2JNFA

Solution structure of fly troponin c, isoform f1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
b'MGDVSKLSSNQVKLLETAFRDFETPEGSGRVSTDQIGIILEVLGIQQTKSTIRQLIDEFDPFGNGDIDFDSFKIIGARFLGEEVNPEQMQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title The structure of lethocerus troponin C: insights into the mechanism of stretch activation in muscles
pubmed doi rcsb
source organism Lethocerus indicus
molecule tags Metal binding protein
total genus 34
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnfA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnfA01
3O2PA 2BCXA 5FYXA 4P2YB 4MZKA 1BOCA 1YX7A 4MN0A 1RJVA 1MF8B 1DJIA 1F4OA 4PHKA 1K9UA 1NWDA 1K94A 3A4UB 1M46A 1NIWA 1CKKA 2H61A 2QACA 3KF9A 4HRHA 2DOQA 2M7NA 4Q04A 1S5GY 1TNQA 2FCEA 1XYDA 4HREE 4DUQA 1YTZC 3PM8A 4YGCB 1QVIZ 1V1FA 3RM1A 1RK9A 5KU1A 2R2IA 2LLSA 1QV1A 4I5LB 5F6TA 4F0ZB 1RROA 2FCDA 5AERA 3EK4A 4E68A 2NZ0A 1DJGA 1KQMB 1CFFA 1HQVA 2AMIA 2FJUB 1ZUZA 3DVEA 2I94A 1OZSA 2E30A 2L0PA 1KWOB 5CSNA 1QIWA 1KQMC 1J55A 1K95A 1EH2A 1KWOC 2OPOA 4GFTA 2LMUA 1CMGA 2COLB 3CLNA 1IRJA 1CTRA 5I2LA 5TNCA 1DT7B 2WOSA 3E3RA 3WHTB 3OB2B 4YI8A 3D10A 3SJSA 1K9KA 1L7ZA 1PSBA 1HT9A 4GUKA 5JOLA 3SG4A 4NQGA 2RGIA 5HLOA 1M63B 2OTGB 1FI6A 2NLNA 1XO5A 1R6PA 1ZMZA 2BKIB 1FW4A 4FQOA 2LC5A 3FWBA 2OTGC 1NYAA 1CDMA 1KFUL 1S36A 2ZFDA 5HYDA 1CLMA 4UPGA 1NX3A 1WRLA 2M97A 1Y0VH 4A4BA 3HX4A 1YUTA 2KAYA 1AUIB 1JUOA 4N5XA 3VGOA 2H61C 4CLNA 1J1DA 1C7VA 1AP4A 1QASA 1SL9A 2BCBA 4GGNA 1M39A 3KEVA 1NCYA 2HQ8A 2V53A 2O5GA 1DVIA 1KK7Z 1Y1UA 2KHNA 5G08A 2LNKA 1UP5A 1JC2A 2JTZA 1QXPA 1IKUA 1G8IA 1SY9A 2SCPA 1MUXA 3KO0A 2CCMA 4JPZB 1EL4A 1RECA 3OX6A 5J3XA 2LVVA 1FPWA 1UHJA 1TNWA 2KBIA 3EVRA 3DVKA 1LA3A 4WRIA 1S3PA 1AVSA 1DTLA 1KQVA 1CMFA 1RWYA 2JT3A 1DJWA 4MZJA 1JBAA 2ZNEA 2KYCA 2FOTA 2JT8A 2LHIA 3OX5A 2KNEA 4XJKA 3LCPC 2BCAA 1IJ6A 3VROA 1CNPA 1N2DA 2M49B 1YUUA 4GAOA 1J7QA 1KSOA 4MEWA 4TNCA 1TCOB 1PK0D 3VRRA 1B7TZ 3A8RA 4PCWA 4M2QA 3TZ1A 4I5NB 3I5IC 1CDLA 3O4YA 1NCXA 2JTTA 1YVHA 2KBMA 1MXLC 2QPTA 1QJTA 2KYFA 2M29A 3JTDB 1K2HA 2EC6B 2MJWB 4I5KA 3EK7A 1QS7A 2LCPA 3BUXB 3JTDC 3PATA 2EC6C 1YRTB 2K2FA 1LA0A 1DGUA 3D0YA 3PFVA 4N1FA 4PE4A 3SG5A 5I2QA 1UURA 1XA5A 3EKJA 4M2OA 1MHOA 4HRGA 4NDBA 2Q91A 2KDHA 2GGMA 4PE1A 1CB1A 2MAZA 2F2PA 1UWOA 3WXAA 2WCFA 1BR1B 5IBWA 1AK8A 3WNXB 3SG2A 1B9AA 4OR9B 1QTXA 1Y6WA 4A4CA 2KFHA 2P6BB 4PHJA 3I5HB 1NX0A 4ICBA 3BYAA 2M9GA 2K2AA 2KGRA 2WORA 2JU0A 4GNKB 4YGBB 1TIZA 3I5HC 4MRYA 2I7AA 3EVVA 1KK8B 3PSRA 4AQJA 3DVJA 1YURA 2GGZA 2LP3A 5D69A 1TCFA 4ZCUA 3DF0A 5AEQA 4XJKB 1ODBA 1VRKA 3CTNA 3NSIA 1UHKA 1A75A 1KK8C 3GK2A 1GJYA 3JVTB 2WCBA 1QVIY 5ER5A 1WDCB 1G33A 1WLZA 2MRDA 1AJ4A 1UHIA 1NPQA 5AANA 3JVTC 4DCKA 3AAKA 4OKHA 1PRWA 1WDCC 4M2PA 5DKQA 1BODA 1SCVA 1CM1A 1JFKA 2PVBA 2JPTA 4MBEA 4QJ5B 3C1VA 4ETOA 1B1GA 1WRZA 1TRFA 3NSKA 4GGFA 2LANA 3PLFB 1H4BA 3TDIA 2MLFC 2Y5IA 3QRXA 5JJGA 3KPXA 1JWDA 2BBNA 2PSRA 2K7BA 3K21A 1XFYO 5D7FA 1K8UA 3LK1A 4YI9A 2KI6C 1GQMA 4L9MA 1CLLA 1QIVA 2L2EA 3TUYB 2WNDA 4DRWA 5HLVA 3EKHA 2BE4A 1PVAA 4OCIA 1DJXA 3TUYC 3HCMA 1F4QA 1OQPA 1SRAA 1H8BA 1NX1A 5CPVA 1Y1AA 5CSJA 1TN4A 3BUOB 1BR4B 1DMOA 2WC8A 3OB1B 1SCMB 4PHNA 1BMOA 3PN7B 4CFRA 1CDPA 1G4YR 1PALA 2ZN9A 1SCMC 2PALA 2K0JA 5CSIA 4MVFA 3PN7C 3ZWHA 2LVIA 1A75B 2F2OA 3SIBA 3BOWA 2EGDA 1JF2A 3NXAA 2KOTA 1KK7Y 1MWNA 1F71A 3CR2A 2K7CA 5ER4X 5K89A 2JOJA 3EVUA 1A29A 1FF1A 2BKHB 4YBHB 4MSPA 1D1OA 1SKTA 1BJFA 1TNXA 2G9BA 2L98A 2PMYA 1K96A 1ZACA 1MXEA 1CFDA 1QATA 1KFXS 3TDUA 2L51A 4PE0A 3CR5X 1J7RA 3FS7A 2M8UA 4C0JA 4WQ3A 5HKZA 1JSAA 2BBMA 2I2RE 1L2OB 1NSHA 4GBAA 1W7JB 4GGFC 1CLBA 4MLWA 1S6CA 1GGWA 4USLA 1RTP1 1YRUB 2F3ZA 3I5FB 1SL8A 1L2OC 4GPLB 1XFWO 3AAJA 1A4PA 4AQIA 2LLTA 3VRQA 2ZRSA 2NCOA 3I5FC 3I5IB 4U8DA 2JZIA 1C07A 2L4HA 1S1EA 1WRKA 2LUXA 2I18A 3TDZA 1OMVA 1NUBA 1BU3A 3BQ3A 2HQWA 3O78A 1FBVA 1EG3A 5AXIA 3FIAA 1XFZO 1B7TY 3GK1A 4HSZA 1C7WA 4FTGA 1SR6B 2Y4QA 2JNXA 3MSEB 1N65A 4C0KA 2LVJA 3CS1A 1SR6C 2JULA 5I2OA 2ZNDA 3F45A 3BOWB 1B8RA 1QV0A 3M0WA 1IQ5A 1XFXO 2AUCA 2L50A 3AKBA 4R1EA 1M45A 4BY4A 1OMRA 1TTXA 2HETA 2IS9A 2LM5A 1BT6A 2KAVA 1XVJA 3SIAA 4YGEB 3I5GB 4ORAB 3ZNIA 1PSRA 1F55A 2CT9A 1NP8A 1SL7A 2LV7A 3BXKA 1SK6D 3I5GC 1EXRA 3IQQA 1YUSA 2JWWA 1MQ1A 1S5GZ 1UHNA 5GQQC 2BECA 1CFCA 1JFJA 2H2KA 1S6IA 5BPJA 1WY9A 2L4IA 1S6JA 2JXLA 1LVCD 1F8HA 1IJ5A 2GV5A 3VRNA 4JWQA 2F3YA 1QLKA 2HF5A 2JC2A 1EG4A 2K8MB 2ISDA 1BF5A 2PASA 4BY5A 3CZTX 5PALA 2JRFA 4NDDA 1CFPA 1SPYA 1DGVA 1IH0A 1S26D 1K90D 2BE6A 1LINA 2LAPA 1DJZA 1XFUO 5DKNA 3BUNB 1IG5A 2KSPA 1UUSA 4ORBB 3CGAA 1CDNA 1KSMA 1DJHA 5AFPA 1QX2A 2F33A 3ICBA 1Y1XA 3D0YB 1GGZA 2G2BA 4YGAA 2LVKA 1ALVA 1OE9B 4CIDA 2LUCA 3SG6A 3RLZA 1KFUS 2CXJA 1NCZA 2NCPA 2LLUA 3DD4A 1B8LA 2AAOA 4QJ4B 2M7LA 3PALA 5I8NA 2KGBC 1OSAA 3IQOA 1OOJA 1XK4A 2HPSA 3LLEA 1ALWA 1A2XA 4OV2A 1TOPA 1U5IA 1WLMA 4DS7A 2K61A 3LK0A 4OVNF 2MHHA 2WCEA 2B1UA 2K7OA 1SW8A 2KI6D 2M3WA 1EJ3A 3CWGA 5CSFA 1JF0A 1BG1A 1J1EA 4PHMA 4QJ3B 2EHBA 1SYMA 5DKRA 3O6BA 2Y1MA 1IQ3A 1KCYA 2CNPA 3DF0B 1LXFC 2JT0A 2VRGA 3NSOA 1YR5A 1DF0A 2LHLA 1AHRA 1B8CA 2F8PA 2LMVA 3VRPA 1J7PA 2M1KB 2MLEC 1QLSA 2LP2A 2OS8B 4NDCA 2KFFA 4YRUA 1DJYA 1K9PA 3OP0A 2OS8C 3EK8A 1MR8A 4WQ2A 1BLQA 4JQ0D 1SMGA 3WHUB 1IWQA 2TN4A 2CBLA 3GOFA 5HKWA 1K93D 2KAXA 1B47A 4PE7A 1N0YA 2ZKMX 1LKJA 1FI5A 1QX5B 4ORCB 4IL1A 1E8AA 2BL0B 3OHMB 2ZN8A 3BUWB 4I5JA 3BUMB 1PVBA 1J7OA 2PRUA 5B8IB 2JQ6A 1TNPA 2BL0C 3KHEA 1W7IB 1CM4A 2CTNA 2D8NA 2E6WA 2L5XB 2Q4UA 2Y1NA 1SNLA 3NSLA 1F70A 1NX2A 2A4JA 1YX8A 2LE9B 4N1GA 3IF7A 1U5IB 1IGVA 2LMTA 1KFXL 1XK4C 2KQ6A 2KI4B 1F54A 1Q80A 4MZLA 1B4CA 1ZOTB 1XFVO 3CR4X 1AJ5A 4ZCVA 2KI4C 1X02A 2JNFA 4PALA 4CPVA 2M1UA 1V1GA 1YVLA 2M0RA 4PDZA 3H4SE 2MBXA 3SG7A 5KSZA 1DF0B 5HKYA 1R2UA 2KQYA 2MA2A 4YGDB 3TS5B 1SBJA 1M31A 2KFGA 2SASA 5KTYA 4MRXA 2K7DA 4AOMA 3SG3A 3LL8B 2NXQA 1UHHA 3FWCA 4P5OE 1PULA 4XYNA 2O60A 3TS5C 4CFQA 1QX7A 3AKAA 2ZRTA 3GK4X 4C0LA 4D1EA 1ZFSA 1A03A 1OZOA 4DIRA 1OMDA 3DVMA 1RFJA 2JXCA
