1MF8B

Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Calcineurin Complexed with Cyclosporin a and Human Cyclophilin
pubmed doi rcsb
molecule keywords CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
molecule tags Hydrolase/isomerase/immunosuppressant
source organism Homo sapiens
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mf8B00
1SK6D 2GGZA 1BJFA 3A8RA 3EVRA 4HRGA 3SG7A 3PFVA 1OE9B 1XA5A 4C0LA 2I7AA 4PHNA 3EK8A 1UUSA 3CR2A 3EVVA 3GK2A 3OB1B 1IWQA 2K8MB 1G33A 4JPZB 1W7IB 4XYNA 2PSRA 2ZRTA 1GGWA 4NDDA 1DJHA 4USLA 2JT8A 3SIBA 2I94A 4MZLA 1RROA 1K9PA 2P6BB 3OX5A 1WLMA 1M31A 4MRXA 1S26D 1IH0A 1PULA 1K9UA 1QVIZ 2GGMA 3NSKA 3K21A 3GK4X 2BCXA 1DGUA 4PHMA 1FPWA 1IKUA 2JT3A 4MEWA 1DF0B 1QV0A 4ORCB 3AKAA 3NSLA 2KHNA 2LNKA 1MUXA 3PN7B 5KSZA 1SY9A 3NXAA 1A75A 3PN7C 5KTYA 1R2UA 2EHBA 1PVAA 1BLQA 1KFUS 2B1UA 2BL0C 5J3XA 4AQIA 1JWDA 3LK0A 1N0YA 5I2LA 1WRKA 2O5GA 1XO5A 1ZMZA 4Q04A 4OV2A 3RM1A 4WQ3A 1B8CA 1A29A 2E30A 1JFJA 1LVCD 3WNXB 1YTZC 2OS8B 4AOMA 4HRHA 3BQ3A 4MVFA 1K94A 2OS8C 4MRYA 1KQVA 1KQMC 3WHTB 1B9AA 1BT6A 2LHIA 4I5KA 1F55A 2KBIA 3I5IC 2F3ZA 2KSPA 3O2PA 3TUYB 2L51A 3PALA 1AHRA 2NZ0A 1CDMA 5I8NA 1A2XA 1DT7B 2NCPA 1NCZA 1Y1XA 5HLVA 5FYXA 1BODA 1MF8B 2KQ6A 5I2OA 4E68A 1DVIA 1NUBA 1OSAA 2WOSA 4XJKB 1JFKA 1S6JA 2KI6D 3KO0A 1NPQA 5HLOA 1PSBA 1DMOA 2NXQA 1IRJA 1H4BA 4XJKA 4BY4A 1DGVA 3JVTB 5HKYA 1ZACA 5B8IB 1XFYO 3CLNA 3JVTC 1TTXA 1JF0A 1F70A 1MXEA 1LA0A 5CSFA 4GNKB 2KGRA 2AUCA 5JOLA 1CLLA 4U8DA 1UWOA 1ZFSA 2H61A 1M46A 2TN4A 4CFRA 2LUXA 1B4CA 3BUWB 1FBVA 1WY9A 1K93D 1IGVA 2KNEA 1XFZO 4ZCUA 3VRQA 5AXIA 2DOQA 1YRUB 1D1OA 1XK4C 1DJIA 1OQPA 1K8UA 4PHKA 1X02A 1UHHA 1XFWO 4CPVA 2FJUB 1IQ3A 4GGNA 1DTLA 1DJGA 3OX6A 1TIZA 2SASA 2LC5A 2LVIA 3D0YB 2KYFA 1OMRA 4M2OA 2PRUA 4MLWA 3D0YA 4N1FA 1AP4A 3CR5X 1KSMA 2MBXA 3WXAA 1C7VA 3CS1A 1CLMA 4HSZA 1MXLC 4MN0A 1VRKA 2WC8A 3OP0A 1WDCB 1YVLA 2GV5A 1B1GA 5KU1A 3LL8B 1KFXS 1WDCC 1L2OC 3TDIA 2K2AA 3H4SE 3RLZA 2M29A 1SL8A 4YGEB 2LVJA 2AAOA 3KPXA 4YBHB 1J7QA 2M9GA 4FQOA 1FI6A 1AVSA 2KFGA 1CDPA 1DJXA 3KEVA 2LANA 4HREE 2MRDA 2I18A 4M2QA 2L5XB 1SCMB 4F0ZB 1SKTA 1UURA 4GGFA 1CKKA 1KFUL 1LXFC 4DS7A 2WORA 2CBLA 1WLZA 1F8HA 1K9KA 1TCOB 1N65A 2JTZA 2OTGB 1A03A 4UPGA 1L7ZA 1FF1A 1GQMA 2OTGC 2ISDA 1NCYA 5DKNA 5IBWA 4JWQA 1CDNA 1QJTA 1JSAA 2LMTA 3EVUA 4MBEA 1YURA 1J7OA 2ZFDA 2BECA 2K7OA 3VRNA 1KK8B 3AAJA 5CPVA 1BMOA 3OHMB 2H2KA 1QASA 4NDBA 2HQ8A 5HYDA 1RJVA 3IQQA 4QJ5B 4MZJA 2ZNDA 2G9BA 1WRZA 1CM4A 1Y1AA 2KFHA 3SG3A 4N1GA 1FI5A 4P5OE 1NYAA 1B47A 1SBJA 3M0WA 1RK9A 2BKHB 4L9MA 3TZ1A 2IS9A 3VRPA 1A75B 2WCBA 1K2HA 4ZCVA 1OMDA 1YX8A 2LAPA 4PE4A 3SG6A 4PALA 2F2OA 4PDZA 2K2FA 2HETA 2KDHA 4C0JA 1QIWA 1UHIA 5AERA 1NP8A 3D10A 1PVBA 2LUCA 1NWDA 1RTP1 5JJGA 1PSRA 1QS7A 3NSOA 1QX5B 2Y4QA 1BU3A 3HCMA 4NQGA 1QV1A 1M63B 2L2EA 1V1FA 2JNFA 3VRRA 5AEQA 1Q80A 1UHJA 1S5GY 2BCBA 4CFQA 1B8LA 1G8IA 1CNPA 1Y0VH 1PRWA 2MAZA 4N5XA 1J7PA 4OCIA 4YGBB 1B8RA 1C7WA 1AK8A 2JWWA 1UHKA 3LK1A 1QTXA 2CNPA 3TUYC 2KGBC 1QATA 1NX3A 2PMYA 2LCPA 2BBNA 3FWCA 5DKRA 2M7LA 1H8BA 1YUUA 2MHHA 2E6WA 2Q91A 3BOWB 2M1KB 4D1EA 3VGOA 3DF0A 3ICBA 2BKIB 1LA3A 3BOWA 3WHUB 3ZWHA 2CT9A 1C07A 3A4UB 1EJ3A 2H61C 3PM8A 1NSHA 2JPTA 1NIWA 2L4HA 1RWYA 2LMVA 1SR6B 2L0PA 1SRAA 1KFXL 2F8PA 4GPLB 3GOFA 3SIAA 1SR6C 2LHLA 2BE4A 3EKHA 3QRXA 3PLFB 3FWBA 1BF5A 2L4IA 1CTRA 1JC2A 1G4YR 5TNCA 1QX2A 5PALA 2Y5IA 1JF2A 1F54A 1XFXO 2QPTA 1UHNA 2MJWB 3DVJA 3IQOA 2LE9B 1U5IA 4AQJA 1J7RA 1Y1UA 2ZN8A 1TNXA 5D7FA 1V1GA 1SL7A 2KAVA 3BUNB 1BR1B 1TNPA 1CFDA 1S5GZ 4YGAA 1S1EA 3BUMB 5ER4X 1MHOA 2ZN9A 4YRUA 1DJZA 2JNXA 2ZKMX 2LP3A 1NX1A 2WCEA 4YI9A 2LMUA 3CR4X 1XYDA 3I5FB 4DCKA 1K95A 1YVHA 1QVIY 2JOJA 3I5FC 3SG2A 2K0JA 1ALWA 4I5LB 3EK7A 2D8NA 1N2DA 2JXCA 2K61A 1OOJA 3FS7A 4R1EA 3SG5A 4WRIA 1TNWA 3CGAA 3CTNA 1KWOB 2NLNA 1YX7A 1KWOC 2JTTA 4I5NB 1LINA 1QXPA 2KOTA 4ORBB 1AUIB 4OKHA 2Y1NA 1QLKA 1ZOTB 4YI8A 4YGDB 4GGFC 1IJ5A 2LLUA 1SCMC 1YUSA 2M7NA 3BUOB 4PHJA 5ER5A 2LLSA 1W7JB 1QX7A 1KK7Y 2LP2A 1SCVA 2K7CA 1LKJA 1SPYA 1EXRA 2VRGA 3I5HB 3KHEA 2COLB 1OZOA 2M97A 4QJ3B 3I5HC 1KSOA 2F33A 3BXKA 3EKJA 2MLEC 1ALVA 2KI6C 3SJSA 1KK8C 2G2BA 1AJ4A 3C1VA 4GBAA 5CSIA 4YGCB 3TDUA 3EK4A 3O4YA 2K7DA 1SYMA 2KQYA 1S3PA 2L50A 4BY5A 1BR4B 1TN4A 5GQQC 4DUQA 3IF7A 5K89A 1CFPA 1IG5A 2O60A 5CSJA 1FW4A 3BYAA 4WQ2A 2PVBA 4M2PA 1JUOA 4PCWA 1F4OA 2EGDA 1NX0A 1SW8A 2MLFC 2M8UA 2ZRSA 2LVVA 1EL4A 5D69A 1K96A 2F2PA 2LLTA 3DVKA 5BPJA 4FTGA 1BOCA 2LVKA 1YRTB 3CWGA 1OMVA 1EG4A 4IL1A 4GAOA 4JQ0D 2FOTA 4TNCA 1ODBA 2SCPA 1MQ1A 1F4QA 3O78A 1S36A 1ZUZA 2KAXA 3AAKA 4ETOA 1GGZA 1RFJA 1M45A 1CMFA 1B7TY 1MR8A 2BCAA 3KF9A 1DF0A 1SNLA 2M0RA 2BL0B 2M49B 2JT0A 1TCFA 1MWNA 2R2IA 3JTDB 3MSEB 1JBAA 3PSRA 1XFUO 1GJYA 2FCDA 3CZTX 3DVEA 3JTDC 2JU0A 3BUXB 1UP5A 1S6CA 2KYCA 2PALA 4CIDA 1CFCA 2PASA 2BBMA 2QACA 3DF0B 1KK7Z 1EH2A 2KFFA 2MA2A 2WCFA 3AKBA 4DRWA 1HQVA 1KQMB 3PATA 1SMGA 4DIRA 3GK1A 5HKZA 1SL9A 2NCOA 3I5IB 1F71A 2CCMA 4OR9B 1A4PA 4I5JA 1J55A 2I2RE 2JQ6A 1CLBA 2EC6B 3TS5B 4NDCA 1HT9A 4OVNF 2EC6C 3TS5C 3HX4A 1YUTA 1YR5A 3DD4A 4C0KA 2M3WA 4PE1A 4CLNA 1CB1A 1CMGA 5I2QA 4ORAB 3VROA 2V53A 2K7BA 3ZNIA 1TNQA 2JULA 1CFFA 1AJ5A 3NSIA 1U5IB 2LV7A 2OPOA 2WNDA 1CDLA 4ICBA 5DKQA 1S6IA 2FCEA 3LCPC 3TDZA 2A4JA 2AMIA 1M39A 1NCXA 3LLEA 1CM1A 1Y6WA 1B7TZ 1PK0D 4A4BA 1XFVO 2HPSA 2RGIA 1XK4A 3I5GB 4P2YB 2CXJA 1DJWA 3I5GC 1XVJA 2ZNEA 2JC2A 4GFTA 2F3YA 4MSPA 2LM5A 5CSNA 1BG1A 2Q4UA 3DVMA 3E3RA 1IQ5A 4PE7A 2KBMA 1WRLA 2KI4B 1J1EA 5AANA 4PE0A 2KI4C 1KCYA 2JRFA 2HQWA 1EG3A 2KAYA 2M1UA 1TRFA 1QIVA 1K90D 3F45A 3OB2B 2L98A 4GUKA 1TOPA 4MZKA 4A4CA 1PALA 4QJ4B 2JZIA 2CTNA 2BE6A 1L2OB 3FIAA 5HKWA 2Y1MA 1R6PA 2HF5A 2JXLA 1E8AA 1RECA 5G08A 5AFPA 1NX2A 3O6BA 5F6TA 3SG4A 1DJYA 1J1DA 1QLSA 1IJ6A 1OZSA
