1SPYA

Regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Muscle protein
molecule keywords TROPONIN C
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1spyA00
3M0WA 4GGFC 3FWBA 1CFDA 1K2HA 1F4QA 1J7PA 1Y1AA 1SCVA 4GAOA 1TNXA 1BU3A 1BT6A 1U5IA 4ZCVA 1YUTA 1LVCD 1XFYO 1OMDA 1AK8A 1KFUL 1SY9A 1KFXL 1K8UA 1DVIA 2KNEA 2JT8A 2LVJA 1A4PA 2BCAA 3FS7A 1J7RA 4I5NB 2H61C 2Q4UA 1F8HA 1LXFC 3SIBA 2PVBA 1B8RA 1SCMB 2HF5A 3O4YA 3QRXA 4YGBB 2KGRA 2OPOA 3AKAA 4YBHB 1EL4A 2K7BA 1TOPA 2JULA 2PALA 1QJTA 1K94A 1KK8C 4PE4A 2M29A 1SYMA 2HQ8A 2KYFA 4PE1A 1PK0D 2CT9A 2ISDA 1UP5A 1YVLA 4WQ2A 1RTP1 3KF9A 3D0YA 5HYDA 4OCIA 1AJ5A 1JF2A 1XFZO 1YUUA 4UPGA 1SNLA 4NQGA 2V53A 2GGZA 2BE6A 4PE7A 1B8LA 1Q80A 2I94A 1BG1A 1S6CA 1XO5A 4PHJA 1PRWA 1TCFA 2O5GA 2MA2A 3EKJA 1V1GA 2P6BB 1UHNA 4I5KA 1WRZA 3CTNA 1CMGA 2LC5A 4N1FA 4XJKB 1WLMA 4U8DA 1M46A 3O2PA 2LMUA 1CB1A 1SRAA 1DJZA 1WRLA 2FJUB 1QX7A 3AKBA 3FWCA 4QJ5B 1KWOB 2M7LA 1KWOC 3DF0B 1TRFA 1IQ5A 2F33A 2MAZA 1XYDA 3BUMB 2E30A 2JNFA 2QACA 3LK0A 1F70A 4A4CA 2HQWA 4WRIA 2NZ0A 3CR4X 2L4HA 2LMTA 3MSEB 1FBVA 3PN7C 4JPZB 1JFJA 2ZNEA 1AP4A 1DJGA 1SR6C 5I2LA 2B1UA 2F8PA 3EVVA 1DMOA 4E68A 3NSIA 4CIDA 4OV2A 1F71A 2TN4A 1BF5A 1YURA 5D69A 2LLSA 1CDMA 4PE0A 2PSRA 2F2PA 1HQVA 2LP2A 4YI9A 1NP8A 3GOFA 4C0LA 1KSMA 1K9PA 1TTXA 2G2BA 1OSAA 3LL8B 4M2PA 1UHHA 2KFGA 2L98A 1A75B 1DT7B 2M8UA 1E8AA 5G08A 1AVSA 1GQMA 2JT3A 2L4IA 2EC6B 3PATA 3VROA 2EC6C 1B1GA 1R6PA 2FCEA 1BJFA 2EHBA 1B47A 1PULA 5DKQA 2CTNA 3ZWHA 1CFFA 1CNPA 2NLNA 2JTTA 1CM1A 2WCEA 3A8RA 5AEQA 1TN4A 1H8BA 1SW8A 1DJWA 1MWNA 1QASA 2K7CA 5AFPA 1JFKA 2JWWA 1CLMA 1S36A 5ER4X 5HKZA 1LINA 2PASA 1B9AA 2BKIB 1KFXS 2MBXA 5KTYA 3EK8A 1OE9B 1JC2A 5B8IB 1Y1XA 2LCPA 4WQ3A 1KQVA 1C7WA 1EG4A 1H4BA 1AUIB 2BCXA 1SL7A 2OS8C 1L7ZA 4C0JA 3TUYC 3BUWB 1NCXA 1XK4A 1ZUZA 4M2QA 4MRYA 1Y1UA 1OQPA 4TNCA 2KSPA 2IS9A 2WCBA 2Q91A 1A75A 3GK1A 1HT9A 1UWOA 1IG5A 4N5XA 1N2DA 3E3RA 1J1EA 3CLNA 3ICBA 2WNDA 1K90D 1J7QA 1Y0VH 2PMYA 4MVFA 4GGNA 3D10A 1RROA 4AOMA 1SMGA 4PHKA 1K93D 1DJIA 2LP3A 3GK4X 1QVIY 3VRRA 4FTGA 2LANA 4C0KA 2L2EA 4P5OE 2GV5A 2L50A 2VRGA 2KAXA 4DUQA 1WLZA 1UUSA 1YX7A 2LHLA 3TS5B 2HPSA 1F54A 1IGVA 1W7IB 2MRDA 3IQOA 4HSZA 3A4UB 4BY5A 1XVJA 3RLZA 1XFVO 4PALA 2QPTA 1MXEA 1QV1A 5ER5A 3TZ1A 3JTDC 4DRWA 4QJ3B 2BL0C 1SL8A 2SASA 1PSBA 1XK4C 1NX2A 1B8CA 1OMVA 1IQ3A 5I2OA 2KDHA 4HREE 2ZFDA 1QVIZ 2KI6C 4I5JA 2KI4B 5CPVA 2JRFA 1J55A 4MLWA 3KHEA 3OX5A 2KQYA 3OP0A 5CSNA 4MSPA 1QIWA 1QX5B 1KSOA 4AQJA 3LK1A 3OHMB 2F3YA 3SIAA 3TDUA 3PALA 4CPVA 2NCPA 2H2KA 1IKUA 3RM1A 5AERA 1BODA 2KFHA 1TIZA 4QJ4B 2R2IA 1YRUB 4OKHA 2DOQA 2JXLA 1S6IA 4YRUA 1RK9A 4CFQA 3BYAA 2ZRSA 1V1FA 3I5GB 1XFUO 5F6TA 1RECA 2LV7A 1J1DA 1UHJA 3OX6A 2D8NA 1M31A 1S6JA 1K96A 1S1EA 1TCOB 4YGDB 2L5XB 1MQ1A 4Q04A 3EK7A 2ZN9A 1YUSA 1M45A 2O60A 3DVEA 1NSHA 2MLEC 2CXJA 4DCKA 1FF1A 2I2RE 4NDCA 4DIRA 3O6BA 2PRUA 1YTZC 3FIAA 2KYCA 2SCPA 2JC2A 4PCWA 2KBIA 1ALWA 2MJWB 1MUXA 2H61A 3TS5C 3KEVA 1M63B 3VRQA 4N1GA 2LVIA 1NX1A 3TDZA 4ZCUA 1CTRA 2AAOA 1MR8A 1B7TY 2ZRTA 1W7JB 5HKWA 4A4BA 3CR5X 4PHNA 2LNKA 3NSLA 3CGAA 3CS1A 1BMOA 2BCBA 2BKHB 2BL0B 2WOSA 3ZNIA 2K7DA 3AAKA 3OB1B 2M49B 2KGBC 2M7NA 3I5IB 4IL1A 1ODBA 3PN7B 2M0RA 1QV0A 1VRKA 2LMVA 3CR2A 1DJHA 3PFVA 4MN0A 1EG3A 4JQ0D 1KQMB 2NXQA 3EVUA 1N65A 5I8NA 3PM8A 2MHHA 2LM5A 4F0ZB 3SG7A 1X02A 1LKJA 1NX0A 1JUOA 5CSJA 3SJSA 1C07A 2JTZA 2K61A 3BXKA 1S5GZ 1CFCA 2OTGC 5TNCA 1L2OB 1NCYA 3PLFB 5CSFA 1BOCA 1MF8B 3I5GC 1S3PA 1SPYA 2M9GA 4ICBA 4OVNF 3BOWB 1ZOTB 2FCDA 3DF0A 1IWQA 1PVAA 2JNXA 1CLLA 2I7AA 3I5HC 1YR5A 1RJVA 2KI4C 4ETOA 1ALVA 2M97A 3I5HB 1KK7Z 2JQ6A 1YVHA 1DGUA 2K2AA 1OMRA 2AUCA 1BR4B 1K9KA 1JF0A 2JOJA 1UHIA 1SBJA 2KQ6A 3OB2B 2RGIA 1QX2A 4BY4A 4MEWA 1SCMC 3O78A 4HRHA 1EXRA 2KHNA 1KCYA 1GJYA 1CKKA 4ORCB 1OOJA 2FOTA 5IBWA 4FQOA 2I18A 3WHTB 1QXPA 2BBMA 3PSRA 5JOLA 4GBAA 1DJYA 2JPTA 2JZIA 2KOTA 3DVJA 5D7FA 1CM4A 1C7VA 1QS7A 5JJGA 1F55A 2LAPA 1K95A 1DJXA 2K0JA 3D0YB 1S26D 1EH2A 1XA5A 1CDPA 1CDNA 1NPQA 2K2FA 4GNKB 1YRTB 2M1KB 3EK4A 3DVKA 1WRKA 5HLOA 3VRPA 2JU0A 4CFRA 4YGAA 1QATA 1TNQA 1XFWO 2M3WA 1IJ6A 4PDZA 1DF0A 1YX8A 3HX4A 1AJ4A 1UURA 2WC8A 3NSOA 3CWGA 1WDCB 1KK7Y 1WDCC 4YGEB 3TUYB 4ORBB 3DVMA 1GGWA 1XFXO 1R2UA 3JVTB 1KFUS 1IJ5A 4MZKA 1NCZA 3WNXB 2F3ZA 3WHUB 3BQ3A 4P2YB 3SG6A 3IQQA 1PVBA 1A29A 1OZSA 4GUKA 5KU1A 3HCMA 1FW4A 4GGFA 3TDIA 5HKYA 5FYXA 3I5IC 4XYNA 3JTDB 3BUNB 1BLQA 2A4JA 5I2QA 2LUXA 1JBAA 2KBMA 1FPWA 2LLUA 2AMIA 2E6WA 2JT0A 3BUOB 2BECA 2L51A 2KAVA 5AXIA 1KQMC 1DF0B 3DD4A 4I5LB 1JWDA 1UHKA 1F4OA 5DKRA 1FI6A 4MBEA 3KPXA 1Y6WA 1QTXA 5HLVA 1FI5A 1GGZA 1A2XA 4HRGA 1J7OA 2LLTA 4CLNA 4USLA 1IRJA 1KK8B 2ZN8A 4R1EA 3SG2A 1K9UA 1CMFA 1SKTA 1L2OC 1PSRA 2OTGB 1RWYA 1U5IB 1G8IA 2LE9B 2OS8B 2Y4QA 2KFFA 1MXLC 4PHMA 1G4YR 2L0PA 1NYAA 3NSKA 3VRNA 4YGCB 1NWDA 1M39A 4YI8A 5BPJA 1NUBA 1LA0A 3VGOA 3F45A 1ZMZA 2MLFC 1QIVA 2NCOA 4GFTA 5CSIA 2Y1MA 3WXAA 2G9BA 3KO0A 1PALA 4D1EA 3EKHA 2KI6D 1N0YA 1OZOA 1WY9A 1AHRA 2LVVA 1TNWA 4JWQA 3H4SE 1B4CA 1SL9A 3C1VA 4NDBA 1CFPA 3EVRA 2K8MB 3IF7A 1ZFSA 2F2OA 3CZTX 1LA3A 4DS7A 3SG4A 3BOWA 3SG3A 5KSZA 1TNPA 3BUXB 1CDLA 1A03A 3GK2A 1QLSA 2EGDA 2LHIA 4AQIA 1NX3A 2K7OA 2M1UA 2LVKA 4L9MA 4MRXA 3LCPC 2CBLA 1IH0A 4GPLB 1QLKA 4NDDA 2Y5IA 3SG5A 2COLB 2CNPA 1CLBA 1G33A 3LLEA 1D1OA 1S5GY 4XJKA 1BR1B 1NIWA 1SR6B 4MZJA 4ORAB 3AAJA 5AANA 1MHOA 2KAYA 4MZLA 5J3XA 2HETA 5GQQC 4M2OA 2WORA 3I5FB 5K89A 2ZKMX 3I5FC 3NXAA 4OR9B 2WCFA 2ZNDA 1DGVA 2BBNA 3JVTC 2LUCA 1JSAA 3K21A 5DKNA 1DTLA 1EJ3A 2GGMA 5PALA 1B7TZ 1RFJA 2JXCA 2BE4A 1SK6D 1ZACA 2Y1NA 2CCMA
