3WHTB

Crystal structure of ergic-53/mcfd2, calcium-free form
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
61
Chain Sequence
QELQLHYFKMHDYDGNNLLDGLELSTAILMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 61
sequence length 74
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3whtB00
3WHUB 2M1KB 2ISDA 4JQ0D 1U5IB 4NDCA 2SCPA 1GQMA 3TS5C 2GGMA 4YI8A 1CLBA 1HT9A 1CDLA 1PVBA 1H4BA 2WCBA 4DCKA 1ZMZA 4XYNA 3I5FC 3BUMB 2F3YA 2OS8C 2AAOA 1E8AA 2B1UA 2JT0A 3EKHA 1A75B 1KQMB 3I5IB 1SRAA 2JU0A 4GGFA 3ICBA 1TNPA 3TUYC 1RWYA 1AJ4A 2KGRA 3LL8B 2BCXA 1CM4A 2BECA 1PALA 1Y1XA 2F2OA 3TUYB 1AJ5A 2IS9A 3AAKA 2FCDA 2WNDA 2FJUB 2NZ0A 2ZRTA 1SL7A 1V1FA 1Y6WA 2MLFC 4U8DA 1AUIB 2JC2A 3EVVA 1J1EA 2NLNA 1WLZA 1EXRA 3SIBA 1JC2A 4M2QA 2HPSA 5JOLA 1SBJA 1W7IB 3TZ1A 2QPTA 3DVJA 4I5NB 1FW4A 1B7TZ 1XFZO 4I5JA 3NSLA 3DVMA 1GGZA 3GK1A 1XFUO 3PLFB 5AEQA 1TNQA 2I2RE 1DGUA 1G4YR 1QATA 1NX1A 3BQ3A 5HLOA 3O4YA 4PDZA 2A4JA 2AUCA 4CIDA 2LLSA 5TNCA 1QLKA 1UHIA 3DVKA 3A4UB 4YGAA 3OHMB 1CKKA 2L0PA 1NX3A 1OSAA 1QX2A 3GK2A 4M2OA 4YRUA 2ZN8A 4WQ3A 1A4PA 3SG4A 1ZFSA 5JJGA 1QIWA 2HETA 3PM8A 5I2OA 1F55A 5CSJA 3A8RA 2CBLA 2JXLA 1KFXS 3EVUA 1S3PA 1F70A 1KK7Y 5AFPA 1S6JA 1W7JB 1TNXA 1QS7A 2KAVA 2KI6C 5I2LA 1A29A 4HREE 1GGWA 2MHHA 3SG7A 2AMIA 2GV5A 4HSZA 2LMVA 1KWOC 2K8MB 4ZCVA 1SK6D 1ALWA 2F2PA 1H8BA 4WQ2A 1QTXA 1IJ6A 1KWOB 2F33A 2H61A 2Y1NA 2LV7A 2BL0B 2BBMA 5DKRA 2M9GA 3ZNIA 1EJ3A 2JTTA 4MSPA 1PVAA 1LA3A 1DJHA 2OPOA 3GOFA 4YGEB 3OB2B 2BCAA 1BODA 1N2DA 3DF0A 4MZJA 1J7PA 1JSAA 2JQ6A 1V1GA 2EGDA 2KFFA 2V53A 2DOQA 1YX8A 2F8PA 1L2OC 1NCXA 3H4SE 4PHKA 1AP4A 2LVJA 2CNPA 2JNFA 4NQGA 5K89A 3BUNB 3HCMA 3EK8A 3PATA 1XYDA 4OV2A 2KNEA 2RGIA 1QX7A 3TDZA 1JBAA 2BE4A 3VRNA 3LK1A 1NPQA 1DVIA 2LP3A 2NXQA 1QLSA 3BOWA 4DS7A 2M7NA 1QASA 1BR4B 1TOPA 1BMOA 1XK4A 1XO5A 3PN7C 4NDDA 1B47A 4AQJA 5BPJA 5GQQC 1CFCA 1K90D 3PN7B 1JF0A 1KK8B 5IBWA 2KAXA 2EC6C 2KOTA 3VGOA 5ER4X 3PALA 2I7AA 2SASA 1L7ZA 1SR6B 1M31A 1SCVA 3WHTB 1XFVO 1NCYA 3RM1A 2ZFDA 4A4CA 2ZKMX 1MR8A 2I18A 4XJKA 3LCPC 3I5GB 5DKQA 1RJVA 2KYFA 4E68A 1IKUA 3BUWB 1IG5A 1XFWO 1CB1A 5HKWA 2KFGA 1KCYA 4R1EA 1RROA 4GUKA 2LP2A 3KO0A 4GGFC 1MWNA 1M46A 3MSEB 5PALA 3TS5B 4CPVA 1IGVA 3O2PA 2E30A 1C7VA 3EVRA 2G2BA 1QVIY 4AQIA 3I5FB 5D7FA 2OS8B 2LNKA 3WNXB 1BU3A 2LHIA 2M7LA 1PRWA 3CS1A 1R2UA 2O5GA 3AKBA 3KF9A 2HQWA 2R2IA 3AAJA 2WORA 1YUTA 1ZUZA 3TDIA 2MBXA 4YGBB 4MVFA 2OTGC 1DT7B 1JWDA 2LC5A 2CTNA 1NX2A 1JFKA 2K7OA 1N0YA 1CMFA 2JT8A 3I5HC 3O78A 1B4CA 1QIVA 2LAPA 4PE4A 2M0RA 1S1EA 4JWQA 3I5HB 3KPXA 5D69A 1CLMA 1A75A 1OMVA 1LA0A 1DF0A 1J7OA 1RK9A 1WLMA 2M8UA 2PSRA 1AVSA 4DRWA 2JRFA 2KHNA 3HX4A 3M0WA 1DMOA 2TN4A 1J55A 1DJGA 3CR5X 4ZCUA 2ZN9A 1SCMC 2PVBA 2CCMA 4I5LB 4PE1A 1JFJA 1PULA 1K8UA 1SPYA 1TNWA 5I8NA 2ZNDA 1K95A 1SL8A 5ER5A 1UHHA 4YGDB 5CPVA 3NXAA 2KYCA 2BKHB 4OVNF 1A03A 1F4QA 1K93D 1F54A 3FIAA 4L9MA 4QJ3B 2KBMA 2LMUA 4M2PA 1K2HA 2BCBA 1SMGA 1QXPA 1TCFA 4C0LA 1NWDA 3IQOA 1EH2A 2D8NA 2L51A 1YRUB 5KSZA 2PMYA 3BXKA 2M29A 1SW8A 3VRQA 2G9BA 1KQVA 1J1DA 1CDPA 5AANA 4GBAA 2JPTA 2K7BA 2P6BB 2H61C 4TNCA 1CFPA 5AXIA 2LLUA 3D10A 3DD4A 3IQQA 3NSKA 4HRHA 1NP8A 5KTYA 1UP5A 3LLEA 4PE7A 3CTNA 4PCWA 1F71A 3CZTX 1KFXL 3EKJA 1VRKA 3VROA 2PALA 3FWBA 2L98A 4MZLA 4A4BA 1B1GA 3DF0B 1IQ5A 1B8RA 2MAZA 3OX5A 1CDMA 4WRIA 4D1EA 2NCPA 2K7DA 4QJ4B 2LVIA 5J3XA 2LMTA 1IRJA 4JPZB 1WRLA 1TIZA 1NUBA 2JULA 1DJYA 1L2OB 1LXFC 3CR4X 1OOJA 1CMGA 2LM5A 3PSRA 1XK4C 3KEVA 1UHNA 1C07A 1TRFA 1BF5A 2K61A 1ODBA 2H2KA 1CFDA 1S26D 5B8IB 1OQPA 1CM1A 2JNXA 3D0YB 2JWWA 4QJ5B 1K94A 3LK0A 2MRDA 1G33A 3O6BA 2Y4QA 1B7TY 3CR2A 2LUCA 1NX0A 1FF1A 1C7WA 2EC6B 1FI5A 1Y1AA 1IWQA 1SYMA 2KI4C 3JVTC 5CSIA 3E3RA 3JTDC 1YUSA 3NSOA 3JVTB 2KI4B 1PSBA 1KFUL 2MLEC 2Y1MA 3RLZA 2JOJA 1BJFA 3PFVA 2KBIA 2L50A 2LUXA 4OR9B 1MHOA 4P5OE 1EG4A 1OZSA 2WCFA 1CLLA 3IF7A 1QX5B 4GAOA 1R6PA 1WRKA 2ZNEA 1QJTA 1DJWA 2WOSA 3EK7A 2L4IA 4PALA 1TTXA 1F8HA 1Q80A 4N1FA 4P2YB 2BE6A 4MBEA 4I5KA 1NSHA 1SL9A 1CTRA 1UHKA 3SJSA 2HQ8A 1G8IA 1U5IA 1K96A 3AKAA 2Q4UA 1J7QA 1WDCC 3CWGA 3OP0A 1KQMC 1ALVA 1MXEA 2OTGB 3I5IC 4OKHA 1K9KA 1WDCB 2Y5IA 1DJIA 1NCZA 1DF0B 1LINA 1Y0VH 2COLB 5F6TA 1K9PA 1DTLA 1WRZA 1RECA 1CNPA 4BY5A 1CDNA 2I94A 1YVLA 3KHEA 3QRXA 1XA5A 1OZOA 1B9AA 4MN0A 2LHLA 3TDUA 1ZOTB 1YX7A 3FWCA 1YTZC 4PHNA 3F45A 1RFJA 3OB1B 4PHJA 1SCMB 4GGNA 4USLA 1S5GZ 3SG5A 4Q04A 5HKZA 1SY9A 1XFXO 3VRRA 2LLTA 3SIAA 1JF2A 1UWOA 4GNKB 2KAYA 3SG6A 4DIRA 4YBHB 3VRPA 4ICBA 2E6WA 3SG3A 2KDHA 2Q91A 1PK0D 1ZACA 1SNLA 1WY9A 1BT6A 2LVVA 2NCOA 1BR1B 1HQVA 1MF8B 1AHRA 2F3ZA 2JXCA 4GFTA 2K7CA 3ZWHA 3BUOB 2WC8A 1K9UA 1N65A 2LANA 1UUSA 2K0JA 2L2EA 1DGVA 1TCOB 1MQ1A 5DKNA 2L4HA 2FOTA 1D1OA 1RTP1 5FYXA 4ORCB 4MRYA 2M1UA 1DJZA 1NYAA 4FQOA 1JUOA 1B8CA 4ORBB 3NSIA 1TN4A 1QVIZ 4N1GA 2KFHA 1XFYO 2PRUA 4F0ZB 4FTGA 1FPWA 2FCEA 1F4OA 3C1VA 4C0JA 2KSPA 4ORAB 1EG3A 1PSRA 2PASA 3BYAA 2CXJA 1BOCA 1UHJA 1Y1UA 5HKYA 4OCIA 1YUUA 1M63B 4ETOA 3BUXB 3K21A 1KSOA 2LE9B 4BY4A 4C0KA 4CFRA 5AERA 4PHMA 2M97A 4MZKA 4NDBA 2VRGA 4UPGA 2BL0C 1B8LA 4CFQA 2JT3A 3WXAA 1IQ3A 1S6IA 1BLQA 3BOWB 5HLVA 1M45A 4CLNA 1XVJA 3CGAA 1KSMA 2KQYA 1FI6A 1QV0A 2JTZA 1A2XA 1LKJA 2JZIA 2ZRSA 4HRGA 1M39A 4AOMA 2KQ6A 1SKTA 4MRXA 3OX6A 2KI6D 4PE0A 2MA2A 4IL1A 1X02A 3FS7A 2GGZA 1YURA 2K2FA 1OMDA 2QACA 2K2AA 5KU1A 2CT9A 3GK4X 1QV1A 4GPLB 1S6CA 1YVHA 4XJKB 1MUXA 5CSFA 1IH0A 2L5XB 5I2QA 2EHBA 4MLWA 3JTDB 1UURA 2O60A 4YGCB 1YRTB 1KK8C 2BBNA 3CLNA 1S5GY 1KFUS 1NIWA 2HF5A 3DVEA 1CFFA 5G08A 5CSNA 2BKIB 5HYDA 1BG1A 3D0YA 1OMRA 1SR6C 2WCEA 2M49B 1MXLC 1S36A 4DUQA 2KGBC 3EK4A 1FBVA 1KK7Z 2MJWB 1J7RA 1GJYA 4N5XA 4YI9A 1AK8A 1IJ5A 1OE9B 3SG2A 3I5GC 2M3WA 2LVKA 1LVCD 1EL4A 4MEWA 1DJXA 1YR5A 2LCPA