chains in the Genus database with same CATH superfamily
3O2PA 2BCXA 5FYXA 4IJ7A 4MZKA 4P2YB 1BOCA 1YX7A 4MN0A 1RJVA 1MF8B 1DJIA 1F4OA 4PHKA 1K9UA 1NWDA 1K94A 3A4UB 1M46A 1NIWA 1CKKA 3NHIA 2H61A 2QACA 1SSEB 3D75A 2DOQA 2M7NA 3KF9A 4HRHA 4Q04A 1S5GY 1TNQA 3D76A 2FCEA 1XYDA 4HREE 4DUQA 1YTZC 3PM8A 4YGCB 1QVIZ 1V1FA 3RM1A 1RK9A 5KU1A 2R2IA 2LLSA 3B87A 1QV1A 4I5LB 5F6TA 4F0ZB 1RROA 2FCDA 5AERA 3EK4A 4E68A 2NZ0A 1DJGA 1KQMB 1CFFA 1HQVA 2AMIA 2FJUB 3SS4A 1ZUZA 3DVEA 2I94A 1OZSA 2E30A 2L0PA 1KWOB 5CSNA 2P71A 1QIWA 1KQMC 1J55A 1K95A 1EH2A 1P28A 1KWOC 2OPOA 4GFTA 2LMUA 1C3ZA 1CMGA 2COLB 3CLNA 1IRJA 1CTRA 5I2LA 5TNCA 1DT7B 3QMEA 2WOSA 3E3RA 3WHTB 3OB2B 1GM0A 4YI8A 2WCJA 3D10A 3SJSA 1K9KA 1L7ZA 1PSBA 1HT9A 4GUKA 2WCHA 5JOLA 3SG4A 4NQGA 2RGIA 5HLOA 1M63B 2OTGB 1FI6A 3FE6A 2NLNA 1XO5A 1R6PA 1ZMZA 2BKIB 1FW4A 3R72A 4FQOA 4JKTA 2LC5A 3FWBA 2OTGC 1NYAA 1CDMA 1KFUL 1S36A 2ZFDA 5HYDA 1CLMA 4UPGA 1DC1A 1NX3A 1WRLA 2M97A 3RZSA 1Y0VH 4A4BA 3HX4A 1YUTA 2KAYA 1AUIB 3D77A 1JUOA 1TUJA 4N5XA 3VGOA 2H61C 4CLNA 1J1DA 1C7VA 1AP4A 1QASA 1SL9A 2BCBA 4GGNA 1M39A 3KEVA 1NCYA 2HQ8A 2V53A 3CZ0A 2O5GA 4F7FA 1DVIA 3BFBA 1KK7Z 1Y1UA 2KHNA 5G08A 3L4AA 2LNKA 1UP5A 1JC2A 2JTZA 1QXPA 1OOGA 1IKUA 1G8IA 1SY9A 3VB1A 2SCPA 3PM2A 1MUXA 3KO0A 2CCMA 4JPZB 1EL4A 1RECA 3OX6A 5J3XA 2LVVA 1FPWA 3EG5B 1UHJA 1TNWA 2KBIA 3EVRA 3DVKA 1LA3A 1QWVA 1S3PA 1AVSA 3D78A 3FE9A 4WRIA 1DTLA 1KQVA 1CMFA 1RWYA 2JT3A 1DJWA 4MZJA 1JBAA 2P70A 2ZNEA 2KYCA 2FOTA 2JT8A 2LHIA 2QEBA 3V2LA 3OX5A 2KNEA 4XJKA 2WCKA 3LCPC 2BCAA 1IJ6A 3VROA 1CNPA 1N2DA 2M49B 1YUUA 2KPHA 4GAOA 1J7QA 1KSOA 4MEWA 4TNCA 1TCOB 1PK0D 3VRRA 1B7TZ 3A8RA 4PCWA 2WCLA 4M2QA 3TZ1A 4I5NB 3I5IC 1CDLA 3O4YA 1NCXA 2JTTA 1YVHA 2KBMA 1MXLC 2QPTA 1QJTA 2KYFA 2M29A 3JTDB 1K2HA 2EC6B 2MJWB 4I5KA 1DEKA 3EK7A 3DY9A 3S0BA 1QS7A 2LCPA 3BUXB 3JTDC 3PATA 2EC6C 1YRTB 2K2FA 1LA0A 1DGUA 3D0YA 3PFVA 4N1FA 4PE4A 3SG5A 5I2QA 1UURA 1XA5A 3EKJA 4M2OA 1MHOA 4HRGA 4NDBA 2Q91A 2KDHA 2GGMA 4PE1A 1CB1A 2MAZA 4OZDA 3PJIA 2F2PA 1UWOA 3WXAA 2WCFA 5FI6A 3BFHA 1BR1B 5IBWA 1AK8A 3WNXB 3SG2A 1B9AA 4OR9B 1QTXA 1Y6WA 4A4CA 2KFHA 2P6BB 4PHJA 3I5HB 1NX0A 4ICBA 3K1EA 3BYAA 2M9GA 2K2AA 2KGRA 2WORA 2JU0A 3R1PA 4GNKB 2WC6A 4YGBB 1TIZA 3I5HC 3O4XA 4MRYA 2I7AA 3EVVA 1KK8B 3PSRA 4AQJA 3DVJA 1YURA 2GGZA 2LP3A 5D69A 1TCFA 4ZCUA 3DF0A 5AEQA 4XJKB 1ODBA 1OOIX 1VRKA 1Z2CB 2ERBA 2JPOA 1UHKA 1A75A 3B88A 3CTNA 3NSIA 1KK8C 3GK2A 1GJYA 3JVTB 2WCBA 1QVIY 5ER5A 1WDCB 1G33A 1Z4HA 1WLZA 2MRDA 1AJ4A 1UHIA 1NPQA 5AANA 3JVTC 4DCKA 3AAKA 4OKHA 1PRWA 1WDCC 4M2PA 5DKQA 1BODA 1SCVA 1CM1A 1JFKA 1ORGA 2PVBA 2JPTA 4MBEA 2WCMA 4QJ5B 3C1VA 4ETOA 1B1GA 1WRZA 1TRFA 3NSKA 4GGFA 2LANA 3PLFB 1H4BA 3TDIA 2MLFC 2Y5IA 3QRXA 5JJGA 3KPXA 1JWDA 2BBNA 2PSRA 2K7BA 3K21A 3UNWA 1XFYO 5D7FA 1K8UA 3BJHA 3LK1A 4YI9A 2KI6C 3R1VA 3L47A 1GQMA 4L9MA 1CLLA 1QIVA 2L2EA 3TUYB 3OBVA 2WNDA 4DRWA 5HLVA 3B86A 3EKHA 2BE4A 1PVAA 4OCIA 3N7HA 1DJXA 3TUYC 3HCMA 1F4QA 1OQPA 1SRAA 5FI7A 3CYZA 4KYNA 1H8BA 1NX1A 5CPVA 1Y1AA 5CSJA 1TN4A 3BUOB 1BR4B 1DMOA 2WC8A 3OB1B 1SCMB 4PHNA 2BAPA 4INWA 1BMOA 3PN7B 4CFRA 1CDPA 1G4YR 1PALA 2ZN9A 1SCMC 2PALA 2K0JA 5CSIA 4MVFA 2PQLA 3PN7C 3ZWHA 1XFRA 2LVIA 1A75B 2F2OA 3SIBA 3BOWA 2EGDA 1JF2A 3NXAA 2KOTA 1KK7Y 1MWNA 5I94A 3CR2A 2K7CA 5ER4X 5K89A 2JOJA 1F71A 3EVUA 1A29A 1FF1A 2BKHB 4YBHB 4MSPA 1D1OA 1SKTA 1BJFA 1TNXA 2G9BA 2L98A 2L2CA 2PMYA 1K96A 1ZACA 1MXEA 1CFDA 1QATA 1KFXS 3TDUA 2L51A 4PE0A 3CR5X 3L4LA 1J7RA 3FS7A 3DYEA 2M8UA 4C0JA 4WQ3A 5HKZA 1JSAA 2BBMA 2I2RE 1L2OB 1NSHA 4GBAA 1W7JB 3CDNA 4GGFC 1CLBA 4MLWA 1S6CA 3S0DA 1GGWA 4USLA 1RTP1 1YRUB 2F3ZA 3I5FB 1SL8A 1L2OC 4GPLB 1XFWO 2L5YA 1A4PA 3AAJA 4AQIA 2LLTA 3VRQA 2ZRSA 2NCOA 3I5FC 3I5IB 4U8DA 2JZIA 1C07A 2L4HA 1S1EA 1WRKA 2LUXA 2I18A 3TDZA 1OW4A 1OMVA 1NUBA 3BFAA 1BU3A 3BQ3A 2HQWA 3O78A 1FBVA 1EG3A 5AXIA 4JD9A 3FIAA 3SS5A 2PYQA 1XFZO 1B7TY 3GK1A 4HSZA 1C7WA 4FTGA 1SR6B 2Y4QA 2JNXA 3MSEB 1N65A 4C0KA 2LVJA 3CS1A 1SR6C 2JULA 5I2OA 2ZNDA 3F45A 3BOWB 1B8RA 1QV0A 3M0WA 1IQ5A 1XFXO 2AUCA 2L50A 3AKBA 4R1EA 1M45A 4BY4A 1OMRA 1TTXA 2HETA 2IS9A 1DQEA 1BT6A 2LM5A 2KAVA 1XVJA 3SIAA 4YGEB 3CABA 3I5GB 4ORAB 3CZ1A 3B6XA 3ZNIA 1PSRA 1F55A 2CT9A 1NP8A 1SL7A 2KLEA 2LV7A 3BXKA 1SK6D 3I5GC 1EXRA 3IQQA 3NHTA 1YUSA 2JWWA 1MQ1A 1S5GZ 1UHNA 5GQQC 3S0GA 2BECA 1CFCA 1JFJA 2H2KA 5D3OA 4PT1A 1S6IA 5BPJA 1WY9A 1TWOA 2L4IA 1S6JA 2JXLA 1LVCD 1F8HA 1IJ5A 2GV5A 3VRNA 4JWQA 2F3YA 1QLKA 2HF5A 2JC2A 1EG4A 2K8MB 2ISDA 1BF5A 2PASA 4BY5A 3CZTX 5PALA 2JRFA 4NDDA 5DICA 1CFPA 1SPYA 1DGVA 1IH0A 1S26D 1K90D 2BE6A 1LINA 2LAPA 1DJZA 1XFUO 5DKNA 3BUNB 1IG5A 3NGVA 2KSPA 1UUSA 4ORBB 3CGAA 1CDNA 1KSMA 1DJHA 5AFPA 1QX2A 2F33A 3ICBA 1Y1XA 1OOHA 3D0YB 1GGZA 3D74A 3UO9A 2G2BA 4YGAA 2LVKA 1ALVA 1OE9B 4CIDA 2LUCA 3SG6A 3RLZA 1KFUS 2CXJA 1NCZA 2NCPA 2LLUA 3DD4A 1B8LA 2AAOA 4QJ4B 2M7LA 3PALA 2QEVA 5I8NA 2KGBC 1OSAA 3OGNA 