1MF8B

Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Calcineurin Complexed with Cyclosporin a and Human Cyclophilin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mf8B00
4CFRA 1BJFA 1YUSA 1KCYA 2LLSA 1CNPA 2BBMA 1NPQA 2FJUB 3CLNA 3VROA 4YRUA 1PVAA 3SJSA 4DUQA 1FW4A 1YVLA 2NLNA 1YVHA 3TUYB 2JZIA 3VRQA 1QIVA 3HCMA 4FQOA 2KBIA 4DS7A 1TCOB 1UURA 2KDHA 4PDZA 3BUNB 3LCPC 2DOQA 2KQ6A 2M0RA 1MHOA 1F4QA 1XFVO 3CS1A 1CDLA 2LP2A 3SG7A 2LVJA 4AQJA 1NCZA 1IG5A 1NX3A 1L2OB 1V1GA 2NXQA 3IQOA 4ORBB 4OKHA 2G2BA 1J7OA 1DJYA 1OZSA 1BR1B 2A4JA 2K0JA 3BOWB 1WDCC 3NSKA 3SG2A 3PN7C 3TUYC 3BXKA 2KFHA 2PVBA 3WNXB 1DJXA 4F0ZB 1KK8C 1MQ1A 1M39A 3DVEA 5HLOA 4WQ3A 1CKKA 2E6WA 1LXFC 4UPGA 1Y1XA 1B8CA 4QJ3B 1QIWA 2GV5A 4PE0A 3KPXA 4YI8A 1MWNA 1FF1A 3I5HC 1B8LA 1GQMA 5I2OA 1S36A 2V53A 1OOJA 3I5GC 5ER4X 4MRYA 2WORA 1NX2A 1QX2A 2KSPA 1RJVA 2Y5IA 1S6CA 5DKRA 1XA5A 1XFWO 3KEVA 1K2HA 4I5NB 3GK4X 1PRWA 2KI4C 4TNCA 2WOSA 2KAXA 1SMGA 2KYFA 1RROA 2F2PA 1HQVA 3OX6A 4NQGA 4PHJA 2Y1MA 1VRKA 2GGMA 4E68A 1NCXA 1SW8A 1XFYO 3TDZA 4C0LA 2KHNA 1ZUZA 3DD4A 1XK4A 2F3ZA 5AXIA 1AUIB 1S3PA 2JT3A 4MZJA 3NSOA 4GGFC 2HQWA 2K2FA 1Y1AA 3GOFA 5KSZA 1NSHA 2AAOA 5CSIA 1DMOA 2MLFC 2PASA 2KNEA 5I8NA 1N2DA 2H61C 2M97A 2L51A 4FTGA 2R2IA 2G9BA 1TIZA 1R2UA 1YUUA 2HETA 4M2QA 3K21A 2OPOA 1BOCA 1DJHA 1KK7Y 1DGUA 1RTP1 1V1FA 2JPTA 1UP5A 1M63B 1OE9B 1SK6D 1G33A 1R6PA 3PM8A 1J7PA 4PHMA 1AVSA 4I5LB 1YX8A 5HLVA 5JOLA 3OX5A 5HKWA 2KGRA 2B1UA 2JU0A 3O2PA 4P5OE 2M9GA 4GNKB 4USLA 2LLUA 1WY9A 4YI9A 5HKYA 1YTZC 1NCYA 4C0JA 1CFPA 2PSRA 2CXJA 1SR6B 5KTYA 2LVVA 2ZRTA 1DF0B 4XYNA 1PVBA 2M3WA 2K7BA 5CPVA 2LMTA 2KAYA 2WCBA 1TCFA 3PSRA 1L7ZA 3M0WA 2L50A 2NCOA 5JJGA 2KAVA 3A4UB 1JFJA 1MXLC 1KSMA 4OVNF 2TN4A 3CR2A 3VRPA 3PFVA 2F3YA 4BY4A 2OS8C 3SG3A 2JXCA 5AFPA 1A03A 1IRJA 4NDBA 1KFUL 3KO0A 1QVIZ 2BE6A 4N5XA 2MRDA 1LVCD 4OCIA 1BU3A 1NX0A 3TDIA 1K95A 2KFGA 1N65A 3IQQA 3EKJA 1J55A 1ZFSA 3CGAA 3FWCA 2KGBC 1CFCA 3D0YA 1EH2A 5GQQC 3O4YA 4PHNA 1BG1A 4MVFA 1CDNA 1NYAA 4PHKA 2K7OA 1KFUS 2KQYA 2LHLA 1PSRA 1NIWA 1SL7A 2MAZA 3SIBA 1K8UA 1SCMB 1OMDA 2EHBA 1OZOA 1QX7A 3DF0A 3I5IC 1ZACA 1MXEA 1S5GY 1FPWA 1G4YR 3PALA 4U8DA 2QPTA 4PALA 2F2OA 2ZNDA 2JRFA 4DCKA 2OTGB 1JFKA 1W7JB 4WRIA 3OHMB 3JTDB 5DKQA 1DGVA 2WCEA 3NSLA 3OB2B 4GGFA 1S6JA 1PALA 3BOWA 1OMVA 1ZMZA 1CLLA 3WHUB 1MUXA 2KBMA 4GAOA 1QATA 2L2EA 2M29A 1OMRA 1DJWA 4I5KA 4GFTA 1MF8B 1UHIA 4JQ0D 2BCAA 1CMFA 2PALA 1KSOA 1SCMC 4WQ2A 1SBJA 3RLZA 1H4BA 2WNDA 4YGCB 3LL8B 2M7NA 3PLFB 4NDDA 2KI4B 4A4CA 3ZNIA 4AOMA 2MLEC 2K61A 1M31A 2JOJA 2K7CA 1XO5A 1YX7A 1SNLA 2CTNA 1X02A 2RGIA 3FS7A 1KQVA 4ORCB 1XVJA 3CWGA 5K89A 3E3RA 5FYXA 2KYCA 2MJWB 1TNPA 1ODBA 1EXRA 3CR4X 3FIAA 2O5GA 4I5JA 1JBAA 2I18A 3ZWHA 2IS9A 2CCMA 4M2PA 1JWDA 3SG4A 5CSNA 4JPZB 2H2KA 4YGAA 1S1EA 2LAPA 1QXPA 1YR5A 1QV1A 2Q91A 4GUKA 2LUCA 2LM5A 3BQ3A 4MZLA 4CFQA 5ER5A 5BPJA 1NWDA 1TN4A 2LCPA 4R1EA 3SG5A 1B4CA 5D69A 3AAJA 1UHKA 2L5XB 1GGWA 2PRUA 2Q4UA 5D7FA 1F70A 2LP3A 1J7QA 4C0KA 2LC5A 5CSFA 4D1EA 2MA2A 1TNQA 1QASA 2BL0C 2M1UA 2NCPA 1BT6A 2BCBA 3VRNA 1C7WA 2JNXA 5F6TA 1C7VA 1IQ3A 2F33A 3NSIA 2EGDA 1OSAA 1AK8A 1J1DA 4PE4A 1M45A 1ZOTB 1W7IB 1K9KA 5J3XA 2BCXA 2LMVA 2M1KB 2ZKMX 2MBXA 2OTGC 2VRGA 2LVKA 4XJKA 2KI6D 3PN7B 3JVTB 5B8IB 1F55A 1TOPA 1BODA 1AJ5A 2KOTA 1FI5A 1SRAA 2ZFDA 1QTXA 2L4HA 3EK8A 2M7LA 1TNXA 4ORAB 5HKZA 1GJYA 1CLMA 1OQPA 1YRTB 2I2RE 4HRGA 1UHHA 1QJTA 1WRLA 1Y6WA 3A8RA 3ICBA 5G08A 3LK0A 1DJIA 1F4OA 4OV2A 1F71A 1IH0A 1WLZA 4ZCUA 1XFZO 1QV0A 1Q80A 2JTTA 3EVVA 1SL9A 1K9PA 1SPYA 4MSPA 4XJKB 2H61A 1AJ4A 1SKTA 1KK7Z 2ZN9A 1G8IA 2LLTA 1CM4A 2JC2A 2WCFA 1XFUO 1H8BA 2BKHB 1RFJA 1YRUB 4N1GA 1A4PA 1L2OC 1LA0A 2Y4QA 4DIRA 4MRXA 1SY9A 3DVMA 2FCDA 5DKNA 3D0YB 3GK1A 4HRHA 3MSEB 2AUCA 1B8RA 1GGZA 1UHNA 4BY5A 4MBEA 3TS5B 2JTZA 3GK2A 1SCVA 1CLBA 2F8PA 1KWOB 1K9UA 2HF5A 5HYDA 4IL1A 4MN0A 2MHHA 1QS7A 3DF0B 1KK8B 4AQIA 1BLQA 1B9AA 4MLWA 1TNWA 1Y1UA 5CSJA 4PE7A 3OB1B 3QRXA 3BUXB 1K94A 1PULA 1A75B 4ICBA 1JF0A 1JUOA 1DJGA 4HREE 1JC2A 3EK4A 2JXLA 2KI6C 1JSAA 3CTNA 2HPSA 2I94A 3WXAA 3WHTB 3HX4A 2E30A 4ZCVA 3RM1A 3AAKA 3I5FB 1A29A 1IWQA 1QVIY 4YBHB 2LV7A 1TTXA 1B7TZ 2JT0A 3CR5X 4PE1A 1B47A 1N0YA 2SCPA 3H4SE 3TS5C 2LHIA 4PCWA 1S6IA 3VRRA 1CDMA 1E8AA 5I2QA 1A75A 1CM1A 1HT9A 2L0PA 3BUWB 4CIDA 1DTLA 2EC6B 1IJ6A 5TNCA 1ALVA 2NZ0A 1XYDA 3F45A 2JWWA 1UUSA 3LK1A 1KQMC 1CFDA 2D8NA 1RECA 2JQ6A 4NDCA 2WC8A 3C1VA 1WRKA 2PMYA 2HQ8A 3IF7A 1K96A 3DVKA 3TDUA 3FWBA 1CTRA 2Y1NA 2K8MB 1YURA 1M46A 1WLMA 4M2OA 4GBAA 1F54A 1PSBA 2AMIA 1KWOC 1SL8A 5AEQA 1KFXL 2EC6C 4CPVA 1F8HA 1K90D 1WDCB 3I5HB 2M8UA 1UWOA 2CNPA 1B1GA 1NX1A 2FOTA 4MEWA 1EG4A 4DRWA 1RK9A 2BL0B 1EG3A 1JF2A 2LUXA 4CLNA 1A2XA 3EVUA 2ISDA 1IGVA 3AKBA 2M49B 1D1OA 1AP4A 2CT9A 1S26D 3VGOA 2FCEA 1U5IA 2LANA 2JNFA 4N1FA 4ETOA 4MZKA 2COLB 1EJ3A 3O6BA 5AANA 4YGDB 1QLKA 1UHJA 2LMUA 1LKJA 3I5IB 3JTDC 3I5GB 5PALA 2BBNA 2ZNEA 3KF9A 1CDPA 4GGNA 2L98A 2K7DA 1J1EA 1PK0D 1BR4B 4YGBB 1IQ5A 3O78A 4GPLB 5I2LA 4A4BA 2BECA 5AERA 1CB1A 3KHEA 3I5FC 1C07A 4L9MA 1KFXS 3LLEA 3DVJA 2ZN8A 1U5IB 1CMGA 2GGZA 1BF5A 2LE9B 1BMOA 1CFFA 2BE4A 4YGEB 3SIAA 1YUTA 5IBWA 3EKHA 5KU1A 1RWYA 1IKUA 1DVIA 2ZRSA 1NP8A 2KFFA 1SYMA 3PATA 3SG6A 1FBVA 2O60A 1EL4A 1QX5B 2BKIB 4P2YB 3BYAA 1Y0VH 1KQMB 2L4IA 3AKAA 4QJ5B 3EK7A 1DF0A 2CBLA 4QJ4B 2JT8A 1DJZA 1IJ5A 1LA3A 1K93D 2JULA 3OP0A 4JWQA 3TZ1A 3D10A 1XFXO 2LVIA 1S5GZ 1TRFA 1DT7B 1B7TY 2K2AA 3BUMB 4HSZA 1ALWA 1LINA 2SASA 3CZTX 1MR8A 1AHRA 1SR6C 2LNKA 1QLSA 1J7RA 3BUOB 2P6BB 1FI6A 2QACA 3JVTC 1XK4C 3NXAA 4OR9B 3EVRA 2OS8B 4Q04A 1WRZA 1NUBA 2I7AA
