2JNFA

Solution structure of fly troponin c, isoform f1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
MGDVSKLSSNQVKLLETAFRDFETPEGSGRVSTDQIGIILEVLGIQQTKSTIRQLIDEFDPFGNGDIDFDSFKIIGARFLGEEVNPEQMQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of lethocerus troponin C: insights into the mechanism of stretch activation in muscles
pubmed doi rcsb
source organism Lethocerus indicus
molecule tags Metal binding protein
molecule keywords Troponin C
total genus 34
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnfA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnfA01
1OMVA 1XFWO 2OTGC 1YX7A 2ZKMX 4PE4A 1B8CA 2KFHA 3PATA 3VRQA 3CLNA 2BBMA 4DIRA 3HX4A 1EL4A 3I5FB 1PRWA 1Q80A 3I5HC 1HT9A 4IL1A 4HREE 4MRXA 3KEVA 2JTZA 2M29A 4YI9A 1WRLA 1TN4A 3NSLA 3TUYC 1FI5A 5GQQC 3CGAA 1DT7B 1K95A 2MLEC 1DJWA 4PHJA 5IBWA 2LMUA 1RFJA 2MAZA 3BXKA 5PALA 5HKZA 4L9MA 2Q4UA 5AXIA 1AP4A 1CLBA 2KYFA 4Q04A 2BCBA 4D1EA 5FYXA 2K7BA 4WQ3A 1TIZA 1WLZA 2WOSA 2EGDA 1ZMZA 2I7AA 3ZNIA 4AQIA 4MEWA 2KYCA 3DVEA 4NDBA 2V53A 1RJVA 1RECA 2ZFDA 1S6CA 2LHIA 3EVUA 1V1GA 2BECA 2NXQA 2JPTA 1CB1A 3D0YA 1SKTA 3OHMB 4ORBB 1BLQA 5AANA 2K61A 2ZN8A 4ZCVA 1PVAA 1S36A 2GGZA 1C7VA 3VRNA 3WHUB 1DF0A 1IG5A 1QV1A 2COLB 1C07A 2OS8C 2OS8B 5AFPA 1A75A 3EK8A 3I5HB 4UPGA 4CIDA 5BPJA 1K9KA 1ODBA 1XFUO 4TNCA 1LA0A 2LNKA 1BJFA 3BYAA 1AJ4A 1UHKA 2KHNA 1QVIZ 1KSMA 1RROA 4GAOA 4QJ5B 1BODA 2K7OA 1KK8C 1AK8A 1K94A 2LE9B 1GJYA 1BT6A 1QATA 5HLOA 2JOJA 1GQMA 1NCXA 1R2UA 3TDUA 1SCVA 5AEQA 4CFRA 1DGVA 1DJZA 4C0JA 2ZRTA 3BUWB 2O5GA 1C7WA 3KHEA 1JFKA 2FCEA 1YUSA 1YRUB 1H8BA 5D69A 1L2OC 3GOFA 4HRGA 1CLMA 1QXPA 2JZIA 2LLUA 4ETOA 1MWNA 4XJKA 1B7TZ 2LLSA 3JVTB 5HLVA 2L2EA 1G8IA 1YRTB 1AUIB 2KAVA 3O2PA 4GNKB 2HQWA 4WRIA 4PE7A 1KQVA 3PM8A 1BR4B 1ZUZA 2HF5A 1S26D 1LA3A 3CWGA 1XK4A 1TTXA 1ZFSA 2QACA 3I5FC 2TN4A 2HPSA 3A4UB 3EKJA 4C0KA 1G4YR 4PHNA 3CR5X 3TS5B 5D7FA 2OTGB 2LVIA 3FWCA 4BY5A 5F6TA 2WNDA 3PN7C 1J7OA 1DMOA 2JC2A 5CSJA 3DVKA 1SBJA 1K96A 4DS7A 1WRKA 3KF9A 1QIVA 2M7NA 1IQ3A 5KU1A 1YTZC 2K2FA 2LP3A 4N1FA 2M1KB 1CM1A 1CMFA 2AAOA 2LP2A 1UWOA 2KNEA 1S5GY 1TNWA 2H61C 3E3RA 3LK0A 3D0YB 1NX2A 1G33A 5CPVA 2FCDA 2D8NA 1NYAA 1EJ3A 5I2QA 1K2HA 1KFXL 1DJYA 1KFUS 1MUXA 2KGBC 2M1UA 3LK1A 4FQOA 3NSOA 4AQJA 3BOWA 2EC6B 3BUXB 5ER5A 4NQGA 2M3WA 1A2XA 1SCMC 1M31A 2CTNA 2MJWB 1U5IA 3IF7A 5DKNA 4DUQA 4GGNA 1N0YA 1FBVA 2WCBA 2R2IA 4AOMA 2BL0B 1QASA 5TNCA 2ZNEA 2KGRA 4XJKB 1JWDA 1KWOB 2Q91A 2KAXA 2LC5A 1LXFC 1IWQA 1CKKA 4GFTA 4NDDA 1F54A 1IJ6A 1SK6D 1OE9B 1YX8A 1WRZA 1IQ5A 1F4QA 3FS7A 1DVIA 2CBLA 2K7CA 1QJTA 1DJHA 1LVCD 2LUXA 2ZRSA 1F71A 1KFUL 1NX0A 5JJGA 3BOWB 2GV5A 1NX1A 1EG4A 4GGFC 2LLTA 4MZKA 5I2LA 1D1OA 2OPOA 3O6BA 2I94A 1QIWA 2IS9A 1B9AA 1SR6C 4P5OE 1OQPA 3SG4A 4OCIA 1F70A 2PSRA 4FTGA 4ORAB 2NCPA 1S1EA 2FJUB 3A8RA 4MZJA 4USLA 1K8UA 1HQVA 1SW8A 1SL8A 3DVJA 1JFJA 3BQ3A 1TNXA 2MHHA 5KSZA 2KFGA 2LMVA 1OZSA 3VGOA 1XVJA 4HSZA 4YBHB 4CFQA 1PK0D 3H4SE 4N5XA 1LKJA 1NP8A 2JWWA 1M39A 2I18A 1NWDA 2MA2A 1XFYO 1Y1XA 4OVNF 1QVIY 3FWBA 2A4JA 4OKHA 1M45A 4BY4A 5HYDA 2F3YA 1KK7Z 1WLMA 2K8MB 4GUKA 2E6WA 5JOLA 1S5GZ 3MSEB 2LMTA 4YGEB 5DKQA 1DGUA 1RWYA 3SG7A 1CNPA 4A4CA 4M2QA 2JTTA 2M7LA 3OB2B 1NCYA 1QX5B 4QJ4B 1S6JA 1WY9A 2LVVA 1A75B 1BMOA 2M8UA 1ZOTB 3CTNA 1U5IB 1JUOA 1RK9A 2KI6C 2O60A 2I2RE 1CDNA 1JF2A 2EHBA 4HRHA 4JWQA 2MBXA 4DRWA 1KCYA 3EVRA 2LAPA 2BKIB 2KFFA 2ZNDA 2JT8A 2M0RA 1JF0A 3SIBA 4N1GA 3BUOB 2LVJA 1WDCC 2KBMA 4ICBA 3VRPA 1CFPA 5CSIA 1NX3A 1TNPA 2BL0C 2NZ0A 1EXRA 3WNXB 1SL9A 1M63B 3SG6A 1J7QA 1PULA 3SJSA 4C0LA 1KSOA 2KI4B 2BCXA 3FIAA 1LINA 1QLSA 2BE4A 4PDZA 4DCKA 3EVVA 3VROA 1PVBA 2F2PA 4P2YB 5ER4X 1DF0B 2KBIA 3RLZA 3SG2A 3I5IB 2LANA 3LCPC 3OP0A 1EG3A 3D10A 1K90D 5AERA 1XFZO 1OSAA 3JVTC 1Y1UA 4MN0A 1QX2A 3HCMA 3M0WA 3IQOA 2AUCA 4GBAA 2G2BA 4M2OA 3DF0A 1OMRA 1MHOA 2L50A 2LUCA 2BE6A 1CDLA 3PSRA 1OOJA 1NSHA 1YVLA 5J3XA 2VRGA 4NDCA 4CPVA 3O4YA 3PLFB 2JNXA 2PVBA 1GGZA 1EH2A 1TCFA 2NCOA 1QLKA 1PALA 2PALA 1KQMB 1F4OA 2L4HA 1JSAA 1A03A 1KK8B 2PMYA 3TZ1A 2JT3A 3JTDB 1YUTA 3K21A 3RM1A 2JNFA 1TOPA 3PALA 1J7PA 1CLLA 5DKRA 3AAKA 2JXLA 1IH0A 1N2DA 2KSPA 1ALVA 1K93D 1SPYA 1NUBA 3BUMB 5I2OA 4PHKA 4OV2A 1B4CA 1PSBA 1E8AA 3DF0B 2JU0A 3CS1A 1L7ZA 4PALA 4GPLB 1CFFA 4MZLA 3AKAA 2LM5A 4JQ0D 4M2PA 4OR9B 2KAYA 1BOCA 1B47A 4YI8A 1J1EA 1X02A 1JC2A 3GK1A 1DJIA 2P6BB 4MRYA 5HKWA 1VRKA 1KK7Y 1MQ1A 2JT0A 2LVKA 2NLNA 1K9UA 3KO0A 3NSKA 2K2AA 1SRAA 1FF1A 3PFVA 1XA5A 2QPTA 2Y4QA 3DD4A 4MVFA 2JRFA 3SG5A 3VRRA 1F55A 1MXLC 1YVHA 4PHMA 2CXJA 2JQ6A 3ICBA 1V1FA 1J1DA 3TUYB 1BF5A 3F45A 4R1EA 1IJ5A 3TDZA 3NSIA 2AMIA 3SIAA 4PE1A 1ZACA 2KQYA 1CFCA 3OX6A 2F8PA 1FW4A 1QS7A 2PASA 1RTP1 2F2OA 1SR6B 4F0ZB 1J7RA 1B7TY 1TCOB 1Y6WA 4WQ2A 2PRUA 1UUSA 2H61A 2MLFC 1BU3A 1S6IA 3OX5A 2JXCA 2B1UA 1QX7A 2HQ8A 4YGAA 4JPZB 5G08A 2CT9A 3JTDC 1KWOC 1SMGA 1UHJA 3IQQA 4MBEA 1IRJA 2HETA 3NXAA 4I5LB 1NCZA 2KQ6A 1AJ5A 3AKBA 1SYMA 2LHLA 2E30A 2WCFA 4MSPA 2SCPA 1FPWA 1TRFA 2L0PA 2RGIA 3TDIA 1IKUA 4I5KA 1W7JB 4A4BA 2EC6C 4ZCUA 5K89A 1QTXA 3O78A 3ZWHA 4E68A 1CTRA 1QV0A 1XK4C 2ZN9A 1DJGA 2L4IA 2L98A 3TS5C 3CR4X 4PCWA 5HKYA 1SL7A 1NPQA 2BCAA 1B8LA 2ISDA 3LL8B 4GGFA 1UHHA 1MXEA 3I5IC 1YR5A 1K9PA 1NIWA 2CCMA 3I5GB 2Y1MA 2F3ZA 1XFVO 4U8DA 2G9BA 1MR8A 1Y0VH 2MRDA 2WCEA 5I8NA 2JULA 1CDMA 2WORA 2KDHA 1J55A 2M97A 2FOTA 3PN7B 1UHIA 2GGMA 2M49B 1KQMC 1YURA 5KTYA 1CDPA 5CSFA 2BKHB 3LLEA 4YGBB 1FI6A 3OB1B 4MLWA 3I5GC 1JBAA 2F33A 1YUUA 2Y5IA 1OZOA 1WDCB 1S3PA 1SCMB 1TNQA 5CSNA 1XYDA 1CM4A 2H2KA 4QJ3B 1AHRA 1OMDA 1M46A 3EKHA 3EK4A 1R6PA 1W7IB 1XO5A 3CZTX 3SG3A 1H4BA 2L5XB 4YRUA 3KPXA 3BUNB 2WC8A 1PSRA 1UP5A 2K7DA 2DOQA 2KOTA 4I5NB 1GGWA 4YGCB 1A4PA 2SASA 1DJXA 1A29A 1N65A 3EK7A 3DVMA 2K0JA 3AAJA 1CMGA 4YGDB 3QRXA 1B1GA 1ALWA 1Y1AA 1UHNA 1AVSA 4CLNA 1UURA 3GK2A 1SY9A 1XFXO 1DTLA 1IGVA 4I5JA 2CNPA 2KI6D 3GK4X 1CFDA 3CR2A 2M9GA 2Y1NA 2LCPA 4ORCB 5B8IB 2KI4C 3C1VA 4XYNA 1MF8B 2L51A 2LV7A 3WHTB 1L2OB 1KFXS 2BBNA 1F8HA 1BG1A 3WXAA 4PE0A 1BR1B 1B8RA 1SNLA
