1SPYA

Regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1spyA00
5HKWA 4WQ3A 1K9UA 3E3RA 2SASA 4AOMA 1DGUA 1NIWA 2COLB 5I8NA 5AERA 2PSRA 2L51A 1SCMC 2MRDA 1CLLA 1S6IA 3BUXB 3DVMA 1TCOB 1IWQA 1NX0A 2KAYA 5AANA 2KBIA 1BT6A 3OB2B 5BPJA 2TN4A 5PALA 2CT9A 2LLTA 1CM1A 3FWCA 1G8IA 1K9PA 1XK4C 1J7QA 2NLNA 4PCWA 1FI6A 4DUQA 2M9GA 1C07A 1YUTA 3WHUB 2MA2A 2NXQA 2JOJA 2LMTA 4NDCA 1K96A 2KQYA 2KFFA 1JBAA 1XA5A 3DVEA 4PE1A 2LVVA 3VROA 4I5JA 3EKJA 2AMIA 2KHNA 1CFDA 3CS1A 3EK7A 1AK8A 1A75A 1RK9A 3DF0A 4MSPA 4PDZA 1XFVO 1NPQA 1M46A 3IF7A 2LANA 4JPZB 2NCOA 1NCZA 1Y1UA 2E30A 1B8CA 1DJWA 3NSLA 4GUKA 1CFFA 1XFZO 2KFHA 1CB1A 5AFPA 1TNWA 2NCPA 1JUOA 3TDZA 2BE4A 1DJHA 3OX5A 3SJSA 4YGDB 2FCEA 2LLSA 1A4PA 1PSBA 4AQJA 2KGBC 1XYDA 4IL1A 2L4HA 4FQOA 1J7RA 2DOQA 2IS9A 3LL8B 2WCEA 1QLKA 3I5HB 3WHTB 1QV1A 3BQ3A 2EGDA 4MLWA 1KFXS 1SPYA 2ZNDA 3KO0A 1A29A 2WORA 1WLZA 2F3ZA 2K7DA 3VRNA 2K2AA 4I5NB 1TN4A 1CFCA 4F0ZB 2KGRA 1A75B 1AJ5A 1XFXO 2CTNA 2HF5A 1ZFSA 3EK4A 1QJTA 1XK4A 3H4SE 4ETOA 2AAOA 1U5IA 1NSHA 4MN0A 4A4CA 1B1GA 1LA3A 4I5LB 5GQQC 2K7BA 1KFUS 4OVNF 1PVBA 1C7VA 2PRUA 5HKZA 2OS8B 1OSAA 2I2RE 3OB1B 1WRKA 4PHJA 1ZUZA 2VRGA 3LK1A 3I5HC 2LMUA 1V1GA 1QIVA 4UPGA 5K89A 4C0JA 4ICBA 4N5XA 2ZN9A 2CXJA 3KPXA 3BUMB 2KFGA 3RLZA 1B4CA 1G4YR 3LLEA 1XO5A 2JNXA 1B7TZ 3SG5A 2LAPA 5AEQA 2M7LA 1OMVA 1OZOA 3D0YB 4XYNA 5CSIA 1MHOA 1DTLA 2H2KA 2JTZA 2HETA 1Y0VH 1BU3A 1OMRA 4FTGA 3TS5B 1DJZA 3TZ1A 1OE9B 3OP0A 1DJGA 4GFTA 1NP8A 4GAOA 1B47A 2BCAA 1QX5B 2MHHA 3KEVA 1BF5A 4MZJA 3EVUA 2HQ8A 4QJ5B 2MLFC 4TNCA 1PK0D 2WCBA 1S6CA 1Y6WA 1YX8A 3HCMA 1RTP1 2JXLA 5CPVA 1YX7A 4DS7A 1M63B 3CZTX 1LXFC 1DJXA 1YUUA 1EH2A 2LV7A 4E68A 5CSJA 2KI6C 1HQVA 1JWDA 3SG2A 4NQGA 1IRJA 1M31A 1OOJA 2LVJA 2JT8A 2ZRSA 3VRPA 1CMGA 2KQ6A 3I5FC 2M7NA 1BJFA 3PN7C 4MBEA 1BODA 1SMGA 1ZMZA 1XFUO 1QATA 2LE9B 2L2EA 4N1FA 3PALA 5DKNA 3PFVA 2V53A 3C1VA 1UP5A 2F33A 4M2PA 1SK6D 4P5OE 3TS5C 2JULA 5D7FA 1SR6C 3BUNB 2BL0B 2WNDA 1CDMA 1RECA 2WC8A 1F71A 1N0YA 1YR5A 1TRFA 3KHEA 1K94A 2QPTA 1WRLA 1NCYA 5AXIA 1DMOA 2MLEC 2QACA 1CDNA 3EKHA 2Y1MA 3D10A 2Q4UA 3AKAA 3DVJA 1IKUA 1J7PA 3IQQA 1SYMA 4YI8A 2JT0A 1B9AA 1YURA 2FJUB 2ISDA 2KYFA 1RJVA 4JWQA 5KSZA 5FYXA 4YGEB 1BR4B 1FI5A 1G33A 4ORAB 1A03A 4R1EA 4OV2A 1YUSA 1F55A 3JTDC 2KDHA 2K2FA 1OQPA 4OCIA 5HKYA 3VRRA 1H8BA 1K93D 1BR1B 2O60A 1PSRA 2BL0C 1UHJA 4WRIA 1IG5A 1SL7A 4XJKA 3SIAA 1J1EA 1TTXA 3AAKA 3IQOA 2PASA 4MEWA 4ORCB 4NDBA 1TNXA 3M0WA 1GGWA 2M49B 1TNPA 1EG4A 4QJ3B 2A4JA 1IJ5A 1QX2A 1SW8A 2JRFA 1TCFA 1JFJA 1JF0A 1WY9A 2LP3A 3O6BA 1PULA 2JU0A 2ZRTA 1AHRA 4JQ0D 1F54A 3NXAA 2I18A 1Y1XA 2BBMA 1KSOA 2K7OA 3CLNA 1W7JB 3EK8A 3TUYB 1CNPA 2MAZA 2BECA 4M2QA 1F8HA 3D0YA 2M1UA 2F2OA 5ER4X 1KWOB 1SKTA 1B7TY 3PM8A 4PHKA 1MF8B 2PALA 1UURA 4D1EA 2K61A 3SG7A 1XVJA 3NSIA 1K90D 2M1KB 3WNXB 1F4QA 3CR2A 3PSRA 1SRAA 3SG6A 4XJKB 2JPTA 4GGFC 3CGAA 2Y5IA 1C7WA 3MSEB 4PHMA 2M97A 1KFXL 1YVLA 2O5GA 3O4YA 3HX4A 1YRUB 1MQ1A 1F4OA 1L2OC 4HRHA 3ZWHA 1M45A 1R2UA 3I5FB 5DKRA 1SCVA 3TUYC 3PN7B 1H4BA 2JXCA 1B8RA 1Y1AA 1UHHA 3KF9A 3TDUA 1XFWO 1SNLA 2LHIA 1KWOC 3EVVA 4L9MA 1S26D 2ZN8A 3ICBA 1B8LA 2K7CA 2ZNEA 