chains in the Genus database with same CATH superfamily
3WHUB 2JPOA 2M1KB 2ISDA 4JQ0D 1U5IB 4NDCA 5D3OA 2SCPA 1GQMA 3TS5C 3L4LA 2GGMA 4YI8A 1CLBA 1HT9A 1CDLA 1PVBA 1H4BA 3VB1A 2WCBA 4DCKA 1ZMZA 4XYNA 3I5FC 3BUMB 2F3YA 2OS8C 2AAOA 1E8AA 2B1UA 2JT0A 3EKHA 1A75B 1KQMB 3I5IB 1SRAA 2JU0A 4GGFA 3ICBA 1TNPA 1W9ZA 3S0DA 3TUYC 1RWYA 1AJ4A 2KGRA 3LL8B 2BCXA 1CM4A 1PALA 2BECA 3B86A 1Y1XA 2F2OA 3NGVA 1AJ5A 2IS9A 3AAKA 3TUYB 1OW4A 2FCDA 2WNDA 2FJUB 2NZ0A 2ZRTA 3V2LA 1SL7A 1V1FA 1Y6WA 2MLFC 4U8DA 1AUIB 2JC2A 3EVVA 1J1EA 2NLNA 1WLZA 3D73A 1EXRA 3SIBA 1JC2A 3BFAA 4M2QA 2HPSA 5JOLA 1SBJA 1W7IB 3TZ1A 2QPTA 3DVJA 4I5NB 1FW4A 1B7TZ 1XFZO 4I5JA 3NSLA 3CYZA 3DVMA 1GGZA 1Z2CB 3GK1A 1LS8A 1XFUO 2FJYA 3PLFB 5AEQA 1OOFA 1TNQA 3UNWA 2I2RE 1DGUA 1G4YR 1QATA 1NX1A 3BQ3A 5HLOA 3O4YA 2WCLA 4PDZA 2A4JA 2AUCA 4CIDA 2LLSA 5TNCA 1QLKA 1UHIA 3DVKA 3A4UB 3CZ0A 3CZ1A 4YGAA 3OHMB 1CKKA 2BAPA 2L0PA 1NX3A 1OSAA 1QX2A 3S0EA 3GK2A 4M2OA 4YRUA 2ZN8A 4WQ3A 1A4PA 3R72A 3SG4A 1ZFSA 3FE8A 1QIWA 2HETA 5JJGA 2QEVA 2WC5A 3PM8A 5I2OA 1F55A 5CSJA 3A8RA 5FI6A 2CBLA 2JXLA 1KFXS 3EVUA 1S3PA 1F70A 1KK7Y 5AFPA 4IJ7A 4KYNA 3DYEA 1S6JA 1W7JB 1TNXA 1C3ZA 1QS7A 2KAVA 2KI6C 3B88A 2WCMA 1A29A 5I2LA 4HREE 1GGWA 2MHHA 3SG7A 2AMIA 2GV5A 4HSZA 2LMVA 1KWOC 2K8MB 4ZCVA 1SK6D 1ALWA 2F2PA 1H8BA 4WQ2A 1QTXA 1IJ6A 1KWOB 2F33A 2H61A 2Y1NA 2LV7A 2BL0B 2BBMA 5DKRA 2M9GA 3ZNIA 1EJ3A 2JTTA 4MSPA 1PVAA 1LA3A 1DJHA 2OPOA 3GOFA 4YGEB 1TUZA 3OB2B 2BCAA 1BODA 1N2DA 3DF0A 4MZJA 1J7PA 1JSAA 2P70A 2JQ6A 1V1GA 2EGDA 2KFFA 2V53A 2DOQA 1YX8A 2F8PA 1L2OC 1NCXA 3H4SE 4PHKA 1AP4A 2LVJA 2CNPA 2JNFA 4NQGA 5K89A 3L4AA 1DC1A 2WC6A 3BUNB 3HCMA 3EK8A 3PATA 2PQLA 1XYDA 4OV2A 2KNEA 2RGIA 1QX7A 3TDZA 1JBAA 2BE4A 2H8VA 3VRNA 3LK1A 1NPQA 1DVIA 2LP3A 2NXQA 1QLSA 3BFBA 3BOWA 4DS7A 2M7NA 1QASA 1BR4B 1TOPA 1BMOA 1XK4A 1XO5A 3PN7C 4NDDA 1B47A 4AQJA 5BPJA 5GQQC 3D77A 1CFCA 1K90D 3PN7B 1JF0A 1KK8B 5IBWA 2KAXA 2EC6C 2KOTA 3VGOA 5ER4X 3PALA 1IIOA 2I7AA 2SASA 1L7ZA 1SR6B 1M31A 1SCVA 3WHTB 1XFVO 1NCYA 3RM1A 2ZFDA 4A4CA 2ZKMX 1MR8A 3PM2A 2I18A 4XJKA 3LCPC 3I5GB 5DKQA 1RJVA 2KYFA 2WCHA 4E68A 1IKUA 3BUWB 1IG5A 1XFWO 1CB1A 5HKWA 2KFGA 1KCYA 4R1EA 1RROA 4GUKA 2LP2A 3KO0A 4GGFC 1MWNA 1M46A 3MSEB 5PALA 5DICA 3TS5B 1IGVA 4CPVA 3O2PA 2E30A 1C7VA 3EVRA 2G2BA 1QVIY 4AQIA 3I5FB 5D7FA 5HL1A 2OS8B 2LNKA 3WNXB 1BU3A 2LHIA 2M7LA 1PRWA 3CS1A 3QMEA 1R2UA 4PT1A 1OOIX 2O5GA 3AKBA 3KF9A 2HQWA 2R2IA 3AAJA 2WORA 1YUTA 1ZUZA 3TDIA 2L5YA 4YGBB 2MBXA 4MVFA 2OTGC 1DT7B 1JWDA 1T14A 2LC5A 2CTNA 1NX2A 1JFKA 2K7OA 1N0YA 1CMFA 2JT8A 3I5HC 3O78A 1B4CA 1QIVA 2LAPA 4PE4A 2M0RA 1S1EA 3Q8IA 4JWQA 3I5HB 3KPXA 5D69A 1CLMA 1SSEB 1A75A 1OMVA 1LA0A 1DF0A 1J7OA 1RK9A 1WLMA 2M8UA 2PSRA 2WCKA 1AVSA 4DRWA 2JRFA 2KHNA 3HX4A 3M0WA 1DMOA 2TN4A 1J55A 1DJGA 3NHIA 2L2CA 3CR5X 4ZCUA 2ZN9A 1SCMC 2PVBA 2CCMA 4I5LB 4PE1A 1JFJA 1PULA 1K8UA 1SPYA 1TNWA 5I8NA 2ZNDA 1K95A 1GM0A 1SL8A 1XFRA 1UHHA 4YGDB 1OOHA 5CPVA 5ER5A 2QEHA 3R1PA 3NXAA 2KYCA 2BKHB 4OVNF 1A03A 1F4QA 1K93D 1F54A 3FIAA 4L9MA 4QJ3B 2KBMA 3S0GA 2LMUA 4M2PA 1TWOA 2BCBA 3S0AA 1K2HA 1SMGA 1QXPA 4JD9A 1TCFA 4C0LA 1NWDA 1C3YA 3IQOA 1EH2A 2D8NA 3DZTA 2L51A 1YRUB 3IVTA 5KSZA 2PMYA 3BXKA 2M29A 1SW8A 3VRQA 2G9BA 3D78A 1J1DA 1CDPA 5AANA 1KQVA 4GBAA 2JPTA 2K7BA 2P6BB 2H61C 4TNCA 1CFPA 5AXIA 2LLUA 3D10A 3DD4A 3IQQA 3NSKA 4HRHA 1NP8A 5KTYA 3N7HA 1UP5A 2KPHA 3K1EA 3LLEA 4PE7A 3CTNA 4PCWA 1F71A 3CZTX 1KFXL 3EKJA 1VRKA 3VROA 2PALA 3FWBA 2L98A 4MZLA 4A4BA 1B1GA 3DF0B 1IQ5A 1B8RA 2MAZA 3OX5A 1CDMA 4WRIA 3S0BA 4D1EA 2NCPA 2K7DA 4QJ4B 2LVIA 5J3XA 2LMTA 1IRJA 4JPZB 1WRLA 1TIZA 1NUBA 2JULA 1DJYA 1L2OB 1LXFC 3CR4X 1OOJA 1CMGA 2LM5A 3PSRA 1XK4C 3OBVA 3KEVA 3O4XA 1UHNA 1C07A 1TRFA 3D76A 1BF5A 2K61A 1ODBA 2H2KA 1CFDA 1S26D 5B8IB 2ERBA 1OQPA 1CM1A 2JNXA 3D0YB 2JWWA 4QJ5B 1K94A 3RZSA 3LK0A 2MRDA 1G33A 3O6BA 2QEOA 2Y4QA 1B7TY 3CR2A 2LUCA 3PJIA 1NX0A 3DY9A 1FF1A 1C7WA 2EC6B 1QWVA 1FI5A 1Y1AA 1IWQA 1SYMA 2KI4C 3JVTC 5CSIA 3E3RA 3JTDC 3CABA 1YUSA 3NSOA 2KLEA 2KI4B 1PSBA 1KFUL 3JVTB 3UO9A 2MLEC 2Y1MA 3RLZA 2JOJA 1BJFA 3PFVA 2KBIA 2L50A 2LUXA 4OR9B 1MHOA 4P5OE 1EG4A 1OZSA 2WCFA 1CLLA 3IF7A 1QX5B 4GAOA 1R6PA 1TUJA 1WRKA 2ZNEA 1QJTA 3CZ2A 2WCJA 1DJWA 2WOSA 3EK7A 2L4IA 4PALA 1TTXA 1F8HA 1Q80A 4N1FA 3SS5A 3DXLA 4P2YB 2BE6A 4MBEA 4I5KA 1NSHA 1SL9A 1CTRA 1UHKA 3SJSA 2HQ8A 1G8IA 1U5IA 1K96A 1OOGA 3SS4A 3AKAA 2Q4UA 1J7QA 1WDCC 3CWGA 3OP0A 1KQMC 1ALVA 1MXEA 2OTGB 3BFHA 3I5IC 3NHTA 1K9KA 4JKTA 4OKHA 2BNXA 1Z4HA 1WDCB 2Y5IA 5I94A 1DJIA 1NCZA 1DF0B 2KLDA 3B7AA 1LINA 1Y0VH 3BJHA 2COLB 5F6TA 1K9PA 1DTLA 1WRZA 1RECA 1CNPA 4BY5A 1CDNA 2I94A 5EL2A 1YVLA 3KHEA 3CDNA 3QRXA 1XA5A 1OZOA 1B9AA 4MN0A 2LHLA 3TDUA 4FQTA 1ZOTB 1YX7A 3FWCA 1YTZC 4PHNA 1ORGA 3F45A 1RFJA 3OB1B 4PHJA 1SCMB 4GGNA 4USLA 1S5GZ 3SG5A 4Q04A 5HKZA 1SY9A 1XFXO 3VRRA 2K60A 2LLTA 3SS3A 3SIAA 2GTEA 1JF2A 1UWOA 4GNKB 2KAYA 3SG6A 4DIRA 4YBHB 3VRPA 4ICBA 2E6WA 3SG3A 2KDHA 2Q91A 1PK0D 1ZACA 1DELA 1SNLA 1BT6A 1WY9A 2LVVA 1BR1B 2NCOA 1HQVA 1MF8B 1AHRA 2F3ZA 2JXCA 4GFTA 2K7CA 3ZWHA 3FE9A 3BUOB 2WC8A 1K9UA 1N65A 2LANA 1UUSA 2K0JA 2QEBA 3OGNA 