3IQOA 1OOJA 1XK4A 2HPSA 3LLEA 1ALWA 1A2XA 2BNXA 4OV2A 1TOPA 1U5IA 1WLMA 3S0FA 4DS7A 2K61A 3LK0A 4OVNF 2MHHA 2GTEA 2WCEA 2B1UA 2QEOA 2K7OA 3FE8A 1SW8A 2KI6D 2M3WA 1EJ3A 1TUZA 3CWGA 1JF0A 5CSFA 1BG1A 1J1EA 4PHMA 4QJ3B 2EHBA 1SYMA 5DKRA 3O6BA 2Y1MA 3SS3A 1IQ3A 1KCYA 2CNPA 2WC5A 3DF0B 1LXFC 2JT0A 2VRGA 3NSOA 1YR5A 1DF0A 2LHLA 1AHRA 1B8CA 2F8PA 2LMVA 3VRPA 1J7PA 2M1KB 2MLEC 1QLSA 2LP2A 3B7AA 2OS8B 4NDCA 2KFFA 3DZTA 4YRUA 1OOFA 1DJYA 1T14A 1K9PA 3OP0A 2OS8C 3EK8A 1MR8A 4WQ2A 1BLQA 4JQ0D 1SMGA 3WHUB 1IWQA 1DELA 2CBLA 2TN4A 3GOFA 1K93D 5HKWA 2YGUA 2KAXA 1B47A 4PE7A 1N0YA 2ZKMX 1LKJA 1FI5A 1QX5B 4ORCB 4IL1A 1E8AA 3S0AA 2BL0B 3OHMB 2ZN8A 3BUWB 3D73A 5EL2A 3S0EA 4I5JA 3BUMB 1PVBA 1J7OA 2PRUA 5B8IB 2JQ6A 1TNPA 2BL0C 2H8VA 3KHEA 1W7IB 1CM4A 2CTNA 2D8NA 2E6WA 2L5XB 2Q4UA 2Y1NA 1SNLA 3NSLA 1F70A 1NX2A 2A4JA 1LS8A 1YX8A 2LE9B 2K60A 2QDIA 4N1GA 3IF7A 1U5IB 1IGVA 2LMTA 3Q8IA 1KFXL 3IVTA 1XK4C 2QEHA 2KQ6A 2KI4B 2FJYA 1F54A 1Q80A 4MZLA 1B4CA 4FQTA 1ZOTB 2KLDA 1XFVO 3CR4X 1AJ5A 4ZCVA 3DXLA 2KI4C 1X02A 2JNFA 4PALA 4CPVA 2M1UA 1V1GA 1YVLA 2M0RA 4PDZA 3H4SE 2MBXA 3SG7A 5KSZA 1C3YA 1DF0B 5HKYA 1R2UA 2KQYA 3CZ2A 3R1OA 2MA2A 4YGDB 3TS5B 1SBJA 1M31A 2KFGA 2SASA 5KTYA 4MRXA 2K7DA 4AOMA 3SG3A 3LL8B 2NXQA 1UHHA 3FWCA 4P5OE 1PULA 4XYNA 2O60A 3TS5C 5HL1A 4INXA 4CFQA 5FI2A 1QX7A 3AKAA 2ZRTA 3GK4X 4C0LA 4D1EA 1ZFSA 1A03A 1OZOA 4DIRA 1OMDA 1W9ZA 3DVMA 1IIOA 1RFJA 2JXCA
chains in the Genus database with same CATH topology
3O2PA 2BCXA 5FYXA 4P2YB 4MZKA 1BOCA 1YX7A 4MN0A 1RJVA 1MF8B 1DJIA 1F4OA 4PHKA 1K9UA 1NWDA 1K94A 3A4UB 1M46A 1NIWA 1CKKA 2H61A 2QACA 3KF9A 4HRHA 2DOQA 2M7NA 4Q04A 1S5GY 1TNQA 2FCEA 1XYDA 4HREE 4DUQA 1YTZC 3PM8A 4YGCB 1QVIZ 1V1FA 3RM1A 1RK9A 5KU1A 2R2IA 2LLSA 1QV1A 4I5LB 5F6TA 4F0ZB 1RROA 2FCDA 5AERA 3EK4A 4E68A 2NZ0A 1DJGA 1KQMB 1CFFA 1HQVA 2AMIA 2FJUB 1ZUZA 3DVEA 2I94A 1OZSA 2E30A 2L0PA 1KWOB 5CSNA 1QIWA 1KQMC 1J55A 1K95A 1EH2A 1KWOC 2OPOA 4GFTA 2LMUA 1CMGA 2COLB 3CLNA 1IRJA 1CTRA 5I2LA 5TNCA 1DT7B 2WOSA 3E3RA 3WHTB 3OB2B 4YI8A 3D10A 3SJSA 1K9KA 1L7ZA 1PSBA 1HT9A 4GUKA 5JOLA 3SG4A 4NQGA 2RGIA 5HLOA 1M63B 2OTGB 1FI6A 2NLNA 1XO5A 1R6PA 1ZMZA 2BKIB 1FW4A 4FQOA 2LC5A 3FWBA 2OTGC 1NYAA 1CDMA 1KFUL 1S36A 2ZFDA 5HYDA 1CLMA 4UPGA 1NX3A 1WRLA 2M97A 1Y0VH 4A4BA 3HX4A 1YUTA 2KAYA 1AUIB 1JUOA 4N5XA 3VGOA 2H61C 4CLNA 1J1DA 1C7VA 1AP4A 1QASA 1SL9A 2BCBA 4GGNA 1M39A 3KEVA 1NCYA 2HQ8A 2V53A 2O5GA 1DVIA 1KK7Z 1Y1UA 2KHNA 5G08A 2LNKA 1UP5A 1JC2A 2JTZA 1QXPA 1IKUA 1G8IA 1SY9A 2SCPA 1MUXA 3KO0A 2CCMA 4JPZB 1EL4A 1RECA 3OX6A 5J3XA 2LVVA 1FPWA 1UHJA 1TNWA 2KBIA 3EVRA 3DVKA 1LA3A 4WRIA 1S3PA 1AVSA 1DTLA 1KQVA 1CMFA 1RWYA 2JT3A 1DJWA 4MZJA 1JBAA 2ZNEA 2KYCA 2FOTA 2JT8A 2LHIA 3OX5A 2KNEA 4XJKA 3LCPC 2BCAA 1IJ6A 3VROA 1CNPA 1N2DA 2M49B 1YUUA 4GAOA 1J7QA 1KSOA 4MEWA 4TNCA 1TCOB 1PK0D 3VRRA 1B7TZ 3A8RA 4PCWA 4M2QA 3TZ1A 4I5NB 3I5IC 1CDLA 3O4YA 1NCXA 2JTTA 1YVHA 2KBMA 1MXLC 2QPTA 1QJTA 2KYFA 2M29A 3JTDB 1K2HA 2EC6B 2MJWB 4I5KA 3EK7A 1QS7A 2LCPA 3BUXB 3JTDC 3PATA 2EC6C 1YRTB 2K2FA 1LA0A 1DGUA 3D0YA 3PFVA 4N1FA 4PE4A 3SG5A 5I2QA 1UURA 1XA5A 3EKJA 4M2OA 1MHOA 4HRGA 4NDBA 2Q91A 2KDHA 2GGMA 4PE1A 1CB1A 2MAZA 2F2PA 1UWOA 3WXAA 2WCFA 1BR1B 5IBWA 1AK8A 3WNXB 3SG2A 1B9AA 4OR9B 1QTXA 1Y6WA 4A4CA 2KFHA 2P6BB 4PHJA 3I5HB 1NX0A 4ICBA 3BYAA 2M9GA 2K2AA 2KGRA 2WORA 2JU0A 4GNKB 4YGBB 1TIZA 3I5HC 4MRYA 2I7AA 3EVVA 1KK8B 3PSRA 4AQJA 3DVJA 1YURA 2GGZA 2LP3A 5D69A 1TCFA 4ZCUA 3DF0A 5AEQA 4XJKB 1ODBA 1VRKA 3CTNA 3NSIA 1UHKA 1A75A 1KK8C 3GK2A 1GJYA 3JVTB 2WCBA 1QVIY 5ER5A 1WDCB 1G33A 1WLZA 2MRDA 1AJ4A 1UHIA 1NPQA 5AANA 3JVTC 4DCKA 3AAKA 4OKHA 1PRWA 1WDCC 4M2PA 5DKQA 1BODA 1SCVA 1CM1A 1JFKA 2PVBA 2JPTA 4MBEA 4QJ5B 3C1VA 4ETOA 1B1GA 1WRZA 1TRFA 3NSKA 4GGFA 2LANA 3PLFB 1H4BA 3TDIA 2MLFC 2Y5IA 3QRXA 5JJGA 3KPXA 1JWDA 2BBNA 2PSRA 2K7BA 3K21A 1XFYO 5D7FA 1K8UA 3LK1A 4YI9A 2KI6C 1GQMA 4L9MA 1CLLA 1QIVA 2L2EA 3TUYB 2WNDA 4DRWA 5HLVA 3EKHA 2BE4A 1PVAA 4OCIA 1DJXA 3TUYC 3HCMA 1F4QA 1OQPA 1SRAA 1H8BA 1NX1A 5CPVA 1Y1AA 5CSJA 1TN4A 3BUOB 1BR4B 1DMOA 2WC8A 3OB1B 1SCMB 4PHNA 1BMOA 3PN7B 4CFRA 1CDPA 1G4YR 1PALA 2ZN9A 1SCMC 2PALA 2K0JA 5CSIA 4MVFA 3PN7C 3ZWHA 2LVIA 1A75B 2F2OA 3SIBA 3BOWA 2EGDA 1JF2A 3NXAA 2KOTA 1KK7Y 1MWNA 1F71A 3CR2A 2K7CA 5ER4X 5K89A 2JOJA 3EVUA 1A29A 1FF1A 2BKHB 4YBHB 4MSPA 1D1OA 1SKTA 1BJFA 1TNXA 2G9BA 2L98A 2PMYA 1K96A 1ZACA 1MXEA 1CFDA 1QATA 1KFXS 3TDUA 2L51A 4PE0A 3CR5X 1J7RA 3FS7A 2M8UA 4C0JA 4WQ3A 5HKZA 1JSAA 2BBMA 2I2RE 1L2OB 1NSHA 4GBAA 1W7JB 4GGFC 1CLBA 4MLWA 1S6CA 1GGWA 4USLA 1RTP1 1YRUB 2F3ZA 3I5FB 1SL8A 1L2OC 4GPLB 1XFWO 3AAJA 1A4PA 4AQIA 2LLTA 3VRQA 2ZRSA 2NCOA 3I5FC 3I5IB 4U8DA 2JZIA 1C07A 2L4HA 1S1EA 1WRKA 2LUXA 2I18A 3TDZA 1OMVA 1NUBA 1BU3A 3BQ3A 2HQWA 3O78A 1FBVA 1EG3A 5AXIA 3FIAA 1XFZO 1B7TY 3GK1A 4HSZA 1C7WA 4FTGA 1SR6B 2Y4QA 2JNXA 3MSEB 1N65A 4C0KA 2LVJA 3CS1A 1SR6C 2JULA 5I2OA 2ZNDA 3F45A 3BOWB 1B8RA 1QV0A 3M0WA 1IQ5A 1XFXO 2AUCA 2L50A 3AKBA 4R1EA 1M45A 4BY4A 1OMRA 1TTXA 2HETA 2IS9A 2LM5A 1BT6A 2KAVA 1XVJA 3SIAA 4YGEB 3I5GB 4ORAB 3ZNIA 1PSRA 1F55A 2CT9A 1NP8A 1SL7A 2LV7A 3BXKA 1SK6D 3I5GC 1EXRA 3IQQA 1YUSA 2JWWA 1MQ1A 1S5GZ 1UHNA 5GQQC 2BECA 1CFCA 1JFJA 2H2KA 1S6IA 5BPJA 1WY9A 2L4IA 1S6JA 2JXLA 1LVCD 1F8HA 1IJ5A 2GV5A 3VRNA 4JWQA 2F3YA 1QLKA 2HF5A 2JC2A 1EG4A 2K8MB 2ISDA 1BF5A 2PASA 4BY5A 3CZTX 5PALA 2JRFA 4NDDA 1CFPA 1SPYA 1DGVA 1IH0A 1S26D 1K90D 2BE6A 1LINA 2LAPA 1DJZA 1XFUO 5DKNA 3BUNB 1IG5A 