4M2OA 1SR6B 2BE6A 2KI4B 2KOTA 1K95A 1KFUL 1BMOA 4PE0A 5G08A 5I2QA 2F8PA 2PVBA 5D69A 2JZIA 3GOFA 4BY4A 1MXEA 4BY5A 4OR9B 2K0JA 1DGVA 2L98A 5JJGA 1MUXA 2LHLA 1FBVA 3CR5X 1EJ3A 1ALWA 4YGAA 5J3XA 2LMVA 1IJ6A 1QASA 3BOWA 4PHNA 3O2PA 1F70A 3DVKA 1NX2A 1NUBA 1D1OA 1Q80A 2JT3A 1YRTB 2PMYA 1UHNA 1JSAA 2I94A 4P2YB 1JFKA 1DF0A 2LP2A 1ALVA 4USLA 1R6PA 4N1GA 4YGBB 1BOCA 1PALA 1WDCB 1GQMA 2L0PA 1OMDA 1NYAA 3JTDB 1KCYA 2MJWB 1KQMC 4GPLB 1QX7A 2H61C 1IGVA 2M8UA 3SIBA 2L5XB 2WOSA 3GK4X 2KI4C 1S5GY 2Y1NA 5I2LA 4GGFA 4DCKA 3EVRA 2WCFA 3NSKA 2MBXA 3RM1A 1N2DA 1FW4A 2OTGB 2KSPA 4CFQA 1CLMA 3FS7A 2M0RA 4YI9A 3CWGA 4AQIA 1GGZA 1CKKA 1QXPA 1WLMA 5CSFA 1CTRA 1QLSA 2D8NA 1HT9A 1MWNA 1K8UA 4GNKB 4DIRA 1SY9A 3SG4A 1DT7B 3BOWB 4A4BA 1J55A 2LUXA 2BBNA 1XFYO 1K9KA 1MXLC 2CNPA 4PE7A 1KK8B 1FF1A 1DF0B 1S5GZ 1UWOA 3ZNIA 1PRWA 2KYCA 4MZKA 2LNKA 3GK2A 1MR8A 3LCPC 3JVTC 3LK0A 1IQ5A 1AUIB 2BCBA 4HRGA 1DJIA 3CR4X 4MRXA 1IH0A 1WDCC 1TNQA 3BXKA 4ZCUA 2HPSA 1CLBA 2EC6B 1CFPA 1KQVA 4DRWA 2RGIA 3A4UB 2G2BA 4GBAA 1PVAA 1DJYA 4CFRA 1BG1A 3I5IB 2JQ6A 3AAJA 2OTGC 3BUWB 1LVCD 5DKQA 5KU1A 3TDIA 3PATA 1UHKA 3DD4A 4Q04A 2LVKA 5JOLA 3A8RA 2KAVA 2FOTA 1S1EA 4NDDA 1L2OB 2Y4QA 3AKBA 1DVIA 4QJ4B 1JC2A 5CSNA 1E8AA 1KK8C 3FWBA 1S3PA 1LINA 2LVIA 1QIWA 5HLVA 2H61A 3OX6A 2F2PA 2GGMA 1CDPA 3CTNA 2KAXA 3PLFB 1L7ZA 2CCMA 1SBJA 2EC6C 2M3WA 4OKHA 1NX1A 1RWYA 2JWWA 1FPWA 4ORBB 5TNCA 1S36A 1AJ4A 1KK7Y 1TIZA 3I5IC 2B1UA 4MZLA 4PALA 1QVIY 1TOPA 4CPVA 2F3YA 4PE4A 3BYAA 1EL4A 3DF0B 3QRXA 1QV0A 3F45A 4YBHB 1QTXA 1ZACA 2AUCA 1M39A 2LC5A 2KI6D 4MRYA 2ZKMX 5IBWA 4I5KA 1ZOTB 2BKHB 2G9BA 2KNEA 2L50A 3GK1A 1YTZC 2SCPA 1KSMA 1X02A 1GJYA 1S6JA 1NWDA 1KK7Z 1NX3A 1UHIA 2L4IA 1SL8A 3I5GB 4HSZA 4HREE 1QVIZ 1KQMB 4YGCB 3SG3A 1K2HA 4GGNA 2JTTA 2CBLA 4C0KA 3VRQA 2LUCA 5HLOA 2I7AA 2FCDA 1AVSA 1SL9A 1N65A 1VRKA 5F6TA 4ZCVA 4U8DA 4C0LA 4WQ2A 5I2OA 1EXRA 1J1DA 2K8MB 1BLQA 3WXAA 5HYDA 1JF2A 4CIDA 1NCXA 2JC2A 1SCMB 1V1FA 2GV5A 1AP4A 4YRUA 1UUSA 2JNFA 1LKJA 1W7IB 2Q91A 5B8IB 3K21A 1CDLA 5KTYA 1IQ3A 2GGZA 4MVFA 4CLNA 1ODBA 2EHBA 1U5IB 1A2XA 2P6BB 1WRZA 3NSOA 2ZFDA 1CM4A 2BCXA 2OPOA 3FIAA 5ER5A 2KBMA 2R2IA 1LA0A 3JVTB 1CMFA 1QS7A 1RFJA 2BKIB 3VGOA 1J7OA 2OS8C 3I5GC 2LM5A 1RROA 3O78A 3BUOB 1OZSA 2M29A 2HQWA 1EG3A 2LCPA 2NZ0A 2LLUA 2E6WA 1YVHA 3OHMB
chains in the Genus database with same CATH superfamily
5HKWA 4WQ3A 1K9UA 3E3RA 2SASA 4AOMA 1DGUA 1NIWA 2COLB 3BJHA 5I8NA 5AERA 2PSRA 2L51A 1SCMC 1TWOA 1CLLA 2MRDA 1S6IA 1SSEB 3BUXB 3CZ2A 1TCOB 1IWQA 1NX0A 3DVMA 2KAYA 2KPHA 3S0BA 5AANA 2KBIA 1BT6A 3OB2B 5BPJA 2TN4A 5PALA 2CT9A 2LLTA 1CM1A 3FWCA 1G8IA 1K9PA 1XK4C 3L4AA 1J7QA 2NLNA 4PCWA 2QEHA 1FI6A 4DUQA 2M9GA 1C07A 4JD9A 1YUTA 3WHUB 2MA2A 2NXQA 2JOJA 1W9ZA 2LMTA 1C3ZA 4NDCA 1K96A 2KQYA 3D77A 2KFFA 1JBAA 1XA5A 3DVEA 4PE1A 2LVVA 3VROA 4I5JA 3EKJA 2AMIA 2KHNA 1CFDA 3CS1A 3V2LA 3RZSA 3EK7A 1AK8A 1A75A 1RK9A 3DF0A 4MSPA 4PDZA 1XFVO 1NPQA 1M46A 3IF7A 2LANA 1DEKA 4JKTA 2NCOA 1NCZA 1Y1UA 2E30A 1B8CA 1DJWA 3NSLA 4GUKA 1CFFA 1XFZO 2KFHA 1CB1A 5AFPA 1TNWA 2NCPA 1JUOA 3TDZA 2BE4A 1DJHA 3OX5A 3SJSA 2WCLA 4YGDB 2FCEA 2LLSA 1A4PA 1PSBA 2ERBA 