chains in the Genus database with same CATH superfamily
1SK6D 1Z2CB 1BJFA 2GGZA 3A8RA 3EVRA 4HRGA 3SG7A 3PFVA 1OE9B 2K60A 1XA5A 4C0LA 2I7AA 4PHNA 3EK8A 1UUSA 3CR2A 3EVVA 3GK2A 3OB1B 1IWQA 2K8MB 1G33A 4JPZB 1W7IB 4XYNA 2PSRA 2QEOA 2ZRTA 1GGWA 1T14A 4NDDA 1DJHA 2L2CA 2JT8A 4USLA 3SIBA 2I94A 4MZLA 1RROA 1K9PA 2P6BB 3OX5A 1WLMA 1M31A 4MRXA 3DXLA 1S26D 1IH0A 1PULA 1K9UA 1QVIZ 2GGMA 3NSKA 3K21A 3GK4X 2BCXA 1DGUA 5EL2A 4PHMA 1FPWA 1IKUA 2JT3A 4KYNA 4MEWA 1DF0B 1QV0A 2QEHA 3AKAA 4ORCB 3NSLA 2KHNA 2LNKA 1MUXA 3PN7B 5KSZA 1SY9A 3NXAA 1A75A 2GTEA 3PN7C 5KTYA 1R2UA 2EHBA 1PVAA 1BLQA 1KFUS 2B1UA 2BL0C 5J3XA 4AQIA 5DICA 3LK0A 1JWDA 1N0YA 3S0GA 5I2LA 1WRKA 2O5GA 1XO5A 1ZMZA 4Q04A 4OV2A 3RM1A 4WQ3A 1B8CA 1A29A 3NHIA 2E30A 2FJYA 1JFJA 1LVCD 3WNXB 1YTZC 2OS8B 4AOMA 4HRHA 3BQ3A 4MVFA 1K94A 2OS8C 4MRYA 1KQVA 1KQMC 3WHTB 1B9AA 1DC1A 1BT6A 2LHIA 4I5KA 1F55A 2KBIA 2PYQA 2F3ZA 2KSPA 3I5IC 3O2PA 2L51A 3R1VA 3TUYB 3CZ2A 3PALA 1AHRA 2NZ0A 1CDMA 5I8NA 1A2XA 1DT7B 2NCPA 1NCZA 1Y1XA 5HLVA 5FYXA 1BODA 1MF8B 2KQ6A 5I2OA 4E68A 1DVIA 1NUBA 1OSAA 2WOSA 3L4AA 1JFKA 1S6JA 2KI6D 3KO0A 1NPQA 4XJKB 5HLOA 1PSBA 1DMOA 2NXQA 1IRJA 1H4BA 4XJKA 2WC5A 4BY4A 1DGVA 3JVTB 2P70A 5HKYA 1ZACA 5B8IB 1XFYO 3CLNA 3PM2A 3JVTC 3D78A 1TTXA 1JF0A 3D76A 1MXEA 1F70A 1LA0A 5CSFA 1P28A 4GNKB 2KGRA 2AUCA 5JOLA 5HL1A 3RZSA 1CLLA 4U8DA 1UWOA 1GM0A 1W9ZA 1ZFSA 2H61A 1M46A 2TN4A 4CFRA 2LUXA 1B4CA 3BUWB 1FBVA 1WY9A 1K93D 1IGVA 4F7FA 1QWVA 2KNEA 1XFZO 4ZCUA 3VRQA 5AXIA 2DOQA 1YRUB 1D1OA 1XK4C 1DJIA 1OQPA 1K8UA 4PHKA 1X02A 3DYEA 3S0EA 1UHHA 1XFWO 4OZDA 4CPVA 2FJUB 4INWA 1IQ3A 4GGNA 1DTLA 1DJGA 3OX6A 1TIZA 2SASA 3UNWA 2LC5A 2LVIA 3D0YB 2KYFA 5FI6A 1OMRA 4M2OA 2PRUA 4MLWA 3D0YA 4N1FA 1AP4A 3CR5X 1KSMA 2KLDA 1SSEB 2MBXA 3WXAA 1C7VA 3CS1A 3Q8IA 1CLMA 4HSZA 1MXLC 3EG5B 1VRKA 3DZTA 4MN0A 2WC8A 3OP0A 1WDCB 1YVLA 2GV5A 1B1GA 1OOHA 3LL8B 5KU1A 1KFXS 1WDCC 1L2OC 3TDIA 2ERBA 2K2AA 3H4SE 3RLZA 5FI7A 2M29A 1SL8A 4YGEB 2LVJA 2AAOA 3KPXA 4YBHB 3NHTA 1J7QA 2M9GA 4FQOA 1FI6A 1AVSA 2KFGA 1CDPA 1DJXA 3KEVA 3SS5A 2LANA 4HREE 2MRDA 2I18A 2QEVA 4M2QA 2L5XB 1SCMB 4F0ZB 3N7HA 1SKTA 1UURA 4GGFA 1CKKA 1KFUL 1LXFC 3FE9A 4DS7A 2WORA 2CBLA 1WLZA 1F8HA 1K9KA 1TCOB 1N65A 2JTZA 2OTGB 3R1PA 4UPGA 1A03A 3CZ1A 1L7ZA 1FF1A 1GQMA 2OTGC 2ISDA 1NCYA 5DKNA 2L5YA 4JWQA 5IBWA 1CDNA 1QJTA 1JSAA 2LMTA 3EVUA 3D77A 1YURA 4MBEA 3VB1A 2ZFDA 1J7OA 2BECA 2K7OA 3VRNA 1KK8B 1LS8A 1ORGA 1BMOA 3AAJA 2H2KA 1QASA 3OHMB 5CPVA 4NDBA 2HQ8A 5HYDA 1RJVA 3IQQA 4QJ5B 4MZJA 2ZNDA 2G9BA 1WRZA 1CM4A 1Y1AA 2KFHA 3SG3A 4N1GA 1FI5A 4P5OE 1NYAA 1B47A 1SBJA 3M0WA 1RK9A 2BKHB 4JKTA 4L9MA 2IS9A 3TZ1A 1A75B 2WCBA 1K2HA 4ZCVA 1OMDA 1YX8A 2LAPA 4PE4A 3SG6A 4PALA 2F2OA 3BFHA 4PDZA 2K2FA 2HETA 3B87A 2KDHA 4C0JA 1QIWA 1UHIA 5AERA 1NP8A 2PQLA 3D10A 1PVBA 2LUCA 1NWDA 1RTP1 3D73A 5JJGA 1PSRA 1QS7A 3NSOA 1QX5B 2Y4QA 1BU3A 3HCMA 4NQGA 1QV1A 1M63B 2L2EA 1V1FA 2JNFA 3VRRA 5AEQA 3UO9A 1Q80A 1UHJA 1S5GY 2BCBA 4CFQA 2YGUA 1B8LA 1G8IA 3S0FA 1CNPA 1Y0VH 1PRWA 2MAZA 4N5XA 1J7PA 4OCIA 4YGBB 2BAPA 1B8RA 1C7WA 1AK8A 2JWWA 1UHKA 3LK1A 1QTXA 1XFRA 2CNPA 3BFBA 2KGBC 1QATA 3B6XA 3TUYC 1NX3A 2PMYA 5I94A 2LCPA 2BBNA 3FWCA 5DKRA 2M7LA 1H8BA 3D74A 3OBVA 2WCLA 1YUUA 2MHHA 2E6WA 2Q91A 1OW4A 3BOWB 2M1KB 2WCJA 4D1EA 3VGOA 3DF0A 3ICBA 2BKIB 1LA3A 3BOWA 3IVTA 3WHUB 3ZWHA 2CT9A 1C07A 3A4UB 3SS3A 1EJ3A 3K1EA 3BJHA 3B88A 2H61C 3PM8A 2H8VA 3S0BA 1NSHA 2JPTA 3FE8A 1NIWA 2L4HA 1RWYA 2LMVA 1SR6B 2L0PA 1SRAA 1KFXL 2F8PA 4GPLB 4FQTA 2QEBA 3GOFA 1SR6C 3SIAA 2LHLA 2BE4A 3EKHA 3QRXA 3PLFB 3FWBA 3R72A 1BF5A 2L4IA 1CTRA 2KLEA 1G4YR 3CYZA 5TNCA 1QX2A 1JC2A 5PALA 2Y5IA 1JF2A 1F54A 1XFXO 2QPTA 1UHNA 2MJWB 3DVJA 3IQOA 2LE9B 1U5IA 4AQJA 1J7RA 1Y1UA 2ZN8A 1TNXA 5D7FA 1V1GA 1C3YA 1SL7A 2KAVA 3BUNB 1BR1B 1TNPA 1CFDA 1S5GZ 4YGAA 1S1EA 3BUMB 5ER4X 1MHOA 2ZN9A 4YRUA 1DJZA 3B86A 2JNXA 3D75A 2ZKMX 2LP3A 1NX1A 2WCEA 4YI9A 2LMUA 3CR4X 1XYDA 3I5FB 5D3OA 4DCKA 1K95A 1YVHA 1QVIY 2JOJA 3I5FC 3SG2A 2K0JA 1ALWA 4I5LB 1DELA 3EK7A 2D8NA 1N2DA 2JXCA 2K61A 1OOJA 3FS7A 4R1EA 3SG5A 1Z4HA 1TNWA 3CGAA 3CTNA 1KWOB 4WRIA 2NLNA 1YX7A 1KWOC 2JTTA 4I5NB 2WCHA 1LINA 1QXPA 2KOTA 4ORBB 1AUIB 4OKHA 2Y1NA 1QLKA 1ZOTB 4YI8A 4YGDB 4GGFC 1IJ5A 2LLUA 1SCMC 1YUSA 2M7NA 3BUOB 4PHJA 5ER5A 2LLSA 2QDIA 1IIOA 1W7JB 1QX7A 1KK7Y 2LP2A 1SCVA 2K7CA 1LKJA 1SPYA 1EXRA 1C3ZA 2VRGA 3I5HB 3KHEA 3PJIA 2COLB 1OZOA 2M97A 4QJ3B 3I5HC 1KSOA 2F33A 3BXKA 3EKJA 2MLEC 1ALVA 2KI6C 3SJSA 1KK8C 2G2BA 1AJ4A 3C1VA 4GBAA 2P71A 5CSIA 4YGCB 3L4LA 3EK4A 3O4YA 2K7DA 1SYMA 2KQYA 3TDUA 1S3PA 3CDNA 2L50A 4BY5A 1BR4B 1TN4A 5GQQC 4DUQA 3IF7A 5K89A 1CFPA 1IG5A 3S0AA 2O60A 5CSJA 1FW4A 3BYAA 3OGNA 4WQ2A 1DEKA 2PVBA 4M2PA 1JUOA 4PCWA 1F4OA 2EGDA 1NX0A 1SW8A 2MLFC 2M8UA 2ZRSA 2LVVA 3BFAA 1EL4A 5D69A 1K96A 2F2PA 2LLTA 3DVKA 5BPJA 4FTGA 1BOCA 2LVKA 1YRTB 3CWGA 1OMVA 1EG4A 4IL1A 4GAOA 4JQ0D 2FOTA 4TNCA 1ODBA 2SCPA 1MQ1A 1F4QA 4PT1A 3O78A 1S36A 1ZUZA 2KAXA 3AAKA 4ETOA 1GGZA 1RFJA 1M45A 1CMFA 1B7TY 3SS4A 1MR8A 2BCAA 3KF9A 1DF0A 1SNLA 2M0RA 2BL0B 2M49B 2JT0A 1TCFA 1MWNA 2R2IA 