chains in the Genus database with same CATH superfamily
3M0WA 4GGFC 3FWBA 1CFDA 1K2HA 1F4QA 1J7PA 1Y1AA 1SCVA 3S0EA 4GAOA 1TNXA 1BU3A 1BT6A 1U5IA 3VB1A 4ZCVA 1YUTA 1LVCD 1XFYO 1OMDA 1AK8A 1KFUL 1SY9A 1KFXL 1K8UA 1DVIA 2KNEA 2JT8A 2LVJA 1A4PA 2BCAA 3FS7A 1J7RA 4I5NB 2H61C 2Q4UA 3PJIA 1LXFC 1F8HA 3SIBA 2PVBA 1B8RA 1SCMB 2HF5A 3O4YA 3QRXA 4YGBB 3D78A 2KGRA 2OPOA 3AKAA 3SS4A 4YBHB 3EG5B 1EL4A 2K7BA 1TOPA 2JULA 2PALA 1QJTA 1K94A 1KK8C 4PE4A 5DICA 2M29A 1SYMA 2HQ8A 2KYFA 4PE1A 1PK0D 2CT9A 2ISDA 3OGNA 3D74A 3O4XA 1UP5A 2WC6A 1YVLA 4WQ2A 1RTP1 3KF9A 4JKTA 3D0YA 5HYDA 4OCIA 1AJ5A 3D75A 1JF2A 1XFZO 1YUUA 4UPGA 1SNLA 2PQLA 4NQGA 2QEHA 2V53A 2GGZA 2BE6A 4PE7A 1B8LA 1Q80A 2I94A 1BG1A 1S6CA 1W9ZA 5FI2A 3CDNA 1XO5A 4PHJA 1PRWA 4JD9A 1TCFA 2O5GA 2MA2A 3EKJA 1V1GA 2P6BB 1UHNA 1ORGA 1WRZA 3CTNA 4I5KA 1CMGA 2LC5A 4N1FA 4XJKB 1WLMA 2WCKA 3IVTA 1M46A 4U8DA 3O2PA 2LMUA 1CB1A 1SRAA 1DJZA 1WRLA 2FJUB 1QX7A 3AKBA 3FWCA 4QJ5B 1KWOB 2M7LA 1KWOC 3DF0B 1TRFA 1IQ5A 2F33A 2MAZA 1XYDA 3BUMB 3R72A 2E30A 2JNFA 2QACA 3LK0A 1F70A 4A4CA 2HQWA 4WRIA 2NZ0A 3CR4X 2L4HA 2LMTA 3MSEB 1FBVA 3PN7C 4JPZB 1JFJA 2ZNEA 1AP4A 1DJGA 1SR6C 5I2LA 2B1UA 2QDIA 3B7AA 2F8PA 3EVVA 1DMOA 4E68A 3NSIA 4CIDA 3N7HA 4OV2A 2TN4A 1F71A 1BF5A 1YURA 5D69A 2LLSA 1CDMA 4PE0A 2PSRA 2F2PA 1HQVA 2LP2A 3BJHA 1NP8A 3GOFA 4YI9A 1KSMA 1K9PA 1TTXA 2G2BA 1OSAA 3LL8B 3QMEA 4M2PA 1UHHA 2KFGA 2L98A 1A75B 1DT7B 2M8UA 1E8AA 5G08A 1AVSA 1GQMA 2JT3A 2WCLA 2L4IA 2EC6B 3PATA 3VROA 2EC6C 1B1GA 1R6PA 2FCEA 1BJFA 2EHBA 1B47A 1PULA 2KLEA 2CTNA 3CZ2A 5DKQA 3ZWHA 1CFFA 1CNPA 2NLNA 2JTTA 1CM1A 2WCEA 3A8RA 5AEQA 1TN4A 1H8BA 1SW8A 1DJWA 3BFBA 1MWNA 1DC1A 1QASA 2K7CA 5AFPA 1JFKA 2JWWA 3S0BA 1CLMA 1S36A 5ER4X 5HKZA 1LINA 2PASA 1B9AA 2BKIB 1KFXS 2MBXA 5KTYA 1DEKA 3EK8A 1OE9B 1JC2A 5B8IB 1Y1XA 2LCPA 4WQ3A 1KQVA 1C7WA 1EG4A 3BFAA 1H4BA 1AUIB 2BCXA 1SL7A 2OS8C 1L7ZA 4C0JA 3TUYC 3BUWB 1NCXA 1XK4A 1ZUZA 4M2QA 4INXA 1DELA 1OOHA 4MRYA 1Y1UA 1OQPA 4TNCA 2KSPA 2IS9A 2WCBA 2Q91A 1A75A 3GK1A 1HT9A 1UWOA 1IG5A 4N5XA 1N2DA 3E3RA 1J1EA 3CLNA 3ICBA 2WNDA 1K90D 1J7QA 1Y0VH 2PMYA 4MVFA 4GGNA 3D10A 1RROA 3DYEA 4AOMA 1SMGA 4PHKA 1K93D 1DJIA 2LP3A 3GK4X 1QVIY 3VRRA 4FTGA 2LANA 4C0KA 2L2EA 4P5OE 2GV5A 2L50A 2VRGA 2KAXA 4DUQA 1WLZA 1UUSA 1YX7A 2LHLA 3TS5B 2HPSA 1F54A 1IGVA 1W7IB 2MRDA 3IQOA 2H8VA 4HSZA 3A4UB 3PM2A 4BY5A 2WCMA 1XVJA 3L4AA 4PT1A 3RLZA 1XFVO 4OZDA 4PALA 2QPTA 1MXEA 1QV1A 5ER5A 3TZ1A 3JTDC 4DRWA 5FI7A 4QJ3B 2BL0C 1SL8A 2SASA 5D3OA 1PSBA 1XK4C 1NX2A 1B8CA 1OMVA 1IQ3A 1C3YA 5I2OA 2KDHA 4HREE 2ZFDA 1QVIZ 2KI6C 3DZTA 2KI4B 4I5JA 5CPVA 3NGVA 2JRFA 1J55A 4MLWA 3KHEA 3OX5A 2KQYA 3OP0A 5CSNA 4MSPA 1QIWA 3V2LA 1QX5B 1KSOA 1LS8A 4AQJA 3LK1A 3OHMB 2F3YA 1GM0A 3SIAA 3UNWA 3TDUA 3PALA 4CPVA 2NCPA 2H2KA 1IKUA 3RM1A 5AERA 1BODA 2KFHA 1TIZA 4QJ4B 2R2IA 1YRUB 4INWA 4OKHA 2DOQA 2JXLA 1S6IA 2WCJA 4YRUA 1RK9A 4CFQA 3BYAA 2ZRSA 1V1FA 3I5GB 1XFUO 5F6TA 1RECA 2LV7A 1J1DA 1UHJA 3D76A 2D8NA 1M31A 3OX6A 1S6JA 1K96A 1S1EA 1TCOB 4YGDB 2L5XB 1MQ1A 4Q04A 3EK7A 2ZN9A 1YUSA 1M45A 2O60A 1DQEA 3DVEA 1NSHA 2MLEC 2CXJA 4DCKA 1FF1A 3UO9A 2I2RE 4NDCA 4DIRA 3O6BA 2PRUA 1YTZC 2BAPA 3FIAA 2KYCA 2SCPA 2JC2A 2GTEA 2WC5A 2KBIA 4PCWA 1ALWA 2MJWB 1MUXA 5I94A 2H61A 3TS5C 3KEVA 1M63B 3VRQA 4N1GA 2LVIA 1NX1A 3TDZA 4ZCUA 1CTRA 2AAOA 1MR8A 1B7TY 2ZRTA 1W7JB 3R1VA 5HKWA 4A4BA 3CR5X 4PHNA 2LNKA 3NSLA 3CGAA 3CS1A 1BMOA 3B87A 3S0GA 2BCBA 3SS5A 2BKHB 2BL0B 2WOSA 3ZNIA 2K7DA 3AAKA 3OB1B 2M49B 2KGBC 2M7NA 3I5IB 4IL1A 1ODBA 3PN7B 2M0RA 1QV0A 1VRKA 2LMVA 3CR2A 1DJHA 3PFVA 4MN0A 1EG3A 4JQ0D 1KQMB 2NXQA 3EVUA 1N65A 5I8NA 2Y1NA 3PM8A 4C0LA 2MHHA 2P71A 2LM5A 4F0ZB 3SG7A 1X02A 1LKJA 1NX0A 1JUOA 3Q8IA 5CSJA 3SJSA 1C07A 2JTZA 2K61A 3BXKA 1S5GZ 3S0FA 1CFCA 2OTGC 3CABA 5TNCA 1L2OB 1NCYA 3PLFB 4IJ7A 5CSFA 1BOCA 1MF8B 3I5GC 1S3PA 1SPYA 2M9GA 4ICBA 1TWOA 4OVNF 3BOWB 1ZOTB 2FCDA 3DF0A 1IWQA 1PVAA 2JNXA 1CLLA 2I7AA 3I5HC 1YR5A 1RJVA 2KI4C 4ETOA 1ALVA 2M97A 3I5HB 4KYNA 2L2CA 1KK7Z 2JQ6A 1YVHA 1DGUA 1OW4A 2K2AA 5EL2A 1OMRA 2AUCA 1BR4B 1K9KA 1JF0A 2JOJA 1UHIA 1SBJA 2KQ6A 3OB2B 2RGIA 1QX2A 4BY4A 3NHIA 4MEWA 3OBVA 1SCMC 3O78A 4HRHA 5HL1A 1EXRA 4F7FA 2KHNA 1KCYA 1GJYA 1CKKA 1IIOA 4ORCB 1OOJA 2FOTA 5IBWA 4FQOA 2I18A 3WHTB 1QXPA 2BBMA 3PSRA 5JOLA 4GBAA 1DJYA 2JPTA 1Z4HA 2JZIA 2KOTA 3DVJA 5D7FA 1CM4A 1C7VA 1QS7A 5JJGA 1F55A 2LAPA 1K95A 1DJXA 2K0JA 3D0YB 1S26D 3K1EA 1EH2A 1XA5A 1CDPA 1C3ZA 1CDNA 1NPQA 2K2FA 4GNKB 1YRTB 2M1KB 3EK4A 3DVKA 1WRKA 3CZ1A 2KLDA 5HLOA 3VRPA 2JU0A 4CFRA 2L5YA 4YGAA 1QATA 3SS3A 1OOIX 1TNQA 1OOFA 1XFWO 2BNXA 2M3WA 1IJ6A 4PDZA 3CYZA 1DF0A 1YX8A 3HX4A 1AJ4A 1UURA 2WC8A 2P70A 3NSOA 3CWGA 1WDCB 1KK7Y 2ERBA 1WDCC 4YGEB 3TUYB 4ORBB 3DVMA 1GGWA 3D73A 1XFXO 2KPHA 1R2UA 3B88A 3JVTB 1KFUS 1IJ5A 2QEOA 4MZKA 3FE8A 1NCZA 3FE6A 3WNXB 2F3ZA 3BFHA 3WHUB 1T14A 3BQ3A 4P2YB 1Z2CB 3SG6A 2WCHA 3IQQA 1PVBA 3L4LA 1A29A 1OZSA 4GUKA 5FI6A 5KU1A 3HCMA 2JPOA 1SSEB 1FW4A 3R1PA 3NHTA 4GGFA 3TDIA 5HKYA 5FYXA 3I5IC 4XYNA 3JTDB 3BUNB 1BLQA 2A4JA 5I2QA 2LUXA 3S0AA 1JBAA 2KBMA 1FPWA 2LLUA 2AMIA 2E6WA 2JT0A 3BUOB 2BECA 2L51A 2K60A 2KAVA 2QEBA 3B86A 1KQMC 1DF0B 3CZ0A 3DD4A 5AXIA 4I5LB 2QEVA 3L47A 1JWDA 1UHKA 1F4OA 5DKRA 1FI6A 4MBEA 