chains in the Genus database with same CATH superfamily
4CFRA 1BJFA 1YUSA 1KCYA 2LLSA 1CNPA 2BBMA 1NPQA 2FJUB 3CLNA 3VROA 4YRUA 1PVAA 1OOGA 2WCMA 3SJSA 4DUQA 1FW4A 1Z2CB 3D77A 1YVLA 2NLNA 1YVHA 3TUYB 3B6XA 2JZIA 3VRQA 3D76A 1QIVA 3HCMA 4FQOA 2KBIA 4DS7A 1TCOB 1UURA 2KDHA 4JD9A 4PDZA 3BUNB 3LCPC 2DOQA 2KQ6A 2M0RA 1MHOA 1F4QA 1XFVO 3CS1A 1CDLA 2JPOA 2LP2A 3SG7A 2LVJA 4AQJA 1NCZA 1IG5A 1NX3A 1L2OB 1V1GA 2NXQA 3IQOA 4ORBB 4OKHA 2G2BA 1J7OA 1DJYA 1OZSA 1BR1B 2A4JA 2K0JA 3BOWB 1WDCC 3NSKA 3SG2A 3PN7C 3TUYC 3BXKA 2KFHA 2PVBA 5HL1A 3WNXB 3B87A 1DJXA 2L5YA 4F0ZB 1KK8C 1MQ1A 1M39A 3DVEA 5HLOA 4WQ3A 1CKKA 2E6WA 1LXFC 4UPGA 1Y1XA 1B8CA 4QJ3B 1QIWA 2GV5A 4PE0A 3KPXA 4YI8A 1MWNA 1FF1A 3I5HC 1B8LA 1GQMA 5I2OA 1S36A 2V53A 1OOJA 3I5GC 5ER4X 4MRYA 3FE9A 2WORA 1NX2A 1QX2A 2KSPA 1RJVA 2Y5IA 1S6CA 5DKRA 1XA5A 1XFWO 3N7HA 3KEVA 1K2HA 1XFRA 3CZ1A 4I5NB 3GK4X 1DEKA 1PRWA 2KI4C 4TNCA 2WOSA 2KAXA 5FI7A 1SMGA 2KYFA 1RROA 2BAPA 2F2PA 3BFHA 1HQVA 3OX6A 4JKTA 4NQGA 2Y1MA 4PHJA 1TUZA 1VRKA 2GGMA 4E68A 1NCXA 1SW8A 1XFYO 3TDZA 4C0LA 2KHNA 1ZUZA 3DD4A 1XK4A 2F3ZA 5AXIA 1AUIB 1S3PA 2JT3A 4MZJA 3NSOA 3QMEA 4GGFC 2HQWA 3S0FA 2K2FA 1Y1AA 3GOFA 5KSZA 1NSHA 2AAOA 2QEBA 5CSIA 1DMOA 1QWVA 2MLFC 2PASA 2KNEA 5I8NA 3K1EA 1N2DA 2H61C 2M97A 3BFAA 2L51A 3OGNA 4FTGA 2R2IA 2G9BA 1TIZA 1Z4HA 1R2UA 1YUUA 2HETA 4M2QA 1TWOA 2OPOA 3K21A 1DJHA 1KK7Y 1DGUA 1RTP1 1V1FA 2JPTA 3S0EA 1UP5A 1M63B 2KPHA 1OE9B 1SK6D 1G33A 1R6PA 3PM8A 1J7PA 4PHMA 1AVSA 4I5LB 1YX8A 5HLVA 5JOLA 3OX5A 1C3YA 1P28A 5HKWA 2KGRA 2B1UA 2JU0A 3O2PA 4P5OE 2M9GA 3CYZA 4GNKB 4USLA 2LLUA 1WY9A 4YI9A 5HKYA 1YTZC 1NCYA 4C0JA 1CFPA 2PSRA 2CXJA 1SR6B 5KTYA 2LVVA 2ZRTA 1DF0B 4XYNA 1PVBA 2M3WA 2K7BA 5CPVA 2LMTA 2KAYA 2QEOA 1TCFA 2WCBA 3PSRA 1L7ZA 3UO9A 3M0WA 2L50A 2NCOA 3PJIA 5JJGA 2KAVA 3A4UB 2QEVA 1JFJA 1MXLC 1KSMA 4OVNF 2WCKA 2TN4A 3CR2A 3VRPA 2K60A 2F3YA 3PFVA 4BY4A 2OS8C 3SG3A 2JXCA 5AFPA 1A03A 1IRJA 3FE8A 4NDBA 1KFUL 3KO0A 1QVIZ 2BE6A 3O4XA 4N5XA 2MRDA 1LVCD 4OCIA 3CZ0A 1BU3A 1NX0A 3TDIA 1K95A 2KFGA 4IJ7A 1N65A 3IQQA 3EKJA 1J55A 1ZFSA 3CGAA 3FWCA 2KGBC 3S0GA 1CFCA 3D0YA 1EH2A 2L2CA 5GQQC 3O4YA 4PHNA 1BG1A 4MVFA 1CDNA 1NYAA 3B86A 2K7OA 1KFUS 2KQYA 2LHLA 1PSRA 1NIWA 1SL7A 2MAZA 4PHKA 1K8UA 1SCMB 1OMDA 2EHBA 1OZOA 1QX7A 3DF0A 3I5IC 1OW4A 1ZACA 1MXEA 1S5GY 1FPWA 1G4YR 3PALA 4U8DA 2QPTA 4PALA 2F2OA 2ZNDA 1W9ZA 2JRFA 1BOCA 3NHIA 4DCKA 2OTGB 1JFKA 1W7JB 4WRIA 3OHMB 3JTDB 5DKQA 1DGVA 2WCEA 3NSLA 3OB2B 4GGFA 1S6JA 1PALA 3BOWA 1OMVA 1ZMZA 1CLLA 3WHUB 1MUXA 2KBMA 4GAOA 1QATA 2L2EA 2M29A 1OMRA 1DJWA 4I5KA 5I94A 4GFTA 1MF8B 1UHIA 4JQ0D 2BCAA 1CMFA 2PALA 1KSOA 1SCMC 4WQ2A 1SBJA 3RLZA 3CZ2A 1H4BA 2WNDA 2KLEA 4YGCB 3LL8B 2M7NA 3PLFB 4NDDA 2KI4B 4A4CA 3ZNIA 4AOMA 2MLEC 2K61A 1M31A 2JOJA 2K7CA 1XO5A 1YX7A 1SNLA 2CTNA 1X02A 2RGIA 3FS7A 1KQVA 4ORCB 1XVJA 3CWGA 5K89A 3E3RA 5FYXA 2KYCA 2MJWB 1TNPA 1ODBA 1EXRA 3CDNA 3CR4X 3FIAA 2O5GA 4I5JA 1JBAA 3S0DA 2I18A 3ZWHA 2IS9A 2CCMA 4M2PA 1JWDA 3SG4A 5CSNA 4JPZB 2H2KA 3D74A 1S1EA 2LAPA 4YGAA 2WC5A 1QXPA 3B88A 2GTEA 1YR5A 5D3OA 1QV1A 2Q91A 4GUKA 2LUCA 2LM5A 3BJHA 3BQ3A 4MZLA 4CFQA 5ER5A 5BPJA 1NWDA 1TN4A 2LCPA 4R1EA 3SG5A 1B4CA 5D69A 3AAJA 1UHKA 2L5XB 1GGWA 2PRUA 2Q4UA 5D7FA 1F70A 2LP3A 1J7QA 4C0KA 2LC5A 5CSFA 4D1EA 1DC1A 2MA2A 1TNQA 1QASA 2BL0C 4INXA 2M1UA 2NCPA 1BT6A 2BCBA 3VRNA 1C7WA 2JNXA 3L4AA 5F6TA 1C7VA 1IQ3A 2F33A 3NSIA 2EGDA 1OSAA 3PM2A 2H8VA 1AK8A 1J1DA 4PE4A 3S0BA 3DYEA 1M45A 3UNWA 1OOFA 1ZOTB 1W7IB 1K9KA 5J3XA 2BCXA 2WCHA 2LMVA 2M1KB 2ZKMX 2MBXA 2OTGC 2VRGA 2LVKA 3R72A 4PT1A 4XJKA 2KI6D 3RZSA 3PN7B 3JVTB 3R1PA 5B8IB 1F55A 1TOPA 1BODA 1AJ5A 2KOTA 1FI5A 1SRAA 2ZFDA 1QTXA 2L4HA 3EK8A 2M7LA 1TNXA 4ORAB 5HKZA 1GJYA 1CLMA 1OQPA 1YRTB 2I2RE 4HRGA 1UHHA 1QJTA 1WRLA 1Y6WA 3A8RA 3ICBA 5G08A 3LK0A 1DJIA 3OBVA 1F4OA 4OV2A 1F71A 1IH0A 3R1VA 1WLZA 4ZCUA 1XFZO 1QV0A 1Q80A 2JTTA 3EVVA 1SL9A 1K9PA 1SPYA 4MSPA 4XJKB 2H61A 1AJ4A 1SKTA 1KK7Z 2ZN9A 1G8IA 2LLTA 1CM4A 2JC2A 2WCFA 1XFUO 1H8BA 2BKHB 1RFJA 1YRUB 4N1GA 1A4PA 1L2OC 1LA0A 2Y4QA 4DIRA 4MRXA 3CABA 1SY9A 3DVMA 2FCDA 5DKNA 3D0YB 3GK1A 4HRHA 3MSEB 2AUCA 1B8RA 1GGZA 1UHNA 4BY5A 4MBEA 3TS5B 2JTZA 3GK2A 1SCVA 3D78A 1CLBA 2F8PA 2FJYA 4OZDA 1KWOB 1K9UA 2HF5A 5HYDA 4IL1A 2QEHA 2MHHA 1QS7A 3DF0B 4MN0A 1KK8B 4AQIA 2PYQA 1BLQA 1B9AA 4MLWA 1TNWA 1Y1UA 5CSJA 4PE7A 1DELA 3OB1B 3QRXA 3Q8IA 1GM0A 3BUXB 3SS5A 1K94A 1T14A 1PULA 1A75B 4ICBA 1JF0A 1JUOA 1DJGA 4HREE 1JC2A 3EK4A 2JXLA 2KI6C 1JSAA 3CTNA 2HPSA 2I94A 3WXAA 3WHTB 2PQLA 3HX4A 2E30A 4ZCVA 3RM1A 3AAKA 3I5FB 1A29A 1IWQA 1QVIY 4YBHB 2LV7A 1TTXA 1B7TZ 2JT0A 3CR5X 2BNXA 1B47A 4PE1A 1N0YA 2SCPA 3H4SE 1ORGA 3FE6A 2ERBA 3TS5C 2LHIA 4PCWA 1S6IA 5DICA 3SIBA 1CDMA 1E8AA 3VRRA 5I2QA 1A75A 1CM1A 1HT9A 2L0PA 3BUWB 3V2LA 1DTLA 4CIDA 2EC6B 1IJ6A 5TNCA 2WC6A 1ALVA 2NZ0A 1XYDA 3F45A 2JWWA 2P70A 4FQTA 1UUSA 3LK1A 1KQMC 1CFDA 2D8NA 1RECA 2JQ6A 4NDCA 2WC8A 3C1VA 1WRKA 2PMYA 2HQ8A 2YGUA 3IF7A 1K96A 3DVKA 3TDUA 3FWBA 1CTRA 2Y1NA 2K8MB 1YURA 1M46A 1WLMA 4M2OA 4GBAA 1F54A 1PSBA 2AMIA 3SS4A 1KWOC 1SL8A 5AEQA 1KFXL 2EC6C 4CPVA 2QDIA 1F8HA 1K90D 1WDCB 3I5HB 2M8UA 1UWOA 2CNPA 1B1GA 1NX1A 2FOTA 4MEWA 1EG4A 4DRWA 1RK9A 3L4LA 2BL0B 1EG3A 1JF2A 