3JTDB 3MSEB 1JBAA 3PSRA 1XFUO 1GJYA 2FCDA 3CZTX 3DVEA 2JPOA 3JTDC 2JU0A 3CZ0A 3BUXB 1UP5A 1S6CA 2KYCA 2PALA 2WCKA 4CIDA 1CFCA 2PASA 2BBMA 2QACA 3DF0B 1KK7Z 1EH2A 2KFFA 2MA2A 2WCFA 3AKBA 4DRWA 1HQVA 1KQMB 3PATA 1SMGA 4DIRA 3O4XA 3GK1A 5HKZA 1SL9A 2NCOA 3I5IB 1F71A 2CCMA 4OR9B 3CABA 1A4PA 3R1OA 4I5JA 1J55A 3L47A 2I2RE 2JQ6A 1CLBA 2EC6B 3TS5B 4NDCA 1HT9A 4OVNF 2EC6C 3TS5C 3HX4A 1YUTA 3V2LA 1YR5A 3DD4A 4C0KA 2M3WA 4PE1A 4CLNA 1CB1A 2KPHA 1CMGA 5I2QA 4ORAB 3VROA 2V53A 2K7BA 3ZNIA 1TNQA 2JULA 1CFFA 1AJ5A 3NSIA 1U5IB 2LV7A 3QMEA 2OPOA 2WNDA 1CDLA 4ICBA 4INXA 3NGVA 5DKQA 1S6IA 2FCEA 3LCPC 3TDZA 1TUJA 2A4JA 2AMIA 1M39A 1NCXA 3LLEA 1CM1A 1Y6WA 1B7TZ 1PK0D 4A4BA 1XFVO 2HPSA 2RGIA 1XK4A 3I5GB 4P2YB 2CXJA 3VRPA 1DJWA 3FE6A 3I5GC 1XVJA 2ZNEA 2JC2A 4GFTA 2F3YA 4MSPA 2LM5A 5CSNA 1BG1A 1DQEA 2Q4UA 3DVMA 3E3RA 1IQ5A 4PE7A 2KBMA 1WRLA 2KI4B 1J1EA 3DY9A 5AANA 4PE0A 1TWOA 2WCMA 2KI4C 1KCYA 2JRFA 2HQWA 1EG3A 3S0DA 1OOIX 2KAYA 2M1UA 4IJ7A 1TRFA 1QIVA 1K90D 2WC6A 3F45A 2L98A 3OB2B 1TOPA 4GUKA 4MZKA 1PALA 4A4CA 4QJ4B 2JZIA 2CTNA 2BE6A 1L2OB 3FIAA 1OOFA 5HKWA 2Y1MA 4JD9A 1R6PA 2HF5A 2JXLA 3B7AA 1E8AA 1RECA 5G08A 2BNXA 5AFPA 1NX2A 3O6BA 5F6TA 3SG4A 5FI2A 1TUZA 1DJYA 1J1DA 1QLSA 1IJ6A 1OOGA 1OZSA
chains in the Genus database with same CATH topology
1SK6D 2GGZA 1BJFA 3A8RA 3EVRA 4HRGA 3SG7A 3PFVA 1OE9B 1XA5A 4C0LA 2I7AA 4PHNA 3EK8A 1UUSA 3CR2A 3EVVA 3GK2A 3OB1B 1IWQA 2K8MB 1G33A 4JPZB 1W7IB 4XYNA 2PSRA 2ZRTA 1GGWA 4NDDA 1DJHA 4USLA 2JT8A 3SIBA 2I94A 4MZLA 1RROA 1K9PA 2P6BB 3OX5A 1WLMA 1M31A 4MRXA 1S26D 1IH0A 1PULA 1K9UA 1QVIZ 2GGMA 3NSKA 3K21A 3GK4X 2BCXA 1DGUA 4PHMA 1FPWA 1IKUA 2JT3A 4MEWA 1DF0B 1QV0A 4ORCB 3AKAA 3NSLA 2KHNA 2LNKA 1MUXA 3PN7B 5KSZA 1SY9A 3NXAA 1A75A 3PN7C 5KTYA 1R2UA 2EHBA 1PVAA 1BLQA 1KFUS 2B1UA 2BL0C 5J3XA 4AQIA 1JWDA 3LK0A 1N0YA 5I2LA 1WRKA 2O5GA 1XO5A 1ZMZA 4Q04A 4OV2A 3RM1A 4WQ3A 1B8CA 1A29A 2E30A 1JFJA 1LVCD 3WNXB 1YTZC 2OS8B 4AOMA 4HRHA 3BQ3A 4MVFA 1K94A 2OS8C 4MRYA 1KQVA 1KQMC 3WHTB 1B9AA 1BT6A 2LHIA 4I5KA 1F55A 2KBIA 3I5IC 2F3ZA 2KSPA 3O2PA 3TUYB 2L51A 3PALA 1AHRA 2NZ0A 1CDMA 5I8NA 1A2XA 1DT7B 2NCPA 1NCZA 1Y1XA 5HLVA 5FYXA 1BODA 1MF8B 2KQ6A 5I2OA 4E68A 1DVIA 1NUBA 1OSAA 2WOSA 4XJKB 1JFKA 1S6JA 2KI6D 3KO0A 1NPQA 5HLOA 1PSBA 1DMOA 2NXQA 1IRJA 1H4BA 4XJKA 4BY4A 1DGVA 3JVTB 5HKYA 1ZACA 5B8IB 1XFYO 3CLNA 3JVTC 1TTXA 1JF0A 1F70A 1MXEA 1LA0A 5CSFA 4GNKB 2KGRA 2AUCA 5JOLA 1CLLA 4U8DA 1UWOA 1ZFSA 2H61A 1M46A 2TN4A 4CFRA 2LUXA 1B4CA 3BUWB 1FBVA 1WY9A 1K93D 1IGVA 2KNEA 1XFZO 4ZCUA 3VRQA 5AXIA 2DOQA 1YRUB 1D1OA 1XK4C 1DJIA 1OQPA 1K8UA 4PHKA 1X02A 1UHHA 1XFWO 4CPVA 2FJUB 1IQ3A 4GGNA 1DTLA 1DJGA 3OX6A 1TIZA 2SASA 2LC5A 2LVIA 3D0YB 2KYFA 1OMRA 4M2OA 2PRUA 4MLWA 3D0YA 4N1FA 1AP4A 3CR5X 1KSMA 2MBXA 3WXAA 1C7VA 3CS1A 1CLMA 4HSZA 1MXLC 4MN0A 1VRKA 2WC8A 3OP0A 1WDCB 1YVLA 2GV5A 1B1GA 5KU1A 3LL8B 1KFXS 1WDCC 1L2OC 3TDIA 2K2AA 3H4SE 3RLZA 2M29A 1SL8A 4YGEB 2LVJA 2AAOA 3KPXA 4YBHB 1J7QA 2M9GA 4FQOA 1FI6A 1AVSA 2KFGA 1CDPA 1DJXA 3KEVA 2LANA 4HREE 2MRDA 2I18A 4M2QA 2L5XB 1SCMB 4F0ZB 1SKTA 1UURA 4GGFA 1CKKA 1KFUL 1LXFC 4DS7A 2WORA 2CBLA 1WLZA 1F8HA 1K9KA 1TCOB 1N65A 2JTZA 2OTGB 1A03A 4UPGA 1L7ZA 1FF1A 1GQMA 2OTGC 2ISDA 1NCYA 5DKNA 5IBWA 4JWQA 1CDNA 1QJTA 1JSAA 2LMTA 3EVUA 4MBEA 1YURA 1J7OA 2ZFDA 2BECA 2K7OA 3VRNA 1KK8B 3AAJA 5CPVA 1BMOA 3OHMB 2H2KA 1QASA 4NDBA 2HQ8A 5HYDA 1RJVA 3IQQA 4QJ5B 4MZJA 2ZNDA 2G9BA 1WRZA 1CM4A 1Y1AA 2KFHA 3SG3A 4N1GA 1FI5A 4P5OE 1NYAA 1B47A 1SBJA 3M0WA 1RK9A 2BKHB 4L9MA 3TZ1A 2IS9A 3VRPA 1A75B 2WCBA 1K2HA 4ZCVA 1OMDA 1YX8A 2LAPA 4PE4A 3SG6A 4PALA 2F2OA 4PDZA 2K2FA 2HETA 2KDHA 4C0JA 1QIWA 1UHIA 5AERA 1NP8A 3D10A 1PVBA 2LUCA 1NWDA 1RTP1 5JJGA 1PSRA 1QS7A 3NSOA 1QX5B 2Y4QA 1BU3A 3HCMA 4NQGA 1QV1A 1M63B 2L2EA 1V1FA 2JNFA 3VRRA 5AEQA 1Q80A 1UHJA 1S5GY 2BCBA 4CFQA 1B8LA 1G8IA 1CNPA 1Y0VH 1PRWA 2MAZA 4N5XA 1J7PA 4OCIA 4YGBB 1B8RA 1C7WA 1AK8A 2JWWA 1UHKA 3LK1A 1QTXA 2CNPA 3TUYC 2KGBC 1QATA 1NX3A 2PMYA 2LCPA 2BBNA 3FWCA 5DKRA 2M7LA 1H8BA 1YUUA 2MHHA 2E6WA 2Q91A 3BOWB 2M1KB 4D1EA 3VGOA 3DF0A 3ICBA 2BKIB 1LA3A 3BOWA 3WHUB 3ZWHA 2CT9A 1C07A 3A4UB 1EJ3A 2H61C 3PM8A 1NSHA 2JPTA 1NIWA 2L4HA 1RWYA 2LMVA 1SR6B 2L0PA 1SRAA 1KFXL 2F8PA 4GPLB 3GOFA 3SIAA 1SR6C 2LHLA 2BE4A 3EKHA 3QRXA 3PLFB 3FWBA 1BF5A 2L4IA 1CTRA 1JC2A 1G4YR 5TNCA 1QX2A 5PALA 2Y5IA 1JF2A 1F54A 1XFXO 2QPTA 1UHNA 2MJWB 3DVJA 3IQOA 2LE9B 1U5IA 4AQJA 1J7RA 1Y1UA 2ZN8A 1TNXA 5D7FA 1V1GA 1SL7A 2KAVA 3BUNB 1BR1B 1TNPA 1CFDA 1S5GZ 4YGAA 1S1EA 3BUMB 5ER4X 1MHOA 2ZN9A 4YRUA 1DJZA 2JNXA 2ZKMX 2LP3A 1NX1A 2WCEA 4YI9A 2LMUA 3CR4X 1XYDA 3I5FB 4DCKA 1K95A 1YVHA 1QVIY 2JOJA 3I5FC 3SG2A 2K0JA 1ALWA 4I5LB 3EK7A 2D8NA 1N2DA 2JXCA 2K61A 1OOJA 3FS7A 4R1EA 3SG5A 4WRIA 1TNWA 3CGAA 3CTNA 1KWOB 2NLNA 1YX7A 1KWOC 2JTTA 4I5NB 1LINA 1QXPA 2KOTA 4ORBB 1AUIB 4OKHA 2Y1NA 1QLKA 1ZOTB 4YI8A 4YGDB 4GGFC 1IJ5A 2LLUA 1SCMC 1YUSA 2M7NA 3BUOB 4PHJA 5ER5A 2LLSA 1W7JB 1QX7A 1KK7Y 2LP2A 1SCVA 2K7CA 1LKJA 1SPYA 1EXRA 2VRGA 3I5HB 3KHEA 2COLB 1OZOA 2M97A 4QJ3B 3I5HC 1KSOA 2F33A 3BXKA 3EKJA 2MLEC 1ALVA 2KI6C 3SJSA 1KK8C 2G2BA 1AJ4A 3C1VA 4GBAA 5CSIA 4YGCB 3TDUA 3EK4A 3O4YA 2K7DA 1SYMA 2KQYA 1S3PA 2L50A 4BY5A 1BR4B 1TN4A 5GQQC 4DUQA 3IF7A 5K89A 1CFPA 1IG5A 2O60A 5CSJA 1FW4A 3BYAA 4WQ2A 2PVBA 4M2PA 1JUOA 4PCWA 1F4OA 2EGDA 1NX0A 1SW8A 2MLFC 2M8UA 2ZRSA 2LVVA 1EL4A 5D69A 1K96A 2F2PA 2LLTA 3DVKA 5BPJA 4FTGA 1BOCA 2LVKA 1YRTB 