3KPXA 1Y6WA 1QTXA 5HLVA 1FI5A 1GGZA 1A2XA 4HRGA 1J7OA 2LLTA 4CLNA 4USLA 1IRJA 1KK8B 2ZN8A 3D77A 4R1EA 1K9UA 4FQTA 3SG2A 1CMFA 1SKTA 1L2OC 1PSRA 2OTGB 1RWYA 1U5IB 1G8IA 2LE9B 2OS8B 2Y4QA 2KFFA 1MXLC 4PHMA 1G4YR 2L0PA 1P28A 3B6XA 2YGUA 3S0DA 1NYAA 3NSKA 3VRNA 4YGCB 1NWDA 1M39A 4YI8A 5BPJA 1NUBA 1LA0A 3VGOA 3F45A 3RZSA 1ZMZA 2MLFC 1QIVA 2NCOA 4GFTA 5CSIA 2Y1MA 3WXAA 2G9BA 3KO0A 1PALA 4D1EA 3EKHA 2KI6D 1N0YA 1OZOA 1WY9A 1AHRA 2LVVA 1TNWA 4JWQA 3H4SE 1B4CA 1SL9A 3C1VA 4NDBA 1CFPA 3DY9A 3EVRA 3R1OA 2K8MB 3IF7A 1ZFSA 1TUJA 2F2OA 3CZTX 1LA3A 4DS7A 3SG4A 3BOWA 3SG3A 5KSZA 1TNPA 3DXLA 3BUXB 1CDLA 1A03A 3GK2A 1QLSA 2EGDA 2FJYA 2LHIA 4AQIA 1NX3A 2K7OA 2M1UA 2LVKA 4L9MA 4MRXA 3LCPC 2CBLA 1IH0A 4GPLB 1QLKA 2PYQA 4NDDA 2Y5IA 3SG5A 2COLB 2CNPA 1CLBA 1G33A 3LLEA 1D1OA 1S5GY 4XJKA 1BR1B 1NIWA 3FE9A 1SR6B 4MZJA 4ORAB 3AAJA 5AANA 1MHOA 2KAYA 4MZLA 5J3XA 2HETA 5GQQC 4M2OA 1QWVA 1XFRA 2WORA 3I5FB 5K89A 2ZKMX 3I5FC 3NXAA 4OR9B 2WCFA 2ZNDA 1DGVA 2BBNA 3JVTC 2LUCA 1JSAA 1TUZA 3K21A 5DKNA 1DTLA 1EJ3A 2GGMA 5PALA 1B7TZ 1RFJA 2JXCA 2BE4A 1SK6D 1ZACA 1OOGA 2CCMA
chains in the Genus database with same CATH topology
3M0WA 4GGFC 3FWBA 1CFDA 1K2HA 1F4QA 1J7PA 1Y1AA 1SCVA 4GAOA 1TNXA 1BU3A 1BT6A 1U5IA 4ZCVA 1YUTA 1LVCD 1XFYO 1OMDA 1AK8A 1KFUL 1SY9A 1KFXL 1K8UA 1DVIA 2KNEA 2JT8A 2LVJA 1A4PA 2BCAA 3FS7A 1J7RA 4I5NB 2H61C 2Q4UA 1F8HA 1LXFC 3SIBA 2PVBA 1B8RA 1SCMB 2HF5A 3O4YA 3QRXA 4YGBB 2KGRA 2OPOA 3AKAA 4YBHB 1EL4A 2K7BA 1TOPA 2JULA 2PALA 1QJTA 1K94A 1KK8C 4PE4A 2M29A 1SYMA 2HQ8A 2KYFA 4PE1A 1PK0D 2CT9A 2ISDA 1UP5A 1YVLA 4WQ2A 1RTP1 3KF9A 3D0YA 5HYDA 4OCIA 1AJ5A 1JF2A 1XFZO 1YUUA 4UPGA 1SNLA 4NQGA 2V53A 2GGZA 2BE6A 4PE7A 1B8LA 1Q80A 2I94A 1BG1A 1S6CA 1XO5A 4PHJA 1PRWA 1TCFA 2O5GA 2MA2A 3EKJA 1V1GA 2P6BB 1UHNA 4I5KA 1WRZA 3CTNA 1CMGA 2LC5A 4N1FA 4XJKB 1WLMA 4U8DA 1M46A 3O2PA 2LMUA 1CB1A 1SRAA 1DJZA 1WRLA 2FJUB 1QX7A 3AKBA 3FWCA 4QJ5B 1KWOB 2M7LA 1KWOC 3DF0B 1TRFA 1IQ5A 2F33A 2MAZA 1XYDA 3BUMB 2E30A 2JNFA 2QACA 3LK0A 1F70A 4A4CA 2HQWA 4WRIA 2NZ0A 3CR4X 2L4HA 2LMTA 3MSEB 1FBVA 3PN7C 4JPZB 1JFJA 2ZNEA 1AP4A 1DJGA 1SR6C 5I2LA 2B1UA 2F8PA 3EVVA 1DMOA 4E68A 3NSIA 4CIDA 4OV2A 1F71A 2TN4A 1BF5A 1YURA 5D69A 2LLSA 1CDMA 4PE0A 2PSRA 2F2PA 1HQVA 2LP2A 4YI9A 1NP8A 3GOFA 4C0LA 1KSMA 1K9PA 1TTXA 2G2BA 1OSAA 3LL8B 4M2PA 1UHHA 2KFGA 2L98A 1A75B 1DT7B 2M8UA 1E8AA 5G08A 1AVSA 1GQMA 2JT3A 2L4IA 2EC6B 3PATA 3VROA 2EC6C 1B1GA 1R6PA 2FCEA 1BJFA 2EHBA 1B47A 1PULA 5DKQA 2CTNA 3ZWHA 1CFFA 1CNPA 2NLNA 2JTTA 1CM1A 2WCEA 3A8RA 5AEQA 1TN4A 1H8BA 1SW8A 1DJWA 1MWNA 1QASA 2K7CA 5AFPA 1JFKA 2JWWA 1CLMA 1S36A 5ER4X 5HKZA 1LINA 2PASA 1B9AA 2BKIB 1KFXS 2MBXA 5KTYA 3EK8A 1OE9B 1JC2A 5B8IB 1Y1XA 2LCPA 4WQ3A 1KQVA 1C7WA 1EG4A 1H4BA 1AUIB 2BCXA 1SL7A 2OS8C 1L7ZA 4C0JA 3TUYC 3BUWB 1NCXA 1XK4A 1ZUZA 4M2QA 4MRYA 1Y1UA 1OQPA 4TNCA 2KSPA 2IS9A 2WCBA 2Q91A 1A75A 3GK1A 1HT9A 1UWOA 1IG5A 4N5XA 1N2DA 3E3RA 1J1EA 3CLNA 3ICBA 2WNDA 1K90D 1J7QA 1Y0VH 2PMYA 4MVFA 4GGNA 3D10A 1RROA 4AOMA 1SMGA 4PHKA 1K93D 1DJIA 2LP3A 3GK4X 1QVIY 3VRRA 4FTGA 2LANA 4C0KA 2L2EA 4P5OE 2GV5A 2L50A 2VRGA 2KAXA 4DUQA 1WLZA 1UUSA 1YX7A 2LHLA 3TS5B 2HPSA 1F54A 1IGVA 1W7IB 2MRDA 3IQOA 4HSZA 3A4UB 4BY5A 1XVJA 3RLZA 1XFVO 4PALA 2QPTA 1MXEA 1QV1A 5ER5A 3TZ1A 3JTDC 4DRWA 4QJ3B 2BL0C 1SL8A 2SASA 1PSBA 1XK4C 1NX2A 1B8CA 1OMVA 1IQ3A 5I2OA 2KDHA 4HREE 2ZFDA 1QVIZ 2KI6C 4I5JA 2KI4B 5CPVA 2JRFA 1J55A 4MLWA 3KHEA 3OX5A 2KQYA 3OP0A 5CSNA 4MSPA 1QIWA 1QX5B 1KSOA 4AQJA 3LK1A 3OHMB 2F3YA 3SIAA 3TDUA 3PALA 4CPVA 2NCPA 2H2KA 1IKUA 3RM1A 5AERA 1BODA 2KFHA 1TIZA 4QJ4B 2R2IA 1YRUB 4OKHA 2DOQA 2JXLA 1S6IA 4YRUA 1RK9A 4CFQA 3BYAA 2ZRSA 1V1FA 3I5GB 1XFUO 5F6TA 1RECA 2LV7A 1J1DA 1UHJA 3OX6A 2D8NA 1M31A 1S6JA 1K96A 1S1EA 1TCOB 4YGDB 2L5XB 1MQ1A 4Q04A 3EK7A 2ZN9A 1YUSA 1M45A 2O60A 3DVEA 1NSHA 2MLEC 2CXJA 4DCKA 1FF1A 2I2RE 4NDCA 4DIRA 3O6BA 2PRUA 1YTZC 3FIAA 2KYCA 2SCPA 2JC2A 4PCWA 2KBIA 1ALWA 2MJWB 1MUXA 2H61A 3TS5C 3KEVA 1M63B 3VRQA 4N1GA 2LVIA 1NX1A 3TDZA 4ZCUA 1CTRA 2AAOA 1MR8A 1B7TY 2ZRTA 1W7JB 5HKWA 4A4BA 3CR5X 4PHNA 2LNKA 3NSLA 3CGAA 3CS1A 1BMOA 2BCBA 2BKHB 2BL0B 2WOSA 3ZNIA 2K7DA 3AAKA 3OB1B 2M49B 2KGBC 2M7NA 3I5IB 4IL1A 1ODBA 3PN7B 2M0RA 1QV0A 1VRKA 2LMVA 3CR2A 1DJHA 3PFVA 4MN0A 1EG3A 4JQ0D 1KQMB 2NXQA 3EVUA 1N65A 5I8NA 3PM8A 2MHHA 2LM5A 4F0ZB 3SG7A 1X02A 1LKJA 1NX0A 1JUOA 5CSJA 3SJSA 1C07A 2JTZA 2K61A 3BXKA 1S5GZ 1CFCA 2OTGC 5TNCA 1L2OB 1NCYA 3PLFB 5CSFA 1BOCA 1MF8B 3I5GC 1S3PA 1SPYA 2M9GA 4ICBA 4OVNF 3BOWB 1ZOTB 2FCDA 3DF0A 1IWQA 1PVAA 2JNXA 1CLLA 2I7AA 3I5HC 1YR5A 1RJVA 2KI4C 4ETOA 1ALVA 2M97A 3I5HB 1KK7Z 2JQ6A 1YVHA 1DGUA 2K2AA 1OMRA 2AUCA 1BR4B 1K9KA 1JF0A 2JOJA 1UHIA 1SBJA 2KQ6A 3OB2B 2RGIA 1QX2A 4BY4A 4MEWA 1SCMC 3O78A 4HRHA 1EXRA 2KHNA 1KCYA 1GJYA 1CKKA 4ORCB 1OOJA 2FOTA 5IBWA 4FQOA 2I18A 3WHTB 1QXPA 2BBMA 3PSRA 5JOLA 4GBAA 1DJYA 2JPTA 2JZIA 2KOTA 3DVJA 5D7FA 1CM4A 1C7VA 1QS7A 5JJGA 1F55A 2LAPA 1K95A 1DJXA 2K0JA 3D0YB 1S26D 1EH2A 1XA5A 1CDPA 1CDNA 1NPQA 2K2FA 4GNKB 1YRTB 2M1KB 3EK4A 3DVKA 1WRKA 5HLOA 3VRPA 2JU0A 4CFRA 4YGAA 1QATA 1TNQA 1XFWO 2M3WA 1IJ6A 4PDZA 1DF0A 1YX8A 3HX4A 1AJ4A 1UURA 2WC8A 3NSOA 3CWGA 1WDCB 1KK7Y 1WDCC 4YGEB 3TUYB 4ORBB 3DVMA 1GGWA 1XFXO 1R2UA 3JVTB 1KFUS 1IJ5A 4MZKA 1NCZA 3WNXB 2F3ZA 3WHUB 3BQ3A 4P2YB 3SG6A 3IQQA 1PVBA 1A29A 1OZSA 4GUKA 5KU1A 3HCMA 1FW4A 4GGFA 3TDIA 5HKYA 5FYXA 3I5IC 4XYNA 3JTDB 3BUNB 