chains in the Genus database with same CATH superfamily
1OMVA 1XFWO 2OTGC 1YX7A 2ZKMX 4PE4A 1B8CA 2KFHA 2WCHA 3PATA 5EL2A 3VRQA 2QEOA 3CLNA 2BBMA 4DIRA 3HX4A 1EL4A 3R1OA 4INXA 3I5FB 3CZ2A 1PRWA 1Q80A 3D78A 3I5HC 1HT9A 4IL1A 3DZTA 4HREE 4MRXA 3KEVA 2JTZA 2M29A 4YI9A 1WRLA 1TN4A 3NSLA 3TUYC 1FI5A 5GQQC 3CGAA 1DT7B 1K95A 2MLEC 1DJWA 4PHJA 5IBWA 2LMUA 1RFJA 2MAZA 3BXKA 5PALA 5HKZA 4L9MA 2Q4UA 5AXIA 1AP4A 1CLBA 2KYFA 4Q04A 4INWA 1DQEA 1C3ZA 2BCBA 4D1EA 1DC1A 5FYXA 2K7BA 4JD9A 4WQ3A 1TIZA 1WLZA 2WOSA 2EGDA 1ZMZA 2I7AA 3ZNIA 4AQIA 4MEWA 2KYCA 3DVEA 4NDBA 2V53A 1P28A 1RJVA 3CZ0A 1RECA 2ZFDA 3SS3A 1S6CA 2LHIA 3EVUA 1V1GA 2BECA 2NXQA 2JPTA 1CB1A 3D0YA 1SKTA 2WC5A 3OHMB 4ORBB 1BLQA 5AANA 2K61A 2ZN8A 4ZCVA 1PVAA 3L47A 1S36A 2GGZA 1C7VA 2QDIA 3VRNA 3WHUB 3CDNA 1DF0A 1IG5A 1QV1A 1Z2CB 2COLB 5FI2A 2OS8C 5I94A 1C07A 2YGUA 2OS8B 3B86A 5AFPA 1A75A 3EK8A 3I5HB 4UPGA 4CIDA 5BPJA 1K9KA 1ODBA 1QWVA 1XFUO 4TNCA 2GTEA 1LA0A 2LNKA 1BJFA 1OOIX 1AJ4A 1UHKA 3BYAA 2KHNA 1QVIZ 1KSMA 1RROA 4GAOA 4QJ5B 1BODA 2K7OA 1KK8C 1AK8A 1K94A 2LE9B 3SS4A 3CABA 1GJYA 1BT6A 1QATA 5HLOA 2JOJA 1DEKA 2K60A 1GQMA 1NCXA 1R2UA 3TDUA 1SCVA 5AEQA 4CFRA 1DGVA 1DJZA 3D75A 4C0JA 2ZRTA 3BUWB 2O5GA 2KPHA 1C7WA 3KHEA 1JFKA 1C3YA 2KLEA 2FCEA 1YUSA 1YRUB 1H8BA 5D69A 1L2OC 3GOFA 3S0GA 4HRGA 1CLMA 1QXPA 2JZIA 2LLUA 3BFHA 3UO9A 4ETOA 1MWNA 4XJKA 1B7TZ 2LLSA 3JVTB 3BJHA 5HLVA 2L2EA 1G8IA 1YRTB 3BFAA 1AUIB 2KAVA 3O2PA 4GNKB 2HQWA 4WRIA 4PE7A 1KQVA 3PM8A 3BFBA 1BR4B 1ZUZA 2HF5A 1S26D 1LA3A 3CWGA 1XK4A 3DXLA 1TTXA 1ZFSA 2QACA 5D3OA 3I5FC 2TN4A 2HPSA 3A4UB 3EKJA 4C0KA 1G4YR 4PHNA 3CR5X 3TS5B 5D7FA 2OTGB 2LVIA 3FWCA 4FQTA 4BY5A 5F6TA 2WNDA 3PN7C 1J7OA 1DMOA 2JC2A 5CSJA 3DVKA 1SBJA 1K96A 4JKTA 4DS7A 1WRKA 3KF9A 3D77A 1QIVA 2M7NA 1IQ3A 5KU1A 1YTZC 2K2FA 2LP3A 4N1FA 3S0DA 2M1KB 1CM1A 3D76A 1CMFA 2AAOA 2LP2A 1UWOA 2KNEA 1S5GY 1TNWA 2H61C 3E3RA 3LK0A 3D0YB 1NX2A 1G33A 2WCJA 5CPVA 2FCDA 2D8NA 1NYAA 1EJ3A 5I2QA 1K2HA 1KFXL 1DJYA 1KFUS 1MUXA 2KGBC 2M1UA 3LK1A 4FQOA 3NSOA 4AQJA 3BOWA 2EC6B 3BUXB 5ER5A 4NQGA 2M3WA 1A2XA 5DICA 3R72A 1SCMC 1M31A 2CTNA 2MJWB 1U5IA 3IF7A 2L5YA 5DKNA 3NHIA 4DUQA 3B7AA 4GGNA 1N0YA 2L2CA 1FBVA 2WCBA 2R2IA 2JPOA 2BL0B 1QASA 5TNCA 2ZNEA 2KGRA 4XJKB 4AOMA 1JWDA 1KWOB 2Q91A 2KAXA 2P70A 2LC5A 2QEHA 1LXFC 1IWQA 1CKKA 4GFTA 4NDDA 1F54A 2H8VA 1IJ6A 1SK6D 1OE9B 1YX8A 1WRZA 1IQ5A 1F4QA 3FS7A 1DVIA 2CBLA 2K7CA 1QJTA 2P71A 3VB1A 1DJHA 1LVCD 2LUXA 3FE8A 2ZRSA 3FE9A 1F71A 1KFUL 1NX0A 5JJGA 3BOWB 2GV5A 1NX1A 1EG4A 4GGFC 2LLTA 4MZKA 5I2LA 3N7HA 1D1OA 2OPOA 3FE6A 3O6BA 2I94A 1QIWA 2IS9A 1B9AA 1SR6C 4P5OE 3V2LA 1OQPA 2PYQA 3SG4A 4OCIA 4PT1A 3B87A 1F70A 3K1EA 2PSRA 4FTGA 4ORAB 2NCPA 1S1EA 3D74A 2FJUB 3A8RA 4MZJA 4USLA 1K8UA 1HQVA 1SW8A 2FJYA 1SL8A 3DVJA 1JFJA 3BQ3A 1TNXA 3RZSA 2MHHA 5KSZA 1Z4HA 2KFGA 2LMVA 1OZSA 3VGOA 1XVJA 4HSZA 4YBHB 4CFQA 3NGVA 1PK0D 3D73A 3H4SE 4N5XA 1LKJA 1NP8A 2BNXA 2JWWA 1M39A 2I18A 1NWDA 1OOFA 2MA2A 1XFYO 1Y1XA 4OVNF 1QVIY 3FWBA 2A4JA 4OKHA 1M45A 4BY4A 1OW4A 5HYDA 2F3YA 1KK7Z 1WLMA 2K8MB 4GUKA 3OBVA 3O4XA 4IJ7A 2E6WA 5JOLA 1S5GZ 3MSEB 2LMTA 4YGEB 5DKQA 1DGUA 1RWYA 3S0AA 3SG7A 1CNPA 4A4CA 4M2QA 2JTTA 2M7LA 3OB2B 4KYNA 1DELA 1NCYA 1QX5B 4QJ4B 1S6JA 1WY9A 2LVVA 1A75B 1BMOA 2M8UA 1ZOTB 3CTNA 1U5IB 1JUOA 1RK9A 2KI6C 2O60A 2I2RE 1CDNA 1JF2A 2EHBA 4HRHA 4JWQA 2MBXA 4DRWA 1KCYA 3EVRA 2LAPA 2BKIB 2KFFA 2ZNDA 2JT8A 2M0RA 1JF0A 3SIBA 4N1GA 3BUOB 2LVJA 1WDCC 2KBMA 4ICBA 3VRPA 1CFPA 5CSIA 1NX3A 1TNPA 2BL0C 2NZ0A 1TWOA 1EXRA 3WNXB 1SL9A 1M63B 3SG6A 1J7QA 3QMEA 3R1PA 1PULA 3R1VA 3SJSA 1W9ZA 4C0LA 1KSOA 2KI4B 2BCXA 2WC6A 1LINA 1QLSA 2BE4A 3FIAA 4PDZA 4DCKA 3EVVA 3VROA 1PVBA 2F2PA 4P2YB 5ER4X 2QEVA 1DF0B 2KBIA 3CZ1A 3RLZA 3I5IB 2LANA 3LCPC 3OP0A 3SG2A 1EG3A 3D10A 1K90D 5AERA 1OOHA 1OSAA 1XFZO 3JVTC 1Y1UA 4MN0A 1QX2A 3HCMA 3M0WA 3IQOA 2AUCA 4GBAA 2G2BA 4M2OA 3DF0A 1OMRA 1MHOA 2L50A 2LUCA 2PQLA 2BE6A 1CDLA 3PSRA 1OOJA 1NSHA 1YVLA 5J3XA 2VRGA 4NDCA 4CPVA 3O4YA 3PLFB 3S0FA 2JNXA 2PVBA 1GGZA 1EH2A 1TCFA 2NCOA 1QLKA 1PALA 2PALA 1KQMB 1F4OA 2L4HA 2QEBA 1JSAA 1A03A 1KK8B 2PMYA 3TZ1A 2JT3A 3JTDB 1YUTA 3K21A 3RM1A 2JNFA 1TOPA 3PALA 1J7PA 1CLLA 5DKRA 5FI6A 2WCLA 3AAKA 1XFRA 2JXLA 1IH0A 3S0EA 1N2DA 2KSPA 1ALVA 1K93D 1SPYA 1NUBA 3BUMB 3Q8IA 5I2OA 4PHKA 4OV2A 1B4CA 1PSBA 1E8AA 3DF0B 2JU0A 3OGNA 3CS1A 5HL1A 1L7ZA 4PALA 4GPLB 1CFFA 4MZLA 3AKAA 2LM5A 3B88A 4JQ0D 4M2PA 4OR9B 2KAYA 1BOCA 1B47A 4YI8A 1J1EA 1X02A 1JC2A 3GK1A 1DJIA 2P6BB 4MRYA 5HKWA 1VRKA 1KK7Y 1MQ1A 2JT0A 2LVKA 2NLNA 1K9UA 3KO0A 3NSKA 2K2AA 1SRAA 1FF1A 3PFVA 1XA5A 2QPTA 2Y4QA 3DD4A 4MVFA 2WCKA 2JRFA 3SG5A 3VRRA 1F55A 1MXLC 1YVHA 4PHMA 2CXJA 2JQ6A 3ICBA 1V1FA 3PM2A 1J1DA 3TUYB 1BF5A 3F45A 4R1EA 1IJ5A 3TDZA 3NSIA 2AMIA 3SIAA 4PE1A 1ZACA 2KQYA 1CFCA 3OX6A 2F8PA 1T14A 1FW4A 1IIOA 1QS7A 2PASA 1RTP1 2F2OA 1OOGA 1SR6B 4F0ZB 1J7RA 1B7TY 1TCOB 1Y6WA 