2L2EA 1DGVA 1TCOB 1MQ1A 5DKNA 2L4HA 2FOTA 1D1OA 1RTP1 5FYXA 1DQEA 4ORCB 4MRYA 2M1UA 1DJZA 1NYAA 1P28A 3FE6A 4FQOA 3B87A 1JUOA 1B8CA 4ORBB 3NSIA 1TN4A 1QVIZ 4N1GA 2KFHA 4OZDA 1XFYO 2PRUA 4F0ZB 4FTGA 1FPWA 2FCEA 1F4OA 2QDIA 3C1VA 4C0JA 3B6XA 3L47A 2KSPA 4ORAB 1EG3A 1PSRA 3EG5B 2PASA 5FI7A 3BYAA 2CXJA 1BOCA 1UHJA 1Y1UA 5HKYA 4OCIA 1YUUA 1M63B 4ETOA 3BUXB 3K21A 1KSOA 2LE9B 3D75A 4BY4A 4C0KA 4CFRA 5AERA 4PHMA 2M97A 3S0FA 4MZKA 4NDBA 2PYQA 2VRGA 2BL0C 4UPGA 1B8LA 4CFQA 2JT3A 3WXAA 1IQ3A 1S6IA 1BLQA 3BOWB 2YGUA 1M45A 5HLVA 4CLNA 1XVJA 3CGAA 1KSMA 2KQYA 1FI6A 1QV0A 2JTZA 2P71A 1A2XA 1LKJA 2JZIA 2ZRSA 4HRGA 1M39A 4AOMA 2KQ6A 1SKTA 4MRXA 3OX6A 5FI2A 2KI6D 4INXA 4PE0A 2MA2A 4IL1A 1X02A 3FS7A 2GGZA 3R1OA 1YURA 2K2FA 1OMDA 2QACA 2K2AA 5KU1A 2CT9A 3GK4X 1QV1A 4GPLB 1S6CA 1YVHA 4XJKB 1MUXA 5CSFA 1IH0A 2L5XB 5I2QA 1DEKA 2EHBA 3R1VA 4MLWA 3JTDB 1UURA 2O60A 4YGCB 1YRTB 1KK8C 2BBNA 3CLNA 1S5GY 1KFUS 1NIWA 2HF5A 3DVEA 1CFFA 4F7FA 5G08A 5CSNA 2BKIB 5HYDA 1BG1A 3D0YA 1OMRA 1SR6C 2WCEA 2M49B 1MXLC 1S36A 4DUQA 2KGBC 3D74A 1FBVA 1KK7Z 2MJWB 1J7RA 1GJYA 3EK4A 4INWA 4N5XA 1IJ5A 4YI9A 1OE9B 3SG2A 1AK8A 3I5GC 2M3WA 2LVKA 1LVCD 1EL4A 4MEWA 1DJXA 1YR5A 2LCPA
chains in the Genus database with same CATH topology
3WHUB 2M1KB 2ISDA 4JQ0D 1U5IB 4NDCA 2SCPA 1GQMA 3TS5C 2GGMA 4YI8A 1CLBA 1HT9A 1CDLA 1PVBA 1H4BA 2WCBA 4DCKA 1ZMZA 4XYNA 3I5FC 3BUMB 2F3YA 2OS8C 2AAOA 1E8AA 2B1UA 2JT0A 3EKHA 1A75B 1KQMB 3I5IB 1SRAA 2JU0A 4GGFA 3ICBA 1TNPA 3TUYC 1RWYA 1AJ4A 2KGRA 3LL8B 2BCXA 1CM4A 2BECA 1PALA 1Y1XA 2F2OA 3TUYB 1AJ5A 2IS9A 3AAKA 2FCDA 2WNDA 2FJUB 2NZ0A 2ZRTA 1SL7A 1V1FA 1Y6WA 2MLFC 4U8DA 1AUIB 2JC2A 3EVVA 1J1EA 2NLNA 1WLZA 1EXRA 3SIBA 1JC2A 4M2QA 2HPSA 5JOLA 1SBJA 1W7IB 3TZ1A 2QPTA 3DVJA 4I5NB 1FW4A 1B7TZ 1XFZO 4I5JA 3NSLA 3DVMA 1GGZA 3GK1A 1XFUO 3PLFB 5AEQA 1TNQA 2I2RE 1DGUA 1G4YR 1QATA 1NX1A 3BQ3A 5HLOA 3O4YA 4PDZA 2A4JA 2AUCA 4CIDA 2LLSA 5TNCA 1QLKA 1UHIA 3DVKA 3A4UB 4YGAA 3OHMB 1CKKA 2L0PA 1NX3A 1OSAA 1QX2A 3GK2A 4M2OA 4YRUA 2ZN8A 4WQ3A 1A4PA 3SG4A 1ZFSA 5JJGA 1QIWA 2HETA 3PM8A 5I2OA 1F55A 5CSJA 3A8RA 2CBLA 2JXLA 1KFXS 3EVUA 1S3PA 1F70A 1KK7Y 5AFPA 1S6JA 1W7JB 1TNXA 1QS7A 2KAVA 2KI6C 5I2LA 1A29A 4HREE 1GGWA 2MHHA 3SG7A 2AMIA 2GV5A 4HSZA 2LMVA 1KWOC 2K8MB 4ZCVA 1SK6D 1ALWA 2F2PA 1H8BA 4WQ2A 1QTXA 1IJ6A 1KWOB 2F33A 2H61A 2Y1NA 2LV7A 2BL0B 2BBMA 5DKRA 2M9GA 3ZNIA 1EJ3A 2JTTA 4MSPA 1PVAA 1LA3A 1DJHA 2OPOA 3GOFA 4YGEB 3OB2B 2BCAA 1BODA 1N2DA 3DF0A 4MZJA 1J7PA 1JSAA 2JQ6A 1V1GA 2EGDA 2KFFA 2V53A 2DOQA 1YX8A 2F8PA 1L2OC 1NCXA 3H4SE 4PHKA 1AP4A 2LVJA 2CNPA 2JNFA 4NQGA 5K89A 3BUNB 3HCMA 3EK8A 3PATA 1XYDA 4OV2A 2KNEA 2RGIA 1QX7A 3TDZA 1JBAA 2BE4A 3VRNA 3LK1A 1NPQA 1DVIA 2LP3A 2NXQA 1QLSA 3BOWA 4DS7A 2M7NA 1QASA 1BR4B 1TOPA 1BMOA 1XK4A 1XO5A 3PN7C 4NDDA 1B47A 4AQJA 5BPJA 5GQQC 1CFCA 1K90D 3PN7B 1JF0A 1KK8B 5IBWA 2KAXA 2EC6C 2KOTA 3VGOA 5ER4X 3PALA 2I7AA 2SASA 1L7ZA 1SR6B 1M31A 1SCVA 3WHTB 1XFVO 1NCYA 3RM1A 2ZFDA 4A4CA 2ZKMX 1MR8A 2I18A 4XJKA 3LCPC 3I5GB 5DKQA 1RJVA 2KYFA 4E68A 1IKUA 3BUWB 1IG5A 1XFWO 1CB1A 5HKWA 2KFGA 1KCYA 4R1EA 1RROA 4GUKA 2LP2A 3KO0A 4GGFC 1MWNA 1M46A 3MSEB 5PALA 3TS5B 4CPVA 1IGVA 3O2PA 2E30A 1C7VA 3EVRA 2G2BA 1QVIY 4AQIA 3I5FB 5D7FA 2OS8B 2LNKA 3WNXB 1BU3A 2LHIA 2M7LA 1PRWA 3CS1A 1R2UA 2O5GA 3AKBA 3KF9A 2HQWA 2R2IA 3AAJA 2WORA 1YUTA 1ZUZA 3TDIA 2MBXA 4YGBB 4MVFA 2OTGC 1DT7B 1JWDA 2LC5A 2CTNA 1NX2A 1JFKA 2K7OA 1N0YA 1CMFA 2JT8A 3I5HC 3O78A 1B4CA 1QIVA 2LAPA 4PE4A 2M0RA 1S1EA 4JWQA 3I5HB 3KPXA 5D69A 1CLMA 1A75A 1OMVA 1LA0A 1DF0A 1J7OA 1RK9A 1WLMA 2M8UA 2PSRA 1AVSA 4DRWA 2JRFA 2KHNA 3HX4A 3M0WA 1DMOA 2TN4A 1J55A 1DJGA 3CR5X 4ZCUA 2ZN9A 1SCMC 2PVBA 2CCMA 4I5LB 4PE1A 1JFJA 1PULA 1K8UA 1SPYA 1TNWA 5I8NA 2ZNDA 1K95A 1SL8A 5ER5A 1UHHA 4YGDB 5CPVA 3NXAA 2KYCA 2BKHB 4OVNF 1A03A 1F4QA 1K93D 1F54A 3FIAA 4L9MA 4QJ3B 2KBMA 2LMUA 4M2PA 1K2HA 2BCBA 1SMGA 1QXPA 1TCFA 4C0LA 1NWDA 3IQOA 1EH2A 2D8NA 2L51A 1YRUB 5KSZA 2PMYA 3BXKA 2M29A 1SW8A 3VRQA 2G9BA 1KQVA 1J1DA 1CDPA 5AANA 4GBAA 2JPTA 2K7BA 2P6BB 2H61C 4TNCA 1CFPA 5AXIA 2LLUA 3D10A 3DD4A 3IQQA 3NSKA 4HRHA 1NP8A 5KTYA 1UP5A 3LLEA 4PE7A 3CTNA 4PCWA 1F71A 3CZTX 1KFXL 3EKJA 1VRKA 3VROA 2PALA 3FWBA 2L98A 4MZLA 4A4BA 1B1GA 3DF0B 1IQ5A 1B8RA 2MAZA 3OX5A 1CDMA 4WRIA 4D1EA 2NCPA 2K7DA 4QJ4B 2LVIA 5J3XA 2LMTA 1IRJA 4JPZB 1WRLA 1TIZA 1NUBA 2JULA 1DJYA 1L2OB 1LXFC 3CR4X 1OOJA 1CMGA 2LM5A 3PSRA 1XK4C 3KEVA 1UHNA 1C07A 1TRFA 1BF5A 2K61A 1ODBA 2H2KA 1CFDA 1S26D 5B8IB 1OQPA 1CM1A 2JNXA 3D0YB 2JWWA 4QJ5B 1K94A 3LK0A 2MRDA 1G33A 3O6BA 2Y4QA 1B7TY 3CR2A 2LUCA 1NX0A 1FF1A 1C7WA 2EC6B 1FI5A 1Y1AA 1IWQA 1SYMA 2KI4C 3JVTC 5CSIA 3E3RA 3JTDC 1YUSA 3NSOA 3JVTB 2KI4B 1PSBA 1KFUL 2MLEC 2Y1MA 3RLZA 2JOJA 1BJFA 3PFVA 2KBIA 2L50A 2LUXA 4OR9B 1MHOA 4P5OE 1EG4A 1OZSA 2WCFA 1CLLA 3IF7A 1QX5B 4GAOA 1R6PA 1WRKA 2ZNEA 1QJTA 1DJWA 2WOSA 3EK7A 2L4IA 4PALA 1TTXA 1F8HA 1Q80A 4N1FA 4P2YB 2BE6A 4MBEA 4I5KA 1NSHA 1SL9A 1CTRA 1UHKA 3SJSA 2HQ8A 1G8IA 1U5IA 1K96A 3AKAA 2Q4UA 1J7QA 1WDCC 3CWGA 3OP0A 1KQMC 1ALVA 1MXEA 2OTGB 3I5IC 4OKHA 1K9KA 1WDCB 2Y5IA 1DJIA 1NCZA 1DF0B 1LINA 1Y0VH 2COLB 5F6TA 1K9PA 1DTLA 1WRZA 1RECA 1CNPA 4BY5A 1CDNA 2I94A 1YVLA 3KHEA 3QRXA 1XA5A 1OZOA 1B9AA 4MN0A 2LHLA 3TDUA 1ZOTB 1YX7A 3FWCA 1YTZC 4PHNA 3F45A 1RFJA 3OB1B 4PHJA 1SCMB 4GGNA 4USLA 1S5GZ 3SG5A 4Q04A 5HKZA 1SY9A 1XFXO 3VRRA 2LLTA 3SIAA 1JF2A 1UWOA 4GNKB 2KAYA 3SG6A 4DIRA 4YBHB 