4AQJA 3CZ0A 2KGBC 1XYDA 4IL1A 2L4HA 4FQOA 1J7RA 2DOQA 1DQEA 2IS9A 3LL8B 2WCEA 1QLKA 3I5HB 3WHTB 1QV1A 3BQ3A 1Z2CB 2EGDA 1KFXS 3FE8A 4MLWA 1SPYA 2P71A 2ZNDA 3DXLA 3KO0A 1A29A 2WORA 1WLZA 2F3ZA 2K7DA 3VRNA 2K2AA 4I5NB 4IJ7A 3S0EA 3O4XA 1TN4A 1CFCA 4F0ZB 2KGRA 1A75B 1AJ5A 1XFXO 2CTNA 2HF5A 1ZFSA 5D3OA 3EK4A 1QJTA 1T14A 1XK4A 3NGVA 3H4SE 2FJYA 4ETOA 2AAOA 1U5IA 1NSHA 4MN0A 4A4CA 1B1GA 1LA3A 4I5LB 5GQQC 2K7BA 1KFUS 4OVNF 1PVBA 1C7VA 2PRUA 5HKZA 2OS8B 1OSAA 2I2RE 3OB1B 3PJIA 1WRKA 4PHJA 1ZUZA 2VRGA 3LK1A 3I5HC 2LMUA 1V1GA 1QIVA 4UPGA 1OOGA 4C0JA 4ICBA 4N5XA 2ZN9A 2CXJA 5K89A 3KPXA 3BUMB 2KFGA 3RLZA 1B4CA 5I94A 1G4YR 3LLEA 1XO5A 2WC6A 2JNXA 1B7TZ 3SG5A 2JPOA 2LAPA 5AEQA 2M7LA 3SS3A 3B88A 1OMVA 1OZOA 3L47A 3D0YB 4XYNA 5CSIA 1MHOA 1DTLA 2WC5A 2H2KA 2JTZA 2HETA 1Y0VH 1BU3A 1OMRA 4FTGA 3TS5B 1DJZA 3TZ1A 1OE9B 3OP0A 1DJGA 1OOIX 4GFTA 1NP8A 4GAOA 1B47A 2BCAA 1QX5B 2MHHA 3KEVA 1BF5A 4MZJA 3EVUA 2HQ8A 4QJ5B 2MLFC 2K60A 4TNCA 1PK0D 2WCBA 1S6CA 1Y6WA 1YX8A 3HCMA 1RTP1 1TUJA 2JXLA 3B7AA 5CPVA 1YX7A 3L4LA 4DS7A 1M63B 3CZTX 1LXFC 1DJXA 2WCKA 1YUUA 1EH2A 2LV7A 4E68A 1DELA 5CSJA 2KI6C 1HQVA 1JWDA 3SG2A 4NQGA 1IRJA 1M31A 1OOJA 2LVJA 2JT8A 2ZRSA 3VRPA 1CMGA 2KQ6A 3CDNA 3B86A 3I5FC 2M7NA 3CYZA 1BJFA 3PN7C 4MBEA 1BODA 1SMGA 1ZMZA 1XFUO 1QATA 2LE9B 3CZ1A 2L2EA 3R1VA 3PALA 4N1FA 3PFVA 5DKNA 2V53A 3C1VA 1UP5A 2F33A 4M2PA 1SK6D 3NHTA 4P5OE 3TS5C 2JULA 5D7FA 3FE6A 1SR6C 3BUNB 2BL0B 2WNDA 1CDMA 2WCJA 1RECA 2WC8A 2BNXA 3DYEA 1F71A 5DICA 1N0YA 1YR5A 3N7HA 1TRFA 3KHEA 1K94A 2QPTA 3D75A 1WRLA 1NCYA 5AXIA 1DMOA 2MLEC 2QACA 1CDNA 3EKHA 2Y1MA 3D10A 2Q4UA 3AKAA 2QEBA 3DVJA 1IKUA 1J7PA 3IQQA 1SYMA 4YI8A 2JT0A 1B9AA 1YURA 2FJUB 2ISDA 1ORGA 2KYFA 1RJVA 4JWQA 5KSZA 5FYXA 4YGEB 1BR4B 3SS4A 2GTEA 1FI5A 1G33A 4ORAB 2L2CA 1A03A 4R1EA 4OV2A 1YUSA 1F55A 3JTDC 2KDHA 2K2FA 1OQPA 4OCIA 5HKYA 3VRRA 1H8BA 1K93D 1BR1B 2O60A 1PSRA 2BL0C 1UHJA 2WCHA 1IG5A 1SL7A 4WRIA 4XJKA 1J1EA 3S0GA 3SIAA 3R1PA 1TTXA 3AAKA 3IQOA 2PASA 4MEWA 4ORCB 4NDBA 1TNXA 5EL2A 3M0WA 1GGWA 2M49B 5FI7A 5HL1A 1TNPA 1EG4A 4QJ3B 2A4JA 4FQTA 1IJ5A 1QX2A 1SW8A 2JRFA 1TCFA 1JFJA 1JF0A 1WY9A 2LP3A 3O6BA 1PULA 2JU0A 2ZRTA 1AHRA 4JQ0D 1F54A 3NXAA 2I18A 1Y1XA 2BBMA 1KSOA 2K7OA 3CLNA 1W7JB 3EK8A 3TUYB 1CNPA 2MAZA 2BECA 4M2QA 1F8HA 1QWVA 3D0YA 2M1UA 2F2OA 5ER4X 1KWOB 3S0DA 5FI2A 1OOHA 1SKTA 1B7TY 3PM8A 4PHKA 1MF8B 2PALA 1UURA 4D1EA 2K61A 3SG7A 1XVJA 3NSIA 1K90D 2M1KB 3WNXB 1F4QA 1LS8A 3CR2A 3FE9A 3K1EA 3PSRA 1SRAA 3SG6A 4XJKB 2JPTA 4GGFC 2H8VA 3CGAA 4INXA 2Y5IA 1C7WA 3MSEB 1IIOA 4OZDA 3S0FA 4PHMA 2M97A 3S0AA 1KFXL 1YVLA 3VB1A 2O5GA 3O4YA 1C3YA 3R1OA 3HX4A 1YRUB 1MQ1A 1F4OA 1L2OC 4HRHA 3ZWHA 1M45A 1R2UA 3I5FB 5DKRA 1SCVA 3TUYC 3PN7B 1H4BA 2JXCA 1B8RA 1Y1AA 1UHHA 3DZTA 3KF9A 3TDUA 1XFWO 1SNLA 2LHIA 1KWOC 3EVVA 4L9MA 1S26D 2ZN8A 3ICBA 1B8LA 2K7CA 2ZNEA 3NHIA 4M2OA 1SR6B 2BE6A 2KI4B 2KOTA 1K95A 1KFUL 1BMOA 4PE0A 5G08A 5I2QA 2F8PA 2PVBA 5D69A 2JZIA 3GOFA 1XFRA 4BY4A 1MXEA 4BY5A 4OR9B 2K0JA 1DGVA 2L98A 5JJGA 1MUXA 2LHLA 1FBVA 3CR5X 1EJ3A 1ALWA 4YGAA 5J3XA 2PQLA 2LMVA 1IJ6A 1QASA 3BOWA 4PHNA 3O2PA 1F70A 3DVKA 1NX2A 3SS5A 1NUBA 