1BLQA 2A4JA 5I2QA 2LUXA 1JBAA 2KBMA 1FPWA 2LLUA 2AMIA 2E6WA 2JT0A 3BUOB 2BECA 2L51A 2KAVA 5AXIA 1KQMC 1DF0B 3DD4A 4I5LB 1JWDA 1UHKA 1F4OA 5DKRA 1FI6A 4MBEA 3KPXA 1Y6WA 1QTXA 5HLVA 1FI5A 1GGZA 1A2XA 4HRGA 1J7OA 2LLTA 4CLNA 4USLA 1IRJA 1KK8B 2ZN8A 4R1EA 3SG2A 1K9UA 1CMFA 1SKTA 1L2OC 1PSRA 2OTGB 1RWYA 1U5IB 1G8IA 2LE9B 2OS8B 2Y4QA 2KFFA 1MXLC 4PHMA 1G4YR 2L0PA 1NYAA 3NSKA 3VRNA 4YGCB 1NWDA 1M39A 4YI8A 5BPJA 1NUBA 1LA0A 3VGOA 3F45A 1ZMZA 2MLFC 1QIVA 2NCOA 4GFTA 5CSIA 2Y1MA 3WXAA 2G9BA 3KO0A 1PALA 4D1EA 3EKHA 2KI6D 1N0YA 1OZOA 1WY9A 1AHRA 2LVVA 1TNWA 4JWQA 3H4SE 1B4CA 1SL9A 3C1VA 4NDBA 1CFPA 3EVRA 2K8MB 3IF7A 1ZFSA 2F2OA 3CZTX 1LA3A 4DS7A 3SG4A 3BOWA 3SG3A 5KSZA 1TNPA 3BUXB 1CDLA 1A03A 3GK2A 1QLSA 2EGDA 2LHIA 4AQIA 1NX3A 2K7OA 2M1UA 2LVKA 4L9MA 4MRXA 3LCPC 2CBLA 1IH0A 4GPLB 1QLKA 4NDDA 2Y5IA 3SG5A 2COLB 2CNPA 1CLBA 1G33A 3LLEA 1D1OA 1S5GY 4XJKA 1BR1B 1NIWA 1SR6B 4MZJA 4ORAB 3AAJA 5AANA 1MHOA 2KAYA 4MZLA 5J3XA 2HETA 5GQQC 4M2OA 2WORA 3I5FB 5K89A 2ZKMX 3I5FC 3NXAA 4OR9B 2WCFA 2ZNDA 1DGVA 2BBNA 3JVTC 2LUCA 1JSAA 3K21A 5DKNA 1DTLA 1EJ3A 2GGMA 5PALA 1B7TZ 1RFJA 2JXCA 2BE4A 1SK6D 1ZACA 2Y1NA 2CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0W A;  4GGF C;  3FWB A;  1CFD A;  1K2H A;  1F4Q A;  1J7P A;  1Y1A A;  1SCV A;  4GAO A;  1TNX A;  1BU3 A;  1BT6 A;  1U5I A;  4ZCV A;  1YUT A;  1LVC D;  1XFY O;  1OMD A;  1AK8 A;  1KFU L;  1SY9 A;  1KFX L;  1K8U A;  1DVI A;  2KNE A;  2JT8 A;  2LVJ A;  1A4P A;  2BCA A;  3FS7 A;  1J7R A;  4I5N B;  2H61 C;  2Q4U A;  1F8H A;  1LXF C;  3SIB A;  2PVB A;  1B8R A;  1SCM B;  2HF5 A;  3O4Y A;  3QRX A;  4YGB B;  2KGR A;  2OPO A;  3AKA A;  4YBH B;  1EL4 A;  2K7B A;  1TOP A;  2JUL A;  2PAL A;  1QJT A;  1K94 A;  1KK8 C;  4PE4 A;  2M29 A;  1SYM A;  2HQ8 A;  2KYF A;  4PE1 A;  1PK0 D;  2CT9 A;  2ISD A;  1UP5 A;  1YVL A;  4WQ2 A;  1RTP 1;  3KF9 A;  3D0Y A;  5HYD A;  4OCI A;  1AJ5 A;  1JF2 A;  1XFZ O;  1YUU A;  4UPG A;  1SNL A;  4NQG A;  2V53 A;  2GGZ A;  2BE6 A;  4PE7 A;  1B8L A;  1Q80 A;  2I94 A;  1BG1 A;  1S6C A;  1XO5 A;  4PHJ A;  1PRW A;  1TCF A;  2O5G A;  2MA2 A;  3EKJ A;  1V1G A;  2P6B B;  1UHN A;  4I5K A;  1WRZ A;  3CTN A;  1CMG A;  2LC5 A;  4N1F A;  4XJK B;  1WLM A;  4U8D A;  1M46 A;  3O2P A;  2LMU A;  1CB1 A;  1SRA A;  1DJZ A;  1WRL A;  2FJU B;  1QX7 A;  3AKB A;  3FWC A;  4QJ5 B;  1KWO B;  2M7L A;  1KWO C;  3DF0 B;  1TRF A;  1IQ5 A;  2F33 A;  2MAZ A;  1XYD A;  3BUM B;  2E30 A;  2JNF A;  2QAC A;  3LK0 A;  1F70 A;  4A4C A;  2HQW A;  4WRI A;  2NZ0 A;  3CR4 X;  2L4H A;  2LMT A;  3MSE B;  1FBV A;  3PN7 C;  4JPZ B;  1JFJ A;  2ZNE A;  1AP4 A;  1DJG A;  1SR6 C;  5I2L A;  2B1U A;  2F8P A;  3EVV A;  1DMO A;  4E68 A;  3NSI A;  4CID A;  4OV2 A;  1F71 A;  2TN4 A;  1BF5 A;  1YUR A;  5D69 A;  2LLS A;  1CDM A;  4PE0 A;  2PSR A;  2F2P A;  1HQV A;  2LP2 A;  4YI9 A;  1NP8 A;  3GOF A;  4C0L A;  1KSM A;  1K9P A;  1TTX A;  2G2B A;  1OSA A;  3LL8 B;  4M2P A;  1UHH A;  2KFG A;  2L98 A;  1A75 B;  1DT7 B;  2M8U A;  1E8A A;  5G08 A;  1AVS A;  1GQM A;  2JT3 A;  2L4I A;  2EC6 B;  3PAT A;  3VRO A;  2EC6 C;  1B1G A;  1R6P A;  2FCE A;  1BJF A;  2EHB A;  1B47 A;  1PUL A;  5DKQ A;  2CTN A;  3ZWH A;  1CFF A;  1CNP A;  2NLN A;  2JTT A;  1CM1 A;  2WCE A;  3A8R A;  5AEQ A;  1TN4 A;  1H8B A;  1SW8 A;  1DJW A;  1MWN A;  1QAS A;  2K7C A;  5AFP A;  1JFK A;  2JWW A;  1CLM A;  1S36 A;  5ER4 X;  5HKZ A;  1LIN A;  2PAS A;  1B9A A;  2BKI B;  1KFX S;  2MBX A;  5KTY A;  3EK8 A;  1OE9 B;  1JC2 A;  5B8I B;  1Y1X A;  2LCP A;  4WQ3 A;  1KQV A;  1C7W A;  1EG4 A;  1H4B A;  1AUI B;  2BCX A;  1SL7 A;  2OS8 C;  1L7Z A;  4C0J A;  3TUY C;  3BUW B;  1NCX A;  1XK4 A;  1ZUZ A;  4M2Q A;  4MRY A;  1Y1U A;  1OQP A;  4TNC A;  2KSP A;  2IS9 A;  2WCB A;  2Q91 A;  1A75 A;  3GK1 A;  1HT9 A;  1UWO A;  1IG5 A;  4N5X A;  1N2D A;  3E3R A;  1J1E A;  3CLN A;  3ICB A;  2WND A;  1K90 D;  1J7Q A;  1Y0V H;  2PMY A;  4MVF A;  4GGN A;  3D10 A;  1RRO A;  4AOM A;  1SMG A;  4PHK A;  1K93 D;  1DJI A;  2LP3 A;  3GK4 X;  1QVI Y;  3VRR A;  4FTG A;  2LAN A;  4C0K A;  2L2E A;  4P5O E;  2GV5 A;  2L50 A;  2VRG A;  2KAX A;  4DUQ A;  1WLZ A;  1UUS A;  1YX7 A;  2LHL A;  3TS5 B;  2HPS A;  1F54 A;  1IGV A;  1W7I B;  2MRD A;  3IQO A;  4HSZ A;  3A4U B;  4BY5 A;  1XVJ A;  3RLZ A;  1XFV O;  4PAL A;  2QPT A;  1MXE A;  1QV1 A;  5ER5 A;  3TZ1 A;  3JTD C;  4DRW A;  4QJ3 B;  2BL0 C;  1SL8 A;  2SAS A;  1PSB A;  1XK4 C;  1NX2 A;  1B8C A;  1OMV A;  1IQ3 A;  5I2O A;  2KDH A;  4HRE E;  2ZFD A;  1QVI Z;  2KI6 C;  4I5J A;  2KI4 B;  5CPV A;  2JRF A;  1J55 A;  4MLW A;  3KHE A;  3OX5 A;  2KQY A;  3OP0 A;  5CSN A;  4MSP A;  1QIW A;  1QX5 B;  1KSO A;  4AQJ A;  3LK1 A;  3OHM B;  2F3Y A;  3SIA A;  3TDU A;  3PAL A;  4CPV A;  2NCP A;  2H2K A;  1IKU A;  3RM1 A;  5AER A;  1BOD A;  2KFH A;  1TIZ A;  4QJ4 B;  2R2I A;  1YRU B;  4OKH A;  2DOQ A;  2JXL A;  1S6I A;  4YRU A;  1RK9 A;  4CFQ A;  3BYA A;  2ZRS A;  1V1F A;  3I5G B;  1XFU O;  5F6T A;  1REC A;  2LV7 A;  1J1D A;  1UHJ A;  3OX6 A;  2D8N A;  1M31 A;  1S6J A;  1K96 A;  1S1E A;  1TCO B;  4YGD B;  2L5X B;  1MQ1 A;  4Q04 A;  3EK7 A;  2ZN9 A;  1YUS A;  1M45 A;  2O60 A;  3DVE A;  1NSH A;  2MLE C;  2CXJ A;  4DCK A;  1FF1 A;  2I2R E;  4NDC A;  4DIR A;  3O6B A;  2PRU A;  1YTZ C;  3FIA A;  2KYC A;  2SCP A;  2JC2 A;  4PCW A;  2KBI A;  1ALW A;  2MJW B;  1MUX A;  