3VRPA 4ICBA 2E6WA 3SG3A 2KDHA 2Q91A 1PK0D 1ZACA 1SNLA 1WY9A 1BT6A 2LVVA 2NCOA 1BR1B 1HQVA 1MF8B 1AHRA 2F3ZA 2JXCA 4GFTA 2K7CA 3ZWHA 3BUOB 2WC8A 1K9UA 1N65A 2LANA 1UUSA 2K0JA 2L2EA 1DGVA 1TCOB 1MQ1A 5DKNA 2L4HA 2FOTA 1D1OA 1RTP1 5FYXA 4ORCB 4MRYA 2M1UA 1DJZA 1NYAA 4FQOA 1JUOA 1B8CA 4ORBB 3NSIA 1TN4A 1QVIZ 4N1GA 2KFHA 1XFYO 2PRUA 4F0ZB 4FTGA 1FPWA 2FCEA 1F4OA 3C1VA 4C0JA 2KSPA 4ORAB 1EG3A 1PSRA 2PASA 3BYAA 2CXJA 1BOCA 1UHJA 1Y1UA 5HKYA 4OCIA 1YUUA 1M63B 4ETOA 3BUXB 3K21A 1KSOA 2LE9B 4BY4A 4C0KA 4CFRA 5AERA 4PHMA 2M97A 4MZKA 4NDBA 2VRGA 4UPGA 2BL0C 1B8LA 4CFQA 2JT3A 3WXAA 1IQ3A 1S6IA 1BLQA 3BOWB 5HLVA 1M45A 4CLNA 1XVJA 3CGAA 1KSMA 2KQYA 1FI6A 1QV0A 2JTZA 1A2XA 1LKJA 2JZIA 2ZRSA 4HRGA 1M39A 4AOMA 2KQ6A 1SKTA 4MRXA 3OX6A 2KI6D 4PE0A 2MA2A 4IL1A 1X02A 3FS7A 2GGZA 1YURA 2K2FA 1OMDA 2QACA 2K2AA 5KU1A 2CT9A 3GK4X 1QV1A 4GPLB 1S6CA 1YVHA 4XJKB 1MUXA 5CSFA 1IH0A 2L5XB 5I2QA 2EHBA 4MLWA 3JTDB 1UURA 2O60A 4YGCB 1YRTB 1KK8C 2BBNA 3CLNA 1S5GY 1KFUS 1NIWA 2HF5A 3DVEA 1CFFA 5G08A 5CSNA 2BKIB 5HYDA 1BG1A 3D0YA 1OMRA 1SR6C 2WCEA 2M49B 1MXLC 1S36A 4DUQA 2KGBC 3EK4A 1FBVA 1KK7Z 2MJWB 1J7RA 1GJYA 4N5XA 4YI9A 1AK8A 1IJ5A 1OE9B 3SG2A 3I5GC 2M3WA 2LVKA 1LVCD 1EL4A 4MEWA 1DJXA 1YR5A 2LCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHU B;  2M1K B;  2ISD A;  4JQ0 D;  1U5I B;  4NDC A;  2SCP A;  1GQM A;  3TS5 C;  2GGM A;  4YI8 A;  1CLB A;  1HT9 A;  1CDL A;  1PVB A;  1H4B A;  2WCB A;  4DCK A;  1ZMZ A;  4XYN A;  3I5F C;  3BUM B;  2F3Y A;  2OS8 C;  2AAO A;  1E8A A;  2B1U A;  2JT0 A;  3EKH A;  1A75 B;  1KQM B;  3I5I B;  1SRA A;  2JU0 A;  4GGF A;  3ICB A;  1TNP A;  3TUY C;  1RWY A;  1AJ4 A;  2KGR A;  3LL8 B;  2BCX A;  1CM4 A;  2BEC A;  1PAL A;  1Y1X A;  2F2O A;  3TUY B;  1AJ5 A;  2IS9 A;  3AAK A;  2FCD A;  2WND A;  2FJU B;  2NZ0 A;  2ZRT A;  1SL7 A;  1V1F A;  1Y6W A;  2MLF C;  4U8D A;  1AUI B;  2JC2 A;  3EVV A;  1J1E A;  2NLN A;  1WLZ A;  1EXR A;  3SIB A;  1JC2 A;  4M2Q A;  2HPS A;  5JOL A;  1SBJ A;  1W7I B;  3TZ1 A;  2QPT A;  3DVJ A;  4I5N B;  1FW4 A;  1B7T Z;  1XFZ O;  4I5J A;  3NSL A;  3DVM A;  1GGZ A;  3GK1 A;  1XFU O;  3PLF B;  5AEQ A;  1TNQ A;  2I2R E;  1DGU A;  1G4Y R;  1QAT A;  1NX1 A;  3BQ3 A;  5HLO A;  3O4Y A;  4PDZ A;  2A4J A;  2AUC A;  4CID A;  2LLS A;  5TNC A;  1QLK A;  1UHI A;  3DVK A;  3A4U B;  4YGA A;  3OHM B;  1CKK A;  2L0P A;  1NX3 A;  1OSA A;  1QX2 A;  3GK2 A;  4M2O A;  4YRU A;  2ZN8 A;  4WQ3 A;  1A4P A;  3SG4 A;  1ZFS A;  5JJG A;  1QIW A;  2HET A;  3PM8 A;  5I2O A;  1F55 A;  5CSJ A;  3A8R A;  2CBL A;  2JXL A;  1KFX S;  3EVU A;  1S3P A;  1F70 A;  1KK7 Y;  5AFP A;  1S6J A;  1W7J B;  1TNX A;  1QS7 A;  2KAV A;  2KI6 C;  5I2L A;  1A29 A;  4HRE E;  1GGW A;  2MHH A;  3SG7 A;  2AMI A;  2GV5 A;  4HSZ A;  2LMV A;  1KWO C;  2K8M B;  4ZCV A;  1SK6 D;  1ALW A;  2F2P A;  1H8B A;  4WQ2 A;  1QTX A;  1IJ6 A;  1KWO B;  2F33 A;  2H61 A;  2Y1N A;  2LV7 A;  2BL0 B;  2BBM A;  5DKR A;  2M9G A;  3ZNI A;  1EJ3 A;  2JTT A;  4MSP A;  1PVA A;  1LA3 A;  1DJH A;  2OPO A;  3GOF A;  4YGE B;  3OB2 B;  2BCA A;  1BOD A;  1N2D A;  3DF0 A;  4MZJ A;  1J7P A;  1JSA A;  2JQ6 A;  1V1G A;  2EGD A;  2KFF A;  2V53 A;  2DOQ A;  1YX8 A;  2F8P A;  1L2O C;  1NCX A;  3H4S E;  4PHK A;  1AP4 A;  2LVJ A;  2CNP A;  2JNF A;  4NQG A;  5K89 A;  3BUN B;  3HCM A;  3EK8 A;  3PAT A;  1XYD A;  4OV2 A;  2KNE A;  2RGI A;  1QX7 A;  3TDZ A;  1JBA A;  2BE4 A;  3VRN A;  3LK1 A;  1NPQ A;  1DVI A;  2LP3 A;  2NXQ A;  1QLS A;  3BOW A;  4DS7 A;  2M7N A;  1QAS A;  1BR4 B;  1TOP A;  1BMO A;  1XK4 A;  1XO5 A;  3PN7 C;  4NDD A;  1B47 A;  4AQJ A;  5BPJ A;  5GQQ C;  1CFC A;  1K90 D;  3PN7 B;  1JF0 A;  1KK8 B;  5IBW A;  2KAX A;  2EC6 C;  2KOT A;  3VGO A;  5ER4 X;  3PAL A;  2I7A A;  2SAS A;  1L7Z A;  1SR6 B;  1M31 A;  1SCV A;  3WHT B;  1XFV O;  1NCY A;  3RM1 A;  2ZFD A;  4A4C A;  2ZKM X;  1MR8 A;  2I18 A;  4XJK A;  3LCP C;  3I5G B;  5DKQ A;  1RJV A;  2KYF A;  4E68 A;  1IKU A;  3BUW B;  1IG5 A;  1XFW O;  1CB1 A;  5HKW A;  2KFG A;  1KCY A;  4R1E A;  1RRO A;  4GUK A;  2LP2 A;  3KO0 A;  4GGF C;  1MWN A;  1M46 A;  3MSE B;  5PAL A;  3TS5 B;  4CPV A;  1IGV A;  3O2P A;  2E30 A;  1C7V A;  3EVR A;  2G2B A;  1QVI Y;  4AQI A;  3I5F B;  5D7F A;  2OS8 B;  2LNK A;  3WNX B;  1BU3 A;  2LHI A;  2M7L A;  1PRW A;  3CS1 A;  1R2U A;  2O5G A;  3AKB A;  3KF9 A;  2HQW A;  2R2I A;  3AAJ A;  2WOR A;  1YUT A;  1ZUZ A;  3TDI A;  2MBX A;  4YGB B;  4MVF A;  2OTG C;  1DT7 B;  1JWD A;  2LC5 A;  2CTN A;  1NX2 A;  1JFK A;  2K7O A;  1N0Y A;  1CMF A;  2JT8 A;  3I5H C;  3O78 A;  1B4C A;  1QIV A;  2LAP A;  4PE4 A;  2M0R A;  1S1E A;  4JWQ A;  3I5H B;  3KPX A;  5D69 A;  1CLM A;  1A75 A;  1OMV A;  1LA0 A;  1DF0 A;  1J7O A;  1RK9 A;  1WLM A;  2M8U A;  2PSR A;  1AVS A;  4DRW A;  2JRF A;  2KHN A;  3HX4 A;  3M0W A;  1DMO A;  2TN4 A;  1J55 A;  1DJG A;  3CR5 X;  4ZCU A;  2ZN9 A;  1SCM C;  2PVB A;  2CCM A;  4I5L B;  4PE1 A;  1JFJ A;  1PUL A;  1K8U A;  1SPY A;  1TNW A;  5I8N A;  2ZND A;  1K95 A;  1SL8 A;  5ER5 A;  1UHH A;  4YGD B;  5CPV A;  3NXA A;  2KYC A;  2BKH B;  4OVN F;  1A03 A;  1F4Q A;  1K93 D;  1F54 A;  3FIA A;  4L9M A;  4QJ3 B;  2KBM A;  2LMU A;  4M2P A;  1K2H A;  2BCB A;  1SMG A;  1QXP A;  1TCF A;  4C0L A;  1NWD A;  3IQO A;  1EH2 A;  2D8N A;  2L51 A;  1YRU B;  5KSZ A;  2PMY A;  3BXK A;  2M29 A;  1SW8 A;  3VRQ A;  2G9B A;  1KQV A;  1J1D