2LUXA 4CLNA 1A2XA 3EVUA 3VB1A 2ISDA 1IGVA 1LS8A 3AKBA 2M49B 1D1OA 1AP4A 2CT9A 1S26D 3D73A 2FCEA 1U5IA 3VGOA 2LANA 2JNFA 4N1FA 4ETOA 4MZKA 2COLB 1EJ3A 1TUJA 3O6BA 5AANA 1OOIX 4YGDB 1QLKA 1UHJA 2LMUA 1LKJA 3I5IB 2WCJA 3I5GB 3JTDC 5PALA 2BBNA 2ZNEA 3KF9A 1CDPA 3DY9A 3IVTA 4GGNA 2L98A 3R1OA 2K7DA 1J1EA 1OOHA 1PK0D 2WCLA 1BR4B 3NGVA 4YGBB 5FI2A 1IQ5A 3O78A 4GPLB 5I2LA 4A4BA 2BECA 3L47A 5AERA 2KLDA 1CB1A 3KHEA 5EL2A 3NHTA 3I5FC 1C07A 4L9MA 1KFXS 3LLEA 3DVJA 2ZN8A 1U5IB 3B7AA 1CMGA 1DQEA 2GGZA 1BF5A 2LE9B 1BMOA 3DZTA 1CFFA 2BE4A 4KYNA 4YGEB 3SIAA 1YUTA 5IBWA 3EKHA 5KU1A 1RWYA 1IKUA 1DVIA 2ZRSA 1NP8A 2KFFA 1SYMA 3PATA 3SG6A 1FBVA 1IIOA 2O60A 1EL4A 1QX5B 2BKIB 2P71A 3D75A 4P2YB 3BYAA 1Y0VH 1KQMB 2L4IA 3AKAA 3DXLA 4QJ5B 3EK7A 1DF0A 2CBLA 4QJ4B 2JT8A 1DJZA 1IJ5A 1LA3A 1K93D 2JULA 3OP0A 4JWQA 3TZ1A 5FI6A 3D10A 3S0AA 1XFXO 2LVIA 1S5GZ 1TRFA 4F7FA 1DT7B 1B7TY 2K2AA 3EG5B 3BUMB 4HSZA 1ALWA 4INWA 1LINA 3BFBA 2SASA 3CZTX 3SS3A 1MR8A 1AHRA 1SR6C 2LNKA 1QLSA 1J7RA 3BUOB 2P6BB 1SSEB 1FI6A 2QACA 3JVTC 1XK4C 3NXAA 4OR9B 1C3ZA 3EVRA 2OS8B 4Q04A 1WRZA 1NUBA 2I7AA
chains in the Genus database with same CATH topology
4CFRA 1BJFA 1YUSA 1KCYA 2LLSA 1CNPA 2BBMA 1NPQA 2FJUB 3CLNA 3VROA 4YRUA 1PVAA 3SJSA 4DUQA 1FW4A 1YVLA 2NLNA 1YVHA 3TUYB 2JZIA 3VRQA 1QIVA 3HCMA 4FQOA 2KBIA 4DS7A 1TCOB 1UURA 2KDHA 4PDZA 3BUNB 3LCPC 2DOQA 2KQ6A 2M0RA 1MHOA 1F4QA 1XFVO 3CS1A 1CDLA 2LP2A 3SG7A 2LVJA 4AQJA 1NCZA 1IG5A 1NX3A 1L2OB 1V1GA 2NXQA 3IQOA 4ORBB 4OKHA 2G2BA 1J7OA 1DJYA 1OZSA 1BR1B 2A4JA 2K0JA 3BOWB 1WDCC 3NSKA 3SG2A 3PN7C 3TUYC 3BXKA 2KFHA 2PVBA 3WNXB 1DJXA 4F0ZB 1KK8C 1MQ1A 1M39A 3DVEA 5HLOA 4WQ3A 1CKKA 2E6WA 1LXFC 4UPGA 1Y1XA 1B8CA 4QJ3B 1QIWA 2GV5A 4PE0A 3KPXA 4YI8A 1MWNA 1FF1A 3I5HC 1B8LA 1GQMA 5I2OA 1S36A 2V53A 1OOJA 3I5GC 5ER4X 4MRYA 2WORA 1NX2A 1QX2A 2KSPA 1RJVA 2Y5IA 1S6CA 5DKRA 1XA5A 1XFWO 3KEVA 1K2HA 4I5NB 3GK4X 1PRWA 2KI4C 4TNCA 2WOSA 2KAXA 1SMGA 2KYFA 1RROA 2F2PA 1HQVA 3OX6A 4NQGA 4PHJA 2Y1MA 1VRKA 2GGMA 4E68A 1NCXA 1SW8A 1XFYO 3TDZA 4C0LA 2KHNA 1ZUZA 3DD4A 1XK4A 2F3ZA 5AXIA 1AUIB 1S3PA 2JT3A 4MZJA 3NSOA 4GGFC 2HQWA 2K2FA 1Y1AA 3GOFA 5KSZA 1NSHA 2AAOA 5CSIA 1DMOA 2MLFC 2PASA 2KNEA 5I8NA 1N2DA 2H61C 2M97A 2L51A 4FTGA 2R2IA 2G9BA 1TIZA 1R2UA 1YUUA 2HETA 4M2QA 3K21A 2OPOA 1BOCA 1DJHA 1KK7Y 1DGUA 1RTP1 1V1FA 2JPTA 1UP5A 1M63B 1OE9B 1SK6D 1G33A 1R6PA 3PM8A 1J7PA 4PHMA 1AVSA 4I5LB 1YX8A 5HLVA 5JOLA 3OX5A 5HKWA 2KGRA 2B1UA 2JU0A 3O2PA 4P5OE 2M9GA 4GNKB 4USLA 2LLUA 1WY9A 4YI9A 5HKYA 1YTZC 1NCYA 4C0JA 1CFPA 2PSRA 2CXJA 1SR6B 5KTYA 2LVVA 2ZRTA 1DF0B 4XYNA 1PVBA 2M3WA 2K7BA 5CPVA 2LMTA 2KAYA 2WCBA 1TCFA 3PSRA 1L7ZA 3M0WA 2L50A 2NCOA 5JJGA 2KAVA 3A4UB 1JFJA 1MXLC 1KSMA 4OVNF 2TN4A 3CR2A 3VRPA 3PFVA 2F3YA 4BY4A 2OS8C 3SG3A 2JXCA 5AFPA 1A03A 1IRJA 4NDBA 1KFUL 3KO0A 1QVIZ 2BE6A 4N5XA 2MRDA 1LVCD 4OCIA 1BU3A 1NX0A 3TDIA 1K95A 2KFGA 1N65A 3IQQA 3EKJA 1J55A 1ZFSA 3CGAA 3FWCA 2KGBC 1CFCA 3D0YA 1EH2A 5GQQC 3O4YA 4PHNA 1BG1A 4MVFA 1CDNA 1NYAA 4PHKA 2K7OA 1KFUS 2KQYA 2LHLA 1PSRA 1NIWA 1SL7A 2MAZA 3SIBA 1K8UA 1SCMB 1OMDA 2EHBA 1OZOA 1QX7A 3DF0A 3I5IC 1ZACA 1MXEA 1S5GY 1FPWA 1G4YR 3PALA 4U8DA 2QPTA 4PALA 2F2OA 2ZNDA 2JRFA 4DCKA 2OTGB 1JFKA 1W7JB 4WRIA 3OHMB 3JTDB 5DKQA 1DGVA 2WCEA 3NSLA 3OB2B 4GGFA 1S6JA 1PALA 3BOWA 1OMVA 1ZMZA 1CLLA 3WHUB 1MUXA 2KBMA 4GAOA 1QATA 2L2EA 2M29A 1OMRA 1DJWA 4I5KA 4GFTA 1MF8B 1UHIA 4JQ0D 2BCAA 1CMFA 2PALA 1KSOA 1SCMC 4WQ2A 1SBJA 3RLZA 1H4BA 2WNDA 4YGCB 3LL8B 2M7NA 3PLFB 4NDDA 2KI4B 4A4CA 3ZNIA 4AOMA 2MLEC 2K61A 1M31A 2JOJA 2K7CA 1XO5A 1YX7A 1SNLA 2CTNA 1X02A 2RGIA 3FS7A 1KQVA 4ORCB 1XVJA 3CWGA 5K89A 3E3RA 5FYXA 2KYCA 2MJWB 1TNPA 1ODBA 1EXRA 3CR4X 3FIAA 2O5GA 4I5JA 1JBAA 2I18A 3ZWHA 2IS9A 2CCMA 4M2PA 1JWDA 3SG4A 5CSNA 4JPZB 2H2KA 4YGAA 1S1EA 2LAPA 1QXPA 1YR5A 1QV1A 2Q91A 4GUKA 2LUCA 2LM5A 3BQ3A 4MZLA 4CFQA 5ER5A 5BPJA 1NWDA 1TN4A 2LCPA 4R1EA 3SG5A 1B4CA 5D69A 3AAJA 1UHKA 2L5XB 1GGWA 2PRUA 2Q4UA 5D7FA 1F70A 2LP3A 1J7QA 4C0KA 2LC5A 5CSFA 4D1EA 2MA2A 1TNQA 1QASA 2BL0C 2M1UA 2NCPA 1BT6A 2BCBA 3VRNA 1C7WA 2JNXA 5F6TA 1C7VA 1IQ3A 2F33A 3NSIA 2EGDA 1OSAA 1AK8A 1J1DA 4PE4A 1M45A 1ZOTB 1W7IB 1K9KA 5J3XA 2BCXA 2LMVA 2M1KB 2ZKMX 2MBXA 2OTGC 2VRGA 2LVKA 4XJKA 2KI6D 3PN7B 3JVTB 5B8IB 1F55A 1TOPA 1BODA 1AJ5A 2KOTA 1FI5A 1SRAA 2ZFDA 1QTXA 2L4HA 3EK8A 2M7LA 1TNXA 4ORAB 5HKZA 1GJYA 1CLMA 1OQPA 1YRTB 2I2RE 4HRGA 1UHHA 1QJTA 1WRLA 1Y6WA 3A8RA 3ICBA 5G08A 3LK0A 1DJIA 1F4OA 4OV2A 1F71A 1IH0A 1WLZA 4ZCUA 1XFZO 1QV0A 1Q80A 2JTTA 3EVVA 1SL9A 1K9PA 1SPYA 4MSPA 4XJKB 2H61A 1AJ4A 1SKTA 1KK7Z 2ZN9A 1G8IA 2LLTA 1CM4A 2JC2A 2WCFA 1XFUO 1H8BA 2BKHB 1RFJA 1YRUB 4N1GA 1A4PA 1L2OC 1LA0A 2Y4QA 4DIRA 4MRXA 1SY9A 3DVMA 2FCDA 5DKNA 3D0YB 3GK1A 4HRHA 3MSEB 2AUCA 1B8RA 1GGZA 1UHNA 4BY5A 4MBEA 3TS5B 2JTZA 3GK2A 1SCVA 1CLBA 2F8PA 1KWOB 1K9UA 2HF5A 5HYDA 4IL1A 4MN0A 2MHHA 1QS7A 3DF0B 1KK8B 4AQIA 1BLQA 1B9AA 4MLWA 1TNWA 1Y1UA 5CSJA 4PE7A 3OB1B 3QRXA 3BUXB 1K94A 1PULA 1A75B 4ICBA 1JF0A 1JUOA 1DJGA 4HREE 1JC2A 3EK4A 2JXLA 2KI6C 1JSAA 3CTNA 2HPSA 2I94A 3WXAA 3WHTB 3HX4A 2E30A 4ZCVA 3RM1A 3AAKA 3I5FB 1A29A 1IWQA 1QVIY 4YBHB 2LV7A 1TTXA 1B7TZ 2JT0A 3CR5X 4PE1A 1B47A 1N0YA 2SCPA 3H4SE 3TS5C 2LHIA 4PCWA 1S6IA 3VRRA 1CDMA 1E8AA 5I2QA 1A75A 1CM1A 1HT9A 2L0PA 3BUWB 4CIDA 1DTLA 2EC6B 1IJ6A 5TNCA 1ALVA 2NZ0A 1XYDA 3F45A 2JWWA 1UUSA 3LK1A 1KQMC 1CFDA 2D8NA 1RECA 2JQ6A 4NDCA 2WC8A 