2H61 A;  3TS5 C;  3KEV A;  1M63 B;  3VRQ A;  4N1G A;  2LVI A;  1NX1 A;  3TDZ A;  4ZCU A;  1CTR A;  2AAO A;  1MR8 A;  1B7T Y;  2ZRT A;  1W7J B;  5HKW A;  4A4B A;  3CR5 X;  4PHN A;  2LNK A;  3NSL A;  3CGA A;  3CS1 A;  1BMO A;  2BCB A;  2BKH B;  2BL0 B;  2WOS A;  3ZNI A;  2K7D A;  3AAK A;  3OB1 B;  2M49 B;  2KGB C;  2M7N A;  3I5I B;  4IL1 A;  1ODB A;  3PN7 B;  2M0R A;  1QV0 A;  1VRK A;  2LMV A;  3CR2 A;  1DJH A;  3PFV A;  4MN0 A;  1EG3 A;  4JQ0 D;  1KQM B;  2NXQ A;  3EVU A;  1N65 A;  5I8N A;  3PM8 A;  2MHH A;  2LM5 A;  4F0Z B;  3SG7 A;  1X02 A;  1LKJ A;  1NX0 A;  1JUO A;  5CSJ A;  3SJS A;  1C07 A;  2JTZ A;  2K61 A;  3BXK A;  1S5G Z;  1CFC A;  2OTG C;  5TNC A;  1L2O B;  1NCY A;  3PLF B;  5CSF A;  1BOC A;  1MF8 B;  3I5G C;  1S3P A;  1SPY A;  2M9G A;  4ICB A;  4OVN F;  3BOW B;  1ZOT B;  2FCD A;  3DF0 A;  1IWQ A;  1PVA A;  2JNX A;  1CLL A;  2I7A A;  3I5H C;  1YR5 A;  1RJV A;  2KI4 C;  4ETO A;  1ALV A;  2M97 A;  3I5H B;  1KK7 Z;  2JQ6 A;  1YVH A;  1DGU A;  2K2A A;  1OMR A;  2AUC A;  1BR4 B;  1K9K A;  1JF0 A;  2JOJ A;  1UHI A;  1SBJ A;  2KQ6 A;  3OB2 B;  2RGI A;  1QX2 A;  4BY4 A;  4MEW A;  1SCM C;  3O78 A;  4HRH A;  1EXR A;  2KHN A;  1KCY A;  1GJY A;  1CKK A;  4ORC B;  1OOJ A;  2FOT A;  5IBW A;  4FQO A;  2I18 A;  3WHT B;  1QXP A;  2BBM A;  3PSR A;  5JOL A;  4GBA A;  1DJY A;  2JPT A;  2JZI A;  2KOT A;  3DVJ A;  5D7F A;  1CM4 A;  1C7V A;  1QS7 A;  5JJG A;  1F55 A;  2LAP A;  1K95 A;  1DJX A;  2K0J A;  3D0Y B;  1S26 D;  1EH2 A;  1XA5 A;  1CDP A;  1CDN A;  1NPQ A;  2K2F A;  4GNK B;  1YRT B;  2M1K B;  3EK4 A;  3DVK A;  1WRK A;  5HLO A;  3VRP A;  2JU0 A;  4CFR A;  4YGA A;  1QAT A;  1TNQ A;  1XFW O;  2M3W A;  1IJ6 A;  4PDZ A;  1DF0 A;  1YX8 A;  3HX4 A;  1AJ4 A;  1UUR A;  2WC8 A;  3NSO A;  3CWG A;  1WDC B;  1KK7 Y;  1WDC C;  4YGE B;  3TUY B;  4ORB B;  3DVM A;  1GGW A;  1XFX O;  1R2U A;  3JVT B;  1KFU S;  1IJ5 A;  4MZK A;  1NCZ A;  3WNX B;  2F3Z A;  3WHU B;  3BQ3 A;  4P2Y B;  3SG6 A;  3IQQ A;  1PVB A;  1A29 A;  1OZS A;  4GUK A;  5KU1 A;  3HCM A;  1FW4 A;  4GGF A;  3TDI A;  5HKY A;  5FYX A;  3I5I C;  4XYN A;  3JTD B;  3BUN B;  1BLQ A;  2A4J A;  5I2Q A;  2LUX A;  1JBA A;  2KBM A;  1FPW A;  2LLU A;  2AMI A;  2E6W A;  2JT0 A;  3BUO B;  2BEC A;  2L51 A;  2KAV A;  5AXI A;  1KQM C;  1DF0 B;  3DD4 A;  4I5L B;  1JWD A;  1UHK A;  1F4O A;  5DKR A;  1FI6 A;  4MBE A;  3KPX A;  1Y6W A;  1QTX A;  5HLV A;  1FI5 A;  1GGZ A;  1A2X A;  4HRG A;  1J7O A;  2LLT A;  4CLN A;  4USL A;  1IRJ A;  1KK8 B;  2ZN8 A;  4R1E A;  3SG2 A;  1K9U A;  1CMF A;  1SKT A;  1L2O C;  1PSR A;  2OTG B;  1RWY A;  1U5I B;  1G8I A;  2LE9 B;  2OS8 B;  2Y4Q A;  2KFF A;  1MXL C;  4PHM A;  1G4Y R;  2L0P A;  1NYA A;  3NSK A;  3VRN A;  4YGC B;  1NWD A;  1M39 A;  4YI8 A;  5BPJ A;  1NUB A;  1LA0 A;  3VGO A;  3F45 A;  1ZMZ A;  2MLF C;  1QIV A;  2NCO A;  4GFT A;  5CSI A;  2Y1M A;  3WXA A;  2G9B A;  3KO0 A;  1PAL A;  4D1E A;  3EKH A;  2KI6 D;  1N0Y A;  1OZO A;  1WY9 A;  1AHR A;  2LVV A;  1TNW A;  4JWQ A;  3H4S E;  1B4C A;  1SL9 A;  3C1V A;  4NDB A;  1CFP A;  3EVR A;  2K8M B;  3IF7 A;  1ZFS A;  2F2O A;  3CZT X;  1LA3 A;  4DS7 A;  3SG4 A;  3BOW A;  3SG3 A;  5KSZ A;  1TNP A;  3BUX B;  1CDL A;  1A03 A;  3GK2 A;  1QLS A;  2EGD A;  2LHI A;  4AQI A;  1NX3 A;  2K7O A;  2M1U A;  2LVK A;  4L9M A;  4MRX A;  3LCP C;  2CBL A;  1IH0 A;  4GPL B;  1QLK A;  4NDD A;  2Y5I A;  3SG5 A;  2COL B;  2CNP A;  1CLB A;  1G33 A;  3LLE A;  1D1O A;  1S5G Y;  4XJK A;  1BR1 B;  1NIW A;  1SR6 B;  4MZJ A;  4ORA B;  3AAJ A;  5AAN A;  1MHO A;  2KAY A;  4MZL A;  5J3X A;  2HET A;  5GQQ C;  4M2O A;  2WOR A;  3I5F B;  5K89 A;  2ZKM X;  3I5F C;  3NXA A;  4OR9 B;  2WCF A;  2ZND A;  1DGV A;  2BBN A;  3JVT C;  2LUC A;  1JSA A;  3K21 A;  5DKN A;  1DTL A;  1EJ3 A;  2GGM A;  5PAL A;  1B7T Z;  1RFJ A;  2JXC A;  2BE4 A;  1SK6 D;  1ZAC A;  2Y1N A;  2CCM A; 
#chains in the Genus database with same CATH topology
 3M0W A;  4GGF C;  3FWB A;  1CFD A;  1K2H A;  1F4Q A;  1J7P A;  1Y1A A;  1SCV A;  3S0E A;  4GAO A;  1TNX A;  1BU3 A;  1BT6 A;  1U5I A;  3VB1 A;  4ZCV A;  1YUT A;  1LVC D;  1XFY O;  1OMD A;  1AK8 A;  1KFU L;  1SY9 A;  1KFX L;  1K8U A;  1DVI A;  2KNE A;  2JT8 A;  2LVJ A;  1A4P A;  2BCA A;  3FS7 A;  1J7R A;  4I5N B;  2H61 C;  2Q4U A;  3PJI A;  1LXF C;  1F8H A;  3SIB A;  2PVB A;  1B8R A;  1SCM B;  2HF5 A;  3O4Y A;  3QRX A;  4YGB B;  3D78 A;  2KGR A;  2OPO A;  3AKA A;  3SS4 A;  4YBH B;  3EG5 B;  1EL4 A;  2K7B A;  1TOP A;  2JUL A;  2PAL A;  1QJT A;  1K94 A;  1KK8 C;  4PE4 A;  5DIC A;  2M29 A;  1SYM A;  2HQ8 A;  2KYF A;  4PE1 A;  1PK0 D;  2CT9 A;  2ISD A;  3OGN A;  3D74 A;  3O4X A;  1UP5 A;  2WC6 A;  1YVL A;  4WQ2 A;  1RTP 1;  3KF9 A;  4JKT A;  3D0Y A;  5HYD A;  4OCI A;  1AJ5 A;  3D75 A;  1JF2 A;  1XFZ O;  1YUU A;  4UPG A;  1SNL A;  2PQL A;  4NQG A;  2QEH A;  2V53 A;  2GGZ A;  2BE6 A;  4PE7 A;  1B8L A;  1Q80 A;  2I94 A;  1BG1 A;  1S6C A;  1W9Z A;  5FI2 A;  3CDN A;  1XO5 A;  4PHJ A;  1PRW A;  4JD9 A;  1TCF A;  2O5G A;  2MA2 A;  3EKJ A;  1V1G A;  2P6B B;  1UHN A;  1ORG A;  1WRZ A;  3CTN A;  4I5K A;  1CMG A;  2LC5 A;  4N1F A;  4XJK B;  1WLM A;  2WCK A;  3IVT A;  1M46 A;  4U8D A;  3O2P A;  2LMU A;  1CB1 A;  1SRA A;  1DJZ A;  1WRL A;  2FJU B;  1QX7 A;  3AKB A;  3FWC A;  4QJ5 B;  1KWO B;  2M7L A;  1KWO C;  3DF0 B;  1TRF A;  1IQ5 A;  