1D1OA 1Q80A 2JT3A 1YRTB 2PMYA 1UHNA 1JSAA 2I94A 4P2YB 1JFKA 1DF0A 2LP2A 2WCMA 1ALVA 4USLA 1R6PA 3D74A 4N1GA 4YGBB 1BOCA 1PALA 1WDCB 1GQMA 2L0PA 1OMDA 1NYAA 2QDIA 3JTDB 2MJWB 1KCYA 1KQMC 4GPLB 1QX7A 2H61C 1IGVA 2M8UA 3SIBA 2L5XB 2WOSA 3GK4X 2KI4C 1S5GY 2Y1NA 5I2LA 4GGFA 4DCKA 3EVRA 2WCFA 4KYNA 3NSKA 2MBXA 3RM1A 1N2DA 1FW4A 2OTGB 2KSPA 4CFQA 1CLMA 3FS7A 2M0RA 4YI9A 3CWGA 4AQIA 1GGZA 1CKKA 1QXPA 1WLMA 5CSFA 1CTRA 1QLSA 2D8NA 1HT9A 1MWNA 1K8UA 3QMEA 4GNKB 1SY9A 3SG4A 4DIRA 1DT7B 3BOWB 4A4BA 1J55A 2LUXA 2BBNA 1XFYO 1K9KA 1MXLC 2CNPA 4PE7A 1KK8B 1FF1A 1DF0B 1S5GZ 1UWOA 3ZNIA 1PRWA 2KYCA 4MZKA 2LNKA 3GK2A 1MR8A 3LCPC 3JVTC 3LK0A 1IQ5A 1AUIB 2BCBA 3B6XA 1DJIA 3CR4X 4HRGA 4MRXA 1IH0A 1WDCC 1TNQA 3BXKA 4ZCUA 2HPSA 1CLBA 2EC6B 1CFPA 1KQVA 5FI6A 4DRWA 2RGIA 3A4UB 2G2BA 4GBAA 1PVAA 1DJYA 4CFRA 1BG1A 3I5IB 3PM2A 2JQ6A 3AAJA 2QEVA 2OTGC 3BUWB 1LVCD 5DKQA 5KU1A 2KLDA 3TDIA 3PATA 1UHKA 3DD4A 4Q04A 2LVKA 5JOLA 3D73A 3A8RA 2KAVA 2FOTA 1S1EA 3EG5B 4NDDA 1L2OB 2Y4QA 3AKBA 1DVIA 4QJ4B 1JC2A 3OBVA 5CSNA 1E8AA 1KK8C 3FWBA 3OGNA 3CABA 1S3PA 1LINA 2LVIA 1QIWA 5HLVA 2H61A 3OX6A 2F2PA 2GGMA 1CDPA 3CTNA 2KAXA 3PLFB 1L7ZA 2CCMA 3UO9A 1SBJA 2EC6C 2M3WA 4OKHA 1NX1A 3R72A 1RWYA 2JWWA 1FPWA 4ORBB 5TNCA 2QEOA 1S36A 1AJ4A 1KK7Y 1TIZA 3I5IC 2B1UA 3BFHA 4MZLA 1QVIY 1TOPA 4PALA 4CPVA 1DC1A 2F3YA 4PE4A 3BYAA 1EL4A 3DF0B 3QRXA 1QV0A 3F45A 4YBHB 4JPZB 1QTXA 1ZACA 2AUCA 1M39A 1Z4HA 1OOFA 2LC5A 2KI6D 4MRYA 2P70A 2ZKMX 5IBWA 4I5KA 1ZOTB 3Q8IA 2BKHB 2G9BA 2KNEA 3D78A 2L50A 3GK1A 1YTZC 2SCPA 3UNWA 3B87A 1KSMA 4F7FA 1X02A 1GJYA 1S6JA 1NWDA 1KK7Z 1NX3A 1UHIA 2L4IA 1SL8A 3I5GB 4HSZA 4HREE 1QVIZ 1KQMB 4YGCB 3SG3A 1P28A 1K2HA 4GGNA 2JTTA 2CBLA 4C0KA 3VRQA 2LUCA 5HLOA 2BAPA 2I7AA 2FCDA 1AVSA 1SL9A 1N65A 1VRKA 2KLEA 2L5YA 5F6TA 4ZCVA 4U8DA 4C0LA 4WQ2A 5I2OA 1EXRA 1J1DA 2K8MB 1BLQA 3WXAA 5HYDA 1JF2A 4CIDA 1NCXA 2JC2A 1SCMB 1V1FA 3BFBA 2GV5A 3IVTA 4PT1A 1AP4A 1GM0A 4YRUA 1UUSA 2JNFA 1LKJA 1W7IB 2PYQA 2Q91A 5B8IB 3K21A 1CDLA 3D76A 5KTYA 1IQ3A 2GGZA 4MVFA 4CLNA 1ODBA 1TUZA 2EHBA 1U5IB 1A2XA 1OW4A 2P6BB 1WRZA 3NSOA 2ZFDA 1CM4A 2BCXA 2OPOA 3FIAA 5ER5A 2YGUA 2KBMA 2R2IA 1LA0A 3JVTB 1CMFA 1QS7A 1RFJA 2BKIB 3BFAA 3VGOA 1J7OA 2OS8C 3I5GC 2LM5A 1RROA 3O78A 3BUOB 1OZSA 4INWA 2M29A 2HQWA 1EG3A 2LCPA 2NZ0A 2LLUA 2E6WA 3DY9A 1YVHA 3OHMB
chains in the Genus database with same CATH topology
5HKWA 4WQ3A 1K9UA 3E3RA 2SASA 4AOMA 1DGUA 1NIWA 2COLB 5I8NA 5AERA 2PSRA 2L51A 1SCMC 2MRDA 1CLLA 1S6IA 3BUXB 3DVMA 1TCOB 1IWQA 1NX0A 2KAYA 5AANA 2KBIA 1BT6A 3OB2B 5BPJA 2TN4A 5PALA 2CT9A 2LLTA 1CM1A 3FWCA 1G8IA 1K9PA 1XK4C 1J7QA 2NLNA 4PCWA 1FI6A 4DUQA 2M9GA 1C07A 1YUTA 3WHUB 2MA2A 2NXQA 2JOJA 2LMTA 4NDCA 1K96A 2KQYA 2KFFA 1JBAA 1XA5A 3DVEA 4PE1A 2LVVA 3VROA 4I5JA 3EKJA 2AMIA 2KHNA 1CFDA 3CS1A 3EK7A 1AK8A 1A75A 1RK9A 3DF0A 4MSPA 4PDZA 1XFVO 1NPQA 1M46A 3IF7A 2LANA 4JPZB 2NCOA 1NCZA 1Y1UA 2E30A 1B8CA 1DJWA 3NSLA 4GUKA 1CFFA 1XFZO 2KFHA 1CB1A 5AFPA 1TNWA 2NCPA 1JUOA 3TDZA 2BE4A 1DJHA 3OX5A 3SJSA 4YGDB 2FCEA 2LLSA 1A4PA 1PSBA 4AQJA 2KGBC 1XYDA 4IL1A 2L4HA 4FQOA 1J7RA 2DOQA 2IS9A 3LL8B 2WCEA 1QLKA 3I5HB 3WHTB 