A;  1CDP A;  5AAN A;  4GBA A;  2JPT A;  2K7B A;  2P6B B;  2H61 C;  4TNC A;  1CFP A;  5AXI A;  2LLU A;  3D10 A;  3DD4 A;  3IQQ A;  3NSK A;  4HRH A;  1NP8 A;  5KTY A;  1UP5 A;  3LLE A;  4PE7 A;  3CTN A;  4PCW A;  1F71 A;  3CZT X;  1KFX L;  3EKJ A;  1VRK A;  3VRO A;  2PAL A;  3FWB A;  2L98 A;  4MZL A;  4A4B A;  1B1G A;  3DF0 B;  1IQ5 A;  1B8R A;  2MAZ A;  3OX5 A;  1CDM A;  4WRI A;  4D1E A;  2NCP A;  2K7D A;  4QJ4 B;  2LVI A;  5J3X A;  2LMT A;  1IRJ A;  4JPZ B;  1WRL A;  1TIZ A;  1NUB A;  2JUL A;  1DJY A;  1L2O B;  1LXF C;  3CR4 X;  1OOJ A;  1CMG A;  2LM5 A;  3PSR A;  1XK4 C;  3KEV A;  1UHN A;  1C07 A;  1TRF A;  1BF5 A;  2K61 A;  1ODB A;  2H2K A;  1CFD A;  1S26 D;  5B8I B;  1OQP A;  1CM1 A;  2JNX A;  3D0Y B;  2JWW A;  4QJ5 B;  1K94 A;  3LK0 A;  2MRD A;  1G33 A;  3O6B A;  2Y4Q A;  1B7T Y;  3CR2 A;  2LUC A;  1NX0 A;  1FF1 A;  1C7W A;  2EC6 B;  1FI5 A;  1Y1A A;  1IWQ A;  1SYM A;  2KI4 C;  3JVT C;  5CSI A;  3E3R A;  3JTD C;  1YUS A;  3NSO A;  3JVT B;  2KI4 B;  1PSB A;  1KFU L;  2MLE C;  2Y1M A;  3RLZ A;  2JOJ A;  1BJF A;  3PFV A;  2KBI A;  2L50 A;  2LUX A;  4OR9 B;  1MHO A;  4P5O E;  1EG4 A;  1OZS A;  2WCF A;  1CLL A;  3IF7 A;  1QX5 B;  4GAO A;  1R6P A;  1WRK A;  2ZNE A;  1QJT A;  1DJW A;  2WOS A;  3EK7 A;  2L4I A;  4PAL A;  1TTX A;  1F8H A;  1Q80 A;  4N1F A;  4P2Y B;  2BE6 A;  4MBE A;  4I5K A;  1NSH A;  1SL9 A;  1CTR A;  1UHK A;  3SJS A;  2HQ8 A;  1G8I A;  1U5I A;  1K96 A;  3AKA A;  2Q4U A;  1J7Q A;  1WDC C;  3CWG A;  3OP0 A;  1KQM C;  1ALV A;  1MXE A;  2OTG B;  3I5I C;  4OKH A;  1K9K A;  1WDC B;  2Y5I A;  1DJI A;  1NCZ A;  1DF0 B;  1LIN A;  1Y0V H;  2COL B;  5F6T A;  1K9P A;  1DTL A;  1WRZ A;  1REC A;  1CNP A;  4BY5 A;  1CDN A;  2I94 A;  1YVL A;  3KHE A;  3QRX A;  1XA5 A;  1OZO A;  1B9A A;  4MN0 A;  2LHL A;  3TDU A;  1ZOT B;  1YX7 A;  3FWC A;  1YTZ C;  4PHN A;  3F45 A;  1RFJ A;  3OB1 B;  4PHJ A;  1SCM B;  4GGN A;  4USL A;  1S5G Z;  3SG5 A;  4Q04 A;  5HKZ A;  1SY9 A;  1XFX O;  3VRR A;  2LLT A;  3SIA A;  1JF2 A;  1UWO A;  4GNK B;  2KAY A;  3SG6 A;  4DIR A;  4YBH B;  3VRP A;  4ICB A;  2E6W A;  3SG3 A;  2KDH A;  2Q91 A;  1PK0 D;  1ZAC A;  1SNL A;  1WY9 A;  1BT6 A;  2LVV A;  2NCO A;  1BR1 B;  1HQV A;  1MF8 B;  1AHR A;  2F3Z A;  2JXC A;  4GFT A;  2K7C A;  3ZWH A;  3BUO B;  2WC8 A;  1K9U A;  1N65 A;  2LAN A;  1UUS A;  2K0J A;  2L2E A;  1DGV A;  1TCO B;  1MQ1 A;  5DKN A;  2L4H A;  2FOT A;  1D1O A;  1RTP 1;  5FYX A;  4ORC B;  4MRY A;  2M1U A;  1DJZ A;  1NYA A;  4FQO A;  1JUO A;  1B8C A;  4ORB B;  3NSI A;  1TN4 A;  1QVI Z;  4N1G A;  2KFH A;  1XFY O;  2PRU A;  4F0Z B;  4FTG A;  1FPW A;  2FCE A;  1F4O A;  3C1V A;  4C0J A;  2KSP A;  4ORA B;  1EG3 A;  1PSR A;  2PAS A;  3BYA A;  2CXJ A;  1BOC A;  1UHJ A;  1Y1U A;  5HKY A;  4OCI A;  1YUU A;  1M63 B;  4ETO A;  3BUX B;  3K21 A;  1KSO A;  2LE9 B;  4BY4 A;  4C0K A;  4CFR A;  5AER A;  4PHM A;  2M97 A;  4MZK A;  4NDB A;  2VRG A;  4UPG A;  2BL0 C;  1B8L A;  4CFQ A;  2JT3 A;  3WXA A;  1IQ3 A;  1S6I A;  1BLQ A;  3BOW B;  5HLV A;  1M45 A;  4CLN A;  1XVJ A;  3CGA A;  1KSM A;  2KQY A;  1FI6 A;  1QV0 A;  2JTZ A;  1A2X A;  1LKJ A;  2JZI A;  2ZRS A;  4HRG A;  1M39 A;  4AOM A;  2KQ6 A;  1SKT A;  4MRX A;  3OX6 A;  2KI6 D;  4PE0 A;  2MA2 A;  4IL1 A;  1X02 A;  3FS7 A;  2GGZ A;  1YUR A;  2K2F A;  1OMD A;  2QAC A;  2K2A A;  5KU1 A;  2CT9 A;  3GK4 X;  1QV1 A;  4GPL B;  1S6C A;  1YVH A;  4XJK B;  1MUX A;  5CSF A;  1IH0 A;  2L5X B;  5I2Q A;  2EHB A;  4MLW A;  3JTD B;  1UUR A;  2O60 A;  4YGC B;  1YRT B;  1KK8 C;  2BBN A;  3CLN A;  1S5G Y;  1KFU S;  1NIW A;  2HF5 A;  3DVE A;  1CFF A;  5G08 A;  5CSN A;  2BKI B;  5HYD A;  1BG1 A;  3D0Y A;  1OMR A;  1SR6 C;  2WCE A;  2M49 B;  1MXL C;  1S36 A;  4DUQ A;  2KGB C;  3EK4 A;  1FBV A;  1KK7 Z;  2MJW B;  1J7R A;  1GJY A;  4N5X A;  4YI9 A;  1AK8 A;  1IJ5 A;  1OE9 B;  3SG2 A;  3I5G C;  2M3W A;  2LVK A;  1LVC D;  1EL4 A;  4MEW A;  1DJX A;  1YR5 A;  2LCP A; 
#chains in the Genus database with same CATH topology
 3WHU B;  2JPO A;  2M1K B;  2ISD A;  4JQ0 D;  1U5I B;  4NDC A;  5D3O A;  2SCP A;  1GQM A;  3TS5 C;  3L4L A;  2GGM A;  4YI8 A;  1CLB A;  1HT9 A;  1CDL A;  1PVB A;  1H4B A;  3VB1 A;  2WCB A;  4DCK A;  1ZMZ A;  4XYN A;  3I5F C;  3BUM B;  2F3Y A;  2OS8 C;  2AAO A;  1E8A A;  2B1U A;  2JT0 A;  3EKH A;  1A75 B;  1KQM B;  3I5I B;  1SRA A;  2JU0 A;  4GGF A;  3ICB A;  1TNP A;  1W9Z A;  3S0D A;  3TUY C;  1RWY A;  1AJ4 A;  2KGR A;  3LL8 B;  2BCX A;  1CM4 A;  1PAL A;  2BEC A;  3B86 A;  1Y1X A;  2F2O A;  3NGV A;  1AJ5 A;  2IS9 A;  3AAK A;  3TUY B;  1OW4 A;  2FCD A;  2WND A;  2FJU B;  2NZ0 A;  2ZRT A;  3V2L A;  1SL7 A;  1V1F A;  1Y6W A;  2MLF C;  4U8D A;  1AUI B;  2JC2 A;  3EVV A;  1J1E A;  2NLN A;  1WLZ A;  3D73 A;  1EXR A;  3SIB A;  1JC2 A;  3BFA A;  4M2Q A;  2HPS A;  5JOL A;  1SBJ A;  1W7I B;  3TZ1 A;  2QPT A;  3DVJ A;  4I5N B;  1FW4 A;  1B7T Z;  1XFZ O;  4I5J A;  3NSL A;  3CYZ A;  3DVM A;  1GGZ A;  1Z2C B;  3GK1 A;  1LS8 A;  1XFU O;  2FJY A;  3PLF B;  5AEQ A;  1OOF A;  1TNQ A;  3UNW A;  2I2R E;  1DGU A;  1G4Y R;  1QAT A;  1NX1 A;  3BQ3 A;  5HLO A;  3O4Y A;  2WCL A;  4PDZ A;  2A4J A;  2AUC A;  4CID A;  2LLS A;  5TNC A;  1QLK A;  1UHI A;  3DVK A;  3A4U B;  3CZ0 A;  3CZ1 A;  4YGA A;  3OHM B;  1CKK A;  2BAP A;  2L0P A;  1NX3 A;  1OSA A;  1QX2 A;  3S0E A;  3GK2 A;  4M2O A;  4YRU A;  2ZN8 