2KSPA 1UUSA 4ORBB 3CGAA 1CDNA 1KSMA 1DJHA 5AFPA 1QX2A 2F33A 3ICBA 1Y1XA 3D0YB 1GGZA 2G2BA 4YGAA 2LVKA 1ALVA 1OE9B 4CIDA 2LUCA 3SG6A 3RLZA 1KFUS 2CXJA 1NCZA 2NCPA 2LLUA 3DD4A 1B8LA 2AAOA 4QJ4B 2M7LA 3PALA 5I8NA 2KGBC 1OSAA 3IQOA 1OOJA 1XK4A 2HPSA 3LLEA 1ALWA 1A2XA 4OV2A 1TOPA 1U5IA 1WLMA 4DS7A 2K61A 3LK0A 4OVNF 2MHHA 2WCEA 2B1UA 2K7OA 1SW8A 2KI6D 2M3WA 1EJ3A 3CWGA 5CSFA 1JF0A 1BG1A 1J1EA 4PHMA 4QJ3B 2EHBA 1SYMA 5DKRA 3O6BA 2Y1MA 1IQ3A 1KCYA 2CNPA 3DF0B 1LXFC 2JT0A 2VRGA 3NSOA 1YR5A 1DF0A 2LHLA 1AHRA 1B8CA 2F8PA 2LMVA 3VRPA 1J7PA 2M1KB 2MLEC 1QLSA 2LP2A 2OS8B 4NDCA 2KFFA 4YRUA 1DJYA 1K9PA 3OP0A 2OS8C 3EK8A 1MR8A 4WQ2A 1BLQA 4JQ0D 1SMGA 3WHUB 1IWQA 2TN4A 2CBLA 3GOFA 5HKWA 1K93D 2KAXA 1B47A 4PE7A 1N0YA 2ZKMX 1LKJA 1FI5A 1QX5B 4ORCB 4IL1A 1E8AA 2BL0B 3OHMB 2ZN8A 3BUWB 4I5JA 3BUMB 1PVBA 1J7OA 2PRUA 5B8IB 2JQ6A 1TNPA 2BL0C 3KHEA 1W7IB 1CM4A 2CTNA 2D8NA 2E6WA 2L5XB 2Q4UA 2Y1NA 1SNLA 3NSLA 1F70A 1NX2A 2A4JA 1YX8A 2LE9B 4N1GA 3IF7A 1U5IB 1IGVA 2LMTA 1KFXL 1XK4C 2KQ6A 2KI4B 1F54A 1Q80A 4MZLA 1B4CA 1ZOTB 1XFVO 3CR4X 1AJ5A 4ZCVA 2KI4C 1X02A 2JNFA 4PALA 4CPVA 2M1UA 1V1GA 1YVLA 2M0RA 4PDZA 3H4SE 2MBXA 3SG7A 5KSZA 1DF0B 5HKYA 1R2UA 2KQYA 2MA2A 4YGDB 3TS5B 1SBJA 1M31A 2KFGA 2SASA 5KTYA 4MRXA 2K7DA 4AOMA 3SG3A 3LL8B 2NXQA 1UHHA 3FWCA 4P5OE 1PULA 4XYNA 2O60A 3TS5C 4CFQA 1QX7A 3AKAA 2ZRTA 3GK4X 4C0LA 4D1EA 1ZFSA 1A03A 1OZOA 4DIRA 1OMDA 3DVMA 1RFJA 2JXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2P A;  2BCX A;  5FYX A;  4P2Y B;  4MZK A;  1BOC A;  1YX7 A;  4MN0 A;  1RJV A;  1MF8 B;  1DJI A;  1F4O A;  4PHK A;  1K9U A;  1NWD A;  1K94 A;  3A4U B;  1M46 A;  1NIW A;  1CKK A;  2H61 A;  2QAC A;  3KF9 A;  4HRH A;  2DOQ A;  2M7N A;  4Q04 A;  1S5G Y;  1TNQ A;  2FCE A;  1XYD A;  4HRE E;  4DUQ A;  1YTZ C;  3PM8 A;  4YGC B;  1QVI Z;  1V1F A;  3RM1 A;  1RK9 A;  5KU1 A;  2R2I A;  2LLS A;  1QV1 A;  4I5L B;  5F6T A;  4F0Z B;  1RRO A;  2FCD A;  5AER A;  3EK4 A;  4E68 A;  2NZ0 A;  1DJG A;  1KQM B;  1CFF A;  1HQV A;  2AMI A;  2FJU B;  1ZUZ A;  3DVE A;  2I94 A;  1OZS A;  2E30 A;  2L0P A;  1KWO B;  5CSN A;  1QIW A;  1KQM C;  1J55 A;  1K95 A;  1EH2 A;  1KWO C;  2OPO A;  4GFT A;  2LMU A;  1CMG A;  2COL B;  3CLN A;  1IRJ A;  1CTR A;  5I2L A;  5TNC A;  1DT7 B;  2WOS A;  3E3R A;  3WHT B;  3OB2 B;  4YI8 A;  3D10 A;  3SJS A;  1K9K A;  1L7Z A;  1PSB A;  1HT9 A;  4GUK A;  5JOL A;  3SG4 A;  4NQG A;  2RGI A;  5HLO A;  1M63 B;  2OTG B;  1FI6 A;  2NLN A;  1XO5 A;  1R6P A;  1ZMZ A;  2BKI B;  1FW4 A;  4FQO A;  2LC5 A;  3FWB A;  2OTG C;  1NYA A;  1CDM A;  1KFU L;  1S36 A;  2ZFD A;  5HYD A;  1CLM A;  4UPG A;  1NX3 A;  1WRL A;  2M97 A;  1Y0V H;  4A4B A;  3HX4 A;  1YUT A;  2KAY A;  1AUI B;  1JUO A;  4N5X A;  3VGO A;  2H61 C;  4CLN A;  1J1D A;  1C7V A;  1AP4 A;  1QAS A;  1SL9 A;  2BCB A;  4GGN A;  1M39 A;  3KEV A;  1NCY A;  2HQ8 A;  2V53 A;  2O5G A;  1DVI A;  1KK7 Z;  1Y1U A;  2KHN A;  5G08 A;  2LNK A;  1UP5 A;  1JC2 A;  2JTZ A;  1QXP A;  1IKU A;  1G8I A;  1SY9 A;  2SCP A;  1MUX A;  3KO0 A;  2CCM A;  4JPZ B;  1EL4 A;  1REC A;  3OX6 A;  5J3X A;  2LVV A;  1FPW A;  1UHJ A;  1TNW A;  2KBI A;  3EVR A;  3DVK A;  1LA3 A;  4WRI A;  1S3P A;  1AVS A;  1DTL A;  1KQV A;  1CMF A;  1RWY A;  2JT3 A;  1DJW A;  4MZJ A;  1JBA A;  2ZNE A;  2KYC A;  2FOT A;  2JT8 A;  2LHI A;  3OX5 A;  2KNE A;  4XJK A;  3LCP C;  2BCA A;  1IJ6 A;  3VRO A;  1CNP A;  1N2D A;  2M49 B;  1YUU A;  4GAO A;  1J7Q A;  1KSO A;  4MEW A;  4TNC A;  1TCO B;  1PK0 D;  3VRR A;  1B7T Z;  3A8R A;  4PCW A;  4M2Q A;  3TZ1 A;  4I5N B;  3I5I C;  1CDL A;  3O4Y A;  1NCX A;  2JTT A;  1YVH A;  2KBM A;  1MXL C;  2QPT A;  1QJT A;  2KYF A;  2M29 A;  3JTD B;  1K2H A;  2EC6 B;  2MJW B;  4I5K A;  3EK7 A;  1QS7 A;  2LCP A;  3BUX B;  3JTD C;  3PAT A;  2EC6 C;  1YRT B;  2K2F A;  1LA0 A;  1DGU A;  3D0Y A;  3PFV A;  4N1F A;  4PE4 A;  3SG5 A;  5I2Q A;  1UUR A;  1XA5 A;  3EKJ A;  4M2O A;  1MHO A;  4HRG A;  4NDB A;  2Q91 A;  2KDH A;  2GGM A;  4PE1 A;  1CB1 A;  2MAZ A;  2F2P A;  1UWO A;  3WXA A;  2WCF A;  1BR1 B;  5IBW A;  1AK8 A;  3WNX B;  3SG2 A;  1B9A A;  4OR9 B;  1QTX A;  1Y6W A;  4A4C A;  2KFH A;  2P6B B;  4PHJ A;  3I5H B;  1NX0 A;  4ICB A;  3BYA A;  2M9G A;  2K2A A;  2KGR A;  2WOR A;  2JU0 A;  4GNK B;  4YGB B;  1TIZ A;  3I5H C;  4MRY A;  2I7A A;  3EVV A;  1KK8 B;  3PSR A;  4AQJ A;  3DVJ A;  1YUR A;  2GGZ A;  2LP3 A;  5D69 A;  1TCF A;  4ZCU A;  3DF0 A;  5AEQ A;  4XJK B;  1ODB A;  1VRK A;  3CTN A;  3NSI A;  1UHK A;  1A75 A;  1KK8 C;  3GK2 A;  1GJY A;  3JVT B;  2WCB A;  1QVI Y;  5ER5 A;  1WDC B;  1G33 A;  1WLZ A;  2MRD A;  1AJ4 A;  1UHI A;  1NPQ A;  5AAN A;  3JVT C;  4DCK A;  3AAK A;  4OKH A;  1PRW A;  1WDC C;  4M2P A;  5DKQ A;  1BOD A;  1SCV A;  1CM1 A;  1JFK A;  2PVB A;  2JPT A;  4MBE A;  4QJ5 B;  3C1V A;  4ETO A;  1B1G A;  1WRZ A;  1TRF A;  3NSK A;  4GGF A;  2LAN A;  3PLF B;  1H4B A;  3TDI A;  2MLF C;  2Y5I A;  3QRX A;  5JJG A;  3KPX A;  1JWD A;  2BBN A;  2PSR A;  2K7B A;  3K21 A;  1XFY O;  5D7F A;  1K8U A;  3LK1 A;  4YI9 A;  2KI6 C;  1GQM A;  4L9M A;  1CLL A;  1QIV A;  2L2E A;  3TUY B;  2WND A;  4DRW A;  5HLV A;  3EKH A;  2BE4 A;  1PVA A;  4OCI A;  1DJX A;  3TUY C;  3HCM A;  1F4Q A;  1OQP A;  1SRA A;  1H8B A;  1NX1 A;  5CPV A;  1Y1A A;  5CSJ A;  1TN4 A;  3BUO B;  1BR4 B;  1DMO A;  2WC8 A;  3OB1 B;  1SCM B;  4PHN A;  1BMO A;  3PN7 B;  4CFR A;  1CDP A;  1G4Y R;  1PAL A;  2ZN9 