1QV1A 3BQ3A 2EGDA 4MLWA 1KFXS 1SPYA 2ZNDA 3KO0A 1A29A 2WORA 1WLZA 2F3ZA 2K7DA 3VRNA 2K2AA 4I5NB 1TN4A 1CFCA 4F0ZB 2KGRA 1A75B 1AJ5A 1XFXO 2CTNA 2HF5A 1ZFSA 3EK4A 1QJTA 1XK4A 3H4SE 4ETOA 2AAOA 1U5IA 1NSHA 4MN0A 4A4CA 1B1GA 1LA3A 4I5LB 5GQQC 2K7BA 1KFUS 4OVNF 1PVBA 1C7VA 2PRUA 5HKZA 2OS8B 1OSAA 2I2RE 3OB1B 1WRKA 4PHJA 1ZUZA 2VRGA 3LK1A 3I5HC 2LMUA 1V1GA 1QIVA 4UPGA 5K89A 4C0JA 4ICBA 4N5XA 2ZN9A 2CXJA 3KPXA 3BUMB 2KFGA 3RLZA 1B4CA 1G4YR 3LLEA 1XO5A 2JNXA 1B7TZ 3SG5A 2LAPA 5AEQA 2M7LA 1OMVA 1OZOA 3D0YB 4XYNA 5CSIA 1MHOA 1DTLA 2H2KA 2JTZA 2HETA 1Y0VH 1BU3A 1OMRA 4FTGA 3TS5B 1DJZA 3TZ1A 1OE9B 3OP0A 1DJGA 4GFTA 1NP8A 4GAOA 1B47A 2BCAA 1QX5B 2MHHA 3KEVA 1BF5A 4MZJA 3EVUA 2HQ8A 4QJ5B 2MLFC 4TNCA 1PK0D 2WCBA 1S6CA 1Y6WA 1YX8A 3HCMA 1RTP1 2JXLA 5CPVA 1YX7A 4DS7A 1M63B 3CZTX 1LXFC 1DJXA 1YUUA 1EH2A 2LV7A 4E68A 5CSJA 2KI6C 1HQVA 1JWDA 3SG2A 4NQGA 1IRJA 1M31A 1OOJA 2LVJA 2JT8A 2ZRSA 3VRPA 1CMGA 2KQ6A 3I5FC 2M7NA 1BJFA 3PN7C 4MBEA 1BODA 1SMGA 1ZMZA 1XFUO 1QATA 2LE9B 2L2EA 4N1FA 3PALA 5DKNA 3PFVA 2V53A 3C1VA 1UP5A 2F33A 4M2PA 1SK6D 4P5OE 3TS5C 2JULA 5D7FA 1SR6C 3BUNB 2BL0B 2WNDA 1CDMA 1RECA 2WC8A 1F71A 1N0YA 1YR5A 1TRFA 3KHEA 1K94A 2QPTA 1WRLA 1NCYA 5AXIA 1DMOA 2MLEC 2QACA 1CDNA 3EKHA 2Y1MA 3D10A 2Q4UA 3AKAA 3DVJA 1IKUA 1J7PA 3IQQA 1SYMA 4YI8A 2JT0A 1B9AA 1YURA 2FJUB 2ISDA 2KYFA 1RJVA 4JWQA 5KSZA 5FYXA 4YGEB 1BR4B 1FI5A 1G33A 4ORAB 1A03A 4R1EA 4OV2A 1YUSA 1F55A 3JTDC 2KDHA 2K2FA 1OQPA 4OCIA 5HKYA 3VRRA 1H8BA 1K93D 1BR1B 2O60A 1PSRA 2BL0C 1UHJA 4WRIA 1IG5A 1SL7A 4XJKA 3SIAA 1J1EA 1TTXA 3AAKA 3IQOA 2PASA 4MEWA 4ORCB 4NDBA 1TNXA 3M0WA 1GGWA 2M49B 1TNPA 1EG4A 4QJ3B 2A4JA 1IJ5A 1QX2A 1SW8A 2JRFA 1TCFA 1JFJA 1JF0A 1WY9A 2LP3A 3O6BA 1PULA 2JU0A 2ZRTA 1AHRA 4JQ0D 1F54A 3NXAA 2I18A 1Y1XA 2BBMA 1KSOA 2K7OA 3CLNA 1W7JB 3EK8A 3TUYB 1CNPA 2MAZA 2BECA 4M2QA 1F8HA 3D0YA 2M1UA 2F2OA 5ER4X 1KWOB 1SKTA 1B7TY 3PM8A 4PHKA 1MF8B 2PALA 1UURA 4D1EA 2K61A 3SG7A 1XVJA 3NSIA 1K90D 2M1KB 3WNXB 1F4QA 3CR2A 3PSRA 1SRAA 3SG6A 4XJKB 2JPTA 4GGFC 3CGAA 2Y5IA 1C7WA 3MSEB 4PHMA 2M97A 1KFXL 1YVLA 2O5GA 3O4YA 3HX4A 1YRUB 1MQ1A 1F4OA 1L2OC 4HRHA 3ZWHA 1M45A 1R2UA 3I5FB 5DKRA 1SCVA 3TUYC 3PN7B 1H4BA 2JXCA 1B8RA 1Y1AA 1UHHA 3KF9A 3TDUA 1XFWO 1SNLA 2LHIA 1KWOC 3EVVA 4L9MA 1S26D 2ZN8A 3ICBA 1B8LA 2K7CA 2ZNEA 4M2OA 1SR6B 2BE6A 2KI4B 2KOTA 1K95A 1KFUL 1BMOA 4PE0A 5G08A 5I2QA 2F8PA 2PVBA 5D69A 2JZIA 3GOFA 4BY4A 1MXEA 4BY5A 4OR9B 2K0JA 1DGVA 2L98A 5JJGA 1MUXA 2LHLA 1FBVA 3CR5X 1EJ3A 1ALWA 4YGAA 5J3XA 2LMVA 1IJ6A 1QASA 3BOWA 4PHNA 3O2PA 1F70A 3DVKA 1NX2A 1NUBA 1D1OA 1Q80A 2JT3A 1YRTB 2PMYA 1UHNA 1JSAA 2I94A 4P2YB 1JFKA 1DF0A 2LP2A 1ALVA 4USLA 1R6PA 4N1GA 4YGBB 1BOCA 1PALA 1WDCB 1GQMA 2L0PA 1OMDA 1NYAA 3JTDB 1KCYA 2MJWB 1KQMC 4GPLB 1QX7A 2H61C 1IGVA 2M8UA 3SIBA 2L5XB 2WOSA 3GK4X 2KI4C 1S5GY 2Y1NA 5I2LA 4GGFA 4DCKA 3EVRA 2WCFA 3NSKA 2MBXA 3RM1A 1N2DA 1FW4A 2OTGB 2KSPA 4CFQA 1CLMA 3FS7A 2M0RA 4YI9A 3CWGA 4AQIA 1GGZA 1CKKA 1QXPA 1WLMA 5CSFA 1CTRA 1QLSA 2D8NA 1HT9A 1MWNA 1K8UA 4GNKB 4DIRA 1SY9A 3SG4A 1DT7B 3BOWB 4A4BA 1J55A 2LUXA 2BBNA 1XFYO 1K9KA 1MXLC 2CNPA 4PE7A 1KK8B 1FF1A 1DF0B 1S5GZ 