A;  4WQ3 A;  1A4P A;  3R72 A;  3SG4 A;  1ZFS A;  3FE8 A;  1QIW A;  2HET A;  5JJG A;  2QEV A;  2WC5 A;  3PM8 A;  5I2O A;  1F55 A;  5CSJ A;  3A8R A;  5FI6 A;  2CBL A;  2JXL A;  1KFX S;  3EVU A;  1S3P A;  1F70 A;  1KK7 Y;  5AFP A;  4IJ7 A;  4KYN A;  3DYE A;  1S6J A;  1W7J B;  1TNX A;  1C3Z A;  1QS7 A;  2KAV A;  2KI6 C;  3B88 A;  2WCM A;  1A29 A;  5I2L A;  4HRE E;  1GGW A;  2MHH A;  3SG7 A;  2AMI A;  2GV5 A;  4HSZ A;  2LMV A;  1KWO C;  2K8M B;  4ZCV A;  1SK6 D;  1ALW A;  2F2P A;  1H8B A;  4WQ2 A;  1QTX A;  1IJ6 A;  1KWO B;  2F33 A;  2H61 A;  2Y1N A;  2LV7 A;  2BL0 B;  2BBM A;  5DKR A;  2M9G A;  3ZNI A;  1EJ3 A;  2JTT A;  4MSP A;  1PVA A;  1LA3 A;  1DJH A;  2OPO A;  3GOF A;  4YGE B;  1TUZ A;  3OB2 B;  2BCA A;  1BOD A;  1N2D A;  3DF0 A;  4MZJ A;  1J7P A;  1JSA A;  2P70 A;  2JQ6 A;  1V1G A;  2EGD A;  2KFF A;  2V53 A;  2DOQ A;  1YX8 A;  2F8P A;  1L2O C;  1NCX A;  3H4S E;  4PHK A;  1AP4 A;  2LVJ A;  2CNP A;  2JNF A;  4NQG A;  5K89 A;  3L4A A;  1DC1 A;  2WC6 A;  3BUN B;  3HCM A;  3EK8 A;  3PAT A;  2PQL A;  1XYD A;  4OV2 A;  2KNE A;  2RGI A;  1QX7 A;  3TDZ A;  1JBA A;  2BE4 A;  2H8V A;  3VRN A;  3LK1 A;  1NPQ A;  1DVI A;  2LP3 A;  2NXQ A;  1QLS A;  3BFB A;  3BOW A;  4DS7 A;  2M7N A;  1QAS A;  1BR4 B;  1TOP A;  1BMO A;  1XK4 A;  1XO5 A;  3PN7 C;  4NDD A;  1B47 A;  4AQJ A;  5BPJ A;  5GQQ C;  3D77 A;  1CFC A;  1K90 D;  3PN7 B;  1JF0 A;  1KK8 B;  5IBW A;  2KAX A;  2EC6 C;  2KOT A;  3VGO A;  5ER4 X;  3PAL A;  1IIO A;  2I7A A;  2SAS A;  1L7Z A;  1SR6 B;  1M31 A;  1SCV A;  3WHT B;  1XFV O;  1NCY A;  3RM1 A;  2ZFD A;  4A4C A;  2ZKM X;  1MR8 A;  3PM2 A;  2I18 A;  4XJK A;  3LCP C;  3I5G B;  5DKQ A;  1RJV A;  2KYF A;  2WCH A;  4E68 A;  1IKU A;  3BUW B;  1IG5 A;  1XFW O;  1CB1 A;  5HKW A;  2KFG A;  1KCY A;  4R1E A;  1RRO A;  4GUK A;  2LP2 A;  3KO0 A;  4GGF C;  1MWN A;  1M46 A;  3MSE B;  5PAL A;  5DIC A;  3TS5 B;  1IGV A;  4CPV A;  3O2P A;  2E30 A;  1C7V A;  3EVR A;  2G2B A;  1QVI Y;  4AQI A;  3I5F B;  5D7F A;  5HL1 A;  2OS8 B;  2LNK A;  3WNX B;  1BU3 A;  2LHI A;  2M7L A;  1PRW A;  3CS1 A;  3QME A;  1R2U A;  4PT1 A;  1OOI X;  2O5G A;  3AKB A;  3KF9 A;  2HQW A;  2R2I A;  3AAJ A;  2WOR A;  1YUT A;  1ZUZ A;  3TDI A;  2L5Y A;  4YGB B;  2MBX A;  4MVF A;  2OTG C;  1DT7 B;  1JWD A;  1T14 A;  2LC5 A;  2CTN A;  1NX2 A;  1JFK A;  2K7O A;  1N0Y A;  1CMF A;  2JT8 A;  3I5H C;  3O78 A;  1B4C A;  1QIV A;  2LAP A;  4PE4 A;  2M0R A;  1S1E A;  3Q8I A;  4JWQ A;  3I5H B;  3KPX A;  5D69 A;  1CLM A;  1SSE B;  1A75 A;  1OMV A;  1LA0 A;  1DF0 A;  1J7O A;  1RK9 A;  1WLM A;  2M8U A;  2PSR A;  2WCK A;  1AVS A;  4DRW A;  2JRF A;  2KHN A;  3HX4 A;  3M0W A;  1DMO A;  2TN4 A;  1J55 A;  1DJG A;  3NHI A;  2L2C A;  3CR5 X;  4ZCU A;  2ZN9 A;  1SCM C;  2PVB A;  2CCM A;  4I5L B;  4PE1 A;  1JFJ A;  1PUL A;  1K8U A;  1SPY A;  1TNW A;  5I8N A;  2ZND A;  1K95 A;  1GM0 A;  1SL8 A;  1XFR A;  1UHH A;  4YGD B;  1OOH A;  5CPV A;  5ER5 A;  2QEH A;  3R1P A;  3NXA A;  2KYC A;  2BKH B;  4OVN F;  1A03 A;  1F4Q A;  1K93 D;  1F54 A;  3FIA A;  4L9M A;  4QJ3 B;  2KBM A;  3S0G A;  2LMU A;  4M2P A;  1TWO A;  2BCB A;  3S0A A;  1K2H A;  1SMG A;  1QXP A;  4JD9 A;  1TCF A;  4C0L A;  1NWD A;  1C3Y A;  3IQO A;  1EH2 A;  2D8N A;  3DZT A;  2L51 A;  1YRU B;  3IVT A;  5KSZ A;  2PMY A;  3BXK A;  2M29 A;  1SW8 A;  3VRQ A;  2G9B A;  3D78 A;  1J1D A;  1CDP A;  5AAN A;  1KQV A;  4GBA A;  2JPT A;  2K7B A;  2P6B B;  2H61 C;  4TNC A;  1CFP A;  5AXI A;  2LLU A;  3D10 A;  3DD4 A;  3IQQ A;  3NSK A;  4HRH A;  1NP8 A;  5KTY A;  3N7H A;  1UP5 A;  2KPH A;  3K1E A;  3LLE A;  4PE7 A;  3CTN A;  4PCW A;  1F71 A;  3CZT X;  1KFX L;  3EKJ A;  1VRK A;  3VRO A;  2PAL A;  3FWB A;  2L98 A;  4MZL A;  4A4B A;  1B1G A;  3DF0 B;  1IQ5 A;  1B8R A;  2MAZ A;  3OX5 A;  1CDM A;  4WRI A;  3S0B A;  4D1E A;  2NCP A;  2K7D A;  4QJ4 B;  2LVI A;  5J3X A;  2LMT A;  1IRJ A;  4JPZ B;  1WRL A;  1TIZ A;  1NUB A;  2JUL A;  1DJY A;  1L2O B;  1LXF C;  3CR4 X;  1OOJ A;  1CMG A;  2LM5 A;  3PSR A;  1XK4 C;  3OBV A;  3KEV A;  3O4X A;  1UHN A;  1C07 A;  1TRF A;  3D76 A;  1BF5 A;  2K61 A;  1ODB A;  2H2K A;  1CFD A;  1S26 D;  5B8I B;  2ERB A;  1OQP A;  1CM1 A;  2JNX A;  3D0Y B;  2JWW A;  4QJ5 B;  1K94 A;  3RZS A;  3LK0 A;  2MRD A;  1G33 A;  3O6B A;  2QEO A;  2Y4Q A;  1B7T Y;  3CR2 A;  2LUC A;  3PJI A;  1NX0 A;  3DY9 A;  1FF1 A;  1C7W A;  2EC6 B;  1QWV A;  1FI5 A;  1Y1A A;  1IWQ A;  1SYM A;  2KI4 C;  3JVT C;  5CSI A;  3E3R A;  3JTD C;  3CAB A;  1YUS A;  3NSO A;  2KLE A;  2KI4 B;  1PSB A;  1KFU L;  3JVT B;  3UO9 A;  2MLE C;  2Y1M A;  3RLZ A;  2JOJ A;  1BJF A;  3PFV A;  2KBI A;  2L50 A;  2LUX A;  4OR9 B;  1MHO A;  4P5O E;  1EG4 A;  1OZS A;  2WCF A;  1CLL A;  3IF7 A;  1QX5 B;  4GAO A;  1R6P A;  1TUJ A;  1WRK A;  2ZNE A;  1QJT A;  3CZ2 A;  2WCJ A;  1DJW A;  2WOS A;  3EK7 A;  2L4I A;  4PAL A;  1TTX A;  1F8H A;  1Q80 A;  4N1F A;  3SS5 A;  3DXL A;  4P2Y B;  2BE6 A;  4MBE A;  4I5K A;  1NSH A;  1SL9 A;  1CTR A;  1UHK A;  3SJS A;  2HQ8 A;  1G8I A;  1U5I A;  1K96 A;  1OOG A;  3SS4 A;  3AKA A;  2Q4U A;  1J7Q A;  1WDC C;  3CWG A;  3OP0 A;  1KQM C;  1ALV A;  1MXE A;  2OTG B;  3BFH A;  3I5I C;  3NHT A;  1K9K A;  4JKT A;  4OKH A;  2BNX A;  1Z4H A;  1WDC B;  2Y5I A;  5I94 A;  1DJI A;  1NCZ A;  1DF0 B;  2KLD A;  3B7A A;  1LIN A;  1Y0V H;  3BJH A;  2COL B;  5F6T A;  1K9P A;  