A;  1SCM C;  2PAL A;  2K0J A;  5CSI A;  4MVF A;  3PN7 C;  3ZWH A;  2LVI A;  1A75 B;  2F2O A;  3SIB A;  3BOW A;  2EGD A;  1JF2 A;  3NXA A;  2KOT A;  1KK7 Y;  1MWN A;  1F71 A;  3CR2 A;  2K7C A;  5ER4 X;  5K89 A;  2JOJ A;  3EVU A;  1A29 A;  1FF1 A;  2BKH B;  4YBH B;  4MSP A;  1D1O A;  1SKT A;  1BJF A;  1TNX A;  2G9B A;  2L98 A;  2PMY A;  1K96 A;  1ZAC A;  1MXE A;  1CFD A;  1QAT A;  1KFX S;  3TDU A;  2L51 A;  4PE0 A;  3CR5 X;  1J7R A;  3FS7 A;  2M8U A;  4C0J A;  4WQ3 A;  5HKZ A;  1JSA A;  2BBM A;  2I2R E;  1L2O B;  1NSH A;  4GBA A;  1W7J B;  4GGF C;  1CLB A;  4MLW A;  1S6C A;  1GGW A;  4USL A;  1RTP 1;  1YRU B;  2F3Z A;  3I5F B;  1SL8 A;  1L2O C;  4GPL B;  1XFW O;  3AAJ A;  1A4P A;  4AQI A;  2LLT A;  3VRQ A;  2ZRS A;  2NCO A;  3I5F C;  3I5I B;  4U8D A;  2JZI A;  1C07 A;  2L4H A;  1S1E A;  1WRK A;  2LUX A;  2I18 A;  3TDZ A;  1OMV A;  1NUB A;  1BU3 A;  3BQ3 A;  2HQW A;  3O78 A;  1FBV A;  1EG3 A;  5AXI A;  3FIA A;  1XFZ O;  1B7T Y;  3GK1 A;  4HSZ A;  1C7W A;  4FTG A;  1SR6 B;  2Y4Q A;  2JNX A;  3MSE B;  1N65 A;  4C0K A;  2LVJ A;  3CS1 A;  1SR6 C;  2JUL A;  5I2O A;  2ZND A;  3F45 A;  3BOW B;  1B8R A;  1QV0 A;  3M0W A;  1IQ5 A;  1XFX O;  2AUC A;  2L50 A;  3AKB A;  4R1E A;  1M45 A;  4BY4 A;  1OMR A;  1TTX A;  2HET A;  2IS9 A;  2LM5 A;  1BT6 A;  2KAV A;  1XVJ A;  3SIA A;  4YGE B;  3I5G B;  4ORA B;  3ZNI A;  1PSR A;  1F55 A;  2CT9 A;  1NP8 A;  1SL7 A;  2LV7 A;  3BXK A;  1SK6 D;  3I5G C;  1EXR A;  3IQQ A;  1YUS A;  2JWW A;  1MQ1 A;  1S5G Z;  1UHN A;  5GQQ C;  2BEC A;  1CFC A;  1JFJ A;  2H2K A;  1S6I A;  5BPJ A;  1WY9 A;  2L4I A;  1S6J A;  2JXL A;  1LVC D;  1F8H A;  1IJ5 A;  2GV5 A;  3VRN A;  4JWQ A;  2F3Y A;  1QLK A;  2HF5 A;  2JC2 A;  1EG4 A;  2K8M B;  2ISD A;  1BF5 A;  2PAS A;  4BY5 A;  3CZT X;  5PAL A;  2JRF A;  4NDD A;  1CFP A;  1SPY A;  1DGV A;  1IH0 A;  1S26 D;  1K90 D;  2BE6 A;  1LIN A;  2LAP A;  1DJZ A;  1XFU O;  5DKN A;  3BUN B;  1IG5 A;  2KSP A;  1UUS A;  4ORB B;  3CGA A;  1CDN A;  1KSM A;  1DJH A;  5AFP A;  1QX2 A;  2F33 A;  3ICB A;  1Y1X A;  3D0Y B;  1GGZ A;  2G2B A;  4YGA A;  2LVK A;  1ALV A;  1OE9 B;  4CID A;  2LUC A;  3SG6 A;  3RLZ A;  1KFU S;  2CXJ A;  1NCZ A;  2NCP A;  2LLU A;  3DD4 A;  1B8L A;  2AAO A;  4QJ4 B;  2M7L A;  3PAL A;  5I8N A;  2KGB C;  1OSA A;  3IQO A;  1OOJ A;  1XK4 A;  2HPS A;  3LLE A;  1ALW A;  1A2X A;  4OV2 A;  1TOP A;  1U5I A;  1WLM A;  4DS7 A;  2K61 A;  3LK0 A;  4OVN F;  2MHH A;  2WCE A;  2B1U A;  2K7O A;  1SW8 A;  2KI6 D;  2M3W A;  1EJ3 A;  3CWG A;  5CSF A;  1JF0 A;  1BG1 A;  1J1E A;  4PHM A;  4QJ3 B;  2EHB A;  1SYM A;  5DKR A;  3O6B A;  2Y1M A;  1IQ3 A;  1KCY A;  2CNP A;  3DF0 B;  1LXF C;  2JT0 A;  2VRG A;  3NSO A;  1YR5 A;  1DF0 A;  2LHL A;  1AHR A;  1B8C A;  2F8P A;  2LMV A;  3VRP A;  1J7P A;  2M1K B;  2MLE C;  1QLS A;  2LP2 A;  2OS8 B;  4NDC A;  2KFF A;  4YRU A;  1DJY A;  1K9P A;  3OP0 A;  2OS8 C;  3EK8 A;  1MR8 A;  4WQ2 A;  1BLQ A;  4JQ0 D;  1SMG A;  3WHU B;  1IWQ A;  2TN4 A;  2CBL A;  3GOF A;  5HKW A;  1K93 D;  2KAX A;  1B47 A;  4PE7 A;  1N0Y A;  2ZKM X;  1LKJ A;  1FI5 A;  1QX5 B;  4ORC B;  4IL1 A;  1E8A A;  2BL0 B;  3OHM B;  2ZN8 A;  3BUW B;  4I5J A;  3BUM B;  1PVB A;  1J7O A;  2PRU A;  5B8I B;  2JQ6 A;  1TNP A;  2BL0 C;  3KHE A;  1W7I B;  1CM4 A;  2CTN A;  2D8N A;  2E6W A;  2L5X B;  2Q4U A;  2Y1N A;  1SNL A;  3NSL A;  1F70 A;  1NX2 A;  2A4J A;  1YX8 A;  2LE9 B;  4N1G A;  3IF7 A;  1U5I B;  1IGV A;  2LMT A;  1KFX L;  1XK4 C;  2KQ6 A;  2KI4 B;  1F54 A;  1Q80 A;  4MZL A;  1B4C A;  1ZOT B;  1XFV O;  3CR4 X;  1AJ5 A;  4ZCV A;  2KI4 C;  1X02 A;  2JNF A;  4PAL A;  4CPV A;  2M1U A;  1V1G A;  1YVL A;  2M0R A;  4PDZ A;  3H4S E;  2MBX A;  3SG7 A;  5KSZ A;  1DF0 B;  5HKY A;  1R2U A;  2KQY A;  2MA2 A;  4YGD B;  3TS5 B;  1SBJ A;  1M31 A;  2KFG A;  2SAS A;  5KTY A;  4MRX A;  2K7D A;  4AOM A;  3SG3 A;  3LL8 B;  2NXQ A;  1UHH A;  3FWC A;  4P5O E;  1PUL A;  4XYN A;  2O60 A;  3TS5 C;  4CFQ A;  1QX7 A;  3AKA A;  2ZRT A;  3GK4 X;  4C0L A;  4D1E A;  1ZFS A;  1A03 A;  1OZO A;  4DIR A;  1OMD A;  3DVM A;  1RFJ A;  2JXC A; 
#chains in the Genus database with same CATH topology
 3O2P A;  2BCX A;  5FYX A;  4IJ7 A;  4MZK A;  4P2Y B;  1BOC A;  1YX7 A;  4MN0 A;  1RJV A;  1MF8 B;  1DJI A;  1F4O A;  4PHK A;  1K9U A;  1NWD A;  1K94 A;  3A4U B;  1M46 A;  1NIW A;  1CKK A;  3NHI A;  2H61 A;  2QAC A;  1SSE B;  3D75 A;  2DOQ A;  2M7N A;  3KF9 A;  4HRH A;  4Q04 A;  1S5G Y;  1TNQ A;  3D76 A;  2FCE A;  1XYD A;  4HRE E;  4DUQ A;  1YTZ C;  3PM8 A;  4YGC B;  1QVI Z;  1V1F A;  3RM1 A;  1RK9 A;  5KU1 A;  2R2I A;  2LLS A;  3B87 A;  1QV1 A;  4I5L B;  5F6T A;  4F0Z B;  1RRO A;  2FCD A;  5AER A;  3EK4 A;  4E68 A;  2NZ0 A;  1DJG A;  1KQM B;  1CFF A;  1HQV A;  2AMI A;  2FJU B;  3SS4 A;  1ZUZ A;  3DVE A;  2I94 A;  1OZS A;  2E30 A;  2L0P A;  1KWO B;  5CSN A;  2P71 A;  1QIW A;  1KQM C;  1J55 A;  1K95 A;  1EH2 A;  1P28 A;  1KWO C;  2OPO A;  4GFT A;  2LMU A;  1C3Z A;  1CMG A;  2COL B;  3CLN A;  1IRJ A;  1CTR A;  5I2L A;  5TNC A;  1DT7 B;  3QME A;  2WOS A;  3E3R A;  3WHT B;  3OB2 B;  1GM0 A;  4YI8 A;  2WCJ A;  3D10 A;  3SJS A;  1K9K A;  1L7Z A;  1PSB A;  1HT9 A;  4GUK A;  2WCH A;  5JOL A;  3SG4 A;  4NQG A;  2RGI A;  5HLO A;  1M63 B;  2OTG B;  1FI6 A;  3FE6 A;  2NLN A;  1XO5 A;  1R6P A;  1ZMZ A;  2BKI B;  1FW4 A;  3R72 A;  4FQO A;  4JKT A;  2LC5 A;  3FWB A;  2OTG C;  1NYA A;  