3C1VA 1WRKA 2PMYA 2HQ8A 3IF7A 1K96A 3DVKA 3TDUA 3FWBA 1CTRA 2Y1NA 2K8MB 1YURA 1M46A 1WLMA 4M2OA 4GBAA 1F54A 1PSBA 2AMIA 1KWOC 1SL8A 5AEQA 1KFXL 2EC6C 4CPVA 1F8HA 1K90D 1WDCB 3I5HB 2M8UA 1UWOA 2CNPA 1B1GA 1NX1A 2FOTA 4MEWA 1EG4A 4DRWA 1RK9A 2BL0B 1EG3A 1JF2A 2LUXA 4CLNA 1A2XA 3EVUA 2ISDA 1IGVA 3AKBA 2M49B 1D1OA 1AP4A 2CT9A 1S26D 3VGOA 2FCEA 1U5IA 2LANA 2JNFA 4N1FA 4ETOA 4MZKA 2COLB 1EJ3A 3O6BA 5AANA 4YGDB 1QLKA 1UHJA 2LMUA 1LKJA 3I5IB 3JTDC 3I5GB 5PALA 2BBNA 2ZNEA 3KF9A 1CDPA 4GGNA 2L98A 2K7DA 1J1EA 1PK0D 1BR4B 4YGBB 1IQ5A 3O78A 4GPLB 5I2LA 4A4BA 2BECA 5AERA 1CB1A 3KHEA 3I5FC 1C07A 4L9MA 1KFXS 3LLEA 3DVJA 2ZN8A 1U5IB 1CMGA 2GGZA 1BF5A 2LE9B 1BMOA 1CFFA 2BE4A 4YGEB 3SIAA 1YUTA 5IBWA 3EKHA 5KU1A 1RWYA 1IKUA 1DVIA 2ZRSA 1NP8A 2KFFA 1SYMA 3PATA 3SG6A 1FBVA 2O60A 1EL4A 1QX5B 2BKIB 4P2YB 3BYAA 1Y0VH 1KQMB 2L4IA 3AKAA 4QJ5B 3EK7A 1DF0A 2CBLA 4QJ4B 2JT8A 1DJZA 1IJ5A 1LA3A 1K93D 2JULA 3OP0A 4JWQA 3TZ1A 3D10A 1XFXO 2LVIA 1S5GZ 1TRFA 1DT7B 1B7TY 2K2AA 3BUMB 4HSZA 1ALWA 1LINA 2SASA 3CZTX 1MR8A 1AHRA 1SR6C 2LNKA 1QLSA 1J7RA 3BUOB 2P6BB 1FI6A 2QACA 3JVTC 1XK4C 3NXAA 4OR9B 3EVRA 2OS8B 4Q04A 1WRZA 1NUBA 2I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFR A;  1BJF A;  1YUS A;  1KCY A;  2LLS A;  1CNP A;  2BBM A;  1NPQ A;  2FJU B;  3CLN A;  3VRO A;  4YRU A;  1PVA A;  3SJS A;  4DUQ A;  1FW4 A;  1YVL A;  2NLN A;  1YVH A;  3TUY B;  2JZI A;  3VRQ A;  1QIV A;  3HCM A;  4FQO A;  2KBI A;  4DS7 A;  1TCO B;  1UUR A;  2KDH A;  4PDZ A;  3BUN B;  3LCP C;  2DOQ A;  2KQ6 A;  2M0R A;  1MHO A;  1F4Q A;  1XFV O;  3CS1 A;  1CDL A;  2LP2 A;  3SG7 A;  2LVJ A;  4AQJ A;  1NCZ A;  1IG5 A;  1NX3 A;  1L2O B;  1V1G A;  2NXQ A;  3IQO A;  4ORB B;  4OKH A;  2G2B A;  1J7O A;  1DJY A;  1OZS A;  1BR1 B;  2A4J A;  2K0J A;  3BOW B;  1WDC C;  3NSK A;  3SG2 A;  3PN7 C;  3TUY C;  3BXK A;  2KFH A;  2PVB A;  3WNX B;  1DJX A;  4F0Z B;  1KK8 C;  1MQ1 A;  1M39 A;  3DVE A;  5HLO A;  4WQ3 A;  1CKK A;  2E6W A;  1LXF C;  4UPG A;  1Y1X A;  1B8C A;  4QJ3 B;  1QIW A;  2GV5 A;  4PE0 A;  3KPX A;  4YI8 A;  1MWN A;  1FF1 A;  3I5H C;  1B8L A;  1GQM A;  5I2O A;  1S36 A;  2V53 A;  1OOJ A;  3I5G C;  5ER4 X;  4MRY A;  2WOR A;  1NX2 A;  1QX2 A;  2KSP A;  1RJV A;  2Y5I A;  1S6C A;  5DKR A;  1XA5 A;  1XFW O;  3KEV A;  1K2H A;  4I5N B;  3GK4 X;  1PRW A;  2KI4 C;  4TNC A;  2WOS A;  2KAX A;  1SMG A;  2KYF A;  1RRO A;  2F2P A;  1HQV A;  3OX6 A;  4NQG A;  4PHJ A;  2Y1M A;  1VRK A;  2GGM A;  4E68 A;  1NCX A;  1SW8 A;  1XFY O;  3TDZ A;  4C0L A;  2KHN A;  1ZUZ A;  3DD4 A;  1XK4 A;  2F3Z A;  5AXI A;  1AUI B;  1S3P A;  2JT3 A;  4MZJ A;  3NSO A;  4GGF C;  2HQW A;  2K2F A;  1Y1A A;  3GOF A;  5KSZ A;  1NSH A;  2AAO A;  5CSI A;  1DMO A;  2MLF C;  2PAS A;  2KNE A;  5I8N A;  1N2D A;  2H61 C;  2M97 A;  2L51 A;  4FTG A;  2R2I A;  2G9B A;  1TIZ A;  1R2U A;  1YUU A;  2HET A;  4M2Q A;  3K21 A;  2OPO A;  1BOC A;  1DJH A;  1KK7 Y;  1DGU A;  1RTP 1;  1V1F A;  2JPT A;  1UP5 A;  1M63 B;  1OE9 B;  1SK6 D;  1G33 A;  1R6P A;  3PM8 A;  1J7P A;  4PHM A;  1AVS A;  4I5L B;  1YX8 A;  5HLV A;  5JOL A;  3OX5 A;  5HKW A;  2KGR A;  2B1U A;  2JU0 A;  3O2P A;  4P5O E;  2M9G A;  4GNK B;  4USL A;  2LLU A;  1WY9 A;  4YI9 A;  5HKY A;  1YTZ C;  1NCY A;  4C0J A;  1CFP A;  2PSR A;  2CXJ A;  1SR6 B;  5KTY A;  2LVV A;  2ZRT A;  1DF0 B;  4XYN A;  1PVB A;  2M3W A;  2K7B A;  5CPV A;  2LMT A;  2KAY A;  2WCB A;  1TCF A;  3PSR A;  1L7Z A;  3M0W A;  2L50 A;  2NCO A;  5JJG A;  2KAV A;  3A4U B;  1JFJ A;  1MXL C;  1KSM A;  4OVN F;  2TN4 A;  3CR2 A;  3VRP A;  3PFV A;  2F3Y A;  4BY4 A;  2OS8 C;  3SG3 A;  2JXC A;  5AFP A;  1A03 A;  1IRJ A;  4NDB A;  1KFU L;  3KO0 A;  1QVI Z;  2BE6 A;  4N5X A;  2MRD A;  1LVC D;  4OCI A;  1BU3 A;  1NX0 A;  3TDI A;  1K95 A;  2KFG A;  1N65 A;  3IQQ A;  3EKJ A;  1J55 A;  1ZFS A;  3CGA A;  3FWC A;  2KGB C;  1CFC A;  3D0Y A;  1EH2 A;  5GQQ C;  3O4Y A;  4PHN A;  1BG1 A;  4MVF A;  1CDN A;  1NYA A;  4PHK A;  2K7O A;  1KFU S;  2KQY A;  2LHL A;  1PSR A;  1NIW A;  1SL7 A;  2MAZ A;  3SIB A;  1K8U A;  1SCM B;  1OMD A;  2EHB A;  1OZO A;  1QX7 A;  3DF0 A;  3I5I C;  1ZAC A;  1MXE A;  1S5G Y;  1FPW A;  1G4Y R;  3PAL A;  4U8D A;  2QPT A;  4PAL A;  2F2O A;  2ZND A;  2JRF A;  4DCK A;  2OTG B;  1JFK A;  1W7J B;  4WRI A;  3OHM B;  3JTD B;  5DKQ A;  1DGV A;  2WCE A;  3NSL A;  3OB2 B;  4GGF A;  1S6J A;  1PAL A;  3BOW A;  1OMV A;  1ZMZ A;  1CLL A;  3WHU B;  1MUX A;  2KBM A;  4GAO A;  1QAT A;  2L2E A;  2M29 A;  1OMR A;  1DJW A;  4I5K A;  4GFT A;  1MF8 B;  1UHI A;  4JQ0 D;  2BCA A;  1CMF A;  2PAL A;  1KSO A;  1SCM C;  4WQ2 A;  1SBJ A;  3RLZ A;  1H4B A;  2WND A;  4YGC B;  3LL8 B;  2M7N A;  3PLF B;  4NDD A;  2KI4 B;  4A4C A;  3ZNI A;  4AOM A;  2MLE C;  2K61 A;  1M31 A;  2JOJ A;  2K7C A;  1XO5 A;  1YX7 A;  1SNL A;  2CTN A;  1X02 A;  2RGI A;  3FS7 A;  1KQV A;  4ORC B;  1XVJ A;  3CWG A;  5K89 A;  3E3R A;  5FYX A;  2KYC A;  2MJW B;  1TNP A;  1ODB A;  1EXR A;  3CR4 X;  3FIA A;  2O5G A;  4I5J A;  1JBA A;  2I18 A;  3ZWH A;  2IS9 A;  2CCM A;  4M2P A;  1JWD A;  3SG4 A;  5CSN A;  4JPZ B;  2H2K A;  4YGA A;  1S1E A;  2LAP A;  1QXP A;  1YR5 A;  1QV1 A;  2Q91 A;  4GUK A;  2LUC A;  2LM5 A;  3BQ3 A;  4MZL A;  4CFQ A;  5ER5 A;  5BPJ A;  1NWD A;  1TN4 A;  2LCP A;  4R1E A;  3SG5 A;  1B4C A;  5D69 A;  3AAJ A;  1UHK A;  2L5X B;  1GGW A;  2PRU A;  2Q4U