  1SW8 A;  3H4S E;  1SY9 A;  2LMU A;  5PAL A;  2BCA A;  5DIC A;  2PAL A;  3OGN A;  1K93 D;  2PYQ A;  2I2R E;  1KFU L;  1V1F A;  3V2L A;  5CSJ A;  2LMV A;  4DRW A;  1N2D A;  1T14 A;  2EHB A;  2Y5I A;  3KF9 A;  1A29 A;  1IWQ A;  1DEL A;  2K8M B;  2KBI A;  5KTY A;  2M0R A;  1ALW A;  2KFF A;  2PAS A;  2H61 C;  5TNC A;  2F8P A;  2K7O A;  1NYA A;  2MBX A;  1DJX A;  1BLQ A;  1NX3 A;  2NCP A;  1S3P A;  2M97 A;  1TNP A;  2BBM A;  2CBL A;  2L4I A;  2ZKM X;  3TS5 B;  5AER A;  4HSZ A;  1BR4 B;  2F3Z A;  1GM0 A;  1G33 A;  3FE8 A;  1DJH A;  1AVS A;  1D1O A;  2LLU A;  3OB2 B;  1QWV A;  2P70 A;  1DQE A;  2CXJ A;  1K9U A;  2SCP A;  3SS4 A;  1QS7 A;  2L2E A;  1DGU A;  1B8L A;  4YRU A;  1XO5 A;  3A8R A;  3GK1 A;  3MSE B;  1MXE A;  4QJ3 B;  1CM1 A;  2KBM A;  3OX5 A;  5IBW A;  3CLN A;  2KI4 B;  1KSM A;  3CR5 X;  4PE4 A;  4U8D A;  5FI7 A;  1C07 A;  1NX0 A;  2Q4U A;  1NIW A;  1K90 D;  4A4B A;  2M29 A;  2WCM A;  3PLF B;  1Z4H A;  1BJF A;  5KU1 A;  4YGE B;  1NP8 A;  1F4O A;  1XYD A;  1LKJ A;  1LVC D;  2QEH A;  3SIB A;  2LUX A;  1S5G Y;  1JF0 A;  2WC6 A;  4C0L A;  5I2O A;  3EK8 A;  3E3R A;  2BAP A;  1CDP A;  3GOF A;  4JWQ A;  2QAC A;  1NX1 A;  4N5X A;  3NSL A;  3OB1 B;  3TDI A;  1SNL A;  2OPO A;  1SK6 D;  5B8I B;  3IQQ A;  1UUR A;  2LCP A;  2O5G A;  1SCV A;  4MBE A;  4P2Y B;  1TCF A;  4PHN A;  2NZ0 A;  2ZN9 A;  4M2O A;  3EG5 B;  1U5I A;  3I5H B;  1HT9 A;  1M39 A;  4MN0 A;  3BUO B;  5KSZ A;  2K7D A;  4GFT A;  3DVK A;  1L7Z A;  1JSA A;  3TDU A;  3VRP A;  1F71 A;  1BMO A;  2MRD A;  1WRL A;  3DF0 B;  1C3Y A;  4XYN A;  2HQW A;  1CDL A;  2PRU A;  3CZ1 A;  1J1E A;  1X02 A;  1XFY O;  1XFV O;  1QVI Z;  2I18 A;  2P6B B;  1GGZ A;  2F2O A;  5GQQ C;  2LP3 A;  2LVK A;  2KFG A;  1IJ5 A;  3TS5 C;  1K2H A;  4L9M A;  1QV1 A;  2CTN A;  1FW4 A;  2GTE A;  2OS8 B;  3A4U B;  1FBV A;  3AAJ A;  1C7V A;  1K95 A;  4CPV A;  2JNX A;  2M7L A;  2KHN A;  2TN4 A;  3EVR A;  3K21 A;  3EVU A;  2L5Y A;  3CDN A;  2G9B A;  4GGF A;  4IL1 A;  1ALV A;  3TZ1 A;  2M8U A;  5D69 A;  4BY4 A;  1J7Q A;  4CID A;  1Y1X A;  5BPJ A;  1BU3 A;  1LA3 A;  1QAS A;  1RFJ A;  2ZNE A;  1PVA A;  1WDC B;  2JZI A;  1IJ6 A;  1QLK A;  3BUM B;  2KI4 C;  2QDI A;  5HKW A;  1EG4 A;  1PUL A;  4YGB B;  5HLV A;  5I8N A;  1OOI X;  2LLS A;  1SKT A;  3SJS A;  1OE9 B;  1B4C A;  4DCK A;  3B88 A;  2PQL A;  1F4Q A;  4ORA B;  2MLF C;  2JT8 A;  3WNX B;  2LVI A;  3BOW B;  3D74 A;  2F2P A;  1QLS A;  4QJ5 B;  2FCE A;  2KSP A;  2E30 A;  4ETO A;  4JKT A;  1AJ5 A;  1XFU O;  2M7N A;  5J3X A;  2KGB C;  4MVF A;  2JRF A;  2JWW A;  4P5O E;  3SG7 A;  3KPX A;  3BFA A;  3PM2 A;  3SS5 A;  4MEW A;  1NCX A;  5DKN A;  