4WQ2A 2PRUA 1UUSA 2H61A 2MLFC 1BU3A 1TUZA 1S6IA 3OX5A 2JXCA 2B1UA 1QX7A 2HQ8A 4YGAA 4JPZB 5G08A 3S0BA 2CT9A 3JTDC 1KWOC 1SMGA 1UHJA 3CYZA 3IQQA 4MBEA 1IRJA 2HETA 3NXAA 4I5LB 1NCZA 2KQ6A 3DY9A 1AJ5A 3L4AA 2BAPA 3EG5B 3AKBA 1SYMA 2LHLA 2E30A 2WCFA 4MSPA 2SCPA 1FPWA 1TRFA 2L0PA 2RGIA 3TDIA 1IKUA 4I5KA 1W7JB 4A4BA 2EC6C 4ZCUA 5K89A 1QTXA 3O78A 3PJIA 3L4LA 1CTRA 3ZWHA 1QV0A 1XK4C 2ZN9A 1DJGA 4E68A 2KLDA 2L4IA 2L98A 3TS5C 3CR4X 4PCWA 5HKYA 3DYEA 1SL7A 1NPQA 2BCAA 1B8LA 2ISDA 3LL8B 4GGFA 1UHHA 1MXEA 3I5IC 1YR5A 1K9PA 1NIWA 2CCMA 3I5GB 2Y1MA 2F3ZA 1XFVO 4U8DA 2G9BA 1MR8A 1Y0VH 2MRDA 2WCEA 5I8NA 2JULA 1CDMA 2WORA 2KDHA 1J55A 2M97A 2FOTA 3PN7B 1UHIA 5FI7A 2GGMA 2M49B 1KQMC 1YURA 5KTYA 1CDPA 5CSFA 3UNWA 2BKHB 3NHTA 3LLEA 4YGBB 1FI6A 3OB1B 4MLWA 3I5GC 1JBAA 2F33A 1YUUA 2Y5IA 1OZOA 1WDCB 1S3PA 1SCMB 1TNQA 5CSNA 1XYDA 1CM4A 1TUJA 2H2KA 4QJ3B 1AHRA 1OMDA 1M46A 3EKHA 3EK4A 1R6PA 1W7IB 1XO5A 3CZTX 3SG3A 1GM0A 2L5XB 1H4BA 4YRUA 3KPXA 3BUNB 1LS8A 3IVTA 2WC8A 1PSRA 1UP5A 2K7DA 2DOQA 2KOTA 4I5NB 1GGWA 4YGCB 1A4PA 2SASA 1DJXA 1A29A 2ERBA 1N65A 3EK7A 3SS5A 3DVMA 2K0JA 3AAJA 1CMGA 2WCMA 4YGDB 3QRXA 1B1GA 1ALWA 1SSEB 1Y1AA 1UHNA 1AVSA 4CLNA 1UURA 3GK2A 1SY9A 3B6XA 1XFXO 1DTLA 1IGVA 4F7FA 4I5JA 2CNPA 2KI6D 3GK4X 1CFDA 3CR2A 2M9GA 2Y1NA 2LCPA 4ORCB 5B8IB 2KI4C 3C1VA 4XYNA 1MF8B 2L51A 1ORGA 2LV7A 3WHTB 1L2OB 1KFXS 2BBNA 1F8HA 1BG1A 4OZDA 3WXAA 4PE0A 1BR1B 1B8RA 1SNLA
chains in the Genus database with same CATH topology
1OMVA 1XFWO 2OTGC 1YX7A 2ZKMX 4PE4A 1B8CA 2KFHA 3PATA 3VRQA 3CLNA 2BBMA 4DIRA 3HX4A 1EL4A 3I5FB 1PRWA 1Q80A 3I5HC 1HT9A 4IL1A 4HREE 4MRXA 3KEVA 2JTZA 2M29A 4YI9A 1WRLA 1TN4A 3NSLA 3TUYC 1FI5A 5GQQC 3CGAA 1DT7B 1K95A 2MLEC 1DJWA 4PHJA 5IBWA 2LMUA 1RFJA 2MAZA 3BXKA 5PALA 5HKZA 4L9MA 2Q4UA 5AXIA 1AP4A 1CLBA 2KYFA 4Q04A 2BCBA 4D1EA 5FYXA 2K7BA 4WQ3A 1TIZA 1WLZA 2WOSA 2EGDA 1ZMZA 2I7AA 3ZNIA 4AQIA 4MEWA 2KYCA 3DVEA 4NDBA 2V53A 1RJVA 1RECA 2ZFDA 1S6CA 2LHIA 3EVUA 1V1GA 2BECA 2NXQA 2JPTA 1CB1A 3D0YA 1SKTA 3OHMB 4ORBB 1BLQA 5AANA 2K61A 2ZN8A 4ZCVA 1PVAA 1S36A 2GGZA 1C7VA 3VRNA 3WHUB 1DF0A 1IG5A 1QV1A 2COLB 1C07A 2OS8C 2OS8B 5AFPA 1A75A 3EK8A 3I5HB 4UPGA 4CIDA 5BPJA 1K9KA 1ODBA 1XFUO 4TNCA 1LA0A 2LNKA 1BJFA 3BYAA 1AJ4A 1UHKA 2KHNA 1QVIZ 1KSMA 1RROA 4GAOA 4QJ5B 1BODA 2K7OA 1KK8C 1AK8A 1K94A 2LE9B 1GJYA 1BT6A 1QATA 5HLOA 2JOJA 1GQMA 1NCXA 1R2UA 3TDUA 1SCVA 5AEQA 4CFRA 1DGVA 1DJZA 4C0JA 2ZRTA 3BUWB 2O5GA 1C7WA 3KHEA 1JFKA 2FCEA 1YUSA 1YRUB 1H8BA 5D69A 1L2OC 3GOFA 4HRGA 1CLMA 1QXPA 2JZIA 2LLUA 4ETOA 1MWNA 4XJKA 1B7TZ 2LLSA 3JVTB 5HLVA 2L2EA 1G8IA 1YRTB 1AUIB 2KAVA 3O2PA 4GNKB 2HQWA 4WRIA 4PE7A 1KQVA 3PM8A 1BR4B 1ZUZA 2HF5A 1S26D 1LA3A 3CWGA 1XK4A 1TTXA 1ZFSA 2QACA 3I5FC 2TN4A 2HPSA 3A4UB 3EKJA 4C0KA 1G4YR 4PHNA 3CR5X 3TS5B 5D7FA 2OTGB 2LVIA 3FWCA 4BY5A 5F6TA 2WNDA 3PN7C 1J7OA 1DMOA 2JC2A 5CSJA 3DVKA 1SBJA 1K96A 4DS7A 1WRKA 3KF9A 1QIVA 2M7NA 1IQ3A 5KU1A 1YTZC 2K2FA 2LP3A 4N1FA 2M1KB 1CM1A 1CMFA 2AAOA 2LP2A 1UWOA 2KNEA 1S5GY 1TNWA 2H61C 3E3RA 3LK0A 3D0YB 1NX2A 1G33A 5CPVA 2FCDA 2D8NA 1NYAA 1EJ3A 5I2QA 1K2HA 1KFXL 1DJYA 1KFUS 1MUXA 2KGBC 2M1UA 3LK1A 4FQOA 3NSOA 4AQJA 3BOWA 2EC6B 3BUXB 5ER5A 4NQGA 2M3WA 1A2XA 1SCMC 1M31A 2CTNA 2MJWB 1U5IA 3IF7A 5DKNA 4DUQA 4GGNA 1N0YA 1FBVA 2WCBA 2R2IA 4AOMA 2BL0B 1QASA 5TNCA 2ZNEA 2KGRA 4XJKB 1JWDA 1KWOB 2Q91A 2KAXA 2LC5A 1LXFC 1IWQA 1CKKA 4GFTA 4NDDA 1F54A 1IJ6A 1SK6D 1OE9B 1YX8A 1WRZA 1IQ5A 1F4QA 3FS7A 1DVIA 2CBLA 2K7CA 1QJTA 1DJHA 1LVCD 2LUXA 2ZRSA 1F71A 1KFUL 1NX0A 5JJGA 3BOWB 2GV5A 1NX1A 1EG4A 4GGFC 2LLTA 4MZKA 5I2LA 1D1OA 2OPOA 3O6BA 2I94A 1QIWA 2IS9A 1B9AA 1SR6C 4P5OE 1OQPA 3SG4A 4OCIA 1F70A 2PSRA 4FTGA 4ORAB 2NCPA 1S1EA 2FJUB 3A8RA 4MZJA 4USLA 1K8UA 1HQVA 1SW8A 1SL8A 3DVJA 1JFJA 3BQ3A 1TNXA 2MHHA 5KSZA 2KFGA 2LMVA 1OZSA 3VGOA 1XVJA 4HSZA 4YBHB 4CFQA 1PK0D 3H4SE 4N5XA 1LKJA 1NP8A 2JWWA 1M39A 2I18A 1NWDA 2MA2A 1XFYO 1Y1XA 4OVNF 1QVIY 3FWBA 2A4JA 4OKHA 1M45A 4BY4A 5HYDA 2F3YA 1KK7Z 1WLMA 2K8MB 4GUKA 2E6WA 5JOLA 1S5GZ 3MSEB 2LMTA 4YGEB 5DKQA 1DGUA 1RWYA 3SG7A 1CNPA 4A4CA 4M2QA 2JTTA 2M7LA 3OB2B 1NCYA 1QX5B 4QJ4B 1S6JA 1WY9A 2LVVA 1A75B 1BMOA 2M8UA 1ZOTB 3CTNA 1U5IB 1JUOA 1RK9A 2KI6C 2O60A 2I2RE 1CDNA 1JF2A 2EHBA 4HRHA 4JWQA 2MBXA 4DRWA 1KCYA 3EVRA 2LAPA 2BKIB 2KFFA 2ZNDA 2JT8A 2M0RA 1JF0A 3SIBA 4N1GA 3BUOB 2LVJA 1WDCC 2KBMA 4ICBA 3VRPA 1CFPA 5CSIA 1NX3A 1TNPA 2BL0C 2NZ0A 1EXRA 3WNXB 1SL9A 1M63B 3SG6A 1J7QA 1PULA 3SJSA 4C0LA 1KSOA 2KI4B 2BCXA 3FIAA 1LINA 1QLSA 2BE4A 4PDZA 4DCKA 3EVVA 3VROA 1PVBA 2F2PA 4P2YB 5ER4X 1DF0B 2KBIA 3RLZA 3SG2A 3I5IB 2LANA 3LCPC 3OP0A 1EG3A 3D10A 1K90D 5AERA 1XFZO 1OSAA 3JVTC 1Y1UA 4MN0A 1QX2A 3HCMA 3M0WA 3IQOA 2AUCA 4GBAA 2G2BA 4M2OA 3DF0A 1OMRA 1MHOA 2L50A 2LUCA 2BE6A 1CDLA 3PSRA 1OOJA 1NSHA 1YVLA 5J3XA 2VRGA 4NDCA 4CPVA 3O4YA 3PLFB 2JNXA 2PVBA 1GGZA 1EH2A 1TCFA 2NCOA 1QLKA 1PALA 2PALA 1KQMB 1F4OA 2L4HA 1JSAA 1A03A 1KK8B 2PMYA 3TZ1A 2JT3A 3JTDB 1YUTA 3K21A 3RM1A 2JNFA 1TOPA 3PALA 1J7PA 1CLLA 5DKRA 3AAKA 2JXLA 1IH0A 1N2DA 2KSPA 1ALVA 1K93D 1SPYA 1NUBA 3BUMB 5I2OA 4PHKA 4OV2A 1B4CA 1PSBA 1E8AA 3DF0B 2JU0A 3CS1A 1L7ZA 4PALA 4GPLB 1CFFA 4MZLA 3AKAA 2LM5A 4JQ0D 4M2PA 4OR9B 2KAYA 1BOCA 1B47A 4YI8A 1J1EA 1X02A 1JC2A 3GK1A 1DJIA 2P6BB 4MRYA 5HKWA 1VRKA 1KK7Y 1MQ1A 2JT0A 2LVKA 2NLNA 1K9UA 3KO0A 3NSKA 2K2AA 1SRAA 1FF1A 3PFVA 1XA5A 2QPTA 2Y4QA 3DD4A 4MVFA 2JRFA 3SG5A 3VRRA 1F55A 1MXLC 1YVHA 4PHMA 2CXJA 2JQ6A 3ICBA 1V1FA 1J1DA 