A;  5D7F A;  1F70 A;  2LP3 A;  1J7Q A;  4C0K A;  2LC5 A;  5CSF A;  4D1E A;  2MA2 A;  1TNQ A;  1QAS A;  2BL0 C;  2M1U A;  2NCP A;  1BT6 A;  2BCB A;  3VRN A;  1C7W A;  2JNX A;  5F6T A;  1C7V A;  1IQ3 A;  2F33 A;  3NSI A;  2EGD A;  1OSA A;  1AK8 A;  1J1D A;  4PE4 A;  1M45 A;  1ZOT B;  1W7I B;  1K9K A;  5J3X A;  2BCX A;  2LMV A;  2M1K B;  2ZKM X;  2MBX A;  2OTG C;  2VRG A;  2LVK A;  4XJK A;  2KI6 D;  3PN7 B;  3JVT B;  5B8I B;  1F55 A;  1TOP A;  1BOD A;  1AJ5 A;  2KOT A;  1FI5 A;  1SRA A;  2ZFD A;  1QTX A;  2L4H A;  3EK8 A;  2M7L A;  1TNX A;  4ORA B;  5HKZ A;  1GJY A;  1CLM A;  1OQP A;  1YRT B;  2I2R E;  4HRG A;  1UHH A;  1QJT A;  1WRL A;  1Y6W A;  3A8R A;  3ICB A;  5G08 A;  3LK0 A;  1DJI A;  1F4O A;  4OV2 A;  1F71 A;  1IH0 A;  1WLZ A;  4ZCU A;  1XFZ O;  1QV0 A;  1Q80 A;  2JTT A;  3EVV A;  1SL9 A;  1K9P A;  1SPY A;  4MSP A;  4XJK B;  2H61 A;  1AJ4 A;  1SKT A;  1KK7 Z;  2ZN9 A;  1G8I A;  2LLT A;  1CM4 A;  2JC2 A;  2WCF A;  1XFU O;  1H8B A;  2BKH B;  1RFJ A;  1YRU B;  4N1G A;  1A4P A;  1L2O C;  1LA0 A;  2Y4Q A;  4DIR A;  4MRX A;  1SY9 A;  3DVM A;  2FCD A;  5DKN A;  3D0Y B;  3GK1 A;  4HRH A;  3MSE B;  2AUC A;  1B8R A;  1GGZ A;  1UHN A;  4BY5 A;  4MBE A;  3TS5 B;  2JTZ A;  3GK2 A;  1SCV A;  1CLB A;  2F8P A;  1KWO B;  1K9U A;  2HF5 A;  5HYD A;  4IL1 A;  4MN0 A;  2MHH A;  1QS7 A;  3DF0 B;  1KK8 B;  4AQI A;  1BLQ A;  1B9A A;  4MLW A;  1TNW A;  1Y1U A;  5CSJ A;  4PE7 A;  3OB1 B;  3QRX A;  3BUX B;  1K94 A;  1PUL A;  1A75 B;  4ICB A;  1JF0 A;  1JUO A;  1DJG A;  4HRE E;  1JC2 A;  3EK4 A;  2JXL A;  2KI6 C;  1JSA A;  3CTN A;  2HPS A;  2I94 A;  3WXA A;  3WHT B;  3HX4 A;  2E30 A;  4ZCV A;  3RM1 A;  3AAK A;  3I5F B;  1A29 A;  1IWQ A;  1QVI Y;  4YBH B;  2LV7 A;  1TTX A;  1B7T Z;  2JT0 A;  3CR5 X;  4PE1 A;  1B47 A;  1N0Y A;  2SCP A;  3H4S E;  3TS5 C;  2LHI A;  4PCW A;  1S6I A;  3VRR A;  1CDM A;  1E8A A;  5I2Q A;  1A75 A;  1CM1 A;  1HT9 A;  2L0P A;  3BUW B;  4CID A;  1DTL A;  2EC6 B;  1IJ6 A;  5TNC A;  1ALV A;  2NZ0 A;  1XYD A;  3F45 A;  2JWW A;  1UUS A;  3LK1 A;  1KQM C;  1CFD A;  2D8N A;  1REC A;  2JQ6 A;  4NDC A;  2WC8 A;  3C1V A;  1WRK A;  2PMY A;  2HQ8 A;  3IF7 A;  1K96 A;  3DVK A;  3TDU A;  3FWB A;  1CTR A;  2Y1N A;  2K8M B;  1YUR A;  1M46 A;  1WLM A;  4M2O A;  4GBA A;  1F54 A;  1PSB A;  2AMI A;  1KWO C;  1SL8 A;  5AEQ A;  1KFX L;  2EC6 C;  4CPV A;  1F8H A;  1K90 D;  1WDC B;  3I5H B;  2M8U A;  1UWO A;  2CNP A;  1B1G A;  1NX1 A;  2FOT A;  4MEW A;  1EG4 A;  4DRW A;  1RK9 A;  2BL0 B;  1EG3 A;  1JF2 A;  2LUX A;  4CLN A;  1A2X A;  3EVU A;  2ISD A;  1IGV A;  3AKB A;  2M49 B;  1D1O A;  1AP4 A;  2CT9 A;  1S26 D;  3VGO A;  2FCE A;  1U5I A;  2LAN A;  2JNF A;  4N1F A;  4ETO A;  4MZK A;  2COL B;  1EJ3 A;  3O6B A;  5AAN A;  4YGD B;  1QLK A;  1UHJ A;  2LMU A;  1LKJ A;  3I5I B;  3JTD C;  3I5G B;  5PAL A;  2BBN A;  2ZNE A;  3KF9 A;  1CDP A;  4GGN A;  2L98 A;  2K7D A;  1J1E A;  1PK0 D;  1BR4 B;  4YGB B;  1IQ5 A;  3O78 A;  4GPL B;  5I2L A;  4A4B A;  2BEC A;  5AER A;  1CB1 A;  3KHE A;  3I5F C;  1C07 A;  4L9M A;  1KFX S;  3LLE A;  3DVJ A;  2ZN8 A;  1U5I B;  1CMG A;  2GGZ A;  1BF5 A;  2LE9 B;  1BMO A;  1CFF A;  2BE4 A;  4YGE B;  3SIA A;  1YUT A;  5IBW A;  3EKH A;  5KU1 A;  1RWY A;  1IKU A;  1DVI A;  2ZRS A;  1NP8 A;  2KFF A;  1SYM A;  3PAT A;  3SG6 A;  1FBV A;  2O60 A;  1EL4 A;  1QX5 B;  2BKI B;  4P2Y B;  3BYA A;  1Y0V H;  1KQM B;  2L4I A;  3AKA A;  4QJ5 B;  3EK7 A;  1DF0 A;  2CBL A;  4QJ4 B;  2JT8 A;  1DJZ A;  1IJ5 A;  1LA3 A;  1K93 D;  2JUL A;  3OP0 A;  4JWQ A;  3TZ1 A;  3D10 A;  1XFX O;  2LVI A;  1S5G Z;  1TRF A;  1DT7 B;  1B7T Y;  2K2A A;  3BUM B;  4HSZ A;  1ALW A;  1LIN A;  2SAS A;  3CZT X;  1MR8 A;  1AHR A;  1SR6 C;  2LNK A;  1QLS A;  1J7R A;  3BUO B;  2P6B B;  1FI6 A;  2QAC A;  3JVT C;  1XK4 C;  3NXA A;  4OR9 B;  3EVR A;  2OS8 B;  4Q04 A;  1WRZ A;  1NUB A;  2I7A A; 
#chains in the Genus database with same CATH topology
 4CFR A;  1BJF A;  1YUS A;  1KCY A;  2LLS A;  1CNP A;  2BBM A;  1NPQ A;  2FJU B;  3CLN A;  3VRO A;  4YRU A;  1PVA A;  1OOG A;  2WCM A;  3SJS A;  4DUQ A;  1FW4 A;  1Z2C B;  3D77 A;  1YVL A;  2NLN A;  1YVH A;  3TUY B;  3B6X A;  2JZI A;  3VRQ A;  3D76 A;  1QIV A;  3HCM A;  4FQO A;  2KBI A;  4DS7 A;  1TCO B;  1UUR A;  2KDH A;  4JD9 A;  4PDZ A;  3BUN B;  3LCP C;  2DOQ A;  2KQ6 A;  2M0R A;  1MHO A;  1F4Q A;  1XFV O;  3CS1 A;  1CDL A;  2JPO A;  2LP2 A;  3SG7 A;  2LVJ A;  4AQJ A;  1NCZ A;  1IG5 A;  1NX3 A;  1L2O B;  1V1G A;  2NXQ A;  3IQO A;  4ORB B;  4OKH A;  2G2B A;  1J7O A;  1DJY A;  1OZS A;  1BR1 B;  2A4J A;  2K0J A;  3BOW B;  1WDC C;  3NSK A;  3SG2 A;  3PN7 C;  3TUY C;  3BXK A;  2KFH A;  2PVB A;  5HL1 A;  3WNX B;  3B87 A;  1DJX A;  2L5Y A;  4F0Z B;  1KK8 C;  1MQ1 A;  1M39 A;  3DVE A;  5HLO A;  4WQ3 A;  1CKK A;  2E6W A;  1LXF C;  4UPG A;  1Y1X A;  1B8C A;  4QJ3 B;  1QIW A;  2GV5 A;  4PE0 A;  3KPX A;  4YI8 A;  1MWN A;  1FF1 A;  3I5H C;  1B8L A;  1GQM A;  5I2O A;  1S36 A;  2V53 A;  1OOJ A;  3I5G C;  5ER4 X;  4MRY A;  3FE9 A;  2WOR A;  1NX2 A;  1QX2 A;  2KSP A;  1RJV A;  2Y5I A;  1S6C A;  5DKR A;  1XA5 A;  1XFW O;  3N7H A;  3KEV A;  1K2H A;  1XFR A;  3CZ1 A;  4I5N B;  3GK4 X;  1DEK A;  1PRW A;  2KI4 C;  4TNC A;  2WOS A;  2KAX A;  5FI7 A;  1SMG A;  2KYF A;  1RRO A;  2BAP A;  2F2P A;  3BFH A;  1HQV A;  3OX6 A;  4JKT A;  4NQG