1CDM A;  1KFU L;  1S36 A;  2ZFD A;  5HYD A;  1CLM A;  4UPG A;  1DC1 A;  1NX3 A;  1WRL A;  2M97 A;  3RZS A;  1Y0V H;  4A4B A;  3HX4 A;  1YUT A;  2KAY A;  1AUI B;  3D77 A;  1JUO A;  1TUJ A;  4N5X A;  3VGO A;  2H61 C;  4CLN A;  1J1D A;  1C7V A;  1AP4 A;  1QAS A;  1SL9 A;  2BCB A;  4GGN A;  1M39 A;  3KEV A;  1NCY A;  2HQ8 A;  2V53 A;  3CZ0 A;  2O5G A;  4F7F A;  1DVI A;  3BFB A;  1KK7 Z;  1Y1U A;  2KHN A;  5G08 A;  3L4A A;  2LNK A;  1UP5 A;  1JC2 A;  2JTZ A;  1QXP A;  1OOG A;  1IKU A;  1G8I A;  1SY9 A;  3VB1 A;  2SCP A;  3PM2 A;  1MUX A;  3KO0 A;  2CCM A;  4JPZ B;  1EL4 A;  1REC A;  3OX6 A;  5J3X A;  2LVV A;  1FPW A;  3EG5 B;  1UHJ A;  1TNW A;  2KBI A;  3EVR A;  3DVK A;  1LA3 A;  1QWV A;  1S3P A;  1AVS A;  3D78 A;  3FE9 A;  4WRI A;  1DTL A;  1KQV A;  1CMF A;  1RWY A;  2JT3 A;  1DJW A;  4MZJ A;  1JBA A;  2P70 A;  2ZNE A;  2KYC A;  2FOT A;  2JT8 A;  2LHI A;  2QEB A;  3V2L A;  3OX5 A;  2KNE A;  4XJK A;  2WCK A;  3LCP C;  2BCA A;  1IJ6 A;  3VRO A;  1CNP A;  1N2D A;  2M49 B;  1YUU A;  2KPH A;  4GAO A;  1J7Q A;  1KSO A;  4MEW A;  4TNC A;  1TCO B;  1PK0 D;  3VRR A;  1B7T Z;  3A8R A;  4PCW A;  2WCL A;  4M2Q A;  3TZ1 A;  4I5N B;  3I5I C;  1CDL A;  3O4Y A;  1NCX A;  2JTT A;  1YVH A;  2KBM A;  1MXL C;  2QPT A;  1QJT A;  2KYF A;  2M29 A;  3JTD B;  1K2H A;  2EC6 B;  2MJW B;  4I5K A;  1DEK A;  3EK7 A;  3DY9 A;  3S0B A;  1QS7 A;  2LCP A;  3BUX B;  3JTD C;  3PAT A;  2EC6 C;  1YRT B;  2K2F A;  1LA0 A;  1DGU A;  3D0Y A;  3PFV A;  4N1F A;  4PE4 A;  3SG5 A;  5I2Q A;  1UUR A;  1XA5 A;  3EKJ A;  4M2O A;  1MHO A;  4HRG A;  4NDB A;  2Q91 A;  2KDH A;  2GGM A;  4PE1 A;  1CB1 A;  2MAZ A;  4OZD A;  3PJI A;  2F2P A;  1UWO A;  3WXA A;  2WCF A;  5FI6 A;  3BFH A;  1BR1 B;  5IBW A;  1AK8 A;  3WNX B;  3SG2 A;  1B9A A;  4OR9 B;  1QTX A;  1Y6W A;  4A4C A;  2KFH A;  2P6B B;  4PHJ A;  3I5H B;  1NX0 A;  4ICB A;  3K1E A;  3BYA A;  2M9G A;  2K2A A;  2KGR A;  2WOR A;  2JU0 A;  3R1P A;  4GNK B;  2WC6 A;  4YGB B;  1TIZ A;  3I5H C;  3O4X A;  4MRY A;  2I7A A;  3EVV A;  1KK8 B;  3PSR A;  4AQJ A;  3DVJ A;  1YUR A;  2GGZ A;  2LP3 A;  5D69 A;  1TCF A;  4ZCU A;  3DF0 A;  5AEQ A;  4XJK B;  1ODB A;  1OOI X;  1VRK A;  1Z2C B;  2ERB A;  2JPO A;  1UHK A;  1A75 A;  3B88 A;  3CTN A;  3NSI A;  1KK8 C;  3GK2 A;  1GJY A;  3JVT B;  2WCB A;  1QVI Y;  5ER5 A;  1WDC B;  1G33 A;  1Z4H A;  1WLZ A;  2MRD A;  1AJ4 A;  1UHI A;  1NPQ A;  5AAN A;  3JVT C;  4DCK A;  3AAK A;  4OKH A;  1PRW A;  1WDC C;  4M2P A;  5DKQ A;  1BOD A;  1SCV A;  1CM1 A;  1JFK A;  1ORG A;  2PVB A;  2JPT A;  4MBE A;  2WCM A;  4QJ5 B;  3C1V A;  4ETO A;  1B1G A;  1WRZ A;  1TRF A;  3NSK A;  4GGF A;  2LAN A;  3PLF B;  1H4B A;  3TDI A;  2MLF C;  2Y5I A;  3QRX A;  5JJG A;  3KPX A;  1JWD A;  2BBN A;  2PSR A;  2K7B A;  3K21 A;  3UNW A;  1XFY O;  5D7F A;  1K8U A;  3BJH A;  3LK1 A;  4YI9 A;  2KI6 C;  3R1V A;  3L47 A;  1GQM A;  4L9M A;  1CLL A;  1QIV A;  2L2E A;  3TUY B;  3OBV A;  2WND A;  4DRW A;  5HLV A;  3B86 A;  3EKH A;  2BE4 A;  1PVA A;  4OCI A;  3N7H A;  1DJX A;  3TUY C;  3HCM A;  1F4Q A;  1OQP A;  1SRA A;  5FI7 A;  3CYZ A;  4KYN A;  1H8B A;  1NX1 A;  5CPV A;  1Y1A A;  5CSJ A;  1TN4 A;  3BUO B;  1BR4 B;  1DMO A;  2WC8 A;  3OB1 B;  1SCM B;  4PHN A;  2BAP A;  4INW A;  1BMO A;  3PN7 B;  4CFR A;  1CDP A;  1G4Y R;  1PAL A;  2ZN9 A;  1SCM C;  2PAL A;  2K0J A;  5CSI A;  4MVF A;  2PQL A;  3PN7 C;  3ZWH A;  1XFR A;  2LVI A;  1A75 B;  2F2O A;  3SIB A;  3BOW A;  2EGD A;  1JF2 A;  3NXA A;  2KOT A;  1KK7 Y;  1MWN A;  5I94 A;  3CR2 A;  2K7C A;  5ER4 X;  5K89 A;  2JOJ A;  1F71 A;  3EVU A;  1A29 A;  1FF1 A;  2BKH B;  4YBH B;  4MSP A;  1D1O A;  1SKT A;  1BJF A;  1TNX A;  2G9B A;  2L98 A;  2L2C A;  2PMY A;  1K96 A;  1ZAC A;  1MXE A;  1CFD A;  1QAT A;  1KFX S;  3TDU A;  2L51 A;  4PE0 A;  3CR5 X;  3L4L A;  1J7R A;  3FS7 A;  3DYE A;  2M8U A;  4C0J A;  4WQ3 A;  5HKZ A;  1JSA A;  2BBM A;  2I2R E;  1L2O B;  1NSH A;  4GBA A;  1W7J B;  3CDN A;  4GGF C;  1CLB A;  4MLW A;  1S6C A;  3S0D A;  1GGW A;  4USL A;  1RTP 1;  1YRU B;  2F3Z A;  3I5F B;  1SL8 A;  1L2O C;  4GPL B;  1XFW O;  2L5Y A;  1A4P A;  3AAJ A;  4AQI A;  2LLT A;  3VRQ A;  2ZRS A;  2NCO A;  3I5F C;  3I5I B;  4U8D A;  2JZI A;  1C07 A;  2L4H A;  1S1E A;  1WRK A;  2LUX A;  2I18 A;  3TDZ A;  1OW4 A;  1OMV A;  1NUB A;  3BFA A;  1BU3 A;  3BQ3 A;  2HQW A;  3O78 A;  1FBV A;  1EG3 A;  5AXI A;  4JD9 A;  3FIA A;  3SS5 A;  2PYQ A;  1XFZ O;  1B7T Y;  3GK1 A;  4HSZ A;  1C7W A;  4FTG A;  1SR6 B;  2Y4Q A;  2JNX A;  3MSE B;  1N65 A;  4C0K A;  2LVJ A;  3CS1 A;  1SR6 C;  2JUL A;  5I2O A;  2ZND A;  3F45 A;  3BOW B;  1B8R A;  1QV0 A;  3M0W A;  1IQ5 A;  1XFX O;  2AUC A;  2L50 A;  3AKB A;  4R1E A;  1M45 A;  4BY4 A;  1OMR A;  1TTX A;  2HET A;  2IS9 A;  1DQE A;  1BT6 A;  2LM5 A;  2KAV A;  1XVJ A;  3SIA A;  4YGE B;  3CAB A;  3I5G B;  4ORA B;  3CZ1 A;  3B6X A;  3ZNI A;  1PSR A;  1F55 A;  2CT9 A;  1NP8 A;  1SL7 A;  2KLE A;  2LV7 A;  3BXK A;  1SK6 D;  3I5G C;  1EXR A;  3IQQ A;  3NHT A;  1YUS A;  2JWW A;  1MQ1 A;  1S5G Z;  1UHN A;  5GQQ C;  3S0G A;  2BEC A;  1CFC A;  1JFJ A;  2H2K A;  5D3O A;  4PT1 A;  1S6I A;  5BPJ A;  1WY9 A;  1TWO A;  2L4I A;  1S6J A;  2JXL A;  1LVC D;  1F8H A;  1IJ5 A;  2GV5 A;  3VRN A;  4JWQ A;  2F3Y A;  1QLK A;  2HF5 A;  2JC2 A;  1EG4 A;  2K8M B;  2ISD A;  1BF5 A;  2PAS A;  4BY5 A;  3CZT X;  5PAL A;  2JRF A;  4NDD A;  5DIC A;  1CFP