3TUYB 1BF5A 3F45A 4R1EA 1IJ5A 3TDZA 3NSIA 2AMIA 3SIAA 4PE1A 1ZACA 2KQYA 1CFCA 3OX6A 2F8PA 1FW4A 1QS7A 2PASA 1RTP1 2F2OA 1SR6B 4F0ZB 1J7RA 1B7TY 1TCOB 1Y6WA 4WQ2A 2PRUA 1UUSA 2H61A 2MLFC 1BU3A 1S6IA 3OX5A 2JXCA 2B1UA 1QX7A 2HQ8A 4YGAA 4JPZB 5G08A 2CT9A 3JTDC 1KWOC 1SMGA 1UHJA 3IQQA 4MBEA 1IRJA 2HETA 3NXAA 4I5LB 1NCZA 2KQ6A 1AJ5A 3AKBA 1SYMA 2LHLA 2E30A 2WCFA 4MSPA 2SCPA 1FPWA 1TRFA 2L0PA 2RGIA 3TDIA 1IKUA 4I5KA 1W7JB 4A4BA 2EC6C 4ZCUA 5K89A 1QTXA 3O78A 3ZWHA 4E68A 1CTRA 1QV0A 1XK4C 2ZN9A 1DJGA 2L4IA 2L98A 3TS5C 3CR4X 4PCWA 5HKYA 1SL7A 1NPQA 2BCAA 1B8LA 2ISDA 3LL8B 4GGFA 1UHHA 1MXEA 3I5IC 1YR5A 1K9PA 1NIWA 2CCMA 3I5GB 2Y1MA 2F3ZA 1XFVO 4U8DA 2G9BA 1MR8A 1Y0VH 2MRDA 2WCEA 5I8NA 2JULA 1CDMA 2WORA 2KDHA 1J55A 2M97A 2FOTA 3PN7B 1UHIA 2GGMA 2M49B 1KQMC 1YURA 5KTYA 1CDPA 5CSFA 2BKHB 3LLEA 4YGBB 1FI6A 3OB1B 4MLWA 3I5GC 1JBAA 2F33A 1YUUA 2Y5IA 1OZOA 1WDCB 1S3PA 1SCMB 1TNQA 5CSNA 1XYDA 1CM4A 2H2KA 4QJ3B 1AHRA 1OMDA 1M46A 3EKHA 3EK4A 1R6PA 1W7IB 1XO5A 3CZTX 3SG3A 1H4BA 2L5XB 4YRUA 3KPXA 3BUNB 2WC8A 1PSRA 1UP5A 2K7DA 2DOQA 2KOTA 4I5NB 1GGWA 4YGCB 1A4PA 2SASA 1DJXA 1A29A 1N65A 3EK7A 3DVMA 2K0JA 3AAJA 1CMGA 4YGDB 3QRXA 1B1GA 1ALWA 1Y1AA 1UHNA 1AVSA 4CLNA 1UURA 3GK2A 1SY9A 1XFXO 1DTLA 1IGVA 4I5JA 2CNPA 2KI6D 3GK4X 1CFDA 3CR2A 2M9GA 2Y1NA 2LCPA 4ORCB 5B8IB 2KI4C 3C1VA 4XYNA 1MF8B 2L51A 2LV7A 3WHTB 1L2OB 1KFXS 2BBNA 1F8HA 1BG1A 3WXAA 4PE0A 1BR1B 1B8RA 1SNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMV A;  1XFW O;  2OTG C;  1YX7 A;  2ZKM X;  4PE4 A;  1B8C A;  2KFH A;  3PAT A;  3VRQ A;  3CLN A;  2BBM A;  4DIR A;  3HX4 A;  1EL4 A;  3I5F B;  1PRW A;  1Q80 A;  3I5H C;  1HT9 A;  4IL1 A;  4HRE E;  4MRX A;  3KEV A;  2JTZ A;  2M29 A;  4YI9 A;  1WRL A;  1TN4 A;  3NSL A;  3TUY C;  1FI5 A;  5GQQ C;  3CGA A;  1DT7 B;  1K95 A;  2MLE C;  1DJW A;  4PHJ A;  5IBW A;  2LMU A;  1RFJ A;  2MAZ A;  3BXK A;  5PAL A;  5HKZ A;  4L9M A;  2Q4U A;  5AXI A;  1AP4 A;  1CLB A;  2KYF A;  4Q04 A;  2BCB A;  4D1E A;  5FYX A;  2K7B A;  4WQ3 A;  1TIZ A;  1WLZ A;  2WOS A;  2EGD A;  1ZMZ A;  2I7A A;  3ZNI A;  4AQI A;  4MEW A;  2KYC A;  3DVE A;  4NDB A;  2V53 A;  1RJV A;  1REC A;  2ZFD A;  1S6C A;  2LHI A;  3EVU A;  1V1G A;  2BEC A;  2NXQ A;  2JPT A;  1CB1 A;  3D0Y A;  1SKT A;  3OHM B;  4ORB B;  1BLQ A;  5AAN A;  2K61 A;  2ZN8 A;  4ZCV A;  1PVA A;  1S36 A;  2GGZ A;  1C7V A;  3VRN A;  3WHU B;  1DF0 A;  1IG5 A;  1QV1 A;  2COL B;  1C07 A;  2OS8 C;  2OS8 B;  5AFP A;  1A75 A;  3EK8 A;  3I5H B;  4UPG A;  4CID A;  5BPJ A;  1K9K A;  1ODB A;  1XFU O;  4TNC A;  1LA0 A;  2LNK A;  1BJF A;  3BYA A;  1AJ4 A;  1UHK A;  2KHN A;  1QVI Z;  1KSM A;  1RRO A;  4GAO A;  4QJ5 B;  1BOD A;  2K7O A;  1KK8 C;  1AK8 A;  1K94 A;  2LE9 B;  1GJY A;  1BT6 A;  1QAT A;  5HLO A;  2JOJ A;  1GQM A;  1NCX A;  1R2U A;  3TDU A;  1SCV A;  5AEQ A;  4CFR A;  1DGV A;  1DJZ A;  4C0J A;  2ZRT A;  3BUW B;  2O5G A;  1C7W A;  3KHE A;  1JFK A;  2FCE A;  1YUS A;  1YRU B;  1H8B A;  5D69 A;  1L2O C;  3GOF A;  4HRG A;  1CLM A;  1QXP A;  2JZI A;  2LLU A;  4ETO A;  1MWN A;  4XJK A;  1B7T Z;  2LLS A;  3JVT B;  5HLV A;  2L2E A;  1G8I A;  1YRT B;  1AUI B;  2KAV A;  3O2P A;  4GNK B;  2HQW A;  4WRI A;  4PE7 A;  1KQV A;  3PM8 A;  1BR4 B;  1ZUZ A;  2HF5 A;  1S26 D;  1LA3 A;  3CWG A;  1XK4 A;  1TTX A;  1ZFS A;  2QAC A;  3I5F C;  2TN4 A;  2HPS A;  3A4U B;  3EKJ A;  4C0K A;  1G4Y R;  4PHN A;  3CR5 X;  3TS5 B;  5D7F A;  2OTG B;  2LVI A;  3FWC A;  4BY5 A;  5F6T A;  2WND A;  3PN7 C;  1J7O A;  1DMO A;  2JC2 A;  5CSJ A;  3DVK A;  1SBJ A;  1K96 A;  4DS7 A;  1WRK A;  3KF9 A;  1QIV A;  2M7N A;  1IQ3 A;  5KU1 A;  1YTZ C;  2K2F A;  2LP3 A;  4N1F A;  2M1K B;  1CM1 A;  1CMF A;  2AAO A;  2LP2 A;  1UWO A;  2KNE A;  1S5G Y;  1TNW A;  2H61 C;  3E3R A;  3LK0 A;  3D0Y B;  1NX2 A;  1G33 A;  5CPV A;  2FCD A;  2D8N A;  1NYA A;  1EJ3 A;  5I2Q A;  1K2H A;  1KFX L;  1DJY A;  1KFU S;  1MUX A;  2KGB C;  2M1U A;  3LK1 A;  4FQO A;  3NSO A;  4AQJ A;  3BOW A;  2EC6 B;  3BUX B;  5ER5 A;  4NQG A;  2M3W A;  1A2X A;  1SCM C;  1M31 A;  2CTN A;  2MJW B;  1U5I A;  3IF7 A;  5DKN A;  4DUQ A;  4GGN A;  1N0Y A;  1FBV A;  2WCB A;  2R2I A;  4AOM A;  2BL0 B;  1QAS A;  5TNC A;  2ZNE A;  2KGR A;  4XJK B;  1JWD A;  1KWO B;  2Q91 A;  2KAX A;  2LC5 A;  1LXF C;  1IWQ A;  1CKK A;  4GFT A;  4NDD A;  1F54 A;  1IJ6 A;  1SK6 D;  1OE9 B;  1YX8 A;  1WRZ A;  1IQ5 A;  1F4Q A;  3FS7 A;  1DVI A;  2CBL A;  2K7C A;  1QJT A;  1DJH A;  1LVC D;  2LUX A;  2ZRS A;  1F71 A;  1KFU L;  1NX0 A;  5JJG A;  3BOW B;  2GV5 A;  1NX1 A;  1EG4 A;  4GGF C;  2LLT A;  4MZK A;  5I2L A;  1D1O A;  2OPO A;  3O6B A;  2I94 A;  1QIW A;  2IS9 A;  1B9A A;  1SR6 C;  4P5O E;  1OQP A;  3SG4 A;  4OCI A;  1F70 A;  2PSR A;  4FTG A;  4ORA B;  2NCP A;  1S1E A;  2FJU B;  3A8R A;  4MZJ A;  4USL A;  1K8U A;  1HQV A;  1SW8 A;  1SL8 A;  3DVJ A;  1JFJ A;  3BQ3 A;  1TNX A;  2MHH A;  5KSZ A;  2KFG A;  2LMV A;  1OZS A;  3VGO A;  1XVJ A;  4HSZ A;  4YBH B;  4CFQ A;  1PK0 D;  3H4S E;  4N5X A;  1LKJ A;  1NP8 A;  2JWW A;  1M39 A;  2I18 A;  1NWD A;  2MA2 A;  1XFY O;  1Y1X A;  4OVN F;  1QVI Y;  3FWB A;  2A4J A;  4OKH A;  1M45 A;  4BY4 A;  5HYD A;  2F3Y A;  1KK7 Z;  1WLM A;  2K8M B;  4GUK A;  2E6W A;  5JOL A;  1S5G Z;  3MSE B;  2LMT A;  4YGE B;  5DKQ A;  1DGU A;  1RWY A;  3SG7 A;  1CNP A;  4A4C A;  4M2Q A;  2JTT A;  2M7L A;  3OB2 B;  1NCY A;  1QX5 B;  4QJ4 B;  1S6J A;  1WY9 A;  