A;  2Y1M A;  4PHJ A;  1TUZ A;  1VRK A;  2GGM A;  4E68 A;  1NCX A;  1SW8 A;  1XFY O;  3TDZ A;  4C0L A;  2KHN A;  1ZUZ A;  3DD4 A;  1XK4 A;  2F3Z A;  5AXI A;  1AUI B;  1S3P A;  2JT3 A;  4MZJ A;  3NSO A;  3QME A;  4GGF C;  2HQW A;  3S0F A;  2K2F A;  1Y1A A;  3GOF A;  5KSZ A;  1NSH A;  2AAO A;  2QEB A;  5CSI A;  1DMO A;  1QWV A;  2MLF C;  2PAS A;  2KNE A;  5I8N A;  3K1E A;  1N2D A;  2H61 C;  2M97 A;  3BFA A;  2L51 A;  3OGN A;  4FTG A;  2R2I A;  2G9B A;  1TIZ A;  1Z4H A;  1R2U A;  1YUU A;  2HET A;  4M2Q A;  1TWO A;  2OPO A;  3K21 A;  1DJH A;  1KK7 Y;  1DGU A;  1RTP 1;  1V1F A;  2JPT A;  3S0E A;  1UP5 A;  1M63 B;  2KPH A;  1OE9 B;  1SK6 D;  1G33 A;  1R6P A;  3PM8 A;  1J7P A;  4PHM A;  1AVS A;  4I5L B;  1YX8 A;  5HLV A;  5JOL A;  3OX5 A;  1C3Y A;  1P28 A;  5HKW A;  2KGR A;  2B1U A;  2JU0 A;  3O2P A;  4P5O E;  2M9G A;  3CYZ A;  4GNK B;  4USL A;  2LLU A;  1WY9 A;  4YI9 A;  5HKY A;  1YTZ C;  1NCY A;  4C0J A;  1CFP A;  2PSR A;  2CXJ A;  1SR6 B;  5KTY A;  2LVV A;  2ZRT A;  1DF0 B;  4XYN A;  1PVB A;  2M3W A;  2K7B A;  5CPV A;  2LMT A;  2KAY A;  2QEO A;  1TCF A;  2WCB A;  3PSR A;  1L7Z A;  3UO9 A;  3M0W A;  2L50 A;  2NCO A;  3PJI A;  5JJG A;  2KAV A;  3A4U B;  2QEV A;  1JFJ A;  1MXL C;  1KSM A;  4OVN F;  2WCK A;  2TN4 A;  3CR2 A;  3VRP A;  2K60 A;  2F3Y A;  3PFV A;  4BY4 A;  2OS8 C;  3SG3 A;  2JXC A;  5AFP A;  1A03 A;  1IRJ A;  3FE8 A;  4NDB A;  1KFU L;  3KO0 A;  1QVI Z;  2BE6 A;  3O4X A;  4N5X A;  2MRD A;  1LVC D;  4OCI A;  3CZ0 A;  1BU3 A;  1NX0 A;  3TDI A;  1K95 A;  2KFG A;  4IJ7 A;  1N65 A;  3IQQ A;  3EKJ A;  1J55 A;  1ZFS A;  3CGA A;  3FWC A;  2KGB C;  3S0G A;  1CFC A;  3D0Y A;  1EH2 A;  2L2C A;  5GQQ C;  3O4Y A;  4PHN A;  1BG1 A;  4MVF A;  1CDN A;  1NYA A;  3B86 A;  2K7O A;  1KFU S;  2KQY A;  2LHL A;  1PSR A;  1NIW A;  1SL7 A;  2MAZ A;  4PHK A;  1K8U A;  1SCM B;  1OMD A;  2EHB A;  1OZO A;  1QX7 A;  3DF0 A;  3I5I C;  1OW4 A;  1ZAC A;  1MXE A;  1S5G Y;  1FPW A;  1G4Y R;  3PAL A;  4U8D A;  2QPT A;  4PAL A;  2F2O A;  2ZND A;  1W9Z A;  2JRF A;  1BOC A;  3NHI A;  4DCK A;  2OTG B;  1JFK A;  1W7J B;  4WRI A;  3OHM B;  3JTD B;  5DKQ A;  1DGV A;  2WCE A;  3NSL A;  3OB2 B;  4GGF A;  1S6J A;  1PAL A;  3BOW A;  1OMV A;  1ZMZ A;  1CLL A;  3WHU B;  1MUX A;  2KBM A;  4GAO A;  1QAT A;  2L2E A;  2M29 A;  1OMR A;  1DJW A;  4I5K A;  5I94 A;  4GFT A;  1MF8 B;  1UHI A;  4JQ0 D;  2BCA A;  1CMF A;  2PAL A;  1KSO A;  1SCM C;  4WQ2 A;  1SBJ A;  3RLZ A;  3CZ2 A;  1H4B A;  2WND A;  2KLE A;  4YGC B;  3LL8 B;  2M7N A;  3PLF B;  4NDD A;  2KI4 B;  4A4C A;  3ZNI A;  4AOM A;  2MLE C;  2K61 A;  1M31 A;  2JOJ A;  2K7C A;  1XO5 A;  1YX7 A;  1SNL A;  2CTN A;  1X02 A;  2RGI A;  3FS7 A;  1KQV A;  4ORC B;  1XVJ A;  3CWG A;  5K89 A;  3E3R A;  5FYX A;  2KYC A;  2MJW B;  1TNP A;  1ODB A;  1EXR A;  3CDN A;  3CR4 X;  3FIA A;  2O5G A;  4I5J A;  1JBA A;  3S0D A;  2I18 A;  3ZWH A;  2IS9 A;  2CCM A;  4M2P A;  1JWD A;  3SG4 A;  5CSN A;  4JPZ B;  2H2K A;  3D74 A;  1S1E A;  2LAP A;  4YGA A;  2WC5 A;  1QXP A;  3B88 A;  2GTE A;  1YR5 A;  5D3O A;  1QV1 A;  2Q91 A;  4GUK A;  2LUC A;  2LM5 A;  3BJH A;  3BQ3 A;  4MZL A;  4CFQ A;  5ER5 A;  5BPJ A;  1NWD A;  1TN4 A;  2LCP A;  4R1E A;  3SG5 A;  1B4C A;  5D69 A;  3AAJ A;  1UHK A;  2L5X B;  1GGW A;  2PRU A;  2Q4U A;  5D7F A;  1F70 A;  2LP3 A;  1J7Q A;  4C0K A;  2LC5 A;  5CSF A;  4D1E A;  1DC1 A;  2MA2 A;  1TNQ A;  1QAS A;  2BL0 C;  4INX A;  2M1U A;  2NCP A;  1BT6 A;  2BCB A;  3VRN A;  1C7W A;  2JNX A;  3L4A A;  5F6T A;  1C7V A;  1IQ3 A;  2F33 A;  3NSI A;  2EGD A;  1OSA A;  3PM2 A;  2H8V A;  1AK8 A;  1J1D A;  4PE4 A;  3S0B A;  3DYE A;  1M45 A;  3UNW A;  1OOF A;  1ZOT B;  1W7I B;  1K9K A;  5J3X A;  2BCX A;  2WCH A;  2LMV A;  2M1K B;  2ZKM X;  2MBX A;  2OTG C;  2VRG A;  2LVK A;  3R72 A;  4PT1 A;  4XJK A;  2KI6 D;  3RZS A;  3PN7 B;  3JVT B;  3R1P A;  5B8I B;  1F55 A;  1TOP A;  1BOD A;  1AJ5 A;  2KOT A;  1FI5 A;  1SRA A;  2ZFD A;  1QTX A;  2L4H A;  3EK8 A;  2M7L A;  1TNX A;  4ORA B;  5HKZ A;  1GJY A;  1CLM A;  1OQP A;  1YRT B;  2I2R E;  4HRG A;  1UHH A;  1QJT A;  1WRL A;  1Y6W A;  3A8R A;  3ICB A;  5G08 A;  3LK0 A;  1DJI A;  3OBV A;  1F4O A;  4OV2 A;  1F71 A;  1IH0 A;  3R1V A;  1WLZ A;  4ZCU A;  1XFZ O;  1QV0 A;  1Q80 A;  2JTT A;  3EVV A;  1SL9 A;  1K9P A;  1SPY A;  4MSP A;  4XJK B;  2H61 A;  1AJ4 A;  1SKT A;  1KK7 Z;  2ZN9 A;  1G8I A;  2LLT A;  1CM4 A;  2JC2 A;  2WCF A;  1XFU O;  1H8B A;  2BKH B;  1RFJ A;  1YRU B;  4N1G A;  1A4P A;  1L2O C;  1LA0 A;  2Y4Q A;  4DIR A;  4MRX A;  3CAB A;  1SY9 A;  3DVM A;  2FCD A;  5DKN A;  3D0Y B;  3GK1 A;  4HRH A;  3MSE B;  2AUC A;  1B8R A;  1GGZ A;  1UHN A;  4BY5 A;  4MBE A;  3TS5 B;  2JTZ A;  3GK2 A;  1SCV A;  3D78 A;  1CLB A;  2F8P A;  2FJY A;  4OZD A;  1KWO B;  1K9U A;  2HF5 A;  5HYD A;  4IL1 A;  2QEH A;  2MHH A;  1QS7 A;  3DF0 B;  4MN0 A;  1KK8 B;  4AQI A;  2PYQ A;  1BLQ A;  1B9A A;  4MLW A;  1TNW A;  1Y1U A;  5CSJ A;  4PE7 A;  1DEL A;  3OB1 B;  3QRX A;  3Q8I A;  1GM0 A;  3BUX B;  3SS5 A;  1K94 A;  1T14 A;  1PUL A;  1A75 B;  4ICB A;  1JF0 A;  1JUO A;  1DJG A;  4HRE E;  1JC2 A;  3EK4 A;  2JXL A;  2KI6 C;  1JSA A;  3CTN A;  2HPS A;  2I94 A;  3WXA A;  3WHT B;  2PQL A;  3HX4 A;  2E30 A;  4ZCV A;  3RM1 A;  3AAK A;  3I5F B;  1A29 A;  1IWQ A;  1QVI Y;  4YBH B;  2LV7 A;  1TTX A;  1B7T Z;  2JT0 