A;  1SPY A;  1DGV A;  1IH0 A;  1S26 D;  1K90 D;  2BE6 A;  1LIN A;  2LAP A;  1DJZ A;  1XFU O;  5DKN A;  3BUN B;  1IG5 A;  3NGV A;  2KSP A;  1UUS A;  4ORB B;  3CGA A;  1CDN A;  1KSM A;  1DJH A;  5AFP A;  1QX2 A;  2F33 A;  3ICB A;  1Y1X A;  1OOH A;  3D0Y B;  1GGZ A;  3D74 A;  3UO9 A;  2G2B A;  4YGA A;  2LVK A;  1ALV A;  1OE9 B;  4CID A;  2LUC A;  3SG6 A;  3RLZ A;  1KFU S;  2CXJ A;  1NCZ A;  2NCP A;  2LLU A;  3DD4 A;  1B8L A;  2AAO A;  4QJ4 B;  2M7L A;  3PAL A;  2QEV A;  5I8N A;  2KGB C;  1OSA A;  3OGN A;  3IQO A;  1OOJ A;  1XK4 A;  2HPS A;  3LLE A;  1ALW A;  1A2X A;  2BNX A;  4OV2 A;  1TOP A;  1U5I A;  1WLM A;  3S0F A;  4DS7 A;  2K61 A;  3LK0 A;  4OVN F;  2MHH A;  2GTE A;  2WCE A;  2B1U A;  2QEO A;  2K7O A;  3FE8 A;  1SW8 A;  2KI6 D;  2M3W A;  1EJ3 A;  1TUZ A;  3CWG A;  1JF0 A;  5CSF A;  1BG1 A;  1J1E A;  4PHM A;  4QJ3 B;  2EHB A;  1SYM A;  5DKR A;  3O6B A;  2Y1M A;  3SS3 A;  1IQ3 A;  1KCY A;  2CNP A;  2WC5 A;  3DF0 B;  1LXF C;  2JT0 A;  2VRG A;  3NSO A;  1YR5 A;  1DF0 A;  2LHL A;  1AHR A;  1B8C A;  2F8P A;  2LMV A;  3VRP A;  1J7P A;  2M1K B;  2MLE C;  1QLS A;  2LP2 A;  3B7A A;  2OS8 B;  4NDC A;  2KFF A;  3DZT A;  4YRU A;  1OOF A;  1DJY A;  1T14 A;  1K9P A;  3OP0 A;  2OS8 C;  3EK8 A;  1MR8 A;  4WQ2 A;  1BLQ A;  4JQ0 D;  1SMG A;  3WHU B;  1IWQ A;  1DEL A;  2CBL A;  2TN4 A;  3GOF A;  1K93 D;  5HKW A;  2YGU A;  2KAX A;  1B47 A;  4PE7 A;  1N0Y A;  2ZKM X;  1LKJ A;  1FI5 A;  1QX5 B;  4ORC B;  4IL1 A;  1E8A A;  3S0A A;  2BL0 B;  3OHM B;  2ZN8 A;  3BUW B;  3D73 A;  5EL2 A;  3S0E A;  4I5J A;  3BUM B;  1PVB A;  1J7O A;  2PRU A;  5B8I B;  2JQ6 A;  1TNP A;  2BL0 C;  2H8V A;  3KHE A;  1W7I B;  1CM4 A;  2CTN A;  2D8N A;  2E6W A;  2L5X B;  2Q4U A;  2Y1N A;  1SNL A;  3NSL A;  1F70 A;  1NX2 A;  2A4J A;  1LS8 A;  1YX8 A;  2LE9 B;  2K60 A;  2QDI A;  4N1G A;  3IF7 A;  1U5I B;  1IGV A;  2LMT A;  3Q8I A;  1KFX L;  3IVT A;  1XK4 C;  2QEH A;  2KQ6 A;  2KI4 B;  2FJY A;  1F54 A;  1Q80 A;  4MZL A;  1B4C A;  4FQT A;  1ZOT B;  2KLD A;  1XFV O;  3CR4 X;  1AJ5 A;  4ZCV A;  3DXL A;  2KI4 C;  1X02 A;  2JNF A;  4PAL A;  4CPV A;  2M1U A;  1V1G A;  1YVL A;  2M0R A;  4PDZ A;  3H4S E;  2MBX A;  3SG7 A;  5KSZ A;  1C3Y A;  1DF0 B;  5HKY A;  1R2U A;  2KQY A;  3CZ2 A;  3R1O A;  2MA2 A;  4YGD B;  3TS5 B;  1SBJ A;  1M31 A;  2KFG A;  2SAS A;  5KTY A;  4MRX A;  2K7D A;  4AOM A;  3SG3 A;  3LL8 B;  2NXQ A;  1UHH A;  3FWC A;  4P5O E;  1PUL A;  4XYN A;  2O60 A;  3TS5 C;  5HL1 A;  4INX A;  4CFQ A;  5FI2 A;  1QX7 A;  3AKA A;  2ZRT A;  3GK4 X;  4C0L A;  4D1E A;  1ZFS A;  1A03 A;  1OZO A;  4DIR A;  1OMD A;  1W9Z A;  3DVM A;  1IIO A;  1RFJ A;  2JXC A; 
#chains in the Genus database with same CATH homology
 3O2P A;  2BCX A;  5FYX A;  4P2Y B;  4MZK A;  1BOC A;  1YX7 A;  4MN0 A;  1RJV A;  1MF8 B;  1DJI A;  1F4O A;  4PHK A;  1K9U A;  1NWD A;  1K94 A;  3A4U B;  1M46 A;  1NIW A;  1CKK A;  2H61 A;  2QAC A;  3KF9 A;  4HRH A;  2DOQ A;  2M7N A;  4Q04 A;  1S5G Y;  1TNQ A;  2FCE A;  1XYD A;  4HRE E;  4DUQ A;  1YTZ C;  3PM8 A;  4YGC B;  1QVI Z;  1V1F A;  3RM1 A;  1RK9 A;  5KU1 A;  2R2I A;  2LLS A;  1QV1 A;  4I5L B;  5F6T A;  4F0Z B;  1RRO A;  2FCD A;  5AER A;  3EK4 A;  4E68 A;  2NZ0 A;  1DJG A;  1KQM B;  1CFF A;  1HQV A;  2AMI A;  2FJU B;  1ZUZ A;  3DVE A;  2I94 A;  1OZS A;  2E30 A;  2L0P A;  1KWO B;  5CSN A;  1QIW A;  1KQM C;  1J55 A;  1K95 A;  1EH2 A;  1KWO C;  2OPO A;  4GFT A;  2LMU A;  1CMG A;  2COL B;  3CLN A;  1IRJ A;  1CTR A;  5I2L A;  5TNC A;  1DT7 B;  2WOS A;  3E3R A;  3WHT B;  3OB2 B;  4YI8 A;  3D10 A;  3SJS A;  1K9K A;  1L7Z A;  1PSB A;  1HT9 A;  4GUK A;  5JOL A;  3SG4 A;  4NQG A;  2RGI A;  5HLO A;  1M63 B;  2OTG B;  1FI6 A;  2NLN A;  1XO5 A;  1R6P A;  1ZMZ A;  2BKI B;  1FW4 A;  4FQO A;  2LC5 A;  3FWB A;  2OTG C;  1NYA A;  1CDM A;  1KFU L;  1S36 A;  2ZFD A;  5HYD A;  1CLM A;  4UPG A;  1NX3 A;  1WRL A;  2M97 A;  1Y0V H;  4A4B A;  3HX4 A;  1YUT A;  2KAY A;  1AUI B;  1JUO A;  4N5X A;  3VGO A;  2H61 C;  4CLN A;  1J1D A;  1C7V A;  1AP4 A;  1QAS A;  1SL9 A;  2BCB A;  4GGN A;  1M39 A;  3KEV A;  1NCY A;  2HQ8 A;  2V53 A;  2O5G A;  1DVI A;  1KK7 Z;  1Y1U A;  2KHN A;  5G08 A;  2LNK A;  1UP5 A;  1JC2 A;  2JTZ A;  1QXP A;  1IKU A;  1G8I A;  1SY9 A;  2SCP A;  1MUX A;  3KO0 A;  2CCM A;  4JPZ B;  1EL4 A;  1REC A;  3OX6 A;  5J3X A;  2LVV A;  1FPW A;  1UHJ A;  1TNW A;  2KBI A;  3EVR A;  3DVK A;  1LA3 A;  4WRI A;  1S3P A;  1AVS A;  1DTL A;  1KQV A;  1CMF A;  1RWY A;  2JT3 A;  1DJW A;  4MZJ A;  1JBA A;  2ZNE A;  2KYC A;  2FOT A;  2JT8 A;  2LHI A;  3OX5 A;  2KNE A;  4XJK A;  3LCP C;  2BCA A;  1IJ6 A;  3VRO A;  1CNP A;  1N2D A;  2M49 B;  1YUU A;  4GAO A;  1J7Q A;  1KSO A;  4MEW A;  4TNC A;  1TCO B;  1PK0 D;  3VRR A;  1B7T Z;  3A8R A;  4PCW A;  4M2Q A;  3TZ1 A;  4I5N B;  3I5I C;  1CDL A;  3O4Y A;  1NCX A;  2JTT A;  1YVH A;  2KBM A;  1MXL C;  2QPT A;  1QJT A;  2KYF A;  2M29 A;  3JTD B;  1K2H A;  2EC6 B;  2MJW B;  4I5K A;  3EK7 A;  1QS7 A;  2LCP A;  3BUX B;  3JTD C;  3PAT A;  2EC6 C;  1YRT B;  2K2F A;  1LA0 A;  1DGU A;  3D0Y A;  3PFV A;  4N1F A;  4PE4 A;  3SG5 A;  5I2Q A;  1UUR A;  1XA5 A;  3EKJ A;  4M2O A;  1MHO A;  4HRG A;  4NDB A;  2Q91 A;  2KDH A;  2GGM A;  4PE1 A;  1CB1 A;  2MAZ A;  2F2P A;  1UWO A;  3WXA A;  2WCF A;  1BR1 B;  5IBW A;  1AK8 A;  3WNX B;  3SG2 A;  1B9A A;  4OR9 B;  1QTX A;  1Y6W A;  4A4C A;  2KFH A;  2P6B B;  