1UWOA 3ZNIA 1PRWA 2KYCA 4MZKA 2LNKA 3GK2A 1MR8A 3LCPC 3JVTC 3LK0A 1IQ5A 1AUIB 2BCBA 4HRGA 1DJIA 3CR4X 4MRXA 1IH0A 1WDCC 1TNQA 3BXKA 4ZCUA 2HPSA 1CLBA 2EC6B 1CFPA 1KQVA 4DRWA 2RGIA 3A4UB 2G2BA 4GBAA 1PVAA 1DJYA 4CFRA 1BG1A 3I5IB 2JQ6A 3AAJA 2OTGC 3BUWB 1LVCD 5DKQA 5KU1A 3TDIA 3PATA 1UHKA 3DD4A 4Q04A 2LVKA 5JOLA 3A8RA 2KAVA 2FOTA 1S1EA 4NDDA 1L2OB 2Y4QA 3AKBA 1DVIA 4QJ4B 1JC2A 5CSNA 1E8AA 1KK8C 3FWBA 1S3PA 1LINA 2LVIA 1QIWA 5HLVA 2H61A 3OX6A 2F2PA 2GGMA 1CDPA 3CTNA 2KAXA 3PLFB 1L7ZA 2CCMA 1SBJA 2EC6C 2M3WA 4OKHA 1NX1A 1RWYA 2JWWA 1FPWA 4ORBB 5TNCA 1S36A 1AJ4A 1KK7Y 1TIZA 3I5IC 2B1UA 4MZLA 4PALA 1QVIY 1TOPA 4CPVA 2F3YA 4PE4A 3BYAA 1EL4A 3DF0B 3QRXA 1QV0A 3F45A 4YBHB 1QTXA 1ZACA 2AUCA 1M39A 2LC5A 2KI6D 4MRYA 2ZKMX 5IBWA 4I5KA 1ZOTB 2BKHB 2G9BA 2KNEA 2L50A 3GK1A 1YTZC 2SCPA 1KSMA 1X02A 1GJYA 1S6JA 1NWDA 1KK7Z 1NX3A 1UHIA 2L4IA 1SL8A 3I5GB 4HSZA 4HREE 1QVIZ 1KQMB 4YGCB 3SG3A 1K2HA 4GGNA 2JTTA 2CBLA 4C0KA 3VRQA 2LUCA 5HLOA 2I7AA 2FCDA 1AVSA 1SL9A 1N65A 1VRKA 5F6TA 4ZCVA 4U8DA 4C0LA 4WQ2A 5I2OA 1EXRA 1J1DA 2K8MB 1BLQA 3WXAA 5HYDA 1JF2A 4CIDA 1NCXA 2JC2A 1SCMB 1V1FA 2GV5A 1AP4A 4YRUA 1UUSA 2JNFA 1LKJA 1W7IB 2Q91A 5B8IB 3K21A 1CDLA 5KTYA 1IQ3A 2GGZA 4MVFA 4CLNA 1ODBA 2EHBA 1U5IB 1A2XA 2P6BB 1WRZA 3NSOA 2ZFDA 1CM4A 2BCXA 2OPOA 3FIAA 5ER5A 2KBMA 2R2IA 1LA0A 3JVTB 1CMFA 1QS7A 1RFJA 2BKIB 3VGOA 1J7OA 2OS8C 3I5GC 2LM5A 1RROA 3O78A 3BUOB 1OZSA 2M29A 2HQWA 1EG3A 2LCPA 2NZ0A 2LLUA 2E6WA 1YVHA 3OHMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  4WQ3 A;  1K9U A;  3E3R A;  2SAS A;  4AOM A;  1DGU A;  1NIW A;  2COL B;  5I8N A;  5AER A;  2PSR A;  2L51 A;  1SCM C;  2MRD A;  1CLL A;  1S6I A;  3BUX B;  3DVM A;  1TCO B;  1IWQ A;  1NX0 A;  2KAY A;  5AAN A;  2KBI A;  1BT6 A;  3OB2 B;  5BPJ A;  2TN4 A;  5PAL A;  2CT9 A;  2LLT A;  1CM1 A;  3FWC A;  1G8I A;  1K9P A;  1XK4 C;  1J7Q A;  2NLN A;  4PCW A;  1FI6 A;  4DUQ A;  2M9G A;  1C07 A;  1YUT A;  3WHU B;  2MA2 A;  2NXQ A;  2JOJ A;  2LMT A;  4NDC A;  1K96 A;  2KQY A;  2KFF A;  1JBA A;  1XA5 A;  3DVE A;  4PE1 A;  2LVV A;  3VRO A;  4I5J A;  3EKJ A;  2AMI A;  2KHN A;  1CFD A;  3CS1 A;  3EK7 A;  1AK8 A;  1A75 A;  1RK9 A;  3DF0 A;  4MSP A;  4PDZ A;  1XFV O;  1NPQ A;  1M46 A;  3IF7 A;  2LAN A;  4JPZ B;  2NCO A;  1NCZ A;  1Y1U A;  2E30 A;  1B8C A;  1DJW A;  3NSL A;  4GUK A;  1CFF A;  1XFZ O;  2KFH A;  1CB1 A;  5AFP A;  1TNW A;  2NCP A;  1JUO A;  3TDZ A;  2BE4 A;  1DJH A;  3OX5 A;  3SJS A;  4YGD B;  2FCE A;  2LLS A;  1A4P A;  1PSB A;  4AQJ A;  2KGB C;  1XYD A;  4IL1 A;  2L4H A;  4FQO A;  1J7R A;  2DOQ A;  2IS9 A;  3LL8 B;  2WCE A;  1QLK A;  3I5H B;  3WHT B;  1QV1 A;  3BQ3 A;  2EGD A;  4MLW A;  1KFX S;  1SPY A;  2ZND A;  3KO0 A;  1A29 A;  2WOR A;  1WLZ A;  2F3Z A;  2K7D A;  3VRN A;  2K2A A;  4I5N B;  1TN4 A;  1CFC A;  4F0Z B;  2KGR A;  1A75 B;  1AJ5 A;  1XFX O;  2CTN A;  2HF5 A;  1ZFS A;  3EK4 A;  1QJT A;  1XK4 A;  3H4S E;  4ETO A;  2AAO A;  1U5I A;  1NSH A;  4MN0 A;  4A4C A;  1B1G A;  1LA3 A;  4I5L B;  5GQQ C;  2K7B A;  1KFU S;  4OVN F;  1PVB A;  1C7V A;  2PRU A;  5HKZ A;  2OS8 B;  1OSA A;  2I2R E;  3OB1 B;  