A;  3CR5 X;  2BNX A;  1B47 A;  4PE1 A;  1N0Y A;  2SCP A;  3H4S E;  1ORG A;  3FE6 A;  2ERB A;  3TS5 C;  2LHI A;  4PCW A;  1S6I A;  5DIC A;  3SIB A;  1CDM A;  1E8A A;  3VRR A;  5I2Q A;  1A75 A;  1CM1 A;  1HT9 A;  2L0P A;  3BUW B;  3V2L A;  1DTL A;  4CID A;  2EC6 B;  1IJ6 A;  5TNC A;  2WC6 A;  1ALV A;  2NZ0 A;  1XYD A;  3F45 A;  2JWW A;  2P70 A;  4FQT A;  1UUS A;  3LK1 A;  1KQM C;  1CFD A;  2D8N A;  1REC A;  2JQ6 A;  4NDC A;  2WC8 A;  3C1V A;  1WRK A;  2PMY A;  2HQ8 A;  2YGU A;  3IF7 A;  1K96 A;  3DVK A;  3TDU A;  3FWB A;  1CTR A;  2Y1N A;  2K8M B;  1YUR A;  1M46 A;  1WLM A;  4M2O A;  4GBA A;  1F54 A;  1PSB A;  2AMI A;  3SS4 A;  1KWO C;  1SL8 A;  5AEQ A;  1KFX L;  2EC6 C;  4CPV A;  2QDI A;  1F8H A;  1K90 D;  1WDC B;  3I5H B;  2M8U A;  1UWO A;  2CNP A;  1B1G A;  1NX1 A;  2FOT A;  4MEW A;  1EG4 A;  4DRW A;  1RK9 A;  3L4L A;  2BL0 B;  1EG3 A;  1JF2 A;  2LUX A;  4CLN A;  1A2X A;  3EVU A;  3VB1 A;  2ISD A;  1IGV A;  1LS8 A;  3AKB A;  2M49 B;  1D1O A;  1AP4 A;  2CT9 A;  1S26 D;  3D73 A;  2FCE A;  1U5I A;  3VGO A;  2LAN A;  2JNF A;  4N1F A;  4ETO A;  4MZK A;  2COL B;  1EJ3 A;  1TUJ A;  3O6B A;  5AAN A;  1OOI X;  4YGD B;  1QLK A;  1UHJ A;  2LMU A;  1LKJ A;  3I5I B;  2WCJ A;  3I5G B;  3JTD C;  5PAL A;  2BBN A;  2ZNE A;  3KF9 A;  1CDP A;  3DY9 A;  3IVT A;  4GGN A;  2L98 A;  3R1O A;  2K7D A;  1J1E A;  1OOH A;  1PK0 D;  2WCL A;  1BR4 B;  3NGV A;  4YGB B;  5FI2 A;  1IQ5 A;  3O78 A;  4GPL B;  5I2L A;  4A4B A;  2BEC A;  3L47 A;  5AER A;  2KLD A;  1CB1 A;  3KHE A;  5EL2 A;  3NHT A;  3I5F C;  1C07 A;  4L9M A;  1KFX S;  3LLE A;  3DVJ A;  2ZN8 A;  1U5I B;  3B7A A;  1CMG A;  1DQE A;  2GGZ A;  1BF5 A;  2LE9 B;  1BMO A;  3DZT A;  1CFF A;  2BE4 A;  4KYN A;  4YGE B;  3SIA A;  1YUT A;  5IBW A;  3EKH A;  5KU1 A;  1RWY A;  1IKU A;  1DVI A;  2ZRS A;  1NP8 A;  2KFF A;  1SYM A;  3PAT A;  3SG6 A;  1FBV A;  1IIO A;  2O60 A;  1EL4 A;  1QX5 B;  2BKI B;  2P71 A;  3D75 A;  4P2Y B;  3BYA A;  1Y0V H;  1KQM B;  2L4I A;  3AKA A;  3DXL A;  4QJ5 B;  3EK7 A;  1DF0 A;  2CBL A;  4QJ4 B;  2JT8 A;  1DJZ A;  1IJ5 A;  1LA3 A;  1K93 D;  2JUL A;  3OP0 A;  4JWQ A;  3TZ1 A;  5FI6 A;  3D10 A;  3S0A A;  1XFX O;  2LVI A;  1S5G Z;  1TRF A;  4F7F A;  1DT7 B;  1B7T Y;  2K2A A;  3EG5 B;  3BUM B;  4HSZ A;  1ALW A;  4INW A;  1LIN A;  3BFB A;  2SAS A;  3CZT X;  3SS3 A;  1MR8 A;  1AHR A;  1SR6 C;  2LNK A;  1QLS A;  1J7R A;  3BUO B;  2P6B B;  1SSE B;  1FI6 A;  2QAC A;  3JVT C;  1XK4 C;  3NXA A;  4OR9 B;  1C3Z A;  3EVR A;  2OS8 B;  4Q04 A;  1WRZ A;  1NUB A;  2I7A A; 
#chains in the Genus database with same CATH homology
 4CFR A;  1BJF A;  1YUS A;  1KCY A;  2LLS A;  1CNP A;  2BBM A;  1NPQ A;  2FJU B;  3CLN A;  3VRO A;  4YRU A;  1PVA A;  3SJS A;  4DUQ A;  1FW4 A;  1YVL A;  2NLN A;  1YVH A;  3TUY B;  2JZI A;  3VRQ A;  1QIV A;  3HCM A;  4FQO A;  2KBI A;  4DS7 A;  1TCO B;  1UUR A;  2KDH A;  4PDZ A;  3BUN B;  3LCP C;  2DOQ A;  2KQ6 A;  2M0R A;  1MHO A;  1F4Q A;  1XFV O;  3CS1 A;  1CDL A;  2LP2 A;  3SG7 A;  2LVJ A;  4AQJ A;  1NCZ A;  1IG5 A;  1NX3 A;  1L2O B;  1V1G A;  2NXQ A;  3IQO A;  4ORB B;  4OKH A;  2G2B A;  1J7O A;  1DJY A;  1OZS A;  1BR1 B;  2A4J A;  2K0J A;  3BOW B;  1WDC C;  3NSK A;  3SG2 A;  3PN7 C;  3TUY C;  3BXK A;  2KFH A;  2PVB A;  3WNX B;  1DJX A;  4F0Z B;  1KK8 C;  1MQ1 A;  1M39 A;  3DVE A;  5HLO A;  4WQ3 A;  1CKK A;  2E6W A;  1LXF C;  4UPG A;  1Y1X A;  1B8C A;  4QJ3 B;  1QIW A;  2GV5 A;  4PE0 A;  3KPX A;  4YI8 A;  1MWN A;  1FF1 A;  3I5H C;  1B8L A;  1GQM A;  5I2O A;  1S36 A;  2V53 A;  1OOJ A;  3I5G C;  5ER4 X;  4MRY A;  2WOR A;  1NX2 A;  1QX2 A;  2KSP A;  1RJV A;  2Y5I A;  1S6C A;  5DKR A;  1XA5 A;  1XFW O;  3KEV A;  1K2H A;  4I5N B;  3GK4 X;  1PRW A;  2KI4 C;  4TNC A;  2WOS A;  2KAX A;  1SMG A;  2KYF A;  1RRO A;  2F2P A;  1HQV A;  3OX6 A;  4NQG A;  4PHJ A;  2Y1M A;  1VRK A;  2GGM A;  4E68 A;  1NCX A;  1SW8 A;  1XFY O;  3TDZ A;  4C0L A;  2KHN A;  1ZUZ A;  3DD4 A;  1XK4 A;  2F3Z A;  5AXI A;  1AUI B;  1S3P A;  2JT3 A;  4MZJ A;  3NSO A;  4GGF C;  2HQW A;  2K2F A;  1Y1A A;  3GOF A;  5KSZ A;  1NSH A;  2AAO A;  5CSI A;  1DMO A;  2MLF C;  2PAS A;  2KNE A;  5I8N A;  1N2D A;  2H61 C;  2M97 A;  2L51 A;  4FTG A;  2R2I A;  2G9B A;  1TIZ A;  1R2U A;  1YUU A;  2HET A;  4M2Q A;  3K21 A;  2OPO A;  1BOC A;  1DJH A;  1KK7 Y;  1DGU A;  1RTP 1;  1V1F A;  2JPT A;  1UP5 A;  1M63 B;  1OE9 B;  1SK6 D;  1G33 A;  1R6P A;  3PM8 A;  1J7P A;  4PHM A;  1AVS A;  4I5L B;  1YX8 A;  5HLV A;  5JOL A;  3OX5 A;  5HKW A;  2KGR A;  2B1U A;  2JU0 A;  3O2P A;  4P5O E;  2M9G A;  4GNK B;  4USL A;  2LLU A;  1WY9 A;  4YI9 A;  5HKY A;  1YTZ C;  1NCY A;  4C0J A;  1CFP A;  2PSR A;  2CXJ A;  1SR6 B;  5KTY A;  2LVV A;  2ZRT A;  1DF0 B;  4XYN A;  1PVB A;  2M3W A;  2K7B A;  5CPV A;  2LMT A;  2KAY A;  2WCB A;  1TCF A;  3PSR A;  1L7Z A;  3M0W A;  2L50 A;  2NCO A;  5JJG A;  2KAV A;  3A4U B;  1JFJ A;  1MXL C;  1KSM A;  4OVN F;  2TN4 A;  3CR2 A;  3VRP A;  3PFV A;  2F3Y A;  4BY4 A;  2OS8 C;  3SG3 A;  2JXC A;  5AFP A;  1A03 A;  1IRJ A;  4NDB A;  1KFU L;  3KO0 A;  1QVI Z;  2BE6 A;  4N5X A;  2MRD A;  1LVC D;  4OCI A;  1BU3 A;  1NX0 A;  3TDI A;  1K95 A;  2KFG A;  1N65 A;  3IQQ A;  3EKJ A;  1J55 A;  1ZFS A;  3CGA A;  3FWC A;  2KGB C;  1CFC A;  3D0Y A;  1EH2 A;  5GQQ C;  3O4Y A;  4PHN A;  1BG1 A;  4MVF A;  1CDN A;  1NYA