4PHJ A;  3I5H B;  1NX0 A;  4ICB A;  3BYA A;  2M9G A;  2K2A A;  2KGR A;  2WOR A;  2JU0 A;  4GNK B;  4YGB B;  1TIZ A;  3I5H C;  4MRY A;  2I7A A;  3EVV A;  1KK8 B;  3PSR A;  4AQJ A;  3DVJ A;  1YUR A;  2GGZ A;  2LP3 A;  5D69 A;  1TCF A;  4ZCU A;  3DF0 A;  5AEQ A;  4XJK B;  1ODB A;  1VRK A;  3CTN A;  3NSI A;  1UHK A;  1A75 A;  1KK8 C;  3GK2 A;  1GJY A;  3JVT B;  2WCB A;  1QVI Y;  5ER5 A;  1WDC B;  1G33 A;  1WLZ A;  2MRD A;  1AJ4 A;  1UHI A;  1NPQ A;  5AAN A;  3JVT C;  4DCK A;  3AAK A;  4OKH A;  1PRW A;  1WDC C;  4M2P A;  5DKQ A;  1BOD A;  1SCV A;  1CM1 A;  1JFK A;  2PVB A;  2JPT A;  4MBE A;  4QJ5 B;  3C1V A;  4ETO A;  1B1G A;  1WRZ A;  1TRF A;  3NSK A;  4GGF A;  2LAN A;  3PLF B;  1H4B A;  3TDI A;  2MLF C;  2Y5I A;  3QRX A;  5JJG A;  3KPX A;  1JWD A;  2BBN A;  2PSR A;  2K7B A;  3K21 A;  1XFY O;  5D7F A;  1K8U A;  3LK1 A;  4YI9 A;  2KI6 C;  1GQM A;  4L9M A;  1CLL A;  1QIV A;  2L2E A;  3TUY B;  2WND A;  4DRW A;  5HLV A;  3EKH A;  2BE4 A;  1PVA A;  4OCI A;  1DJX A;  3TUY C;  3HCM A;  1F4Q A;  1OQP A;  1SRA A;  1H8B A;  1NX1 A;  5CPV A;  1Y1A A;  5CSJ A;  1TN4 A;  3BUO B;  1BR4 B;  1DMO A;  2WC8 A;  3OB1 B;  1SCM B;  4PHN A;  1BMO A;  3PN7 B;  4CFR A;  1CDP A;  1G4Y R;  1PAL A;  2ZN9 A;  1SCM C;  2PAL A;  2K0J A;  5CSI A;  4MVF A;  3PN7 C;  3ZWH A;  2LVI A;  1A75 B;  2F2O A;  3SIB A;  3BOW A;  2EGD A;  1JF2 A;  3NXA A;  2KOT A;  1KK7 Y;  1MWN A;  1F71 A;  3CR2 A;  2K7C A;  5ER4 X;  5K89 A;  2JOJ A;  3EVU A;  1A29 A;  1FF1 A;  2BKH B;  4YBH B;  4MSP A;  1D1O A;  1SKT A;  1BJF A;  1TNX A;  2G9B A;  2L98 A;  2PMY A;  1K96 A;  1ZAC A;  1MXE A;  1CFD A;  1QAT A;  1KFX S;  3TDU A;  2L51 A;  4PE0 A;  3CR5 X;  1J7R A;  3FS7 A;  2M8U A;  4C0J A;  4WQ3 A;  5HKZ A;  1JSA A;  2BBM A;  2I2R E;  1L2O B;  1NSH A;  4GBA A;  1W7J B;  4GGF C;  1CLB A;  4MLW A;  1S6C A;  1GGW A;  4USL A;  1RTP 1;  1YRU B;  2F3Z A;  3I5F B;  1SL8 A;  1L2O C;  4GPL B;  1XFW O;  3AAJ A;  1A4P A;  4AQI A;  2LLT A;  3VRQ A;  2ZRS A;  2NCO A;  3I5F C;  3I5I B;  4U8D A;  2JZI A;  1C07 A;  2L4H A;  1S1E A;  1WRK A;  2LUX A;  2I18 A;  3TDZ A;  1OMV A;  1NUB A;  1BU3 A;  3BQ3 A;  2HQW A;  3O78 A;  1FBV A;  1EG3 A;  5AXI A;  3FIA A;  1XFZ O;  1B7T Y;  3GK1 A;  4HSZ A;  1C7W A;  4FTG A;  1SR6 B;  2Y4Q A;  2JNX A;  3MSE B;  1N65 A;  4C0K A;  2LVJ A;  3CS1 A;  1SR6 C;  2JUL A;  5I2O A;  2ZND A;  3F45 A;  3BOW B;  1B8R A;  1QV0 A;  3M0W A;  1IQ5 A;  1XFX O;  2AUC A;  2L50 A;  3AKB A;  4R1E A;  1M45 A;  4BY4 A;  1OMR A;  1TTX A;  2HET A;  2IS9 A;  2LM5 A;  1BT6 A;  2KAV A;  1XVJ A;  3SIA A;  4YGE B;  3I5G B;  4ORA B;  3ZNI A;  1PSR A;  1F55 A;  2CT9 A;  1NP8 A;  1SL7 A;  2LV7 A;  3BXK A;  1SK6 D;  3I5G C;  1EXR A;  3IQQ A;  1YUS A;  2JWW A;  1MQ1 A;  1S5G Z;  1UHN A;  5GQQ C;  2BEC A;  1CFC A;  1JFJ A;  2H2K A;  1S6I A;  5BPJ A;  1WY9 A;  2L4I A;  1S6J A;  2JXL A;  1LVC D;  1F8H A;  1IJ5 A;  2GV5 A;  3VRN A;  4JWQ A;  2F3Y A;  1QLK A;  2HF5 A;  2JC2 A;  1EG4 A;  2K8M B;  2ISD A;  1BF5 A;  2PAS A;  4BY5 A;  3CZT X;  5PAL A;  2JRF A;  4NDD A;  1CFP A;  1SPY A;  1DGV A;  1IH0 A;  1S26 D;  1K90 D;  2BE6 A;  1LIN A;  2LAP A;  1DJZ A;  1XFU O;  5DKN A;  3BUN B;  1IG5 A;  2KSP A;  1UUS A;  4ORB B;  3CGA A;  1CDN A;  1KSM A;  1DJH A;  5AFP A;  1QX2 A;  2F33 A;  3ICB A;  1Y1X A;  3D0Y B;  1GGZ A;  2G2B A;  4YGA A;  2LVK A;  1ALV A;  1OE9 B;  4CID A;  2LUC A;  3SG6 A;  3RLZ A;  1KFU S;  2CXJ A;  1NCZ A;  2NCP A;  2LLU A;  3DD4 A;  1B8L A;  2AAO A;  4QJ4 B;  2M7L A;  3PAL A;  5I8N A;  2KGB C;  1OSA A;  3IQO A;  1OOJ A;  1XK4 A;  2HPS A;  3LLE A;  1ALW A;  1A2X A;  4OV2 A;  1TOP A;  1U5I A;  1WLM A;  4DS7 A;  2K61 A;  3LK0 A;  4OVN F;  2MHH A;  2WCE A;  2B1U A;  2K7O A;  1SW8 A;  2KI6 D;  2M3W A;  1EJ3 A;  3CWG A;  5CSF A;  1JF0 A;  1BG1 A;  1J1E A;  4PHM A;  4QJ3 B;  2EHB A;  1SYM A;  5DKR A;  3O6B A;  2Y1M A;  1IQ3 A;  1KCY A;  2CNP A;  3DF0 B;  1LXF C;  2JT0 A;  2VRG A;  3NSO A;  1YR5 A;  1DF0 A;  2LHL A;  1AHR A;  1B8C A;  2F8P A;  2LMV A;  3VRP A;  1J7P A;  2M1K B;  2MLE C;  1QLS A;  2LP2 A;  2OS8 B;  4NDC A;  2KFF A;  4YRU A;  1DJY A;  1K9P A;  3OP0 A;  2OS8 C;  3EK8 A;  1MR8 A;  4WQ2 A;  1BLQ A;  4JQ0 D;  1SMG A;  3WHU B;  1IWQ A;  2TN4 A;  2CBL A;  3GOF A;  5HKW A;  1K93 D;  2KAX A;  1B47 A;  4PE7 A;  1N0Y A;  2ZKM X;  1LKJ A;  1FI5 A;  1QX5 B;  4ORC B;  4IL1 A;  1E8A A;  2BL0 B;  3OHM B;  2ZN8 A;  3BUW B;  4I5J A;  3BUM B;  1PVB A;  1J7O A;  2PRU A;  5B8I B;  2JQ6 A;  1TNP A;  2BL0 C;  3KHE A;  1W7I B;  1CM4 A;  2CTN A;  2D8N A;  2E6W A;  2L5X B;  2Q4U A;  2Y1N A;  1SNL A;  3NSL A;  1F70 A;  1NX2 A;  2A4J A;  1YX8 A;  2LE9 B;  4N1G A;  3IF7 A;  1U5I B;  1IGV A;  2LMT A;  1KFX L;  1XK4 C;  2KQ6 A;  2KI4 B;  1F54 A;  1Q80 A;  4MZL A;  1B4C A;  1ZOT B;  1XFV O;  3CR4 X;  1AJ5 A;  4ZCV A;  2KI4 C;  1X02 A;  2JNF A;  4PAL A;  4CPV A;  2M1U A;  1V1G A;  1YVL A;  2M0R A;  4PDZ A;  3H4S E;  2MBX A;  3SG7 A;  5KSZ A;  1DF0 B;  5HKY A;  1R2U A;  2KQY A;  2MA2 A;  4YGD B;  3TS5 B;  1SBJ A;  1M31 A;  2KFG A;  2SAS A;  5KTY A;  4MRX A;  2K7D A;  4AOM A;  3SG3 A;  3LL8 B;  2NXQ A;  1UHH A;  3FWC A;  4P5O E;  1PUL A;  4XYN A;  2O60 A;  3TS5 C;  4CFQ A;  1QX7 A;  3AKA A;  2ZRT A;  3GK4 X;  4C0L A;  4D1E A;  1ZFS A;  1A03 A;  1OZO A;  4DIR A;  1OMD A;  3DVM A;  1RFJ A;  2JXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...