2LVV A;  1A75 B;  1BMO A;  2M8U A;  1ZOT B;  3CTN A;  1U5I B;  1JUO A;  1RK9 A;  2KI6 C;  2O60 A;  2I2R E;  1CDN A;  1JF2 A;  2EHB A;  4HRH A;  4JWQ A;  2MBX A;  4DRW A;  1KCY A;  3EVR A;  2LAP A;  2BKI B;  2KFF A;  2ZND A;  2JT8 A;  2M0R A;  1JF0 A;  3SIB A;  4N1G A;  3BUO B;  2LVJ A;  1WDC C;  2KBM A;  4ICB A;  3VRP A;  1CFP A;  5CSI A;  1NX3 A;  1TNP A;  2BL0 C;  2NZ0 A;  1EXR A;  3WNX B;  1SL9 A;  1M63 B;  3SG6 A;  1J7Q A;  1PUL A;  3SJS A;  4C0L A;  1KSO A;  2KI4 B;  2BCX A;  3FIA A;  1LIN A;  1QLS A;  2BE4 A;  4PDZ A;  4DCK A;  3EVV A;  3VRO A;  1PVB A;  2F2P A;  4P2Y B;  5ER4 X;  1DF0 B;  2KBI A;  3RLZ A;  3SG2 A;  3I5I B;  2LAN A;  3LCP C;  3OP0 A;  1EG3 A;  3D10 A;  1K90 D;  5AER A;  1XFZ O;  1OSA A;  3JVT C;  1Y1U A;  4MN0 A;  1QX2 A;  3HCM A;  3M0W A;  3IQO A;  2AUC A;  4GBA A;  2G2B A;  4M2O A;  3DF0 A;  1OMR A;  1MHO A;  2L50 A;  2LUC A;  2BE6 A;  1CDL A;  3PSR A;  1OOJ A;  1NSH A;  1YVL A;  5J3X A;  2VRG A;  4NDC A;  4CPV A;  3O4Y A;  3PLF B;  2JNX A;  2PVB A;  1GGZ A;  1EH2 A;  1TCF A;  2NCO A;  1QLK A;  1PAL A;  2PAL A;  1KQM B;  1F4O A;  2L4H A;  1JSA A;  1A03 A;  1KK8 B;  2PMY A;  3TZ1 A;  2JT3 A;  3JTD B;  1YUT A;  3K21 A;  3RM1 A;  2JNF A;  1TOP A;  3PAL A;  1J7P A;  1CLL A;  5DKR A;  3AAK A;  2JXL A;  1IH0 A;  1N2D A;  2KSP A;  1ALV A;  1K93 D;  1SPY A;  1NUB A;  3BUM B;  5I2O A;  4PHK A;  4OV2 A;  1B4C A;  1PSB A;  1E8A A;  3DF0 B;  2JU0 A;  3CS1 A;  1L7Z A;  4PAL A;  4GPL B;  1CFF A;  4MZL A;  3AKA A;  2LM5 A;  4JQ0 D;  4M2P A;  4OR9 B;  2KAY A;  1BOC A;  1B47 A;  4YI8 A;  1J1E A;  1X02 A;  1JC2 A;  3GK1 A;  1DJI A;  2P6B B;  4MRY A;  5HKW A;  1VRK A;  1KK7 Y;  1MQ1 A;  2JT0 A;  2LVK A;  2NLN A;  1K9U A;  3KO0 A;  3NSK A;  2K2A A;  1SRA A;  1FF1 A;  3PFV A;  1XA5 A;  2QPT A;  2Y4Q A;  3DD4 A;  4MVF A;  2JRF A;  3SG5 A;  3VRR A;  1F55 A;  1MXL C;  1YVH A;  4PHM A;  2CXJ A;  2JQ6 A;  3ICB A;  1V1F A;  1J1D A;  3TUY B;  1BF5 A;  3F45 A;  4R1E A;  1IJ5 A;  3TDZ A;  3NSI A;  2AMI A;  3SIA A;  4PE1 A;  1ZAC A;  2KQY A;  1CFC A;  3OX6 A;  2F8P A;  1FW4 A;  1QS7 A;  2PAS A;  1RTP 1;  2F2O A;  1SR6 B;  4F0Z B;  1J7R A;  1B7T Y;  1TCO B;  1Y6W A;  4WQ2 A;  2PRU A;  1UUS A;  2H61 A;  2MLF C;  1BU3 A;  1S6I A;  3OX5 A;  2JXC A;  2B1U A;  1QX7 A;  2HQ8 A;  4YGA A;  4JPZ B;  5G08 A;  2CT9 A;  3JTD C;  1KWO C;  1SMG A;  1UHJ A;  3IQQ A;  4MBE A;  1IRJ A;  2HET A;  3NXA A;  4I5L B;  1NCZ A;  2KQ6 A;  1AJ5 A;  3AKB A;  1SYM A;  2LHL A;  2E30 A;  2WCF A;  4MSP A;  2SCP A;  1FPW A;  1TRF A;  2L0P A;  2RGI A;  3TDI A;  1IKU A;  4I5K A;  1W7J B;  4A4B A;  2EC6 C;  4ZCU A;  5K89 A;  1QTX A;  3O78 A;  3ZWH A;  4E68 A;  1CTR A;  1QV0 A;  1XK4 C;  2ZN9 A;  1DJG A;  2L4I A;  2L98 A;  3TS5 C;  3CR4 X;  4PCW A;  5HKY A;  1SL7 A;  1NPQ A;  2BCA A;  1B8L A;  2ISD A;  3LL8 B;  4GGF A;  1UHH A;  1MXE A;  3I5I C;  1YR5 A;  1K9P A;  1NIW A;  2CCM A;  3I5G B;  2Y1M A;  2F3Z A;  1XFV O;  4U8D A;  2G9B A;  1MR8 A;  1Y0V H;  2MRD A;  2WCE A;  5I8N A;  2JUL A;  1CDM A;  2WOR A;  2KDH A;  1J55 A;  2M97 A;  2FOT A;  3PN7 B;  1UHI A;  2GGM A;  2M49 B;  1KQM C;  1YUR A;  5KTY A;  1CDP A;  5CSF A;  2BKH B;  3LLE A;  4YGB B;  1FI6 A;  3OB1 B;  4MLW A;  3I5G C;  1JBA A;  2F33 A;  1YUU A;  2Y5I A;  1OZO A;  1WDC B;  1S3P A;  1SCM B;  1TNQ A;  5CSN A;  1XYD A;  1CM4 A;  2H2K A;  4QJ3 B;  1AHR A;  1OMD A;  1M46 A;  3EKH A;  3EK4 A;  1R6P A;  1W7I B;  1XO5 A;  3CZT X;  3SG3 A;  1H4B A;  2L5X B;  4YRU A;  3KPX A;  3BUN B;  2WC8 A;  1PSR A;  1UP5 A;  2K7D A;  2DOQ A;  2KOT A;  4I5N B;  1GGW A;  4YGC B;  1A4P A;  2SAS A;  1DJX A;  1A29 A;  1N65 A;  3EK7 A;  3DVM A;  2K0J A;  3AAJ A;  1CMG A;  4YGD B;  3QRX A;  1B1G A;  1ALW A;  1Y1A A;  1UHN A;  1AVS A;  4CLN A;  1UUR A;  3GK2 A;  1SY9 A;  1XFX O;  1DTL A;  1IGV A;  4I5J A;  2CNP A;  2KI6 D;  3GK4 X;  1CFD A;  3CR2 A;  2M9G A;  2Y1N A;  2LCP A;  4ORC B;  5B8I B;  2KI4 C;  3C1V A;  4XYN A;  1MF8 B;  2L51 A;  2LV7 A;  3WHT B;  1L2O B;  1KFX S;  2BBN A;  1F8H A;  1BG1 A;  3WXA A;  4PE0 A;  1BR1 B;  1B8R A;  1SNL A; 
#chains in the Genus database with same CATH topology
 1OMV A;  1XFW O;  2OTG C;  1YX7 A;  2ZKM X;  4PE4 A;  1B8C A;  2KFH A;  2WCH A;  3PAT A;  5EL2 A;  3VRQ A;  2QEO A;  3CLN A;  2BBM A;  4DIR A;  3HX4 A;  1EL4 A;  3R1O A;  4INX A;  3I5F B;  3CZ2 A;  1PRW A;  1Q80 A;  3D78 A;  3I5H C;  1HT9 A;  4IL1 A;  3DZT A;  4HRE E;  4MRX A;  3KEV A;  2JTZ A;  2M29 A;  4YI9 A;  1WRL A;  1TN4 A;  3NSL A;  3TUY C;  1FI5 A;  5GQQ C;  3CGA A;  1DT7 B;  1K95 A;  2MLE C;  1DJW A;  4PHJ A;  5IBW A;  2LMU A;  1RFJ A;  2MAZ A;  3BXK A;  5PAL A;  5HKZ A;  4L9M A;  2Q4U A;  5AXI A;  1AP4 A;  1CLB A;  2KYF A;  4Q04 A;  4INW A;  1DQE A;  1C3Z A;  2BCB A;  4D1E A;  1DC1 A;  5FYX A;  2K7B A;  4JD9 A;  4WQ3 A;  1TIZ A;  1WLZ A;  2WOS A;  2EGD A;  1ZMZ A;  2I7A A;  3ZNI A;  4AQI A;  4MEW A;  2KYC A;  3DVE A;  4NDB A;  2V53 A;  1P28 A;  1RJV A;  3CZ0 A;  1REC A;  2ZFD A;  3SS3 A;  1S6C A;  2LHI A;  3EVU A;  1V1G A;  2BEC A;  2NXQ A;  2JPT A;  1CB1 A;  3D0Y A;  1SKT A;  2WC5 A;  3OHM B;  4ORB B;  1BLQ A;  5AAN A;  2K61 A;  2ZN8 A;  4ZCV A;  1PVA A;  3L47 A;  1S36 A;  2GGZ A;  1C7V A;  2QDI A;  3VRN A;  3WHU B;  3CDN A;  1DF0 A;  1IG5 A;  1QV1 A;  1Z2C B;  2COL B;  5FI2 A;  2OS8 C;  5I94 A;  1C07 A;  2YGU A;  2OS8 B;  3B86 A;  5AFP A;  1A75 A;  3EK8 