3CWGA 1OMVA 1EG4A 4IL1A 4GAOA 4JQ0D 2FOTA 4TNCA 1ODBA 2SCPA 1MQ1A 1F4QA 3O78A 1S36A 1ZUZA 2KAXA 3AAKA 4ETOA 1GGZA 1RFJA 1M45A 1CMFA 1B7TY 1MR8A 2BCAA 3KF9A 1DF0A 1SNLA 2M0RA 2BL0B 2M49B 2JT0A 1TCFA 1MWNA 2R2IA 3JTDB 3MSEB 1JBAA 3PSRA 1XFUO 1GJYA 2FCDA 3CZTX 3DVEA 3JTDC 2JU0A 3BUXB 1UP5A 1S6CA 2KYCA 2PALA 4CIDA 1CFCA 2PASA 2BBMA 2QACA 3DF0B 1KK7Z 1EH2A 2KFFA 2MA2A 2WCFA 3AKBA 4DRWA 1HQVA 1KQMB 3PATA 1SMGA 4DIRA 3GK1A 5HKZA 1SL9A 2NCOA 3I5IB 1F71A 2CCMA 4OR9B 1A4PA 4I5JA 1J55A 2I2RE 2JQ6A 1CLBA 2EC6B 3TS5B 4NDCA 1HT9A 4OVNF 2EC6C 3TS5C 3HX4A 1YUTA 1YR5A 3DD4A 4C0KA 2M3WA 4PE1A 4CLNA 1CB1A 1CMGA 5I2QA 4ORAB 3VROA 2V53A 2K7BA 3ZNIA 1TNQA 2JULA 1CFFA 1AJ5A 3NSIA 1U5IB 2LV7A 2OPOA 2WNDA 1CDLA 4ICBA 5DKQA 1S6IA 2FCEA 3LCPC 3TDZA 2A4JA 2AMIA 1M39A 1NCXA 3LLEA 1CM1A 1Y6WA 1B7TZ 1PK0D 4A4BA 1XFVO 2HPSA 2RGIA 1XK4A 3I5GB 4P2YB 2CXJA 1DJWA 3I5GC 1XVJA 2ZNEA 2JC2A 4GFTA 2F3YA 4MSPA 2LM5A 5CSNA 1BG1A 2Q4UA 3DVMA 3E3RA 1IQ5A 4PE7A 2KBMA 1WRLA 2KI4B 1J1EA 5AANA 4PE0A 2KI4C 1KCYA 2JRFA 2HQWA 1EG3A 2KAYA 2M1UA 1TRFA 1QIVA 1K90D 3F45A 3OB2B 2L98A 4GUKA 1TOPA 4MZKA 4A4CA 1PALA 4QJ4B 2JZIA 2CTNA 2BE6A 1L2OB 3FIAA 5HKWA 2Y1MA 1R6PA 2HF5A 2JXLA 1E8AA 1RECA 5G08A 5AFPA 1NX2A 3O6BA 5F6TA 3SG4A 1DJYA 1J1DA 1QLSA 1IJ6A 1OZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK6 D;  2GGZ A;  1BJF A;  3A8R A;  3EVR A;  4HRG A;  3SG7 A;  3PFV A;  1OE9 B;  1XA5 A;  4C0L A;  2I7A A;  4PHN A;  3EK8 A;  1UUS A;  3CR2 A;  3EVV A;  3GK2 A;  3OB1 B;  1IWQ A;  2K8M B;  1G33 A;  4JPZ B;  1W7I B;  4XYN A;  2PSR A;  2ZRT A;  1GGW A;  4NDD A;  1DJH A;  4USL A;  2JT8 A;  3SIB A;  2I94 A;  4MZL A;  1RRO A;  1K9P A;  2P6B B;  3OX5 A;  1WLM A;  1M31 A;  4MRX A;  1S26 D;  1IH0 A;  1PUL A;  1K9U A;  1QVI Z;  2GGM A;  3NSK A;  3K21 A;  3GK4 X;  2BCX A;  1DGU A;  4PHM A;  1FPW A;  1IKU A;  2JT3 A;  4MEW A;  1DF0 B;  1QV0 A;  4ORC B;  3AKA A;  3NSL A;  2KHN A;  2LNK A;  1MUX A;  3PN7 B;  5KSZ A;  1SY9 A;  3NXA A;  1A75 A;  3PN7 C;  5KTY A;  1R2U A;  2EHB A;  1PVA A;  1BLQ A;  1KFU S;  2B1U A;  2BL0 C;  5J3X A;  4AQI A;  1JWD A;  3LK0 A;  1N0Y A;  5I2L A;  1WRK A;  2O5G A;  1XO5 A;  1ZMZ A;  4Q04 A;  4OV2 A;  3RM1 A;  4WQ3 A;  1B8C A;  1A29 A;  2E30 A;  1JFJ A;  1LVC D;  3WNX B;  1YTZ C;  2OS8 B;  4AOM A;  4HRH A;  3BQ3 A;  4MVF A;  1K94 A;  2OS8 C;  4MRY A;  1KQV A;  1KQM C;  3WHT B;  1B9A A;  1BT6 A;  2LHI A;  4I5K A;  1F55 A;  2KBI A;  3I5I C;  2F3Z A;  2KSP A;  3O2P A;  3TUY B;  2L51 A;  3PAL A;  1AHR A;  2NZ0 A;  1CDM A;  5I8N A;  1A2X A;  1DT7 B;  2NCP A;  1NCZ A;  1Y1X A;  5HLV A;  5FYX A;  1BOD A;  1MF8 B;  2KQ6 A;  5I2O A;  4E68 A;  1DVI A;  1NUB A;  1OSA A;  2WOS A;  4XJK B;  1JFK A;  1S6J A;  2KI6 D;  3KO0 A;  1NPQ A;  5HLO A;  1PSB A;  1DMO A;  2NXQ A;  1IRJ A;  1H4B A;  4XJK A;  4BY4 A;  1DGV A;  3JVT B;  5HKY A;  1ZAC A;  5B8I B;  1XFY O;  3CLN A;  3JVT C;  1TTX A;  1JF0 A;  1F70 A;  1MXE A;  1LA0 A;  5CSF A;  4GNK B;  2KGR A;  2AUC A;  5JOL A;  1CLL A;  4U8D A;  1UWO A;  1ZFS A;  2H61 A;  1M46 A;  2TN4 A;  4CFR A;  2LUX A;  1B4C A;  3BUW B;  1FBV A;  1WY9 A;  1K93 D;  1IGV A;  2KNE A;  1XFZ O;  4ZCU A;  3VRQ A;  5AXI A;  2DOQ A;  1YRU B;  1D1O A;  1XK4 C;  1DJI A;  1OQP A;  1K8U A;  4PHK A;  1X02 A;  1UHH A;  1XFW O;  4CPV A;  2FJU B;  1IQ3 A;  4GGN A;  1DTL A;  1DJG A;  3OX6 A;  1TIZ A;  2SAS A;  2LC5 A;  2LVI A;  3D0Y B;  2KYF A;  1OMR A;  4M2O A;  2PRU A;  4MLW A;  3D0Y A;  4N1F A;  1AP4 A;  3CR5 X;  1KSM A;  2MBX A;  3WXA A;  1C7V A;  3CS1 A;  1CLM A;  4HSZ A;  1MXL C;  4MN0 A;  1VRK A;  2WC8 A;  3OP0 A;  1WDC B;  1YVL A;  2GV5 A;  1B1G A;  5KU1 A;  3LL8 B;  1KFX S;  1WDC C;  1L2O C;  3TDI A;  2K2A A;  3H4S E;  3RLZ A;  2M29 A;  1SL8 A;  4YGE B;  2LVJ A;  2AAO A;  3KPX A;  4YBH B;  1J7Q A;  2M9G A;  4FQO A;  1FI6 A;  1AVS A;  2KFG A;  1CDP A;  1DJX A;  3KEV A;  2LAN A;  4HRE E;  2MRD A;  2I18 A;  4M2Q A;  2L5X B;  1SCM B;  4F0Z B;  1SKT A;  1UUR A;  4GGF A;  1CKK A;  1KFU L;  1LXF C;  4DS7 A;  2WOR A;  2CBL A;  1WLZ A;  1F8H A;  1K9K A;  1TCO B;  1N65 A;  2JTZ A;  2OTG B;  1A03 A;  4UPG A;  1L7Z A;  1FF1 A;  1GQM A;  2OTG C;  2ISD A;  1NCY A;  5DKN A;  5IBW A;  4JWQ A;  1CDN A;  1QJT A;  1JSA A;  2LMT A;  3EVU A;  4MBE A;  1YUR A;  1J7O A;  2ZFD A;  2BEC A;  2K7O A;  3VRN A;  1KK8 B;  3AAJ A;  5CPV A;  1BMO A;  3OHM B;  2H2K A;  1QAS A;  4NDB A;  2HQ8 A;  5HYD A;  1RJV A;  3IQQ A;  4QJ5 B;  4MZJ A;  2ZND A;  2G9B A;  1WRZ A;  1CM4 A;  1Y1A A;  2KFH A;  3SG3 A;  4N1G A;  1FI5 A;  4P5O E;  1NYA A;  1B47 A;  1SBJ A;  3M0W A;  1RK9 A;  2BKH B;  4L9M A;  3TZ1 A;  2IS9 A;  3VRP A;  1A75 B;  2WCB A;  1K2H A;  4ZCV A;  1OMD A;  1YX8 A;  2LAP A;  4PE4 A;  3SG6 A;  4PAL A;  2F2O A;  4PDZ A;  2K2F A;  2HET A;  2KDH A;  4C0J A;  1QIW A;  1UHI A;  5AER A;  1NP8 A;  3D10 A;  1PVB A;  2LUC A;  1NWD A;  1RTP 1;  5JJG A;  1PSR A;  1QS7 A;  3NSO A;  1QX5 B;  2Y4Q A;  1BU3 A;  3HCM A;  4NQG A;  1QV1 A;  1M63 B;  2L2E A;  1V1F A;  2JNF A;  3VRR A;  5AEQ A;  1Q80 A;  1UHJ A;  1S5G Y;  2BCB A;  4CFQ A;  1B8L A;  1G8I A;  1CNP A;  1Y0V H;  1PRW A;  2MAZ A;  4N5X A;  1J7P A;  4OCI A;  4YGB B;  1B8R A;  1C7W A;  1AK8 A;  2JWW A;  1UHK A;  3LK1 A;  1QTX A;  2CNP A;  3TUY C;  2KGB C;  1QAT A;  1NX3 A;  2PMY A;  2LCP A;  2BBN A;  3FWC A;  5DKR A;  2M7L A;  1H8B A;  1YUU A;  2MHH A;  