2F33 A;  2MAZ A;  1XYD A;  3BUM B;  3R72 A;  2E30 A;  2JNF A;  2QAC A;  3LK0 A;  1F70 A;  4A4C A;  2HQW A;  4WRI A;  2NZ0 A;  3CR4 X;  2L4H A;  2LMT A;  3MSE B;  1FBV A;  3PN7 C;  4JPZ B;  1JFJ A;  2ZNE A;  1AP4 A;  1DJG A;  1SR6 C;  5I2L A;  2B1U A;  2QDI A;  3B7A A;  2F8P A;  3EVV A;  1DMO A;  4E68 A;  3NSI A;  4CID A;  3N7H A;  4OV2 A;  2TN4 A;  1F71 A;  1BF5 A;  1YUR A;  5D69 A;  2LLS A;  1CDM A;  4PE0 A;  2PSR A;  2F2P A;  1HQV A;  2LP2 A;  3BJH A;  1NP8 A;  3GOF A;  4YI9 A;  1KSM A;  1K9P A;  1TTX A;  2G2B A;  1OSA A;  3LL8 B;  3QME A;  4M2P A;  1UHH A;  2KFG A;  2L98 A;  1A75 B;  1DT7 B;  2M8U A;  1E8A A;  5G08 A;  1AVS A;  1GQM A;  2JT3 A;  2WCL A;  2L4I A;  2EC6 B;  3PAT A;  3VRO A;  2EC6 C;  1B1G A;  1R6P A;  2FCE A;  1BJF A;  2EHB A;  1B47 A;  1PUL A;  2KLE A;  2CTN A;  3CZ2 A;  5DKQ A;  3ZWH A;  1CFF A;  1CNP A;  2NLN A;  2JTT A;  1CM1 A;  2WCE A;  3A8R A;  5AEQ A;  1TN4 A;  1H8B A;  1SW8 A;  1DJW A;  3BFB A;  1MWN A;  1DC1 A;  1QAS A;  2K7C A;  5AFP A;  1JFK A;  2JWW A;  3S0B A;  1CLM A;  1S36 A;  5ER4 X;  5HKZ A;  1LIN A;  2PAS A;  1B9A A;  2BKI B;  1KFX S;  2MBX A;  5KTY A;  1DEK A;  3EK8 A;  1OE9 B;  1JC2 A;  5B8I B;  1Y1X A;  2LCP A;  4WQ3 A;  1KQV A;  1C7W A;  1EG4 A;  3BFA A;  1H4B A;  1AUI B;  2BCX A;  1SL7 A;  2OS8 C;  1L7Z A;  4C0J A;  3TUY C;  3BUW B;  1NCX A;  1XK4 A;  1ZUZ A;  4M2Q A;  4INX A;  1DEL A;  1OOH A;  4MRY A;  1Y1U A;  1OQP A;  4TNC A;  2KSP A;  2IS9 A;  2WCB A;  2Q91 A;  1A75 A;  3GK1 A;  1HT9 A;  1UWO A;  1IG5 A;  4N5X A;  1N2D A;  3E3R A;  1J1E A;  3CLN A;  3ICB A;  2WND A;  1K90 D;  1J7Q A;  1Y0V H;  2PMY A;  4MVF A;  4GGN A;  3D10 A;  1RRO A;  3DYE A;  4AOM A;  1SMG A;  4PHK A;  1K93 D;  1DJI A;  2LP3 A;  3GK4 X;  1QVI Y;  3VRR A;  4FTG A;  2LAN A;  4C0K A;  2L2E A;  4P5O E;  2GV5 A;  2L50 A;  2VRG A;  2KAX A;  4DUQ A;  1WLZ A;  1UUS A;  1YX7 A;  2LHL A;  3TS5 B;  2HPS A;  1F54 A;  1IGV A;  1W7I B;  2MRD A;  3IQO A;  2H8V A;  4HSZ A;  3A4U B;  3PM2 A;  4BY5 A;  2WCM A;  1XVJ A;  3L4A A;  4PT1 A;  3RLZ A;  1XFV O;  4OZD A;  4PAL A;  2QPT A;  1MXE A;  1QV1 A;  5ER5 A;  3TZ1 A;  3JTD C;  4DRW A;  5FI7 A;  4QJ3 B;  2BL0 C;  1SL8 A;  2SAS A;  5D3O A;  1PSB A;  1XK4 C;  1NX2 A;  1B8C A;  1OMV A;  1IQ3 A;  1C3Y A;  5I2O A;  2KDH A;  4HRE E;  2ZFD A;  1QVI Z;  2KI6 C;  3DZT A;  2KI4 B;  4I5J A;  5CPV A;  3NGV A;  2JRF A;  1J55 A;  4MLW A;  3KHE A;  3OX5 A;  2KQY A;  3OP0 A;  5CSN A;  4MSP A;  1QIW A;  3V2L A;  1QX5 B;  1KSO A;  1LS8 A;  4AQJ A;  3LK1 A;  3OHM B;  2F3Y A;  1GM0 A;  3SIA A;  3UNW A;  3TDU A;  3PAL A;  4CPV A;  2NCP A;  2H2K A;  1IKU A;  3RM1 A;  5AER A;  1BOD A;  2KFH A;  1TIZ A;  4QJ4 B;  2R2I A;  1YRU B;  4INW A;  4OKH A;  2DOQ A;  2JXL A;  1S6I A;  2WCJ A;  4YRU A;  1RK9 A;  4CFQ A;  3BYA A;  2ZRS A;  1V1F A;  3I5G B;  1XFU O;  5F6T A;  1REC A;  2LV7 A;  1J1D A;  1UHJ A;  3D76 A;  2D8N A;  1M31 A;  3OX6 A;  1S6J A;  1K96 A;  1S1E A;  1TCO B;  4YGD B;  2L5X B;  1MQ1 A;  4Q04 A;  3EK7 A;  2ZN9 A;  1YUS A;  1M45 A;  2O60 A;  1DQE A;  3DVE A;  1NSH A;  2MLE C;  2CXJ A;  4DCK A;  1FF1 A;  3UO9 A;  2I2R E;  4NDC A;  4DIR A;  3O6B A;  2PRU A;  1YTZ C;  2BAP A;  3FIA A;  2KYC A;  2SCP A;  2JC2 A;  2GTE A;  2WC5 A;  2KBI A;  4PCW A;  1ALW A;  2MJW B;  1MUX A;  5I94 A;  2H61 A;  3TS5 C;  3KEV A;  1M63 B;  3VRQ A;  4N1G A;  2LVI A;  1NX1 A;  3TDZ A;  4ZCU A;  1CTR A;  2AAO A;  1MR8 A;  1B7T Y;  2ZRT A;  1W7J B;  3R1V A;  5HKW A;  4A4B A;  3CR5 X;  4PHN A;  2LNK A;  3NSL A;  3CGA A;  3CS1 A;  1BMO A;  3B87 A;  3S0G A;  2BCB A;  3SS5 A;  2BKH B;  2BL0 B;  2WOS A;  3ZNI A;  2K7D A;  3AAK A;  3OB1 B;  2M49 B;  2KGB C;  2M7N A;  3I5I B;  4IL1 A;  1ODB A;  3PN7 B;  2M0R A;  1QV0 A;  1VRK A;  2LMV A;  3CR2 A;  1DJH A;  3PFV A;  4MN0 A;  1EG3 A;  4JQ0 D;  1KQM B;  2NXQ A;  3EVU A;  1N65 A;  5I8N A;  2Y1N A;  3PM8 A;  4C0L A;  2MHH A;  2P71 A;  2LM5 A;  4F0Z B;  3SG7 A;  1X02 A;  1LKJ A;  1NX0 A;  1JUO A;  3Q8I A;  5CSJ A;  3SJS A;  1C07 A;  2JTZ A;  2K61 A;  3BXK A;  1S5G Z;  3S0F A;  1CFC A;  2OTG C;  3CAB A;  5TNC A;  1L2O B;  1NCY A;  3PLF B;  4IJ7 A;  5CSF A;  1BOC A;  1MF8 B;  3I5G C;  1S3P A;  1SPY A;  2M9G A;  4ICB A;  1TWO A;  4OVN F;  3BOW B;  1ZOT B;  2FCD A;  3DF0 A;  1IWQ A;  1PVA A;  2JNX A;  1CLL A;  2I7A A;  3I5H C;  1YR5 A;  1RJV A;  2KI4 C;  4ETO A;  1ALV A;  2M97 A;  3I5H B;  4KYN A;  2L2C A;  1KK7 Z;  2JQ6 A;  1YVH A;  1DGU A;  1OW4 A;  2K2A A;  5EL2 A;  1OMR A;  2AUC A;  1BR4 B;  1K9K A;  1JF0 A;  2JOJ A;  1UHI A;  1SBJ A;  2KQ6 A;  3OB2 B;  2RGI A;  1QX2 A;  4BY4 A;  3NHI A;  4MEW A;  3OBV A;  1SCM C;  3O78 A;  4HRH A;  5HL1 A;  1EXR A;  4F7F A;  2KHN A;  1KCY A;  1GJY A;  1CKK A;  1IIO A;  4ORC B;  1OOJ A;  2FOT A;  5IBW A;  4FQO A;  2I18 A;  3WHT B;  1QXP A;  2BBM A;  3PSR A;  5JOL A;  4GBA A;  1DJY A;  2JPT A;  1Z4H A;  2JZI A;  2KOT A;  3DVJ A;  5D7F A;  1CM4 A;  1C7V A;  1QS7 A;  5JJG A;  1F55 A;  2LAP A;  1K95 A;  1DJX A;  2K0J A;  3D0Y B;  1S26 D;  3K1E A;  1EH2 A;  1XA5 A;  1CDP A;  1C3Z A;  1CDN A;  1NPQ A;  2K2F A;  4GNK B;  1YRT B;  2M1K B;  3EK4 A;  3DVK A;  1WRK A;  3CZ1 A;  2KLD A;  5HLO A;  3VRP A;  2JU0 A;  4CFR A;  2L5Y A;  4YGA A;  1QAT A;  3SS3 A;  1OOI X;  1TNQ A;  1OOF A;  1XFW O;  2BNX A;  2M3W A;  1IJ6 A;  4PDZ A;  3CYZ A;  