A;  3I5H B;  4UPG A;  4CID A;  5BPJ A;  1K9K A;  1ODB A;  1QWV A;  1XFU O;  4TNC A;  2GTE A;  1LA0 A;  2LNK A;  1BJF A;  1OOI X;  1AJ4 A;  1UHK A;  3BYA A;  2KHN A;  1QVI Z;  1KSM A;  1RRO A;  4GAO A;  4QJ5 B;  1BOD A;  2K7O A;  1KK8 C;  1AK8 A;  1K94 A;  2LE9 B;  3SS4 A;  3CAB A;  1GJY A;  1BT6 A;  1QAT A;  5HLO A;  2JOJ A;  1DEK A;  2K60 A;  1GQM A;  1NCX A;  1R2U A;  3TDU A;  1SCV A;  5AEQ A;  4CFR A;  1DGV A;  1DJZ A;  3D75 A;  4C0J A;  2ZRT A;  3BUW B;  2O5G A;  2KPH A;  1C7W A;  3KHE A;  1JFK A;  1C3Y A;  2KLE A;  2FCE A;  1YUS A;  1YRU B;  1H8B A;  5D69 A;  1L2O C;  3GOF A;  3S0G A;  4HRG A;  1CLM A;  1QXP A;  2JZI A;  2LLU A;  3BFH A;  3UO9 A;  4ETO A;  1MWN A;  4XJK A;  1B7T Z;  2LLS A;  3JVT B;  3BJH A;  5HLV A;  2L2E A;  1G8I A;  1YRT B;  3BFA A;  1AUI B;  2KAV A;  3O2P A;  4GNK B;  2HQW A;  4WRI A;  4PE7 A;  1KQV A;  3PM8 A;  3BFB A;  1BR4 B;  1ZUZ A;  2HF5 A;  1S26 D;  1LA3 A;  3CWG A;  1XK4 A;  3DXL A;  1TTX A;  1ZFS A;  2QAC A;  5D3O A;  3I5F C;  2TN4 A;  2HPS A;  3A4U B;  3EKJ A;  4C0K A;  1G4Y R;  4PHN A;  3CR5 X;  3TS5 B;  5D7F A;  2OTG B;  2LVI A;  3FWC A;  4FQT A;  4BY5 A;  5F6T A;  2WND A;  3PN7 C;  1J7O A;  1DMO A;  2JC2 A;  5CSJ A;  3DVK A;  1SBJ A;  1K96 A;  4JKT A;  4DS7 A;  1WRK A;  3KF9 A;  3D77 A;  1QIV A;  2M7N A;  1IQ3 A;  5KU1 A;  1YTZ C;  2K2F A;  2LP3 A;  4N1F A;  3S0D A;  2M1K B;  1CM1 A;  3D76 A;  1CMF A;  2AAO A;  2LP2 A;  1UWO A;  2KNE A;  1S5G Y;  1TNW A;  2H61 C;  3E3R A;  3LK0 A;  3D0Y B;  1NX2 A;  1G33 A;  2WCJ A;  5CPV A;  2FCD A;  2D8N A;  1NYA A;  1EJ3 A;  5I2Q A;  1K2H A;  1KFX L;  1DJY A;  1KFU S;  1MUX A;  2KGB C;  2M1U A;  3LK1 A;  4FQO A;  3NSO A;  4AQJ A;  3BOW A;  2EC6 B;  3BUX B;  5ER5 A;  4NQG A;  2M3W A;  1A2X A;  5DIC A;  3R72 A;  1SCM C;  1M31 A;  2CTN A;  2MJW B;  1U5I A;  3IF7 A;  2L5Y A;  5DKN A;  3NHI A;  4DUQ A;  3B7A A;  4GGN A;  1N0Y A;  2L2C A;  1FBV A;  2WCB A;  2R2I A;  2JPO A;  2BL0 B;  1QAS A;  5TNC A;  2ZNE A;  2KGR A;  4XJK B;  4AOM A;  1JWD A;  1KWO B;  2Q91 A;  2KAX A;  2P70 A;  2LC5 A;  2QEH A;  1LXF C;  1IWQ A;  1CKK A;  4GFT A;  4NDD A;  1F54 A;  2H8V A;  1IJ6 A;  1SK6 D;  1OE9 B;  1YX8 A;  1WRZ A;  1IQ5 A;  1F4Q A;  3FS7 A;  1DVI A;  2CBL A;  2K7C A;  1QJT A;  2P71 A;  3VB1 A;  1DJH A;  1LVC D;  2LUX A;  3FE8 A;  2ZRS A;  3FE9 A;  1F71 A;  1KFU L;  1NX0 A;  5JJG A;  3BOW B;  2GV5 A;  1NX1 A;  1EG4 A;  4GGF C;  2LLT A;  4MZK A;  5I2L A;  3N7H A;  1D1O A;  2OPO A;  3FE6 A;  3O6B A;  2I94 A;  1QIW A;  2IS9 A;  1B9A A;  1SR6 C;  4P5O E;  3V2L A;  1OQP A;  2PYQ A;  3SG4 A;  4OCI A;  4PT1 A;  3B87 A;  1F70 A;  3K1E A;  2PSR A;  4FTG A;  4ORA B;  2NCP A;  1S1E A;  3D74 A;  2FJU B;  3A8R A;  4MZJ A;  4USL A;  1K8U A;  1HQV A;  1SW8 A;  2FJY A;  1SL8 A;  3DVJ A;  1JFJ A;  3BQ3 A;  1TNX A;  3RZS A;  2MHH A;  5KSZ A;  1Z4H A;  2KFG A;  2LMV A;  1OZS A;  3VGO A;  1XVJ A;  4HSZ A;  4YBH B;  4CFQ A;  3NGV A;  1PK0 D;  3D73 A;  3H4S E;  4N5X A;  1LKJ A;  1NP8 A;  2BNX A;  2JWW A;  1M39 A;  2I18 A;  1NWD A;  1OOF A;  2MA2 A;  1XFY O;  1Y1X A;  4OVN F;  1QVI Y;  3FWB A;  2A4J A;  4OKH A;  1M45 A;  4BY4 A;  1OW4 A;  5HYD A;  2F3Y A;  1KK7 Z;  1WLM A;  2K8M B;  4GUK A;  3OBV A;  3O4X A;  4IJ7 A;  2E6W A;  5JOL A;  1S5G Z;  3MSE B;  2LMT A;  4YGE B;  5DKQ A;  1DGU A;  1RWY A;  3S0A A;  3SG7 A;  1CNP A;  4A4C A;  4M2Q A;  2JTT A;  2M7L A;  3OB2 B;  4KYN A;  1DEL A;  1NCY A;  1QX5 B;  4QJ4 B;  1S6J A;  1WY9 A;  2LVV A;  1A75 B;  1BMO A;  2M8U A;  1ZOT B;  3CTN A;  1U5I B;  1JUO A;  1RK9 A;  2KI6 C;  2O60 A;  2I2R E;  1CDN A;  1JF2 A;  2EHB A;  4HRH A;  4JWQ A;  2MBX A;  4DRW A;  1KCY A;  3EVR A;  2LAP A;  2BKI B;  2KFF A;  2ZND A;  2JT8 A;  2M0R A;  1JF0 A;  3SIB A;  4N1G A;  3BUO B;  2LVJ A;  1WDC C;  2KBM A;  4ICB A;  3VRP A;  1CFP A;  5CSI A;  1NX3 A;  1TNP A;  2BL0 C;  2NZ0 A;  1TWO A;  1EXR A;  3WNX B;  1SL9 A;  1M63 B;  3SG6 A;  1J7Q A;  3QME A;  3R1P A;  1PUL A;  3R1V A;  3SJS A;  1W9Z A;  4C0L A;  1KSO A;  2KI4 B;  2BCX A;  2WC6 A;  1LIN A;  1QLS A;  2BE4 A;  3FIA A;  4PDZ A;  4DCK A;  3EVV A;  3VRO A;  1PVB A;  2F2P A;  4P2Y B;  5ER4 X;  2QEV A;  1DF0 B;  2KBI A;  3CZ1 A;  3RLZ A;  3I5I B;  2LAN A;  3LCP C;  3OP0 A;  3SG2 A;  1EG3 A;  3D10 A;  1K90 D;  5AER A;  1OOH A;  1OSA A;  1XFZ O;  3JVT C;  1Y1U A;  4MN0 A;  1QX2 A;  3HCM A;  3M0W A;  3IQO A;  2AUC A;  4GBA A;  2G2B A;  4M2O A;  3DF0 A;  1OMR A;  1MHO A;  2L50 A;  2LUC A;  2PQL A;  2BE6 A;  1CDL A;  3PSR A;  1OOJ A;  1NSH A;  1YVL A;  5J3X A;  2VRG A;  4NDC A;  4CPV A;  3O4Y A;  3PLF B;  3S0F A;  2JNX A;  2PVB A;  1GGZ A;  1EH2 A;  1TCF A;  2NCO A;  1QLK A;  1PAL A;  2PAL A;  1KQM B;  1F4O A;  2L4H A;  2QEB A;  1JSA A;  1A03 A;  1KK8 B;  2PMY A;  3TZ1 A;  2JT3 A;  3JTD B;  1YUT A;  3K21 A;  3RM1 A;  2JNF A;  1TOP A;  3PAL A;  1J7P A;  1CLL A;  5DKR A;  5FI6 A;  2WCL A;  3AAK A;  1XFR A;  2JXL A;  1IH0 A;  3S0E A;  1N2D A;  2KSP A;  1ALV A;  1K93 D;  1SPY A;  1NUB A;  3BUM B;  3Q8I A;  5I2O A;  4PHK A;  4OV2 A;  1B4C A;  1PSB A;  1E8A A;  3DF0 B;  2JU0 A;  3OGN A;  3CS1 A;  5HL1 A;  1L7Z A;  4PAL A;  4GPL B;  1CFF A;  4MZL A;  3AKA A;  2LM5 A;  3B88 A;  4JQ0 D;  4M2P A;  4OR9 B;  2KAY A;  1BOC A;  1B47 A;  4YI8 A;  1J1E A;  1X02 A;  1JC2 A;  3GK1 A;  1DJI A;  2P6B B;  4MRY A;  5HKW A;  1VRK A;  1KK7 Y;  1MQ1 A;  2JT0 A;  2LVK A;  