2E6W A;  2Q91 A;  3BOW B;  2M1K B;  4D1E A;  3VGO A;  3DF0 A;  3ICB A;  2BKI B;  1LA3 A;  3BOW A;  3WHU B;  3ZWH A;  2CT9 A;  1C07 A;  3A4U B;  1EJ3 A;  2H61 C;  3PM8 A;  1NSH A;  2JPT A;  1NIW A;  2L4H A;  1RWY A;  2LMV A;  1SR6 B;  2L0P A;  1SRA A;  1KFX L;  2F8P A;  4GPL B;  3GOF A;  3SIA A;  1SR6 C;  2LHL A;  2BE4 A;  3EKH A;  3QRX A;  3PLF B;  3FWB A;  1BF5 A;  2L4I A;  1CTR A;  1JC2 A;  1G4Y R;  5TNC A;  1QX2 A;  5PAL A;  2Y5I A;  1JF2 A;  1F54 A;  1XFX O;  2QPT A;  1UHN A;  2MJW B;  3DVJ A;  3IQO A;  2LE9 B;  1U5I A;  4AQJ A;  1J7R A;  1Y1U A;  2ZN8 A;  1TNX A;  5D7F A;  1V1G A;  1SL7 A;  2KAV A;  3BUN B;  1BR1 B;  1TNP A;  1CFD A;  1S5G Z;  4YGA A;  1S1E A;  3BUM B;  5ER4 X;  1MHO A;  2ZN9 A;  4YRU A;  1DJZ A;  2JNX A;  2ZKM X;  2LP3 A;  1NX1 A;  2WCE A;  4YI9 A;  2LMU A;  3CR4 X;  1XYD A;  3I5F B;  4DCK A;  1K95 A;  1YVH A;  1QVI Y;  2JOJ A;  3I5F C;  3SG2 A;  2K0J A;  1ALW A;  4I5L B;  3EK7 A;  2D8N A;  1N2D A;  2JXC A;  2K61 A;  1OOJ A;  3FS7 A;  4R1E A;  3SG5 A;  4WRI A;  1TNW A;  3CGA A;  3CTN A;  1KWO B;  2NLN A;  1YX7 A;  1KWO C;  2JTT A;  4I5N B;  1LIN A;  1QXP A;  2KOT A;  4ORB B;  1AUI B;  4OKH A;  2Y1N A;  1QLK A;  1ZOT B;  4YI8 A;  4YGD B;  4GGF C;  1IJ5 A;  2LLU A;  1SCM C;  1YUS A;  2M7N A;  3BUO B;  4PHJ A;  5ER5 A;  2LLS A;  1W7J B;  1QX7 A;  1KK7 Y;  2LP2 A;  1SCV A;  2K7C A;  1LKJ A;  1SPY A;  1EXR A;  2VRG A;  3I5H B;  3KHE A;  2COL B;  1OZO A;  2M97 A;  4QJ3 B;  3I5H C;  1KSO A;  2F33 A;  3BXK A;  3EKJ A;  2MLE C;  1ALV A;  2KI6 C;  3SJS A;  1KK8 C;  2G2B A;  1AJ4 A;  3C1V A;  4GBA A;  5CSI A;  4YGC B;  3TDU A;  3EK4 A;  3O4Y A;  2K7D A;  1SYM A;  2KQY A;  1S3P A;  2L50 A;  4BY5 A;  1BR4 B;  1TN4 A;  5GQQ C;  4DUQ A;  3IF7 A;  5K89 A;  1CFP A;  1IG5 A;  2O60 A;  5CSJ A;  1FW4 A;  3BYA A;  4WQ2 A;  2PVB A;  4M2P A;  1JUO A;  4PCW A;  1F4O A;  2EGD A;  1NX0 A;  1SW8 A;  2MLF C;  2M8U A;  2ZRS A;  2LVV A;  1EL4 A;  5D69 A;  1K96 A;  2F2P A;  2LLT A;  3DVK A;  5BPJ A;  4FTG A;  1BOC A;  2LVK A;  1YRT B;  3CWG A;  1OMV A;  1EG4 A;  4IL1 A;  4GAO A;  4JQ0 D;  2FOT A;  4TNC A;  1ODB A;  2SCP A;  1MQ1 A;  1F4Q A;  3O78 A;  1S36 A;  1ZUZ A;  2KAX A;  3AAK A;  4ETO A;  1GGZ A;  1RFJ A;  1M45 A;  1CMF A;  1B7T Y;  1MR8 A;  2BCA A;  3KF9 A;  1DF0 A;  1SNL A;  2M0R A;  2BL0 B;  2M49 B;  2JT0 A;  1TCF A;  1MWN A;  2R2I A;  3JTD B;  3MSE B;  1JBA A;  3PSR A;  1XFU O;  1GJY A;  2FCD A;  3CZT X;  3DVE A;  3JTD C;  2JU0 A;  3BUX B;  1UP5 A;  1S6C A;  2KYC A;  2PAL A;  4CID A;  1CFC A;  2PAS A;  2BBM A;  2QAC A;  3DF0 B;  1KK7 Z;  1EH2 A;  2KFF A;  2MA2 A;  2WCF A;  3AKB A;  4DRW A;  1HQV A;  1KQM B;  3PAT A;  1SMG A;  4DIR A;  3GK1 A;  5HKZ A;  1SL9 A;  2NCO A;  3I5I B;  1F71 A;  2CCM A;  4OR9 B;  1A4P A;  4I5J A;  1J55 A;  2I2R E;  2JQ6 A;  1CLB A;  2EC6 B;  3TS5 B;  4NDC A;  1HT9 A;  4OVN F;  2EC6 C;  3TS5 C;  3HX4 A;  1YUT A;  1YR5 A;  3DD4 A;  4C0K A;  2M3W A;  4PE1 A;  4CLN A;  1CB1 A;  1CMG A;  5I2Q A;  4ORA B;  3VRO A;  2V53 A;  2K7B A;  3ZNI A;  1TNQ A;  2JUL A;  1CFF A;  1AJ5 A;  3NSI A;  1U5I B;  2LV7 A;  2OPO A;  2WND A;  1CDL A;  4ICB A;  5DKQ A;  1S6I A;  2FCE A;  3LCP C;  3TDZ A;  2A4J A;  2AMI A;  1M39 A;  1NCX A;  3LLE A;  1CM1 A;  1Y6W A;  1B7T Z;  1PK0 D;  4A4B A;  1XFV O;  2HPS A;  2RGI A;  1XK4 A;  3I5G B;  4P2Y B;  2CXJ A;  1DJW A;  3I5G C;  1XVJ A;  2ZNE A;  2JC2 A;  4GFT A;  2F3Y A;  4MSP A;  2LM5 A;  5CSN A;  1BG1 A;  2Q4U A;  3DVM A;  3E3R A;  1IQ5 A;  4PE7 A;  2KBM A;  1WRL A;  2KI4 B;  1J1E A;  5AAN A;  4PE0 A;  2KI4 C;  1KCY A;  2JRF A;  2HQW A;  1EG3 A;  2KAY A;  2M1U A;  1TRF A;  1QIV A;  1K90 D;  3F45 A;  3OB2 B;  2L98 A;  4GUK A;  1TOP A;  4MZK A;  4A4C A;  1PAL A;  4QJ4 B;  2JZI A;  2CTN A;  2BE6 A;  1L2O B;  3FIA A;  5HKW A;  2Y1M A;  1R6P A;  2HF5 A;  2JXL A;  1E8A A;  1REC A;  5G08 A;  5AFP A;  1NX2 A;  3O6B A;  5F6T A;  3SG4 A;  1DJY A;  1J1D A;  1QLS A;  1IJ6 A;  1OZS A; 
#chains in the Genus database with same CATH topology
 1SK6 D;  1Z2C B;  1BJF A;  2GGZ A;  3A8R A;  3EVR A;  4HRG A;  3SG7 A;  3PFV A;  1OE9 B;  2K60 A;  1XA5 A;  4C0L A;  2I7A A;  4PHN A;  3EK8 A;  1UUS A;  3CR2 A;  3EVV A;  3GK2 A;  3OB1 B;  1IWQ A;  2K8M B;  1G33 A;  4JPZ B;  1W7I B;  4XYN A;  2PSR A;  2QEO A;  2ZRT A;  1GGW A;  1T14 A;  4NDD A;  1DJH A;  2L2C A;  2JT8 A;  4USL A;  3SIB A;  2I94 A;  4MZL A;  1RRO A;  1K9P A;  2P6B B;  3OX5 A;  1WLM A;  1M31 A;  4MRX A;  3DXL A;  1S26 D;  1IH0 A;  1PUL A;  1K9U A;  1QVI Z;  2GGM A;  3NSK A;  3K21 A;  3GK4 X;  2BCX A;  1DGU A;  5EL2 A;  4PHM A;  1FPW A;  1IKU A;  2JT3 A;  4KYN A;  4MEW A;  1DF0 B;  1QV0 A;  2QEH A;  3AKA A;  4ORC B;  3NSL A;  2KHN A;  2LNK A;  1MUX A;  3PN7 B;  5KSZ A;  1SY9 A;  3NXA A;  1A75 A;  2GTE A;  3PN7 C;  5KTY A;  1R2U A;  2EHB A;  1PVA A;  1BLQ A;  1KFU S;  2B1U A;  2BL0 C;  5J3X A;  4AQI A;  5DIC A;  3LK0 A;  1JWD A;  1N0Y A;  3S0G A;  5I2L A;  1WRK A;  2O5G A;  1XO5 A;  1ZMZ A;  4Q04 A;  4OV2 A;  3RM1 A;  4WQ3 A;  1B8C A;  1A29 A;  3NHI A;  2E30 A;  2FJY A;  1JFJ A;  1LVC D;  3WNX B;  1YTZ C;  2OS8 B;  4AOM A;  4HRH A;  3BQ3 A;  4MVF A;  1K94 A;  2OS8 C;  4MRY A;  1KQV A;  1KQM C;  3WHT B;  1B9A A;  1DC1 A;  1BT6 A;  2LHI A;  4I5K A;  1F55 A;  2KBI A;  2PYQ A;  2F3Z A;  2KSP A;  3I5I C;  3O2P A;  2L51 A;  3R1V A;  3TUY B;  