A;  4PHK A;  2K7O A;  1KFU S;  2KQY A;  2LHL A;  1PSR A;  1NIW A;  1SL7 A;  2MAZ A;  3SIB A;  1K8U A;  1SCM B;  1OMD A;  2EHB A;  1OZO A;  1QX7 A;  3DF0 A;  3I5I C;  1ZAC A;  1MXE A;  1S5G Y;  1FPW A;  1G4Y R;  3PAL A;  4U8D A;  2QPT A;  4PAL A;  2F2O A;  2ZND A;  2JRF A;  4DCK A;  2OTG B;  1JFK A;  1W7J B;  4WRI A;  3OHM B;  3JTD B;  5DKQ A;  1DGV A;  2WCE A;  3NSL A;  3OB2 B;  4GGF A;  1S6J A;  1PAL A;  3BOW A;  1OMV A;  1ZMZ A;  1CLL A;  3WHU B;  1MUX A;  2KBM A;  4GAO A;  1QAT A;  2L2E A;  2M29 A;  1OMR A;  1DJW A;  4I5K A;  4GFT A;  1MF8 B;  1UHI A;  4JQ0 D;  2BCA A;  1CMF A;  2PAL A;  1KSO A;  1SCM C;  4WQ2 A;  1SBJ A;  3RLZ A;  1H4B A;  2WND A;  4YGC B;  3LL8 B;  2M7N A;  3PLF B;  4NDD A;  2KI4 B;  4A4C A;  3ZNI A;  4AOM A;  2MLE C;  2K61 A;  1M31 A;  2JOJ A;  2K7C A;  1XO5 A;  1YX7 A;  1SNL A;  2CTN A;  1X02 A;  2RGI A;  3FS7 A;  1KQV A;  4ORC B;  1XVJ A;  3CWG A;  5K89 A;  3E3R A;  5FYX A;  2KYC A;  2MJW B;  1TNP A;  1ODB A;  1EXR A;  3CR4 X;  3FIA A;  2O5G A;  4I5J A;  1JBA A;  2I18 A;  3ZWH A;  2IS9 A;  2CCM A;  4M2P A;  1JWD A;  3SG4 A;  5CSN A;  4JPZ B;  2H2K A;  4YGA A;  1S1E A;  2LAP A;  1QXP A;  1YR5 A;  1QV1 A;  2Q91 A;  4GUK A;  2LUC A;  2LM5 A;  3BQ3 A;  4MZL A;  4CFQ A;  5ER5 A;  5BPJ A;  1NWD A;  1TN4 A;  2LCP A;  4R1E A;  3SG5 A;  1B4C A;  5D69 A;  3AAJ A;  1UHK A;  2L5X B;  1GGW A;  2PRU A;  2Q4U A;  5D7F A;  1F70 A;  2LP3 A;  1J7Q A;  4C0K A;  2LC5 A;  5CSF A;  4D1E A;  2MA2 A;  1TNQ A;  1QAS A;  2BL0 C;  2M1U A;  2NCP A;  1BT6 A;  2BCB A;  3VRN A;  1C7W A;  2JNX A;  5F6T A;  1C7V A;  1IQ3 A;  2F33 A;  3NSI A;  2EGD A;  1OSA A;  1AK8 A;  1J1D A;  4PE4 A;  1M45 A;  1ZOT B;  1W7I B;  1K9K A;  5J3X A;  2BCX A;  2LMV A;  2M1K B;  2ZKM X;  2MBX A;  2OTG C;  2VRG A;  2LVK A;  4XJK A;  2KI6 D;  3PN7 B;  3JVT B;  5B8I B;  1F55 A;  1TOP A;  1BOD A;  1AJ5 A;  2KOT A;  1FI5 A;  1SRA A;  2ZFD A;  1QTX A;  2L4H A;  3EK8 A;  2M7L A;  1TNX A;  4ORA B;  5HKZ A;  1GJY A;  1CLM A;  1OQP A;  1YRT B;  2I2R E;  4HRG A;  1UHH A;  1QJT A;  1WRL A;  1Y6W A;  3A8R A;  3ICB A;  5G08 A;  3LK0 A;  1DJI A;  1F4O A;  4OV2 A;  1F71 A;  1IH0 A;  1WLZ A;  4ZCU A;  1XFZ O;  1QV0 A;  1Q80 A;  2JTT A;  3EVV A;  1SL9 A;  1K9P A;  1SPY A;  4MSP A;  4XJK B;  2H61 A;  1AJ4 A;  1SKT A;  1KK7 Z;  2ZN9 A;  1G8I A;  2LLT A;  1CM4 A;  2JC2 A;  2WCF A;  1XFU O;  1H8B A;  2BKH B;  1RFJ A;  1YRU B;  4N1G A;  1A4P A;  1L2O C;  1LA0 A;  2Y4Q A;  4DIR A;  4MRX A;  1SY9 A;  3DVM A;  2FCD A;  5DKN A;  3D0Y B;  3GK1 A;  4HRH A;  3MSE B;  2AUC A;  1B8R A;  1GGZ A;  1UHN A;  4BY5 A;  4MBE A;  3TS5 B;  2JTZ A;  3GK2 A;  1SCV A;  1CLB A;  2F8P A;  1KWO B;  1K9U A;  2HF5 A;  5HYD A;  4IL1 A;  4MN0 A;  2MHH A;  1QS7 A;  3DF0 B;  1KK8 B;  4AQI A;  1BLQ A;  1B9A A;  4MLW A;  1TNW A;  1Y1U A;  5CSJ A;  4PE7 A;  3OB1 B;  3QRX A;  3BUX B;  1K94 A;  1PUL A;  1A75 B;  4ICB A;  1JF0 A;  1JUO A;  1DJG A;  4HRE E;  1JC2 A;  3EK4 A;  2JXL A;  2KI6 C;  1JSA A;  3CTN A;  2HPS A;  2I94 A;  3WXA A;  3WHT B;  3HX4 A;  2E30 A;  4ZCV A;  3RM1 A;  3AAK A;  3I5F B;  1A29 A;  1IWQ A;  1QVI Y;  4YBH B;  2LV7 A;  1TTX A;  1B7T Z;  2JT0 A;  3CR5 X;  4PE1 A;  1B47 A;  1N0Y A;  2SCP A;  3H4S E;  3TS5 C;  2LHI A;  4PCW A;  1S6I A;  3VRR A;  1CDM A;  1E8A A;  5I2Q A;  1A75 A;  1CM1 A;  1HT9 A;  2L0P A;  3BUW B;  4CID A;  1DTL A;  2EC6 B;  1IJ6 A;  5TNC A;  1ALV A;  2NZ0 A;  1XYD A;  3F45 A;  2JWW A;  1UUS A;  3LK1 A;  1KQM C;  1CFD A;  2D8N A;  1REC A;  2JQ6 A;  4NDC A;  2WC8 A;  3C1V A;  1WRK A;  2PMY A;  2HQ8 A;  3IF7 A;  1K96 A;  3DVK A;  3TDU A;  3FWB A;  1CTR A;  2Y1N A;  2K8M B;  1YUR A;  1M46 A;  1WLM A;  4M2O A;  4GBA A;  1F54 A;  1PSB A;  2AMI A;  1KWO C;  1SL8 A;  5AEQ A;  1KFX L;  2EC6 C;  4CPV A;  1F8H A;  1K90 D;  1WDC B;  3I5H B;  2M8U A;  1UWO A;  2CNP A;  1B1G A;  1NX1 A;  2FOT A;  4MEW A;  1EG4 A;  4DRW A;  1RK9 A;  2BL0 B;  1EG3 A;  1JF2 A;  2LUX A;  4CLN A;  1A2X A;  3EVU A;  2ISD A;  1IGV A;  3AKB A;  2M49 B;  1D1O A;  1AP4 A;  2CT9 A;  1S26 D;  3VGO A;  2FCE A;  1U5I A;  2LAN A;  2JNF A;  4N1F A;  4ETO A;  4MZK A;  2COL B;  1EJ3 A;  3O6B A;  5AAN A;  4YGD B;  1QLK A;  1UHJ A;  2LMU A;  1LKJ A;  3I5I B;  3JTD C;  3I5G B;  5PAL A;  2BBN A;  2ZNE A;  3KF9 A;  1CDP A;  4GGN A;  2L98 A;  2K7D A;  1J1E A;  1PK0 D;  1BR4 B;  4YGB B;  1IQ5 A;  3O78 A;  4GPL B;  5I2L A;  4A4B A;  2BEC A;  5AER A;  1CB1 A;  3KHE A;  3I5F C;  1C07 A;  4L9M A;  1KFX S;  3LLE A;  3DVJ A;  2ZN8 A;  1U5I B;  1CMG A;  2GGZ A;  1BF5 A;  2LE9 B;  1BMO A;  1CFF A;  2BE4 A;  4YGE B;  3SIA A;  1YUT A;  5IBW A;  3EKH A;  5KU1 A;  1RWY A;  1IKU A;  1DVI A;  2ZRS A;  1NP8 A;  2KFF A;  1SYM A;  3PAT A;  3SG6 A;  1FBV A;  2O60 A;  1EL4 A;  1QX5 B;  2BKI B;  4P2Y B;  3BYA A;  1Y0V H;  1KQM B;  2L4I A;  3AKA A;  4QJ5 B;  3EK7 A;  1DF0 A;  2CBL A;  4QJ4 B;  2JT8 A;  1DJZ A;  1IJ5 A;  1LA3 A;  1K93 D;  2JUL A;  3OP0 A;  4JWQ A;  3TZ1 A;  3D10 A;  1XFX O;  2LVI A;  1S5G Z;  1TRF A;  1DT7 B;  1B7T Y;  2K2A A;  3BUM B;  4HSZ A;  1ALW A;  1LIN A;  2SAS A;  3CZT X;  1MR8 A;  1AHR A;  1SR6 C;  2LNK A;  1QLS A;  1J7R A;  3BUO B;  2P6B B;  1FI6 A;  2QAC A;  3JVT C;  1XK4 C;  3NXA A;  4OR9 B;  3EVR A;  2OS8 B;  4Q04 A;  1WRZ A;  1NUB A;  2I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...