2NLN A;  1K9U A;  3KO0 A;  3NSK A;  2K2A A;  1SRA A;  1FF1 A;  3PFV A;  1XA5 A;  2QPT A;  2Y4Q A;  3DD4 A;  4MVF A;  2WCK A;  2JRF A;  3SG5 A;  3VRR A;  1F55 A;  1MXL C;  1YVH A;  4PHM A;  2CXJ A;  2JQ6 A;  3ICB A;  1V1F A;  3PM2 A;  1J1D A;  3TUY B;  1BF5 A;  3F45 A;  4R1E A;  1IJ5 A;  3TDZ A;  3NSI A;  2AMI A;  3SIA A;  4PE1 A;  1ZAC A;  2KQY A;  1CFC A;  3OX6 A;  2F8P A;  1T14 A;  1FW4 A;  1IIO A;  1QS7 A;  2PAS A;  1RTP 1;  2F2O A;  1OOG A;  1SR6 B;  4F0Z B;  1J7R A;  1B7T Y;  1TCO B;  1Y6W A;  4WQ2 A;  2PRU A;  1UUS A;  2H61 A;  2MLF C;  1BU3 A;  1TUZ A;  1S6I A;  3OX5 A;  2JXC A;  2B1U A;  1QX7 A;  2HQ8 A;  4YGA A;  4JPZ B;  5G08 A;  3S0B A;  2CT9 A;  3JTD C;  1KWO C;  1SMG A;  1UHJ A;  3CYZ A;  3IQQ A;  4MBE A;  1IRJ A;  2HET A;  3NXA A;  4I5L B;  1NCZ A;  2KQ6 A;  3DY9 A;  1AJ5 A;  3L4A A;  2BAP A;  3EG5 B;  3AKB A;  1SYM A;  2LHL A;  2E30 A;  2WCF A;  4MSP A;  2SCP A;  1FPW A;  1TRF A;  2L0P A;  2RGI A;  3TDI A;  1IKU A;  4I5K A;  1W7J B;  4A4B A;  2EC6 C;  4ZCU A;  5K89 A;  1QTX A;  3O78 A;  3PJI A;  3L4L A;  1CTR A;  3ZWH A;  1QV0 A;  1XK4 C;  2ZN9 A;  1DJG A;  4E68 A;  2KLD A;  2L4I A;  2L98 A;  3TS5 C;  3CR4 X;  4PCW A;  5HKY A;  3DYE A;  1SL7 A;  1NPQ A;  2BCA A;  1B8L A;  2ISD A;  3LL8 B;  4GGF A;  1UHH A;  1MXE A;  3I5I C;  1YR5 A;  1K9P A;  1NIW A;  2CCM A;  3I5G B;  2Y1M A;  2F3Z A;  1XFV O;  4U8D A;  2G9B A;  1MR8 A;  1Y0V H;  2MRD A;  2WCE A;  5I8N A;  2JUL A;  1CDM A;  2WOR A;  2KDH A;  1J55 A;  2M97 A;  2FOT A;  3PN7 B;  1UHI A;  5FI7 A;  2GGM A;  2M49 B;  1KQM C;  1YUR A;  5KTY A;  1CDP A;  5CSF A;  3UNW A;  2BKH B;  3NHT A;  3LLE A;  4YGB B;  1FI6 A;  3OB1 B;  4MLW A;  3I5G C;  1JBA A;  2F33 A;  1YUU A;  2Y5I A;  1OZO A;  1WDC B;  1S3P A;  1SCM B;  1TNQ A;  5CSN A;  1XYD A;  1CM4 A;  1TUJ A;  2H2K A;  4QJ3 B;  1AHR A;  1OMD A;  1M46 A;  3EKH A;  3EK4 A;  1R6P A;  1W7I B;  1XO5 A;  3CZT X;  3SG3 A;  1GM0 A;  2L5X B;  1H4B A;  4YRU A;  3KPX A;  3BUN B;  1LS8 A;  3IVT A;  2WC8 A;  1PSR A;  1UP5 A;  2K7D A;  2DOQ A;  2KOT A;  4I5N B;  1GGW A;  4YGC B;  1A4P A;  2SAS A;  1DJX A;  1A29 A;  2ERB A;  1N65 A;  3EK7 A;  3SS5 A;  3DVM A;  2K0J A;  3AAJ A;  1CMG A;  2WCM A;  4YGD B;  3QRX A;  1B1G A;  1ALW A;  1SSE B;  1Y1A A;  1UHN A;  1AVS A;  4CLN A;  1UUR A;  3GK2 A;  1SY9 A;  3B6X A;  1XFX O;  1DTL A;  1IGV A;  4F7F A;  4I5J A;  2CNP A;  2KI6 D;  3GK4 X;  1CFD A;  3CR2 A;  2M9G A;  2Y1N A;  2LCP A;  4ORC B;  5B8I B;  2KI4 C;  3C1V A;  4XYN A;  1MF8 B;  2L51 A;  1ORG A;  2LV7 A;  3WHT B;  1L2O B;  1KFX S;  2BBN A;  1F8H A;  1BG1 A;  4OZD A;  3WXA A;  4PE0 A;  1BR1 B;  1B8R A;  1SNL A; 
#chains in the Genus database with same CATH homology
 1OMV A;  1XFW O;  2OTG C;  1YX7 A;  2ZKM X;  4PE4 A;  1B8C A;  2KFH A;  3PAT A;  3VRQ A;  3CLN A;  2BBM A;  4DIR A;  3HX4 A;  1EL4 A;  3I5F B;  1PRW A;  1Q80 A;  3I5H C;  1HT9 A;  4IL1 A;  4HRE E;  4MRX A;  3KEV A;  2JTZ A;  2M29 A;  4YI9 A;  1WRL A;  1TN4 A;  3NSL A;  3TUY C;  1FI5 A;  5GQQ C;  3CGA A;  1DT7 B;  1K95 A;  2MLE C;  1DJW A;  4PHJ A;  5IBW A;  2LMU A;  1RFJ A;  2MAZ A;  3BXK A;  5PAL A;  5HKZ A;  4L9M A;  2Q4U A;  5AXI A;  1AP4 A;  1CLB A;  2KYF A;  4Q04 A;  2BCB A;  4D1E A;  5FYX A;  2K7B A;  4WQ3 A;  1TIZ A;  1WLZ A;  2WOS A;  2EGD A;  1ZMZ A;  2I7A A;  3ZNI A;  4AQI A;  4MEW A;  2KYC A;  3DVE A;  4NDB A;  2V53 A;  1RJV A;  1REC A;  2ZFD A;  1S6C A;  2LHI A;  3EVU A;  1V1G A;  2BEC A;  2NXQ A;  2JPT A;  1CB1 A;  3D0Y A;  1SKT A;  3OHM B;  4ORB B;  1BLQ A;  5AAN A;  2K61 A;  2ZN8 A;  4ZCV A;  1PVA A;  1S36 A;  2GGZ A;  1C7V A;  3VRN A;  3WHU B;  1DF0 A;  1IG5 A;  1QV1 A;  2COL B;  1C07 A;  2OS8 C;  2OS8 B;  5AFP A;  1A75 A;  3EK8 A;  3I5H B;  4UPG A;  4CID A;  5BPJ A;  1K9K A;  1ODB A;  1XFU O;  4TNC A;  1LA0 A;  2LNK A;  1BJF A;  3BYA A;  1AJ4 A;  1UHK A;  2KHN A;  1QVI Z;  1KSM A;  1RRO A;  4GAO A;  4QJ5 B;  1BOD A;  2K7O A;  1KK8 C;  1AK8 A;  1K94 A;  2LE9 B;  1GJY A;  1BT6 A;  1QAT A;  5HLO A;  2JOJ A;  1GQM A;  1NCX A;  1R2U A;  3TDU A;  1SCV A;  5AEQ A;  4CFR A;  1DGV A;  1DJZ A;  4C0J A;  2ZRT A;  3BUW B;  2O5G A;  1C7W A;  3KHE A;  1JFK A;  2FCE A;  1YUS A;  1YRU B;  1H8B A;  5D69 A;  1L2O C;  3GOF A;  4HRG A;  1CLM A;  1QXP A;  2JZI A;  2LLU A;  4ETO A;  1MWN A;  4XJK A;  1B7T Z;  2LLS A;  3JVT B;  5HLV A;  2L2E A;  1G8I A;  1YRT B;  1AUI B;  2KAV A;  3O2P A;  4GNK B;  2HQW A;  4WRI A;  4PE7 A;  1KQV A;  3PM8 A;  1BR4 B;  1ZUZ A;  2HF5 A;  1S26 D;  1LA3 A;  3CWG A;  1XK4 A;  1TTX A;  1ZFS A;  2QAC A;  3I5F C;  2TN4 A;  2HPS A;  3A4U B;  3EKJ A;  4C0K A;  1G4Y R;  4PHN A;  3CR5 X;  3TS5 B;  5D7F A;  2OTG B;  2LVI A;  3FWC A;  4BY5 A;  5F6T A;  2WND A;  3PN7 C;  1J7O A;  1DMO A;  2JC2 A;  5CSJ A;  3DVK A;  1SBJ A;  1K96 A;  4DS7 A;  1WRK A;  3KF9 A;  1QIV A;  2M7N A;  1IQ3 A;  5KU1 A;  1YTZ C;  2K2F A;  2LP3 A;  4N1F A;  2M1K B;  1CM1 A;  1CMF A;  2AAO A;  2LP2 A;  1UWO A;  2KNE A;  1S5G Y;  1TNW A;  2H61 C;  3E3R A;  3LK0 A;  3D0Y B;  1NX2 A;  1G33 A;  5CPV A;  2FCD A;  2D8N A;  1NYA A;  1EJ3 A;  5I2Q A;  1K2H A;  1KFX L;  1DJY A;  1KFU S;  1MUX A;  2KGB C;  2M1U A;  3LK1 A;  4FQO A;  3NSO A;  4AQJ A;  3BOW A;  2EC6 B;  3BUX B;  5ER5 A;  4NQG A;  2M3W A;  1A2X A;  1SCM C;  1M31 A;  2CTN A;  2MJW B;  1U5I A;  3IF7 A;  5DKN A;  4DUQ A;  4GGN A;  1N0Y A;  1FBV A;  2WCB A;  2R2I A;  