3CZ2 A;  3PAL A;  1AHR A;  2NZ0 A;  1CDM A;  5I8N A;  1A2X A;  1DT7 B;  2NCP A;  1NCZ A;  1Y1X A;  5HLV A;  5FYX A;  1BOD A;  1MF8 B;  2KQ6 A;  5I2O A;  4E68 A;  1DVI A;  1NUB A;  1OSA A;  2WOS A;  3L4A A;  1JFK A;  1S6J A;  2KI6 D;  3KO0 A;  1NPQ A;  4XJK B;  5HLO A;  1PSB A;  1DMO A;  2NXQ A;  1IRJ A;  1H4B A;  4XJK A;  2WC5 A;  4BY4 A;  1DGV A;  3JVT B;  2P70 A;  5HKY A;  1ZAC A;  5B8I B;  1XFY O;  3CLN A;  3PM2 A;  3JVT C;  3D78 A;  1TTX A;  1JF0 A;  3D76 A;  1MXE A;  1F70 A;  1LA0 A;  5CSF A;  1P28 A;  4GNK B;  2KGR A;  2AUC A;  5JOL A;  5HL1 A;  3RZS A;  1CLL A;  4U8D A;  1UWO A;  1GM0 A;  1W9Z A;  1ZFS A;  2H61 A;  1M46 A;  2TN4 A;  4CFR A;  2LUX A;  1B4C A;  3BUW B;  1FBV A;  1WY9 A;  1K93 D;  1IGV A;  4F7F A;  1QWV A;  2KNE A;  1XFZ O;  4ZCU A;  3VRQ A;  5AXI A;  2DOQ A;  1YRU B;  1D1O A;  1XK4 C;  1DJI A;  1OQP A;  1K8U A;  4PHK A;  1X02 A;  3DYE A;  3S0E A;  1UHH A;  1XFW O;  4OZD A;  4CPV A;  2FJU B;  4INW A;  1IQ3 A;  4GGN A;  1DTL A;  1DJG A;  3OX6 A;  1TIZ A;  2SAS A;  3UNW A;  2LC5 A;  2LVI A;  3D0Y B;  2KYF A;  5FI6 A;  1OMR A;  4M2O A;  2PRU A;  4MLW A;  3D0Y A;  4N1F A;  1AP4 A;  3CR5 X;  1KSM A;  2KLD A;  1SSE B;  2MBX A;  3WXA A;  1C7V A;  3CS1 A;  3Q8I A;  1CLM A;  4HSZ A;  1MXL C;  3EG5 B;  1VRK A;  3DZT A;  4MN0 A;  2WC8 A;  3OP0 A;  1WDC B;  1YVL A;  2GV5 A;  1B1G A;  1OOH A;  3LL8 B;  5KU1 A;  1KFX S;  1WDC C;  1L2O C;  3TDI A;  2ERB A;  2K2A A;  3H4S E;  3RLZ A;  5FI7 A;  2M29 A;  1SL8 A;  4YGE B;  2LVJ A;  2AAO A;  3KPX A;  4YBH B;  3NHT A;  1J7Q A;  2M9G A;  4FQO A;  1FI6 A;  1AVS A;  2KFG A;  1CDP A;  1DJX A;  3KEV A;  3SS5 A;  2LAN A;  4HRE E;  2MRD A;  2I18 A;  2QEV A;  4M2Q A;  2L5X B;  1SCM B;  4F0Z B;  3N7H A;  1SKT A;  1UUR A;  4GGF A;  1CKK A;  1KFU L;  1LXF C;  3FE9 A;  4DS7 A;  2WOR A;  2CBL A;  1WLZ A;  1F8H A;  1K9K A;  1TCO B;  1N65 A;  2JTZ A;  2OTG B;  3R1P A;  4UPG A;  1A03 A;  3CZ1 A;  1L7Z A;  1FF1 A;  1GQM A;  2OTG C;  2ISD A;  1NCY A;  5DKN A;  2L5Y A;  4JWQ A;  5IBW A;  1CDN A;  1QJT A;  1JSA A;  2LMT A;  3EVU A;  3D77 A;  1YUR A;  4MBE A;  3VB1 A;  2ZFD A;  1J7O A;  2BEC A;  2K7O A;  3VRN A;  1KK8 B;  1LS8 A;  1ORG A;  1BMO A;  3AAJ A;  2H2K A;  1QAS A;  3OHM B;  5CPV A;  4NDB A;  2HQ8 A;  5HYD A;  1RJV A;  3IQQ A;  4QJ5 B;  4MZJ A;  2ZND A;  2G9B A;  1WRZ A;  1CM4 A;  1Y1A A;  2KFH A;  3SG3 A;  4N1G A;  1FI5 A;  4P5O E;  1NYA A;  1B47 A;  1SBJ A;  3M0W A;  1RK9 A;  2BKH B;  4JKT A;  4L9M A;  2IS9 A;  3TZ1 A;  1A75 B;  2WCB A;  1K2H A;  4ZCV A;  1OMD A;  1YX8 A;  2LAP A;  4PE4 A;  3SG6 A;  4PAL A;  2F2O A;  3BFH A;  4PDZ A;  2K2F A;  2HET A;  3B87 A;  2KDH A;  4C0J A;  1QIW A;  1UHI A;  5AER A;  1NP8 A;  2PQL A;  3D10 A;  1PVB A;  2LUC A;  1NWD A;  1RTP 1;  3D73 A;  5JJG A;  1PSR A;  1QS7 A;  3NSO A;  1QX5 B;  2Y4Q A;  1BU3 A;  3HCM A;  4NQG A;  1QV1 A;  1M63 B;  2L2E A;  1V1F A;  2JNF A;  3VRR A;  5AEQ A;  3UO9 A;  1Q80 A;  1UHJ A;  1S5G Y;  2BCB A;  4CFQ A;  2YGU A;  1B8L A;  1G8I A;  3S0F A;  1CNP A;  1Y0V H;  1PRW A;  2MAZ A;  4N5X A;  1J7P A;  4OCI A;  4YGB B;  2BAP A;  1B8R A;  1C7W A;  1AK8 A;  2JWW A;  1UHK A;  3LK1 A;  1QTX A;  1XFR A;  2CNP A;  3BFB A;  2KGB C;  1QAT A;  3B6X A;  3TUY C;  1NX3 A;  2PMY A;  5I94 A;  2LCP A;  2BBN A;  3FWC A;  5DKR A;  2M7L A;  1H8B A;  3D74 A;  3OBV A;  2WCL A;  1YUU A;  2MHH A;  2E6W A;  2Q91 A;  1OW4 A;  3BOW B;  2M1K B;  2WCJ A;  4D1E A;  3VGO A;  3DF0 A;  3ICB A;  2BKI B;  1LA3 A;  3BOW A;  3IVT A;  3WHU B;  3ZWH A;  2CT9 A;  1C07 A;  3A4U B;  3SS3 A;  1EJ3 A;  3K1E A;  3BJH A;  3B88 A;  2H61 C;  3PM8 A;  2H8V A;  3S0B A;  1NSH A;  2JPT A;  3FE8 A;  1NIW A;  2L4H A;  1RWY A;  2LMV A;  1SR6 B;  2L0P A;  1SRA A;  1KFX L;  2F8P A;  4GPL B;  4FQT A;  2QEB A;  3GOF A;  1SR6 C;  3SIA A;  2LHL A;  2BE4 A;  3EKH A;  3QRX A;  3PLF B;  3FWB A;  3R72 A;  1BF5 A;  2L4I A;  1CTR A;  2KLE A;  1G4Y R;  3CYZ A;  5TNC A;  1QX2 A;  1JC2 A;  5PAL A;  2Y5I A;  1JF2 A;  1F54 A;  1XFX O;  2QPT A;  1UHN A;  2MJW B;  3DVJ A;  3IQO A;  2LE9 B;  1U5I A;  4AQJ A;  1J7R A;  1Y1U A;  2ZN8 A;  1TNX A;  5D7F A;  1V1G A;  1C3Y A;  1SL7 A;  2KAV A;  3BUN B;  1BR1 B;  1TNP A;  1CFD A;  1S5G Z;  4YGA A;  1S1E A;  3BUM B;  5ER4 X;  1MHO A;  2ZN9 A;  4YRU A;  1DJZ A;  3B86 A;  2JNX A;  3D75 A;  2ZKM X;  2LP3 A;  1NX1 A;  2WCE A;  4YI9 A;  2LMU A;  3CR4 X;  1XYD A;  3I5F B;  5D3O A;  4DCK A;  1K95 A;  1YVH A;  1QVI Y;  2JOJ A;  3I5F C;  3SG2 A;  2K0J A;  1ALW A;  4I5L B;  1DEL A;  3EK7 A;  2D8N A;  1N2D A;  2JXC A;  2K61 A;  1OOJ A;  3FS7 A;  4R1E A;  3SG5 A;  1Z4H A;  1TNW A;  3CGA A;  3CTN A;  1KWO B;  4WRI A;  2NLN A;  1YX7 A;  1KWO C;  2JTT A;  4I5N B;  2WCH A;  1LIN A;  1QXP A;  2KOT A;  4ORB B;  1AUI B;  4OKH A;  2Y1N A;  1QLK A;  1ZOT B;  4YI8 A;  4YGD B;  4GGF C;  1IJ5 A;  2LLU A;  1SCM C;  1YUS A;  2M7N A;  3BUO B;  4PHJ A;  5ER5 A;  2LLS A;  2QDI A;  1IIO A;  1W7J B;  1QX7 A;  1KK7 Y;  2LP2 A;  1SCV A;  2K7C A;  1LKJ A;  1SPY A;  1EXR A;  1C3Z A;  2VRG A;  3I5H B;  3KHE A;  3PJI A;  2COL B;  1OZO A;  2M97 A;  4QJ3 B;  3I5H C;  1KSO A;  2F33 A;  3BXK A;  3EKJ A;  2MLE C;  1ALV A;  2KI6 C;  3SJS A;  1KK8 C;  2G2B A;  1AJ4 A;  3C1V A;  4GBA A;  2P71 A;  5CSI A;  4YGC B;  3L4L A;  3EK4 A;  3O4Y A;  2K7D A;  1SYM A;  2KQY A;  3TDU A;  1S3P A;  3CDN A;  2L50 