1WRK A;  4PHJ A;  1ZUZ A;  2VRG A;  3LK1 A;  3I5H C;  2LMU A;  1V1G A;  1QIV A;  4UPG A;  5K89 A;  4C0J A;  4ICB A;  4N5X A;  2ZN9 A;  2CXJ A;  3KPX A;  3BUM B;  2KFG A;  3RLZ A;  1B4C A;  1G4Y R;  3LLE A;  1XO5 A;  2JNX A;  1B7T Z;  3SG5 A;  2LAP A;  5AEQ A;  2M7L A;  1OMV A;  1OZO A;  3D0Y B;  4XYN A;  5CSI A;  1MHO A;  1DTL A;  2H2K A;  2JTZ A;  2HET A;  1Y0V H;  1BU3 A;  1OMR A;  4FTG A;  3TS5 B;  1DJZ A;  3TZ1 A;  1OE9 B;  3OP0 A;  1DJG A;  4GFT A;  1NP8 A;  4GAO A;  1B47 A;  2BCA A;  1QX5 B;  2MHH A;  3KEV A;  1BF5 A;  4MZJ A;  3EVU A;  2HQ8 A;  4QJ5 B;  2MLF C;  4TNC A;  1PK0 D;  2WCB A;  1S6C A;  1Y6W A;  1YX8 A;  3HCM A;  1RTP 1;  2JXL A;  5CPV A;  1YX7 A;  4DS7 A;  1M63 B;  3CZT X;  1LXF C;  1DJX A;  1YUU A;  1EH2 A;  2LV7 A;  4E68 A;  5CSJ A;  2KI6 C;  1HQV A;  1JWD A;  3SG2 A;  4NQG A;  1IRJ A;  1M31 A;  1OOJ A;  2LVJ A;  2JT8 A;  2ZRS A;  3VRP A;  1CMG A;  2KQ6 A;  3I5F C;  2M7N A;  1BJF A;  3PN7 C;  4MBE A;  1BOD A;  1SMG A;  1ZMZ A;  1XFU O;  1QAT A;  2LE9 B;  2L2E A;  4N1F A;  3PAL A;  5DKN A;  3PFV A;  2V53 A;  3C1V A;  1UP5 A;  2F33 A;  4M2P A;  1SK6 D;  4P5O E;  3TS5 C;  2JUL A;  5D7F A;  1SR6 C;  3BUN B;  2BL0 B;  2WND A;  1CDM A;  1REC A;  2WC8 A;  1F71 A;  1N0Y A;  1YR5 A;  1TRF A;  3KHE A;  1K94 A;  2QPT A;  1WRL A;  1NCY A;  5AXI A;  1DMO A;  2MLE C;  2QAC A;  1CDN A;  3EKH A;  2Y1M A;  3D10 A;  2Q4U A;  3AKA A;  3DVJ A;  1IKU A;  1J7P A;  3IQQ A;  1SYM A;  4YI8 A;  2JT0 A;  1B9A A;  1YUR A;  2FJU B;  2ISD A;  2KYF A;  1RJV A;  4JWQ A;  5KSZ A;  5FYX A;  4YGE B;  1BR4 B;  1FI5 A;  1G33 A;  4ORA B;  1A03 A;  4R1E A;  4OV2 A;  1YUS A;  1F55 A;  3JTD C;  2KDH A;  2K2F A;  1OQP A;  4OCI A;  5HKY A;  3VRR A;  1H8B A;  1K93 D;  1BR1 B;  2O60 A;  1PSR A;  2BL0 C;  1UHJ A;  4WRI A;  1IG5 A;  1SL7 A;  4XJK A;  3SIA A;  1J1E A;  1TTX A;  3AAK A;  3IQO A;  2PAS A;  4MEW A;  4ORC B;  4NDB A;  1TNX A;  3M0W A;  1GGW A;  2M49 B;  1TNP A;  1EG4 A;  4QJ3 B;  2A4J A;  1IJ5 A;  1QX2 A;  1SW8 A;  2JRF A;  1TCF A;  1JFJ A;  1JF0 A;  1WY9 A;  2LP3 A;  3O6B A;  1PUL A;  2JU0 A;  2ZRT A;  1AHR A;  4JQ0 D;  1F54 A;  3NXA A;  2I18 A;  1Y1X A;  2BBM A;  1KSO A;  2K7O A;  3CLN A;  1W7J B;  3EK8 A;  3TUY B;  1CNP A;  2MAZ A;  2BEC A;  4M2Q A;  1F8H A;  3D0Y A;  2M1U A;  2F2O A;  5ER4 X;  1KWO B;  1SKT A;  1B7T Y;  3PM8 A;  4PHK A;  1MF8 B;  2PAL A;  1UUR A;  4D1E A;  2K61 A;  3SG7 A;  1XVJ A;  3NSI A;  1K90 D;  2M1K B;  3WNX B;  1F4Q A;  3CR2 A;  3PSR A;  1SRA A;  3SG6 A;  4XJK B;  2JPT A;  4GGF C;  3CGA A;  2Y5I A;  1C7W A;  3MSE B;  4PHM A;  2M97 A;  1KFX L;  1YVL A;  2O5G A;  3O4Y A;  3HX4 A;  1YRU B;  1MQ1 A;  1F4O A;  1L2O C;  4HRH A;  3ZWH A;  1M45 A;  1R2U A;  3I5F B;  5DKR A;  1SCV A;  3TUY C;  3PN7 B;  1H4B A;  2JXC A;  1B8R A;  1Y1A A;  1UHH A;  3KF9 A;  3TDU A;  1XFW O;  1SNL A;  2LHI A;  1KWO C;  3EVV A;  4L9M A;  1S26 D;  2ZN8 A;  3ICB A;  1B8L A;  2K7C A;  2ZNE A;  4M2O A;  1SR6 B;  2BE6 A;  2KI4 B;  2KOT A;  1K95 A;  1KFU L;  1BMO A;  4PE0 A;  5G08 A;  5I2Q A;  2F8P A;  2PVB A;  5D69 A;  2JZI A;  3GOF A;  4BY4 