4AOM A;  2BL0 B;  1QAS A;  5TNC A;  2ZNE A;  2KGR A;  4XJK B;  1JWD A;  1KWO B;  2Q91 A;  2KAX A;  2LC5 A;  1LXF C;  1IWQ A;  1CKK A;  4GFT A;  4NDD A;  1F54 A;  1IJ6 A;  1SK6 D;  1OE9 B;  1YX8 A;  1WRZ A;  1IQ5 A;  1F4Q A;  3FS7 A;  1DVI A;  2CBL A;  2K7C A;  1QJT A;  1DJH A;  1LVC D;  2LUX A;  2ZRS A;  1F71 A;  1KFU L;  1NX0 A;  5JJG A;  3BOW B;  2GV5 A;  1NX1 A;  1EG4 A;  4GGF C;  2LLT A;  4MZK A;  5I2L A;  1D1O A;  2OPO A;  3O6B A;  2I94 A;  1QIW A;  2IS9 A;  1B9A A;  1SR6 C;  4P5O E;  1OQP A;  3SG4 A;  4OCI A;  1F70 A;  2PSR A;  4FTG A;  4ORA B;  2NCP A;  1S1E A;  2FJU B;  3A8R A;  4MZJ A;  4USL A;  1K8U A;  1HQV A;  1SW8 A;  1SL8 A;  3DVJ A;  1JFJ A;  3BQ3 A;  1TNX A;  2MHH A;  5KSZ A;  2KFG A;  2LMV A;  1OZS A;  3VGO A;  1XVJ A;  4HSZ A;  4YBH B;  4CFQ A;  1PK0 D;  3H4S E;  4N5X A;  1LKJ A;  1NP8 A;  2JWW A;  1M39 A;  2I18 A;  1NWD A;  2MA2 A;  1XFY O;  1Y1X A;  4OVN F;  1QVI Y;  3FWB A;  2A4J A;  4OKH A;  1M45 A;  4BY4 A;  5HYD A;  2F3Y A;  1KK7 Z;  1WLM A;  2K8M B;  4GUK A;  2E6W A;  5JOL A;  1S5G Z;  3MSE B;  2LMT A;  4YGE B;  5DKQ A;  1DGU A;  1RWY A;  3SG7 A;  1CNP A;  4A4C A;  4M2Q A;  2JTT A;  2M7L A;  3OB2 B;  1NCY A;  1QX5 B;  4QJ4 B;  1S6J A;  1WY9 A;  2LVV A;  1A75 B;  1BMO A;  2M8U A;  1ZOT B;  3CTN A;  1U5I B;  1JUO A;  1RK9 A;  2KI6 C;  2O60 A;  2I2R E;  1CDN A;  1JF2 A;  2EHB A;  4HRH A;  4JWQ A;  2MBX A;  4DRW A;  1KCY A;  3EVR A;  2LAP A;  2BKI B;  2KFF A;  2ZND A;  2JT8 A;  2M0R A;  1JF0 A;  3SIB A;  4N1G A;  3BUO B;  2LVJ A;  1WDC C;  2KBM A;  4ICB A;  3VRP A;  1CFP A;  5CSI A;  1NX3 A;  1TNP A;  2BL0 C;  2NZ0 A;  1EXR A;  3WNX B;  1SL9 A;  1M63 B;  3SG6 A;  1J7Q A;  1PUL A;  3SJS A;  4C0L A;  1KSO A;  2KI4 B;  2BCX A;  3FIA A;  1LIN A;  1QLS A;  2BE4 A;  4PDZ A;  4DCK A;  3EVV A;  3VRO A;  1PVB A;  2F2P A;  4P2Y B;  5ER4 X;  1DF0 B;  2KBI A;  3RLZ A;  3SG2 A;  3I5I B;  2LAN A;  3LCP C;  3OP0 A;  1EG3 A;  3D10 A;  1K90 D;  5AER A;  1XFZ O;  1OSA A;  3JVT C;  1Y1U A;  4MN0 A;  1QX2 A;  3HCM A;  3M0W A;  3IQO A;  2AUC A;  4GBA A;  2G2B A;  4M2O A;  3DF0 A;  1OMR A;  1MHO A;  2L50 A;  2LUC A;  2BE6 A;  1CDL A;  3PSR A;  1OOJ A;  1NSH A;  1YVL A;  5J3X A;  2VRG A;  4NDC A;  4CPV A;  3O4Y A;  3PLF B;  2JNX A;  2PVB A;  1GGZ A;  1EH2 A;  1TCF A;  2NCO A;  1QLK A;  1PAL A;  2PAL A;  1KQM B;  1F4O A;  2L4H A;  1JSA A;  1A03 A;  1KK8 B;  2PMY A;  3TZ1 A;  2JT3 A;  3JTD B;  1YUT A;  3K21 A;  3RM1 A;  2JNF A;  1TOP A;  3PAL A;  1J7P A;  1CLL A;  5DKR A;  3AAK A;  2JXL A;  1IH0 A;  1N2D A;  2KSP A;  1ALV A;  1K93 D;  1SPY A;  1NUB A;  3BUM B;  5I2O A;  4PHK A;  4OV2 A;  1B4C A;  1PSB A;  1E8A A;  3DF0 B;  2JU0 A;  3CS1 A;  1L7Z A;  4PAL A;  4GPL B;  1CFF A;  4MZL A;  3AKA A;  2LM5 A;  4JQ0 D;  4M2P A;  4OR9 B;  2KAY A;  1BOC A;  1B47 A;  4YI8 A;  1J1E A;  1X02 A;  1JC2 A;  3GK1 A;  1DJI A;  2P6B B;  4MRY A;  5HKW A;  1VRK A;  1KK7 Y;  1MQ1 A;  2JT0 A;  2LVK A;  2NLN A;  1K9U A;  3KO0 A;  3NSK A;  2K2A A;  1SRA A;  1FF1 A;  3PFV A;  1XA5 A;  2QPT A;  2Y4Q A;  3DD4 A;  4MVF A;  2JRF A;  3SG5 A;  3VRR A;  1F55 A;  1MXL C;  1YVH A;  4PHM A;  2CXJ A;  2JQ6 A;  3ICB A;  1V1F A;  1J1D A;  3TUY B;  1BF5 A;  3F45 A;  4R1E A;  1IJ5 A;  3TDZ A;  3NSI A;  2AMI A;  3SIA A;  4PE1 A;  1ZAC A;  2KQY A;  1CFC A;  3OX6 A;  2F8P A;  1FW4 A;  1QS7 A;  2PAS A;  1RTP 1;  2F2O A;  1SR6 B;  4F0Z B;  1J7R A;  1B7T Y;  1TCO B;  1Y6W A;  4WQ2 A;  2PRU A;  1UUS A;  2H61 A;  2MLF C;  1BU3 A;  1S6I A;  3OX5 A;  2JXC A;  2B1U A;  1QX7 A;  2HQ8 A;  4YGA A;  4JPZ B;  5G08 A;  2CT9 A;  3JTD C;  1KWO C;  1SMG A;  1UHJ A;  3IQQ A;  4MBE A;  1IRJ A;  2HET A;  3NXA A;  4I5L B;  1NCZ A;  2KQ6 A;  1AJ5 A;  3AKB A;  1SYM A;  2LHL A;  2E30 A;  2WCF A;  4MSP A;  2SCP A;  1FPW A;  1TRF A;  2L0P A;  2RGI A;  3TDI A;  1IKU A;  4I5K A;  1W7J B;  4A4B A;  2EC6 C;  4ZCU A;  5K89 A;  1QTX A;  3O78 A;  3ZWH A;  4E68 A;  1CTR A;  1QV0 A;  1XK4 C;  2ZN9 A;  1DJG A;  2L4I A;  2L98 A;  3TS5 C;  3CR4 X;  4PCW A;  5HKY A;  1SL7 A;  1NPQ A;  2BCA A;  1B8L A;  2ISD A;  3LL8 B;  4GGF A;  1UHH A;  1MXE A;  3I5I C;  1YR5 A;  1K9P A;  1NIW A;  2CCM A;  3I5G B;  2Y1M A;  2F3Z A;  1XFV O;  4U8D A;  2G9B A;  1MR8 A;  1Y0V H;  2MRD A;  2WCE A;  5I8N A;  2JUL A;  1CDM A;  2WOR A;  2KDH A;  1J55 A;  2M97 A;  2FOT A;  3PN7 B;  1UHI A;  2GGM A;  2M49 B;  1KQM C;  1YUR A;  5KTY A;  1CDP A;  5CSF A;  2BKH B;  3LLE A;  4YGB B;  1FI6 A;  3OB1 B;  4MLW A;  3I5G C;  1JBA A;  2F33 A;  1YUU A;  2Y5I A;  1OZO A;  1WDC B;  1S3P A;  1SCM B;  1TNQ A;  5CSN A;  1XYD A;  1CM4 A;  2H2K A;  4QJ3 B;  1AHR A;  1OMD A;  1M46 A;  3EKH A;  3EK4 A;  1R6P A;  1W7I B;  1XO5 A;  3CZT X;  3SG3 A;  1H4B A;  2L5X B;  4YRU A;  3KPX A;  3BUN B;  2WC8 A;  1PSR A;  1UP5 A;  2K7D A;  2DOQ A;  2KOT A;  4I5N B;  1GGW A;  4YGC B;  1A4P A;  2SAS A;  1DJX A;  1A29 A;  1N65 A;  3EK7 A;  3DVM A;  2K0J A;  3AAJ A;  1CMG A;  4YGD B;  3QRX A;  1B1G A;  1ALW A;  1Y1A A;  1UHN A;  1AVS A;  4CLN A;  1UUR A;  3GK2 A;  1SY9 A;  1XFX O;  1DTL A;  1IGV A;  4I5J A;  2CNP A;  2KI6 D;  3GK4 X;  1CFD A;  3CR2 A;  2M9G A;  2Y1N A;  2LCP A;  4ORC B;  5B8I B;  2KI4 C;  3C1V A;  4XYN A;  1MF8 B;  2L51 A;  2LV7 A;  3WHT B;  1L2O B;  1KFX S;  2BBN A;  1F8H A;  1BG1 A;  3WXA A;  4PE0 A;  1BR1 B;  1B8R A;  1SNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...