A;  4BY5 A;  1BR4 B;  1TN4 A;  5GQQ C;  4DUQ A;  3IF7 A;  5K89 A;  1CFP A;  1IG5 A;  3S0A A;  2O60 A;  5CSJ A;  1FW4 A;  3BYA A;  3OGN A;  4WQ2 A;  1DEK A;  2PVB A;  4M2P A;  1JUO A;  4PCW A;  1F4O A;  2EGD A;  1NX0 A;  1SW8 A;  2MLF C;  2M8U A;  2ZRS A;  2LVV A;  3BFA A;  1EL4 A;  5D69 A;  1K96 A;  2F2P A;  2LLT A;  3DVK A;  5BPJ A;  4FTG A;  1BOC A;  2LVK A;  1YRT B;  3CWG A;  1OMV A;  1EG4 A;  4IL1 A;  4GAO A;  4JQ0 D;  2FOT A;  4TNC A;  1ODB A;  2SCP A;  1MQ1 A;  1F4Q A;  4PT1 A;  3O78 A;  1S36 A;  1ZUZ A;  2KAX A;  3AAK A;  4ETO A;  1GGZ A;  1RFJ A;  1M45 A;  1CMF A;  1B7T Y;  3SS4 A;  1MR8 A;  2BCA A;  3KF9 A;  1DF0 A;  1SNL A;  2M0R A;  2BL0 B;  2M49 B;  2JT0 A;  1TCF A;  1MWN A;  2R2I A;  3JTD B;  3MSE B;  1JBA A;  3PSR A;  1XFU O;  1GJY A;  2FCD A;  3CZT X;  3DVE A;  2JPO A;  3JTD C;  2JU0 A;  3CZ0 A;  3BUX B;  1UP5 A;  1S6C A;  2KYC A;  2PAL A;  2WCK A;  4CID A;  1CFC A;  2PAS A;  2BBM A;  2QAC A;  3DF0 B;  1KK7 Z;  1EH2 A;  2KFF A;  2MA2 A;  2WCF A;  3AKB A;  4DRW A;  1HQV A;  1KQM B;  3PAT A;  1SMG A;  4DIR A;  3O4X A;  3GK1 A;  5HKZ A;  1SL9 A;  2NCO A;  3I5I B;  1F71 A;  2CCM A;  4OR9 B;  3CAB A;  1A4P A;  3R1O A;  4I5J A;  1J55 A;  3L47 A;  2I2R E;  2JQ6 A;  1CLB A;  2EC6 B;  3TS5 B;  4NDC A;  1HT9 A;  4OVN F;  2EC6 C;  3TS5 C;  3HX4 A;  1YUT A;  3V2L A;  1YR5 A;  3DD4 A;  4C0K A;  2M3W A;  4PE1 A;  4CLN A;  1CB1 A;  2KPH A;  1CMG A;  5I2Q A;  4ORA B;  3VRO A;  2V53 A;  2K7B A;  3ZNI A;  1TNQ A;  2JUL A;  1CFF A;  1AJ5 A;  3NSI A;  1U5I B;  2LV7 A;  3QME A;  2OPO A;  2WND A;  1CDL A;  4ICB A;  4INX A;  3NGV A;  5DKQ A;  1S6I A;  2FCE A;  3LCP C;  3TDZ A;  1TUJ A;  2A4J A;  2AMI A;  1M39 A;  1NCX A;  3LLE A;  1CM1 A;  1Y6W A;  1B7T Z;  1PK0 D;  4A4B A;  1XFV O;  2HPS A;  2RGI A;  1XK4 A;  3I5G B;  4P2Y B;  2CXJ A;  3VRP A;  1DJW A;  3FE6 A;  3I5G C;  1XVJ A;  2ZNE A;  2JC2 A;  4GFT A;  2F3Y A;  4MSP A;  2LM5 A;  5CSN A;  1BG1 A;  1DQE A;  2Q4U A;  3DVM A;  3E3R A;  1IQ5 A;  4PE7 A;  2KBM A;  1WRL A;  2KI4 B;  1J1E A;  3DY9 A;  5AAN A;  4PE0 A;  1TWO A;  2WCM A;  2KI4 C;  1KCY A;  2JRF A;  2HQW A;  1EG3 A;  3S0D A;  1OOI X;  2KAY A;  2M1U A;  4IJ7 A;  1TRF A;  1QIV A;  1K90 D;  2WC6 A;  3F45 A;  2L98 A;  3OB2 B;  1TOP A;  4GUK A;  4MZK A;  1PAL A;  4A4C A;  4QJ4 B;  2JZI A;  2CTN A;  2BE6 A;  1L2O B;  3FIA A;  1OOF A;  5HKW A;  2Y1M A;  4JD9 A;  1R6P A;  2HF5 A;  2JXL A;  3B7A A;  1E8A A;  1REC A;  5G08 A;  2BNX A;  5AFP A;  1NX2 A;  3O6B A;  5F6T A;  3SG4 A;  5FI2 A;  1TUZ A;  1DJY A;  1J1D A;  1QLS A;  1IJ6 A;  1OOG A;  1OZS A; 
#chains in the Genus database with same CATH homology
 1SK6 D;  2GGZ A;  1BJF A;  3A8R A;  3EVR A;  4HRG A;  3SG7 A;  3PFV A;  1OE9 B;  1XA5 A;  4C0L A;  2I7A A;  4PHN A;  3EK8 A;  1UUS A;  3CR2 A;  3EVV A;  3GK2 A;  3OB1 B;  1IWQ A;  2K8M B;  1G33 A;  4JPZ B;  1W7I B;  4XYN A;  2PSR A;  2ZRT A;  1GGW A;  4NDD A;  1DJH A;  4USL A;  2JT8 A;  3SIB A;  2I94 A;  4MZL A;  1RRO A;  1K9P A;  2P6B B;  3OX5 A;  1WLM A;  1M31 A;  4MRX A;  1S26 D;  1IH0 A;  1PUL A;  1K9U A;  1QVI Z;  2GGM A;  3NSK A;  3K21 A;  3GK4 X;  2BCX A;  1DGU A;  4PHM A;  1FPW A;  1IKU A;  2JT3 A;  4MEW A;  1DF0 B;  1QV0 A;  4ORC B;  3AKA A;  3NSL A;  2KHN A;  2LNK A;  1MUX A;  3PN7 B;  5KSZ A;  1SY9 A;  3NXA A;  1A75 A;  3PN7 C;  5KTY A;  1R2U A;  2EHB A;  1PVA A;  1BLQ A;  1KFU S;  2B1U A;  2BL0 C;  5J3X A;  4AQI A;  1JWD A;  3LK0 A;  1N0Y A;  5I2L A;  1WRK A;  2O5G A;  1XO5 A;  1ZMZ A;  4Q04 A;  4OV2 A;  3RM1 A;  4WQ3 A;  1B8C A;  1A29 A;  2E30 A;  1JFJ A;  1LVC D;  3WNX B;  1YTZ C;  2OS8 B;  4AOM A;  4HRH A;  3BQ3 A;  4MVF A;  1K94 A;  2OS8 C;  4MRY A;  1KQV A;  1KQM C;  3WHT B;  1B9A A;  1BT6 A;  2LHI A;  4I5K A;  1F55 A;  2KBI A;  3I5I C;  2F3Z A;  2KSP A;  3O2P A;  3TUY B;  2L51 A;  3PAL A;  1AHR A;  2NZ0 A;  1CDM A;  5I8N A;  1A2X A;  1DT7 B;  2NCP A;  1NCZ A;  1Y1X A;  5HLV A;  5FYX A;  1BOD A;  1MF8 B;  2KQ6 A;  5I2O A;  4E68 A;  1DVI A;  1NUB A;  1OSA A;  2WOS A;  4XJK B;  1JFK A;  1S6J A;  2KI6 D;  3KO0 A;  1NPQ A;  5HLO A;  1PSB A;  1DMO A;  2NXQ A;  1IRJ A;  1H4B A;  4XJK A;  4BY4 A;  1DGV A;  3JVT B;  5HKY A;  1ZAC A;  5B8I B;  1XFY O;  3CLN A;  3JVT C;  1TTX A;  1JF0 A;  1F70 A;  1MXE A;  1LA0 A;  5CSF A;  4GNK B;  2KGR A;  2AUC A;  5JOL A;  1CLL A;  4U8D A;  1UWO A;  1ZFS A;  2H61 A;  1M46 A;  2TN4 A;  4CFR A;  2LUX A;  1B4C A;  3BUW B;  1FBV A;  1WY9 A;  1K93 D;  1IGV A;  2KNE A;  1XFZ O;  4ZCU A;  3VRQ A;  5AXI A;  2DOQ A;  1YRU B;  1D1O A;  1XK4 C;  1DJI A;  1OQP A;  1K8U A;  4PHK A;  1X02 A;  1UHH A;  1XFW O;  4CPV A;  2FJU B;  1IQ3 A;  4GGN A;  1DTL A;  1DJG A;  3OX6 A;  1TIZ A;  2SAS A;  2LC5 A;  2LVI A;  3D0Y B;  2KYF A;  1OMR A;  4M2O A;  2PRU A;  4MLW A;  3D0Y A;  4N1F A;  1AP4 A;  3CR5 X;  1KSM A;  2MBX A;  3WXA A;  1C7V A;  3CS1 A;  1CLM A;  4HSZ A;  1MXL C;  4MN0 A;  1VRK A;  2WC8 A;  3OP0 A;  1WDC B;  1YVL A;  2GV5 A;  1B1G A;  5KU1 A;  3LL8 B;  1KFX S;  1WDC C;  1L2O C;  3TDI A;  2K2A A;  3H4S E;  3RLZ A;  2M29 A;  1SL8 A;  4YGE B;  2LVJ A;  2AAO A;  3KPX A;  4YBH B;  1J7Q A;  2M9G A;  4FQO A;  1FI6 A;  1AVS A;  2KFG A;  1CDP A;  1DJX A;  3KEV A;  2LAN A;  4HRE E;  2MRD A;  2I18 A;  4M2Q A;  2L5X B;  1SCM B;  4F0Z B;  1SKT A;  1UUR A;  4GGF A;  1CKK A;  1KFU L;  1LXF C;  4DS7 A;  2WOR A;  