1DTL A;  1WRZ A;  1REC A;  1CNP A;  4BY5 A;  1CDN A;  2I94 A;  5EL2 A;  1YVL A;  3KHE A;  3CDN A;  3QRX A;  1XA5 A;  1OZO A;  1B9A A;  4MN0 A;  2LHL A;  3TDU A;  4FQT A;  1ZOT B;  1YX7 A;  3FWC A;  1YTZ C;  4PHN A;  1ORG A;  3F45 A;  1RFJ A;  3OB1 B;  4PHJ A;  1SCM B;  4GGN A;  4USL A;  1S5G Z;  3SG5 A;  4Q04 A;  5HKZ A;  1SY9 A;  1XFX O;  3VRR A;  2K60 A;  2LLT A;  3SS3 A;  3SIA A;  2GTE A;  1JF2 A;  1UWO A;  4GNK B;  2KAY A;  3SG6 A;  4DIR A;  4YBH B;  3VRP A;  4ICB A;  2E6W A;  3SG3 A;  2KDH A;  2Q91 A;  1PK0 D;  1ZAC A;  1DEL A;  1SNL A;  1BT6 A;  1WY9 A;  2LVV A;  1BR1 B;  2NCO A;  1HQV A;  1MF8 B;  1AHR A;  2F3Z A;  2JXC A;  4GFT A;  2K7C A;  3ZWH A;  3FE9 A;  3BUO B;  2WC8 A;  1K9U A;  1N65 A;  2LAN A;  1UUS A;  2K0J A;  2QEB A;  3OGN A;  2L2E A;  1DGV A;  1TCO B;  1MQ1 A;  5DKN A;  2L4H A;  2FOT A;  1D1O A;  1RTP 1;  5FYX A;  1DQE A;  4ORC B;  4MRY A;  2M1U A;  1DJZ A;  1NYA A;  1P28 A;  3FE6 A;  4FQO A;  3B87 A;  1JUO A;  1B8C A;  4ORB B;  3NSI A;  1TN4 A;  1QVI Z;  4N1G A;  2KFH A;  4OZD A;  1XFY O;  2PRU A;  4F0Z B;  4FTG A;  1FPW A;  2FCE A;  1F4O A;  2QDI A;  3C1V A;  4C0J A;  3B6X A;  3L47 A;  2KSP A;  4ORA B;  1EG3 A;  1PSR A;  3EG5 B;  2PAS A;  5FI7 A;  3BYA A;  2CXJ A;  1BOC A;  1UHJ A;  1Y1U A;  5HKY A;  4OCI A;  1YUU A;  1M63 B;  4ETO A;  3BUX B;  3K21 A;  1KSO A;  2LE9 B;  3D75 A;  4BY4 A;  4C0K A;  4CFR A;  5AER A;  4PHM A;  2M97 A;  3S0F A;  4MZK A;  4NDB A;  2PYQ A;  2VRG A;  2BL0 C;  4UPG A;  1B8L A;  4CFQ A;  2JT3 A;  3WXA A;  1IQ3 A;  1S6I A;  1BLQ A;  3BOW B;  2YGU A;  1M45 A;  5HLV A;  4CLN A;  1XVJ A;  3CGA A;  1KSM A;  2KQY A;  1FI6 A;  1QV0 A;  2JTZ A;  2P71 A;  1A2X A;  1LKJ A;  2JZI A;  2ZRS A;  4HRG A;  1M39 A;  4AOM A;  2KQ6 A;  1SKT A;  4MRX A;  3OX6 A;  5FI2 A;  2KI6 D;  4INX A;  4PE0 A;  2MA2 A;  4IL1 A;  1X02 A;  3FS7 A;  2GGZ A;  3R1O A;  1YUR A;  2K2F A;  1OMD A;  2QAC A;  2K2A A;  5KU1 A;  2CT9 A;  3GK4 X;  1QV1 A;  4GPL B;  1S6C A;  1YVH A;  4XJK B;  1MUX A;  5CSF A;  1IH0 A;  2L5X B;  5I2Q A;  1DEK A;  2EHB A;  3R1V A;  4MLW A;  3JTD B;  1UUR A;  2O60 A;  4YGC B;  1YRT B;  1KK8 C;  2BBN A;  3CLN A;  1S5G Y;  1KFU S;  1NIW A;  2HF5 A;  3DVE A;  1CFF A;  4F7F A;  5G08 A;  5CSN A;  2BKI B;  5HYD A;  1BG1 A;  3D0Y A;  1OMR A;  1SR6 C;  2WCE A;  2M49 B;  1MXL C;  1S36 A;  4DUQ A;  2KGB C;  3D74 A;  1FBV A;  1KK7 Z;  2MJW B;  1J7R A;  1GJY A;  3EK4 A;  4INW A;  4N5X A;  1IJ5 A;  4YI9 A;  1OE9 B;  3SG2 A;  1AK8 A;  3I5G C;  2M3W A;  2LVK A;  1LVC D;  1EL4 A;  4MEW A;  1DJX A;  1YR5 A;  2LCP A; 
#chains in the Genus database with same CATH homology
 3WHU B;  2M1K B;  2ISD A;  4JQ0 D;  1U5I B;  4NDC A;  2SCP A;  1GQM A;  3TS5 C;  2GGM A;  4YI8 A;  1CLB A;  1HT9 A;  1CDL A;  1PVB A;  1H4B A;  2WCB A;  4DCK A;  1ZMZ A;  4XYN A;  3I5F C;  3BUM B;  2F3Y A;  2OS8 C;  2AAO A;  1E8A A;  2B1U A;  2JT0 A;  3EKH A;  1A75 B;  1KQM B;  3I5I B;  1SRA A;  2JU0 A;  4GGF A;  3ICB A;  1TNP A;  3TUY C;  1RWY A;  1AJ4 A;  2KGR A;  3LL8 B;  2BCX A;  1CM4 A;  2BEC A;  1PAL A;  1Y1X A;  2F2O A;  3TUY B;  1AJ5 A;  2IS9 A;  3AAK A;  2FCD A;  2WND A;  2FJU B;  2NZ0 A;  2ZRT A;  1SL7 A;  1V1F A;  1Y6W A;  2MLF C;  4U8D A;  1AUI B;  2JC2 A;  3EVV A;  1J1E A;  2NLN A;  1WLZ A;  1EXR A;  3SIB A;  1JC2 A;  4M2Q A;  2HPS A;  5JOL A;  1SBJ A;  1W7I B;  3TZ1 A;  2QPT A;  3DVJ A;  4I5N B;  1FW4 A;  1B7T Z;  1XFZ O;  4I5J A;  3NSL A;  3DVM A;  1GGZ A;  3GK1 A;  1XFU O;  3PLF B;  5AEQ A;  1TNQ A;  2I2R E;  1DGU A;  1G4Y R;  1QAT A;  1NX1 A;  3BQ3 A;  5HLO A;  3O4Y A;  4PDZ A;  2A4J A;  2AUC A;  4CID A;  2LLS A;  5TNC A;  1QLK A;  1UHI A;  3DVK A;  3A4U B;  4YGA A;  3OHM B;  1CKK A;  2L0P A;  1NX3 A;  1OSA A;  1QX2 A;  3GK2 A;  4M2O A;  4YRU A;  2ZN8 A;  4WQ3 A;  1A4P A;  3SG4 A;  1ZFS A;  5JJG A;  1QIW A;  2HET A;  3PM8 A;  5I2O A;  1F55 A;  5CSJ A;  3A8R A;  2CBL A;  2JXL A;  1KFX S;  3EVU A;  1S3P A;  1F70 A;  1KK7 Y;  5AFP A;  1S6J A;  1W7J B;  1TNX A;  1QS7 A;  2KAV A;  2KI6 C;  5I2L A;  1A29 A;  4HRE E;  1GGW A;  2MHH A;  3SG7 A;  2AMI A;  2GV5 A;  4HSZ A;  2LMV A;  1KWO C;  2K8M B;  4ZCV A;  1SK6 D;  1ALW A;  2F2P A;  1H8B A;  4WQ2 A;  1QTX A;  1IJ6 A;  1KWO B;  2F33 A;  2H61 A;  2Y1N A;  2LV7 A;  2BL0 B;  2BBM A;  5DKR A;  2M9G A;  3ZNI A;  1EJ3 A;  2JTT A;  4MSP A;  1PVA A;  1LA3 A;  1DJH A;  2OPO A;  3GOF A;  4YGE B;  3OB2 B;  2BCA A;  1BOD A;  1N2D A;  3DF0 A;  4MZJ A;  1J7P A;  1JSA A;  2JQ6 A;  1V1G A;  2EGD A;  2KFF A;  2V53 A;  2DOQ A;  1YX8 A;  2F8P A;  1L2O C;  1NCX A;  3H4S E;  4PHK A;  1AP4 A;  2LVJ A;  2CNP A;  2JNF A;  4NQG A;  5K89 A;  3BUN B;  3HCM A;  3EK8 A;  3PAT A;  1XYD A;  4OV2 A;  2KNE A;  2RGI A;  1QX7 A;  3TDZ A;  1JBA A;  2BE4 A;  3VRN A;  3LK1 A;  1NPQ A;  1DVI A;  2LP3 A;  2NXQ A;  1QLS A;  3BOW A;  4DS7 A;  2M7N A;  1QAS A;  1BR4 B;  1TOP A;  1BMO A;  1XK4 A;  1XO5 A;  3PN7 C;  4NDD A;  1B47 A;  4AQJ A;  5BPJ A;  5GQQ C;  1CFC A;  1K90 D;  3PN7 B;  1JF0 A;  1KK8 B;  5IBW A;  2KAX A;  2EC6 C;  2KOT A;  3VGO A;  5ER4 X;  3PAL A;  2I7A A;  2SAS A;  1L7Z A;  1SR6 B;  1M31 A;  1SCV A;  3WHT B;  1XFV O;  1NCY A;  3RM1 A;  2ZFD A;  4A4C A;  2ZKM X;  1MR8 A;  2I18 A;  4XJK A;  3LCP C;  3I5G B;  5DKQ A;  1RJV A;  2KYF A;  4E68 A;  1IKU A;  3BUW B;  1IG5 A;  1XFW O;  1CB1 A;  5HKW A;  2KFG A;  