1OOJ A;  2EGD A;  1A75 B;  4KYN A;  1CM4 A;  1F70 A;  1PK0 D;  1Z2C B;  3SS3 A;  1JF2 A;  3I5H C;  3O4X A;  1SCM B;  1REC A;  2JOJ A;  3FE9 A;  2L0P A;  4M2Q A;  3CR4 X;  4NDD A;  2LVJ A;  2M3W A;  2QPT A;  4XJK A;  4GPL B;  1J7P A;  2BE4 A;  1Y0V H;  1PVB A;  1DEK A;  2G2B A;  1YX7 A;  3SG4 A;  1DVI A;  3S0D A;  1OMD A;  3EK4 A;  2VRG A;  3NXA A;  5HKY A;  2JTZ A;  3CR2 A;  2Y1N A;  3FE6 A;  1OMV A;  1WRZ A;  1LA0 A;  1DTL A;  2BL0 B;  2LV7 A;  1H4B A;  2OS8 C;  1K94 A;  3ICB A;  5CPV A;  1BOD A;  3I5F B;  1SRA A;  2WCE A;  1V1G A;  3LK0 A;  3OBV A;  1DGV A;  1MXL C;  1PSB A;  2MLE C;  3S0A A;  2L98 A;  4BY5 A;  2OTG B;  4DUQ A;  1A03 A;  1JFK A;  1SMG A;  1TUJ A;  1WDC C;  2JU0 A;  3DXL A;  1OOG A;  3LL8 B;  2ERB A;  5HKZ A;  5AXI A;  4FTG A;  2PMY A;  3D77 A;  1S6J A;  3OHM B;  4QJ4 B;  4PDZ A;  4JPZ B;  5I2Q A;  2JUL A;  1NPQ A;  5G08 A;  1M63 B;  1SSE B;  1GJY A;  2WCB A;  2DOQ A;  4F0Z B;  4UPG A;  3NSO A;  2WCH A;  1S6C A;  1RTP 1;  3DYE A;  1DF0 B;  2BNX A;  4WQ2 A;  4YGD B;  2GGM A;  4INX A;  5I2L A;  1F55 A;  1CTR A;  1Y1A A;  2M1K B;  3EK7 A;  4GBA A;  1QX2 A;  1S6I A;  1UHN A;  5F6T A;  2I94 A;  3GK4 X;  3RZS A;  2KOT A;  1GQM A;  1K9P A;  1RWY A;  2KAY A;  4D1E A;  1XK4 C;  2H61 A;  2NCO A;  1S36 A;  2FJU B;  3VGO A;  4FQT A;  3B87 A;  4MZJ A;  1EXR A;  1F54 A;  1SL9 A;  1NSH A;  3SG5 A;  1CMG A;  3IF7 A;  1HQV A;  1QXP A;  1SBJ A;  5JJG A;  1J7O A;  3PM8 A;  3KO0 A;  2L5X B;  1IG5 A;  3L47 A;  4ORB B;  1SCM C;  3HCM A;  2MA2 A;  4I5K A;  4I5L B;  4M2P A;  1ZOT B;  1K96 A;  3BJH A;  1KWO B;  4GUK A;  1YVH A;  3PN7 B;  5CSN A;  5HL1 A;  1BF5 A;  2JXC A;  3NSK A;  3VRO A;  1KK7 Z;  1B7T Z;  5D3O A;  3FWB A;  4MRY A;  1CLB A;  2D8N A;  4GNK B;  2P71 A;  2L50 A;  4TNC A;  2WOR A;  1QTX A;  3PSR A;  1YR5 A;  2BL0 C;  1YRT B;  4HRH A;  4PHJ A;  1AK8 A;  1MF8 B;  3I5F C;  1TUZ A;  3BUN B;  3CWG A;  1MWN A;  3LLE A;  3QME A;  2LHI A;  4MSP A;  3B6X A;  1H8B A;  1JUO A;  2LNK A;  1TRF A;  2BBN A;  2JXL A;  4PT1 A;  3LK1 A;  1A2X A;  1JFJ A;  1TOP A;  4JD9 A;  1AHR A;  2LP2 A;  1DJI A;  2OTG C;  1UWO A;  1NCY A;  3CZ0 A;  4ORC B;  1CB1 A;  2B1U A;  3S0B A;  2BEC A;  2ZN8 A;  1BT6 A;  1MHO A;  4NDC A;  1K9K A;  2H8V A;  3TUY B;  3VRN A;  1CMF A;  1QJT A;  2JT0 A;  3NHT A;  1B47 A;  5K89 A;  2L51 A;  3JVT B;  5AAN A;  2LHL A;  3D75 A;  4Q04 A;  1EG3 A;  2I7A A;  1K8U A;  2LC5 A;  3ZWH A;  1IQ5 A;  4GAO A;  4PE7 A;  1DJG A;  4YGA A;  4C0K A;  1L2O B;  3BFH A;  4PAL A;  3WXA A;  2JPO A;  2KAV A;  2KI6 D;  1QIW A;  1MR8 A;  3O78 A;  1RRO A;  1TNX A;  5CSI A;  3PAT A;  3DVJ A;  1J55 A;  3S0G A;  4N1G