2CBL A;  1WLZ A;  1F8H A;  1K9K A;  1TCO B;  1N65 A;  2JTZ A;  2OTG B;  1A03 A;  4UPG A;  1L7Z A;  1FF1 A;  1GQM A;  2OTG C;  2ISD A;  1NCY A;  5DKN A;  5IBW A;  4JWQ A;  1CDN A;  1QJT A;  1JSA A;  2LMT A;  3EVU A;  4MBE A;  1YUR A;  1J7O A;  2ZFD A;  2BEC A;  2K7O A;  3VRN A;  1KK8 B;  3AAJ A;  5CPV A;  1BMO A;  3OHM B;  2H2K A;  1QAS A;  4NDB A;  2HQ8 A;  5HYD A;  1RJV A;  3IQQ A;  4QJ5 B;  4MZJ A;  2ZND A;  2G9B A;  1WRZ A;  1CM4 A;  1Y1A A;  2KFH A;  3SG3 A;  4N1G A;  1FI5 A;  4P5O E;  1NYA A;  1B47 A;  1SBJ A;  3M0W A;  1RK9 A;  2BKH B;  4L9M A;  3TZ1 A;  2IS9 A;  3VRP A;  1A75 B;  2WCB A;  1K2H A;  4ZCV A;  1OMD A;  1YX8 A;  2LAP A;  4PE4 A;  3SG6 A;  4PAL A;  2F2O A;  4PDZ A;  2K2F A;  2HET A;  2KDH A;  4C0J A;  1QIW A;  1UHI A;  5AER A;  1NP8 A;  3D10 A;  1PVB A;  2LUC A;  1NWD A;  1RTP 1;  5JJG A;  1PSR A;  1QS7 A;  3NSO A;  1QX5 B;  2Y4Q A;  1BU3 A;  3HCM A;  4NQG A;  1QV1 A;  1M63 B;  2L2E A;  1V1F A;  2JNF A;  3VRR A;  5AEQ A;  1Q80 A;  1UHJ A;  1S5G Y;  2BCB A;  4CFQ A;  1B8L A;  1G8I A;  1CNP A;  1Y0V H;  1PRW A;  2MAZ A;  4N5X A;  1J7P A;  4OCI A;  4YGB B;  1B8R A;  1C7W A;  1AK8 A;  2JWW A;  1UHK A;  3LK1 A;  1QTX A;  2CNP A;  3TUY C;  2KGB C;  1QAT A;  1NX3 A;  2PMY A;  2LCP A;  2BBN A;  3FWC A;  5DKR A;  2M7L A;  1H8B A;  1YUU A;  2MHH A;  2E6W A;  2Q91 A;  3BOW B;  2M1K B;  4D1E A;  3VGO A;  3DF0 A;  3ICB A;  2BKI B;  1LA3 A;  3BOW A;  3WHU B;  3ZWH A;  2CT9 A;  1C07 A;  3A4U B;  1EJ3 A;  2H61 C;  3PM8 A;  1NSH A;  2JPT A;  1NIW A;  2L4H A;  1RWY A;  2LMV A;  1SR6 B;  2L0P A;  1SRA A;  1KFX L;  2F8P A;  4GPL B;  3GOF A;  3SIA A;  1SR6 C;  2LHL A;  2BE4 A;  3EKH A;  3QRX A;  3PLF B;  3FWB A;  1BF5 A;  2L4I A;  1CTR A;  1JC2 A;  1G4Y R;  5TNC A;  1QX2 A;  5PAL A;  2Y5I A;  1JF2 A;  1F54 A;  1XFX O;  2QPT A;  1UHN A;  2MJW B;  3DVJ A;  3IQO A;  2LE9 B;  1U5I A;  4AQJ A;  1J7R A;  1Y1U A;  2ZN8 A;  1TNX A;  5D7F A;  1V1G A;  1SL7 A;  2KAV A;  3BUN B;  1BR1 B;  1TNP A;  1CFD A;  1S5G Z;  4YGA A;  1S1E A;  3BUM B;  5ER4 X;  1MHO A;  2ZN9 A;  4YRU A;  1DJZ A;  2JNX A;  2ZKM X;  2LP3 A;  1NX1 A;  2WCE A;  4YI9 A;  2LMU A;  3CR4 X;  1XYD A;  3I5F B;  4DCK A;  1K95 A;  1YVH A;  1QVI Y;  2JOJ A;  3I5F C;  3SG2 A;  2K0J A;  1ALW A;  4I5L B;  3EK7 A;  2D8N A;  1N2D A;  2JXC A;  2K61 A;  1OOJ A;  3FS7 A;  4R1E A;  3SG5 A;  4WRI A;  1TNW A;  3CGA A;  3CTN A;  1KWO B;  2NLN A;  1YX7 A;  1KWO C;  2JTT A;  4I5N B;  1LIN A;  1QXP A;  2KOT A;  4ORB B;  1AUI B;  4OKH A;  2Y1N A;  1QLK A;  1ZOT B;  4YI8 A;  4YGD B;  4GGF C;  1IJ5 A;  2LLU A;  1SCM C;  1YUS A;  2M7N A;  3BUO B;  4PHJ A;  5ER5 A;  2LLS A;  1W7J B;  1QX7 A;  1KK7 Y;  2LP2 A;  1SCV A;  2K7C A;  1LKJ A;  1SPY A;  1EXR A;  2VRG A;  3I5H B;  3KHE A;  2COL B;  1OZO A;  2M97 A;  4QJ3 B;  3I5H C;  1KSO A;  2F33 A;  3BXK A;  3EKJ A;  2MLE C;  1ALV A;  2KI6 C;  3SJS A;  1KK8 C;  2G2B A;  1AJ4 A;  3C1V A;  4GBA A;  5CSI A;  4YGC B;  3TDU A;  3EK4 A;  3O4Y A;  2K7D A;  1SYM A;  2KQY A;  1S3P A;  2L50 A;  4BY5 A;  1BR4 B;  1TN4 A;  5GQQ C;  4DUQ A;  3IF7 A;  5K89 A;  1CFP A;  1IG5 A;  2O60 A;  5CSJ A;  1FW4 A;  3BYA A;  4WQ2 A;  2PVB A;  4M2P A;  1JUO A;  4PCW A;  1F4O A;  2EGD A;  1NX0 A;  1SW8 A;  2MLF C;  2M8U A;  2ZRS A;  2LVV A;  1EL4 A;  5D69 A;  1K96 A;  2F2P A;  2LLT A;  3DVK A;  5BPJ A;  4FTG A;  1BOC A;  2LVK A;  1YRT B;  3CWG A;  1OMV A;  1EG4 A;  4IL1 A;  4GAO A;  4JQ0 D;  2FOT A;  4TNC A;  1ODB A;  2SCP A;  1MQ1 A;  1F4Q A;  3O78 A;  1S36 A;  1ZUZ A;  2KAX A;  3AAK A;  4ETO A;  1GGZ A;  1RFJ A;  1M45 A;  1CMF A;  1B7T Y;  1MR8 A;  2BCA A;  3KF9 A;  1DF0 A;  1SNL A;  2M0R A;  2BL0 B;  2M49 B;  2JT0 A;  1TCF A;  1MWN A;  2R2I A;  3JTD B;  3MSE B;  1JBA A;  3PSR A;  1XFU O;  1GJY A;  2FCD A;  3CZT X;  3DVE A;  3JTD C;  2JU0 A;  3BUX B;  1UP5 A;  1S6C A;  2KYC A;  2PAL A;  4CID A;  1CFC A;  2PAS A;  2BBM A;  2QAC A;  3DF0 B;  1KK7 Z;  1EH2 A;  2KFF A;  2MA2 A;  2WCF A;  3AKB A;  4DRW A;  1HQV A;  1KQM B;  3PAT A;  1SMG A;  4DIR A;  3GK1 A;  5HKZ A;  1SL9 A;  2NCO A;  3I5I B;  1F71 A;  2CCM A;  4OR9 B;  1A4P A;  4I5J A;  1J55 A;  2I2R E;  2JQ6 A;  1CLB A;  2EC6 B;  3TS5 B;  4NDC A;  1HT9 A;  4OVN F;  2EC6 C;  3TS5 C;  3HX4 A;  1YUT A;  1YR5 A;  3DD4 A;  4C0K A;  2M3W A;  4PE1 A;  4CLN A;  1CB1 A;  1CMG A;  5I2Q A;  4ORA B;  3VRO A;  2V53 A;  2K7B A;  3ZNI A;  1TNQ A;  2JUL A;  1CFF A;  1AJ5 A;  3NSI A;  1U5I B;  2LV7 A;  2OPO A;  2WND A;  1CDL A;  4ICB A;  5DKQ A;  1S6I A;  2FCE A;  3LCP C;  3TDZ A;  2A4J A;  2AMI A;  1M39 A;  1NCX A;  3LLE A;  1CM1 A;  1Y6W A;  1B7T Z;  1PK0 D;  4A4B A;  1XFV O;  2HPS A;  2RGI A;  1XK4 A;  3I5G B;  4P2Y B;  2CXJ A;  1DJW A;  3I5G C;  1XVJ A;  2ZNE A;  2JC2 A;  4GFT A;  2F3Y A;  4MSP A;  2LM5 A;  5CSN A;  1BG1 A;  2Q4U A;  3DVM A;  3E3R A;  1IQ5 A;  4PE7 A;  2KBM A;  1WRL A;  2KI4 B;  1J1E A;  5AAN A;  4PE0 A;  2KI4 C;  1KCY A;  2JRF A;  2HQW A;  1EG3 A;  2KAY A;  2M1U A;  1TRF A;  1QIV A;  1K90 D;  3F45 A;  3OB2 B;  2L98 A;  4GUK A;  1TOP A;  4MZK A;  4A4C A;  1PAL A;  4QJ4 B;  2JZI A;  2CTN A;  2BE6 A;  1L2O B;  3FIA A;  5HKW A;  2Y1M A;  1R6P A;  2HF5 A;  2JXL A;  1E8A A;  1REC A;  5G08 A;  5AFP A;  1NX2 A;  3O6B A;  5F6T A;  3SG4 A;  1DJY A;  1J1D A;  1QLS A;  1IJ6 A;  1OZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...