1DF0 A;  1YX8 A;  3HX4 A;  1AJ4 A;  1UUR A;  2WC8 A;  2P70 A;  3NSO A;  3CWG A;  1WDC B;  1KK7 Y;  2ERB A;  1WDC C;  4YGE B;  3TUY B;  4ORB B;  3DVM A;  1GGW A;  3D73 A;  1XFX O;  2KPH A;  1R2U A;  3B88 A;  3JVT B;  1KFU S;  1IJ5 A;  2QEO A;  4MZK A;  3FE8 A;  1NCZ A;  3FE6 A;  3WNX B;  2F3Z A;  3BFH A;  3WHU B;  1T14 A;  3BQ3 A;  4P2Y B;  1Z2C B;  3SG6 A;  2WCH A;  3IQQ A;  1PVB A;  3L4L A;  1A29 A;  1OZS A;  4GUK A;  5FI6 A;  5KU1 A;  3HCM A;  2JPO A;  1SSE B;  1FW4 A;  3R1P A;  3NHT A;  4GGF A;  3TDI A;  5HKY A;  5FYX A;  3I5I C;  4XYN A;  3JTD B;  3BUN B;  1BLQ A;  2A4J A;  5I2Q A;  2LUX A;  3S0A A;  1JBA A;  2KBM A;  1FPW A;  2LLU A;  2AMI A;  2E6W A;  2JT0 A;  3BUO B;  2BEC A;  2L51 A;  2K60 A;  2KAV A;  2QEB A;  3B86 A;  1KQM C;  1DF0 B;  3CZ0 A;  3DD4 A;  5AXI A;  4I5L B;  2QEV A;  3L47 A;  1JWD A;  1UHK A;  1F4O A;  5DKR A;  1FI6 A;  4MBE A;  3KPX A;  1Y6W A;  1QTX A;  5HLV A;  1FI5 A;  1GGZ A;  1A2X A;  4HRG A;  1J7O A;  2LLT A;  4CLN A;  4USL A;  1IRJ A;  1KK8 B;  2ZN8 A;  3D77 A;  4R1E A;  1K9U A;  4FQT A;  3SG2 A;  1CMF A;  1SKT A;  1L2O C;  1PSR A;  2OTG B;  1RWY A;  1U5I B;  1G8I A;  2LE9 B;  2OS8 B;  2Y4Q A;  2KFF A;  1MXL C;  4PHM A;  1G4Y R;  2L0P A;  1P28 A;  3B6X A;  2YGU A;  3S0D A;  1NYA A;  3NSK A;  3VRN A;  4YGC B;  1NWD A;  1M39 A;  4YI8 A;  5BPJ A;  1NUB A;  1LA0 A;  3VGO A;  3F45 A;  3RZS A;  1ZMZ A;  2MLF C;  1QIV A;  2NCO A;  4GFT A;  5CSI A;  2Y1M A;  3WXA A;  2G9B A;  3KO0 A;  1PAL A;  4D1E A;  3EKH A;  2KI6 D;  1N0Y A;  1OZO A;  1WY9 A;  1AHR A;  2LVV A;  1TNW A;  4JWQ A;  3H4S E;  1B4C A;  1SL9 A;  3C1V A;  4NDB A;  1CFP A;  3DY9 A;  3EVR A;  3R1O A;  2K8M B;  3IF7 A;  1ZFS A;  1TUJ A;  2F2O A;  3CZT X;  1LA3 A;  4DS7 A;  3SG4 A;  3BOW A;  3SG3 A;  5KSZ A;  1TNP A;  3DXL A;  3BUX B;  1CDL A;  1A03 A;  3GK2 A;  1QLS A;  2EGD A;  2FJY A;  2LHI A;  4AQI A;  1NX3 A;  2K7O A;  2M1U A;  2LVK A;  4L9M A;  4MRX A;  3LCP C;  2CBL A;  1IH0 A;  4GPL B;  1QLK A;  2PYQ A;  4NDD A;  2Y5I A;  3SG5 A;  2COL B;  2CNP A;  1CLB A;  1G33 A;  3LLE A;  1D1O A;  1S5G Y;  4XJK A;  1BR1 B;  1NIW A;  3FE9 A;  1SR6 B;  4MZJ A;  4ORA B;  3AAJ A;  5AAN A;  1MHO A;  2KAY A;  4MZL A;  5J3X A;  2HET A;  5GQQ C;  4M2O A;  1QWV A;  1XFR A;  2WOR A;  3I5F B;  5K89 A;  2ZKM X;  3I5F C;  3NXA A;  4OR9 B;  2WCF A;  2ZND A;  1DGV A;  2BBN A;  3JVT C;  2LUC A;  1JSA A;  1TUZ A;  3K21 A;  5DKN A;  1DTL A;  1EJ3 A;  2GGM A;  5PAL A;  1B7T Z;  1RFJ A;  2JXC A;  2BE4 A;  1SK6 D;  1ZAC A;  1OOG A;  2CCM A; 
#chains in the Genus database with same CATH homology
 3M0W A;  4GGF C;  3FWB A;  1CFD A;  1K2H A;  1F4Q A;  1J7P A;  1Y1A A;  1SCV A;  4GAO A;  1TNX A;  1BU3 A;  1BT6 A;  1U5I A;  4ZCV A;  1YUT A;  1LVC D;  1XFY O;  1OMD A;  1AK8 A;  1KFU L;  1SY9 A;  1KFX L;  1K8U A;  1DVI A;  2KNE A;  2JT8 A;  2LVJ A;  1A4P A;  2BCA A;  3FS7 A;  1J7R A;  4I5N B;  2H61 C;  2Q4U A;  1F8H A;  1LXF C;  3SIB A;  2PVB A;  1B8R A;  1SCM B;  2HF5 A;  3O4Y A;  3QRX A;  4YGB B;  2KGR A;  2OPO A;  3AKA A;  4YBH B;  1EL4 A;  2K7B A;  1TOP A;  2JUL A;  2PAL A;  1QJT A;  1K94 A;  1KK8 C;  4PE4 A;  2M29 A;  1SYM A;  2HQ8 A;  2KYF A;  4PE1 A;  1PK0 D;  2CT9 A;  2ISD A;  1UP5 A;  1YVL A;  4WQ2 A;  1RTP 1;  3KF9 A;  3D0Y A;  5HYD A;  4OCI A;  1AJ5 A;  1JF2 A;  1XFZ O;  1YUU A;  4UPG A;  1SNL A;  4NQG A;  2V53 A;  2GGZ A;  2BE6 A;  4PE7 A;  1B8L A;  1Q80 A;  2I94 A;  1BG1 A;  1S6C A;  1XO5 A;  4PHJ A;  1PRW A;  1TCF A;  2O5G A;  2MA2 A;  3EKJ A;  1V1G A;  2P6B B;  1UHN A;  4I5K A;  1WRZ A;  3CTN A;  1CMG A;  2LC5 A;  4N1F A;  4XJK B;  1WLM A;  4U8D A;  1M46 A;  3O2P A;  2LMU A;  1CB1 A;  1SRA A;  1DJZ A;  1WRL A;  2FJU B;  1QX7 A;  3AKB A;  3FWC A;  4QJ5 B;  1KWO B;  2M7L A;  1KWO C;  3DF0 B;  1TRF A;  1IQ5 A;  2F33 A;  2MAZ A;  1XYD A;  3BUM B;  2E30 A;  2JNF A;  2QAC A;  3LK0 A;  1F70 A;  4A4C A;  2HQW A;  4WRI A;  2NZ0 A;  3CR4 X;  2L4H A;  2LMT A;  3MSE B;  1FBV A;  3PN7 C;  4JPZ B;  1JFJ A;  2ZNE A;  1AP4 A;  1DJG A;  1SR6 C;  5I2L A;  2B1U A;  2F8P A;  3EVV A;  1DMO A;  4E68 A;  3NSI A;  4CID A;  4OV2 A;  1F71 A;  2TN4 A;  1BF5 A;  1YUR A;  5D69 A;  2LLS A;  1CDM A;  4PE0 A;  2PSR A;  2F2P A;  1HQV A;  2LP2 A;  4YI9 A;  1NP8 A;  3GOF A;  4C0L A;  1KSM A;  1K9P A;  1TTX A;  2G2B A;  1OSA A;  3LL8 B;  4M2P A;  1UHH A;  2KFG A;  2L98 A;  1A75 B;  1DT7 B;  2M8U A;  1E8A A;  5G08 A;  1AVS A;  1GQM A;  2JT3 A;  2L4I A;  2EC6 B;  3PAT A;  3VRO A;  2EC6 C;  1B1G A;  1R6P A;  2FCE A;  1BJF A;  2EHB A;  1B47 A;  1PUL A;  5DKQ A;  2CTN A;  3ZWH A;  1CFF A;  1CNP A;  2NLN A;  2JTT A;  1CM1 A;  2WCE A;  3A8R A;  5AEQ A;  1TN4 A;  1H8B A;  1SW8 A;  1DJW A;  1MWN A;  1QAS A;  2K7C A;  5AFP A;  1JFK A;  2JWW A;  1CLM A;  1S36 A;  5ER4 X;  5HKZ A;  1LIN A;  2PAS A;  1B9A A;  2BKI B;  1KFX S;  2MBX A;  5KTY A;  3EK8 A;  1OE9 B;  1JC2 A;  5B8I B;  1Y1X A;  2LCP A;  4WQ3 A;  1KQV A;  1C7W A;  1EG4 A;  1H4B A;  1AUI B;  2BCX A;  1SL7 A;  2OS8 C;  1L7Z A;  4C0J A;  3TUY C;  3BUW B;  1NCX A;  1XK4 A;  1ZUZ A;  4M2Q A;  4MRY A;  1Y1U A;  1OQP A;  4TNC A;  2KSP A;  2IS9 A;  2WCB A;  2Q91 A;  1A75 A;  3GK1 A;  1HT9 A;  1UWO A;  1IG5 A;  4N5X A;  1N2D A;  3E3R A;  1J1E A;  3CLN A;  3ICB A;  2WND A;  1K90 D;  1J7Q A;  1Y0V H;  2PMY A;  4MVF A;  4GGN A;  3D10 