1KCY A;  4R1E A;  1RRO A;  4GUK A;  2LP2 A;  3KO0 A;  4GGF C;  1MWN A;  1M46 A;  3MSE B;  5PAL A;  3TS5 B;  4CPV A;  1IGV A;  3O2P A;  2E30 A;  1C7V A;  3EVR A;  2G2B A;  1QVI Y;  4AQI A;  3I5F B;  5D7F A;  2OS8 B;  2LNK A;  3WNX B;  1BU3 A;  2LHI A;  2M7L A;  1PRW A;  3CS1 A;  1R2U A;  2O5G A;  3AKB A;  3KF9 A;  2HQW A;  2R2I A;  3AAJ A;  2WOR A;  1YUT A;  1ZUZ A;  3TDI A;  2MBX A;  4YGB B;  4MVF A;  2OTG C;  1DT7 B;  1JWD A;  2LC5 A;  2CTN A;  1NX2 A;  1JFK A;  2K7O A;  1N0Y A;  1CMF A;  2JT8 A;  3I5H C;  3O78 A;  1B4C A;  1QIV A;  2LAP A;  4PE4 A;  2M0R A;  1S1E A;  4JWQ A;  3I5H B;  3KPX A;  5D69 A;  1CLM A;  1A75 A;  1OMV A;  1LA0 A;  1DF0 A;  1J7O A;  1RK9 A;  1WLM A;  2M8U A;  2PSR A;  1AVS A;  4DRW A;  2JRF A;  2KHN A;  3HX4 A;  3M0W A;  1DMO A;  2TN4 A;  1J55 A;  1DJG A;  3CR5 X;  4ZCU A;  2ZN9 A;  1SCM C;  2PVB A;  2CCM A;  4I5L B;  4PE1 A;  1JFJ A;  1PUL A;  1K8U A;  1SPY A;  1TNW A;  5I8N A;  2ZND A;  1K95 A;  1SL8 A;  5ER5 A;  1UHH A;  4YGD B;  5CPV A;  3NXA A;  2KYC A;  2BKH B;  4OVN F;  1A03 A;  1F4Q A;  1K93 D;  1F54 A;  3FIA A;  4L9M A;  4QJ3 B;  2KBM A;  2LMU A;  4M2P A;  1K2H A;  2BCB A;  1SMG A;  1QXP A;  1TCF A;  4C0L A;  1NWD A;  3IQO A;  1EH2 A;  2D8N A;  2L51 A;  1YRU B;  5KSZ A;  2PMY A;  3BXK A;  2M29 A;  1SW8 A;  3VRQ A;  2G9B A;  1KQV A;  1J1D A;  1CDP A;  5AAN A;  4GBA A;  2JPT A;  2K7B A;  2P6B B;  2H61 C;  4TNC A;  1CFP A;  5AXI A;  2LLU A;  3D10 A;  3DD4 A;  3IQQ A;  3NSK A;  4HRH A;  1NP8 A;  5KTY A;  1UP5 A;  3LLE A;  4PE7 A;  3CTN A;  4PCW A;  1F71 A;  3CZT X;  1KFX L;  3EKJ A;  1VRK A;  3VRO A;  2PAL A;  3FWB A;  2L98 A;  4MZL A;  4A4B A;  1B1G A;  3DF0 B;  1IQ5 A;  1B8R A;  2MAZ A;  3OX5 A;  1CDM A;  4WRI A;  4D1E A;  2NCP A;  2K7D A;  4QJ4 B;  2LVI A;  5J3X A;  2LMT A;  1IRJ A;  4JPZ B;  1WRL A;  1TIZ A;  1NUB A;  2JUL A;  1DJY A;  1L2O B;  1LXF C;  3CR4 X;  1OOJ A;  1CMG A;  2LM5 A;  3PSR A;  1XK4 C;  3KEV A;  1UHN A;  1C07 A;  1TRF A;  1BF5 A;  2K61 A;  1ODB A;  2H2K A;  1CFD A;  1S26 D;  5B8I B;  1OQP A;  1CM1 A;  2JNX A;  3D0Y B;  2JWW A;  4QJ5 B;  1K94 A;  3LK0 A;  2MRD A;  1G33 A;  3O6B A;  2Y4Q A;  1B7T Y;  3CR2 A;  2LUC A;  1NX0 A;  1FF1 A;  1C7W A;  2EC6 B;  1FI5 A;  1Y1A A;  1IWQ A;  1SYM A;  2KI4 C;  3JVT C;  5CSI A;  3E3R A;  3JTD C;  1YUS A;  3NSO A;  3JVT B;  2KI4 B;  1PSB A;  1KFU L;  2MLE C;  2Y1M A;  3RLZ A;  2JOJ A;  1BJF A;  3PFV A;  2KBI A;  2L50 A;  2LUX A;  4OR9 B;  1MHO A;  4P5O E;  1EG4 A;  1OZS A;  2WCF A;  1CLL A;  3IF7 A;  1QX5 B;  4GAO A;  1R6P A;  1WRK A;  2ZNE A;  1QJT A;  1DJW A;  2WOS A;  3EK7 A;  2L4I A;  4PAL A;  1TTX A;  1F8H A;  1Q80 A;  4N1F A;  4P2Y B;  2BE6 A;  4MBE A;  4I5K A;  1NSH A;  1SL9 A;  1CTR A;  1UHK A;  3SJS A;  2HQ8 A;  1G8I A;  1U5I A;  1K96 A;  3AKA A;  2Q4U A;  1J7Q A;  1WDC C;  3CWG A;  3OP0 A;  1KQM C;  1ALV A;  1MXE A;  2OTG B;  3I5I C;  4OKH A;  1K9K A;  1WDC B;  2Y5I A;  1DJI A;  1NCZ A;  1DF0 B;  1LIN A;  1Y0V H;  2COL B;  5F6T A;  1K9P A;  1DTL A;  1WRZ A;  1REC A;  1CNP A;  4BY5 A;  1CDN A;  2I94 A;  1YVL A;  3KHE A;  3QRX A;  1XA5 A;  1OZO A;  1B9A A;  4MN0 A;  2LHL A;  3TDU A;  1ZOT B;  1YX7 A;  3FWC A;  1YTZ C;  4PHN A;  3F45 A;  1RFJ A;  3OB1 B;  4PHJ A;  1SCM B;  4GGN A;  4USL A;  1S5G Z;  3SG5 A;  4Q04 A;  5HKZ A;  1SY9 A;  1XFX O;  3VRR A;  2LLT A;  3SIA A;  1JF2 A;  1UWO A;  4GNK B;  2KAY A;  3SG6 A;  4DIR A;  4YBH B;  3VRP A;  4ICB A;  2E6W A;  3SG3 A;  2KDH A;  2Q91 A;  1PK0 D;  1ZAC A;  1SNL A;  1WY9 A;  1BT6 A;  2LVV A;  2NCO A;  1BR1 B;  1HQV A;  1MF8 B;  1AHR A;  2F3Z A;  2JXC A;  4GFT A;  2K7C A;  3ZWH A;  3BUO B;  2WC8 A;  1K9U A;  1N65 A;  2LAN A;  1UUS A;  2K0J A;  2L2E A;  1DGV A;  1TCO B;  1MQ1 A;  5DKN A;  2L4H A;  2FOT A;  1D1O A;  1RTP 1;  5FYX A;  4ORC B;  4MRY A;  2M1U A;  1DJZ A;  1NYA A;  4FQO A;  1JUO A;  1B8C A;  4ORB B;  3NSI A;  1TN4 A;  1QVI Z;  4N1G A;  2KFH A;  1XFY O;  2PRU A;  4F0Z B;  4FTG A;  1FPW A;  2FCE A;  1F4O A;  3C1V A;  4C0J A;  2KSP A;  4ORA B;  1EG3 A;  1PSR A;  2PAS A;  3BYA A;  2CXJ A;  1BOC A;  1UHJ A;  1Y1U A;  5HKY A;  4OCI A;  1YUU A;  1M63 B;  4ETO A;  3BUX B;  3K21 A;  1KSO A;  2LE9 B;  4BY4 A;  4C0K A;  4CFR A;  5AER A;  4PHM A;  2M97 A;  4MZK A;  4NDB A;  2VRG A;  4UPG A;  2BL0 C;  1B8L A;  4CFQ A;  2JT3 A;  3WXA A;  1IQ3 A;  1S6I A;  1BLQ A;  3BOW B;  5HLV A;  1M45 A;  4CLN A;  1XVJ A;  3CGA A;  1KSM A;  2KQY A;  1FI6 A;  1QV0 A;  2JTZ A;  1A2X A;  1LKJ A;  2JZI A;  2ZRS A;  4HRG A;  1M39 A;  4AOM A;  2KQ6 A;  1SKT A;  4MRX A;  3OX6 A;  2KI6 D;  4PE0 A;  2MA2 A;  4IL1 A;  1X02 A;  3FS7 A;  2GGZ A;  1YUR A;  2K2F A;  1OMD A;  2QAC A;  2K2A A;  5KU1 A;  2CT9 A;  3GK4 X;  1QV1 A;  4GPL B;  1S6C A;  1YVH A;  4XJK B;  1MUX A;  5CSF A;  1IH0 A;  2L5X B;  5I2Q A;  2EHB A;  4MLW A;  3JTD B;  1UUR A;  2O60 A;  4YGC B;  1YRT B;  1KK8 C;  2BBN A;  3CLN A;  1S5G Y;  1KFU S;  1NIW A;  2HF5 A;  3DVE A;  1CFF A;  5G08 A;  5CSN A;  2BKI B;  5HYD A;  1BG1 A;  3D0Y A;  1OMR A;  1SR6 C;  2WCE A;  2M49 B;  1MXL C;  1S36 A;  4DUQ A;  2KGB C;  3EK4 A;  1FBV A;  1KK7 Z;  2MJW B;  1J7R A;  1GJY A;  4N5X A;  4YI9 A;  1AK8 A;  1IJ5 A;  1OE9 B;  3SG2 A;  3I5G C;  2M3W A;  2LVK A;  1LVC D;  1EL4 A;  4MEW A;  1DJX A;  1YR5 A;  2LCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...