A;  1IGV A;  3TDZ A;  2ZRS A;  1DC1 A;  1YRU B;  2LMT A;  2ZND A;  2LE9 B;  1OMR A;  2KQ6 A;  3L4A A;  4OV2 A;  2K2A A;  1YUR A;  2E6W A;  1IKU A;  1G8I A;  1JBA A;  3VRQ A;  1FF1 A;  1U5I B;  2HET A;  1RJV A;  2KQY A;  1XFX O;  3AKB A;  4N1F A;  2KLD A;  1QVI Y;  1KFX S;  3AAK A;  2FCD A;  1ORG A;  1OOF A;  2KFH A;  1KWO C;  3PN7 C;  1R2U A;  2WC8 A;  1CFC A;  1B8R A;  3K1E A;  4DS7 A;  4FQO A;  1BG1 A;  1UHI A;  2JQ6 A;  1S1E A;  1AP4 A;  1KK8 B;  1W9Z A;  3N7H A;  1XFR A;  4F7F A;  2CCM A;  1A4P A;  1MQ1 A;  3O2P A;  1KFX L;  2GGZ A;  3CZT X;  1UP5 A;  5JOL A;  3I5I B;  1AUI B;  1SYM A;  1OZS A;  3HX4 A;  3I5G B;  5DKQ A;  3M0W A;  3OP0 A;  2MHH A;  3F45 A;  2SAS A;  1ZFS A;  2KYC A;  3NSI A;  2BCX A;  4WQ3 A;  1TCO B;  4HRG A;  1UHJ A;  1KFU S;  1W7J B;  1FI6 A;  2COL B;  1CDM A;  1SPY A;  3PJI A;  1E8A A;  1IRJ A;  1YX8 A;  2ZRT A;  1UUS A;  3DD4 A;  1YUT A;  1OOH A;  3KEV A;  1QIV A;  2NLN A;  1TNQ A;  4C0J A;  1UHH A;  2JNF A;  3CAB A;  2KYF A;  2WCK A;  3JTD B;  3TUY C;  1JC2 A;  2H2K A;  4PCW A;  1S5G Z;  4HRE E;  3D76 A;  2JPT A;  5D7F A;  3L4L A;  3O4Y A;  4ZCU A;  3JVT C;  4MLW A;  2KGR A;  3D10 A;  1J7R A;  2K7C A;  1NWD A;  1YTZ C;  5FYX A;  1LXF C;  1Y1U A;  2BE6 A;  1B1G A;  2F33 A;  1L2O C;  3BUX B;  1OQP A;  4AQJ A;  1F8H A;  1JWD A;  3D0Y A;  2LLT A;  4PHM A;  1CFD A;  4USL A;  1CNP A;  3DF0 A;  1DJY A;  2KPH A;  2PVB A;  3O6B A;  2AMI A;  1VRK A;  2V53 A;  4MZK A;  2M9G A;  3R1O A;  3CZ2 A;  3VRR A;  3B7A A;  1KCY A;  4YBH B;  3EKJ A;  3BUW B;  1WLM A;  1QV0 A;  3NHI A;  1KQM B; 
#chains in the Genus database with same CATH homology
 3VB1 A;  1OOI X;  5DIC A;  3OGN A;  3QME A;  3B88 A;  2PQL A;  1TWO A;  3B6X A;  3V2L A;  4PT1 A;  4OZD A;  1T14 A;  3D74 A;  4JD9 A;  2QEO A;  3CZ0 A;  3S0B A;  2H8V A;  3B86 A;  3CYZ A;  3BFA A;  3NHT A;  3D75 A;  3D73 A;  4INW A;  1GM0 A;  3FE8 A;  3FE9 A;  1QWV A;  2P70 A;  1DQE A;  3BFH A;  2JPO A;  1LS8 A;  3Q8I A;  3NGV A;  3S0D A;  3S0F A;  3R1V A;  3S0G A;  2QEB A;  2FJY A;  3L4A A;  3FE6 A;  3S0E A;  3BFB A;  2WCM A;  2WCL A;  2QEH A;  1ORG A;  1OOF A;  2WC6 A;  3S0A A;  5EL2 A;  3K1E A;  1TUJ A;  1C3Z A;  2WCJ A;  3DXL A;  1OOG A;  3N7H A;  2ERB A;  3R72 A;  1XFR A;  2WC5 A;  4F7F A;  3D77 A;  3D78 A;  2L2C A;  2WCH A;  3DYE A;  4INX A;  1P28 A;  3PJI A;  3RZS A;  1OOH A;  1C3Y A;  3CZ1 A;  3CAB A;  2WCK A;  3D76 A;  4FQT A;  3B87 A;  1OW4 A;  2GTE A;  2QEV A;  3R1P A;  3L47 A;  3CDN A;  3BJH A;  3DY9 A;  2KPH A;  3R1O A;  3CZ2 A;  3B7A A;  2P71 A;  3DZT A;  3L4L A;  2QDI A;  3NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...