A;  1RRO A;  4AOM A;  1SMG A;  4PHK A;  1K93 D;  1DJI A;  2LP3 A;  3GK4 X;  1QVI Y;  3VRR A;  4FTG A;  2LAN A;  4C0K A;  2L2E A;  4P5O E;  2GV5 A;  2L50 A;  2VRG A;  2KAX A;  4DUQ A;  1WLZ A;  1UUS A;  1YX7 A;  2LHL A;  3TS5 B;  2HPS A;  1F54 A;  1IGV A;  1W7I B;  2MRD A;  3IQO A;  4HSZ A;  3A4U B;  4BY5 A;  1XVJ A;  3RLZ A;  1XFV O;  4PAL A;  2QPT A;  1MXE A;  1QV1 A;  5ER5 A;  3TZ1 A;  3JTD C;  4DRW A;  4QJ3 B;  2BL0 C;  1SL8 A;  2SAS A;  1PSB A;  1XK4 C;  1NX2 A;  1B8C A;  1OMV A;  1IQ3 A;  5I2O A;  2KDH A;  4HRE E;  2ZFD A;  1QVI Z;  2KI6 C;  4I5J A;  2KI4 B;  5CPV A;  2JRF A;  1J55 A;  4MLW A;  3KHE A;  3OX5 A;  2KQY A;  3OP0 A;  5CSN A;  4MSP A;  1QIW A;  1QX5 B;  1KSO A;  4AQJ A;  3LK1 A;  3OHM B;  2F3Y A;  3SIA A;  3TDU A;  3PAL A;  4CPV A;  2NCP A;  2H2K A;  1IKU A;  3RM1 A;  5AER A;  1BOD A;  2KFH A;  1TIZ A;  4QJ4 B;  2R2I A;  1YRU B;  4OKH A;  2DOQ A;  2JXL A;  1S6I A;  4YRU A;  1RK9 A;  4CFQ A;  3BYA A;  2ZRS A;  1V1F A;  3I5G B;  1XFU O;  5F6T A;  1REC A;  2LV7 A;  1J1D A;  1UHJ A;  3OX6 A;  2D8N A;  1M31 A;  1S6J A;  1K96 A;  1S1E A;  1TCO B;  4YGD B;  2L5X B;  1MQ1 A;  4Q04 A;  3EK7 A;  2ZN9 A;  1YUS A;  1M45 A;  2O60 A;  3DVE A;  1NSH A;  2MLE C;  2CXJ A;  4DCK A;  1FF1 A;  2I2R E;  4NDC A;  4DIR A;  3O6B A;  2PRU A;  1YTZ C;  3FIA A;  2KYC A;  2SCP A;  2JC2 A;  4PCW A;  2KBI A;  1ALW A;  2MJW B;  1MUX A;  2H61 A;  3TS5 C;  3KEV A;  1M63 B;  3VRQ A;  4N1G A;  2LVI A;  1NX1 A;  3TDZ A;  4ZCU A;  1CTR A;  2AAO A;  1MR8 A;  1B7T Y;  2ZRT A;  1W7J B;  5HKW A;  4A4B A;  3CR5 X;  4PHN A;  2LNK A;  3NSL A;  3CGA A;  3CS1 A;  1BMO A;  2BCB A;  2BKH B;  2BL0 B;  2WOS A;  3ZNI A;  2K7D A;  3AAK A;  3OB1 B;  2M49 B;  2KGB C;  2M7N A;  3I5I B;  4IL1 A;  1ODB A;  3PN7 B;  2M0R A;  1QV0 A;  1VRK A;  2LMV A;  3CR2 A;  1DJH A;  3PFV A;  4MN0 A;  1EG3 A;  4JQ0 D;  1KQM B;  2NXQ A;  3EVU A;  1N65 A;  5I8N A;  3PM8 A;  2MHH A;  2LM5 A;  4F0Z B;  3SG7 A;  1X02 A;  1LKJ A;  1NX0 A;  1JUO A;  5CSJ A;  3SJS A;  1C07 A;  2JTZ A;  2K61 A;  3BXK A;  1S5G Z;  1CFC A;  2OTG C;  5TNC A;  1L2O B;  1NCY A;  3PLF B;  5CSF A;  1BOC A;  1MF8 B;  3I5G C;  1S3P A;  1SPY A;  2M9G A;  4ICB A;  4OVN F;  3BOW B;  1ZOT B;  2FCD A;  3DF0 A;  1IWQ A;  1PVA A;  2JNX A;  1CLL A;  2I7A A;  3I5H C;  1YR5 A;  1RJV A;  2KI4 C;  4ETO A;  1ALV A;  2M97 A;  3I5H B;  1KK7 Z;  2JQ6 A;  1YVH A;  1DGU A;  2K2A A;  1OMR A;  2AUC A;  1BR4 B;  1K9K A;  1JF0 A;  2JOJ A;  1UHI A;  1SBJ A;  2KQ6 A;  3OB2 B;  2RGI A;  1QX2 A;  4BY4 A;  4MEW A;  1SCM C;  3O78 A;  4HRH A;  1EXR A;  2KHN A;  1KCY A;  1GJY A;  1CKK A;  4ORC B;  1OOJ A;  2FOT A;  5IBW A;  4FQO A;  2I18 A;  3WHT B;  1QXP A;  2BBM A;  3PSR A;  5JOL A;  4GBA A;  1DJY A;  2JPT A;  2JZI A;  2KOT A;  3DVJ A;  5D7F A;  1CM4 A;  1C7V A;  1QS7 A;  5JJG A;  1F55 A;  2LAP A;  1K95 A;  1DJX A;  2K0J A;  3D0Y B;  1S26 D;  1EH2 A;  1XA5 A;  1CDP A;  1CDN A;  1NPQ A;  2K2F A;  4GNK B;  1YRT B;  2M1K B;  3EK4 A;  3DVK A;  1WRK A;  5HLO A;  3VRP A;  2JU0 A;  4CFR A;  4YGA A;  1QAT A;  1TNQ A;  1XFW O;  2M3W A;  1IJ6 A;  4PDZ A;  1DF0 A;  1YX8 A;  3HX4 A;  1AJ4 A;  1UUR A;  2WC8 A;  3NSO A;  3CWG A;  1WDC B;  1KK7 Y;  1WDC C;  4YGE B;  3TUY B;  4ORB B;  3DVM A;  1GGW A;  1XFX O;  1R2U A;  3JVT B;  1KFU S;  1IJ5 A;  4MZK A;  1NCZ A;  3WNX B;  2F3Z A;  3WHU B;  3BQ3 A;  4P2Y B;  3SG6 A;  3IQQ A;  1PVB A;  1A29 A;  1OZS A;  4GUK A;  5KU1 A;  3HCM A;  1FW4 A;  4GGF A;  3TDI A;  5HKY A;  5FYX A;  3I5I C;  4XYN A;  3JTD B;  3BUN B;  1BLQ A;  2A4J A;  5I2Q A;  2LUX A;  1JBA A;  2KBM A;  1FPW A;  2LLU A;  2AMI A;  2E6W A;  2JT0 A;  3BUO B;  2BEC A;  2L51 A;  2KAV A;  5AXI A;  1KQM C;  1DF0 B;  3DD4 A;  4I5L B;  1JWD A;  1UHK A;  1F4O A;  5DKR A;  1FI6 A;  4MBE A;  3KPX A;  1Y6W A;  1QTX A;  5HLV A;  1FI5 A;  1GGZ A;  1A2X A;  4HRG A;  1J7O A;  2LLT A;  4CLN A;  4USL A;  1IRJ A;  1KK8 B;  2ZN8 A;  4R1E A;  3SG2 A;  1K9U A;  1CMF A;  1SKT A;  1L2O C;  1PSR A;  2OTG B;  1RWY A;  1U5I B;  1G8I A;  2LE9 B;  2OS8 B;  2Y4Q A;  2KFF A;  1MXL C;  4PHM A;  1G4Y R;  2L0P A;  1NYA A;  3NSK A;  3VRN A;  4YGC B;  1NWD A;  1M39 A;  4YI8 A;  5BPJ A;  1NUB A;  1LA0 A;  3VGO A;  3F45 A;  1ZMZ A;  2MLF C;  1QIV A;  2NCO A;  4GFT A;  5CSI A;  2Y1M A;  3WXA A;  2G9B A;  3KO0 A;  1PAL A;  4D1E A;  3EKH A;  2KI6 D;  1N0Y A;  1OZO A;  1WY9 A;  1AHR A;  2LVV A;  1TNW A;  4JWQ A;  3H4S E;  1B4C A;  1SL9 A;  3C1V A;  4NDB A;  1CFP A;  3EVR A;  2K8M B;  3IF7 A;  1ZFS A;  2F2O A;  3CZT X;  1LA3 A;  4DS7 A;  3SG4 A;  3BOW A;  3SG3 A;  5KSZ A;  1TNP A;  3BUX B;  1CDL A;  1A03 A;  3GK2 A;  1QLS A;  2EGD A;  2LHI A;  4AQI A;  1NX3 A;  2K7O A;  2M1U A;  2LVK A;  4L9M A;  4MRX A;  3LCP C;  2CBL A;  1IH0 A;  4GPL B;  1QLK A;  4NDD A;  2Y5I A;  3SG5 A;  2COL B;  2CNP A;  1CLB A;  1G33 A;  3LLE A;  1D1O A;  1S5G Y;  4XJK A;  1BR1 B;  1NIW A;  1SR6 B;  4MZJ A;  4ORA B;  3AAJ A;  5AAN A;  1MHO A;  2KAY A;  4MZL A;  5J3X A;  2HET A;  5GQQ C;  4M2O A;  2WOR A;  3I5F B;  5K89 A;  2ZKM X;  3I5F C;  3NXA A;  4OR9 B;  2WCF A;  2ZND A;  1DGV A;  2BBN A;  3JVT C;  2LUC A;  1JSA A;  3K21 A;  5DKN A;  1DTL A;  1EJ3 A;  2GGM A;  5PAL A;  1B7T Z;  1RFJ A;  2JXC A;  2BE4 A;  1SK6 D;  1ZAC A;  2Y1N A;  2CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...