A;  1MXE A;  4BY5 A;  4OR9 B;  2K0J A;  1DGV A;  2L98 A;  5JJG A;  1MUX A;  2LHL A;  1FBV A;  3CR5 X;  1EJ3 A;  1ALW A;  4YGA A;  5J3X A;  2LMV A;  1IJ6 A;  1QAS A;  3BOW A;  4PHN A;  3O2P A;  1F70 A;  3DVK A;  1NX2 A;  1NUB A;  1D1O A;  1Q80 A;  2JT3 A;  1YRT B;  2PMY A;  1UHN A;  1JSA A;  2I94 A;  4P2Y B;  1JFK A;  1DF0 A;  2LP2 A;  1ALV A;  4USL A;  1R6P A;  4N1G A;  4YGB B;  1BOC A;  1PAL A;  1WDC B;  1GQM A;  2L0P A;  1OMD A;  1NYA A;  3JTD B;  1KCY A;  2MJW B;  1KQM C;  4GPL B;  1QX7 A;  2H61 C;  1IGV A;  2M8U A;  3SIB A;  2L5X B;  2WOS A;  3GK4 X;  2KI4 C;  1S5G Y;  2Y1N A;  5I2L A;  4GGF A;  4DCK A;  3EVR A;  2WCF A;  3NSK A;  2MBX A;  3RM1 A;  1N2D A;  1FW4 A;  2OTG B;  2KSP A;  4CFQ A;  1CLM A;  3FS7 A;  2M0R A;  4YI9 A;  3CWG A;  4AQI A;  1GGZ A;  1CKK A;  1QXP A;  1WLM A;  5CSF A;  1CTR A;  1QLS A;  2D8N A;  1HT9 A;  1MWN A;  1K8U A;  4GNK B;  4DIR A;  1SY9 A;  3SG4 A;  1DT7 B;  3BOW B;  4A4B A;  1J55 A;  2LUX A;  2BBN A;  1XFY O;  1K9K A;  1MXL C;  2CNP A;  4PE7 A;  1KK8 B;  1FF1 A;  1DF0 B;  1S5G Z;  1UWO A;  3ZNI A;  1PRW A;  2KYC A;  4MZK A;  2LNK A;  3GK2 A;  1MR8 A;  3LCP C;  3JVT C;  3LK0 A;  1IQ5 A;  1AUI B;  2BCB A;  4HRG A;  1DJI A;  3CR4 X;  4MRX A;  1IH0 A;  1WDC C;  1TNQ A;  3BXK A;  4ZCU A;  2HPS A;  1CLB A;  2EC6 B;  1CFP A;  1KQV A;  4DRW A;  2RGI A;  3A4U B;  2G2B A;  4GBA A;  1PVA A;  1DJY A;  4CFR A;  1BG1 A;  3I5I B;  2JQ6 A;  3AAJ A;  2OTG C;  3BUW B;  1LVC D;  5DKQ A;  5KU1 A;  3TDI A;  3PAT A;  1UHK A;  3DD4 A;  4Q04 A;  2LVK A;  5JOL A;  3A8R A;  2KAV A;  2FOT A;  1S1E A;  4NDD A;  1L2O B;  2Y4Q A;  3AKB A;  1DVI A;  4QJ4 B;  1JC2 A;  5CSN A;  1E8A A;  1KK8 C;  3FWB A;  1S3P A;  1LIN A;  2LVI A;  1QIW A;  5HLV A;  2H61 A;  3OX6 A;  2F2P A;  2GGM A;  1CDP A;  3CTN A;  2KAX A;  3PLF B;  1L7Z A;  2CCM A;  1SBJ A;  2EC6 C;  2M3W A;  4OKH A;  1NX1 A;  1RWY A;  2JWW A;  1FPW A;  4ORB B;  5TNC A;  1S36 A;  1AJ4 A;  1KK7 Y;  1TIZ A;  3I5I C;  2B1U A;  4MZL A;  4PAL A;  1QVI Y;  1TOP A;  4CPV A;  2F3Y A;  4PE4 A;  3BYA A;  1EL4 A;  3DF0 B;  3QRX A;  1QV0 A;  3F45 A;  4YBH B;  1QTX A;  1ZAC A;  2AUC A;  1M39 A;  2LC5 A;  2KI6 D;  4MRY A;  2ZKM X;  5IBW A;  4I5K A;  1ZOT B;  2BKH B;  2G9B A;  2KNE A;  2L50 A;  3GK1 A;  1YTZ C;  2SCP A;  1KSM A;  1X02 A;  1GJY A;  1S6J A;  1NWD A;  1KK7 Z;  1NX3 A;  1UHI A;  2L4I A;  1SL8 A;  3I5G B;  4HSZ A;  4HRE E;  1QVI Z;  1KQM B;  4YGC B;  3SG3 A;  1K2H A;  4GGN A;  2JTT A;  2CBL A;  4C0K A;  3VRQ A;  2LUC A;  5HLO A;  2I7A A;  2FCD A;  1AVS A;  1SL9 A;  1N65 A;  1VRK A;  5F6T A;  4ZCV A;  4U8D A;  4C0L A;  4WQ2 A;  5I2O A;  1EXR A;  1J1D A;  2K8M B;  1BLQ A;  3WXA A;  5HYD A;  1JF2 A;  4CID A;  1NCX A;  2JC2 A;  1SCM B;  1V1F A;  2GV5 A;  1AP4 A;  4YRU A;  1UUS A;  2JNF A;  1LKJ A;  1W7I B;  2Q91 A;  5B8I B;  3K21 A;  1CDL A;  5KTY A;  1IQ3 A;  2GGZ A;  4MVF A;  4CLN A;  1ODB A;  2EHB A;  1U5I B;  1A2X A;  2P6B B;  1WRZ A;  3NSO A;  2ZFD A;  1CM4 A;  2BCX A;  2OPO A;  3FIA A;  5ER5 A;  2KBM A;  2R2I A;  1LA0 A;  3JVT B;  1CMF A;  1QS7 A;  1RFJ A;  2BKI B;  3VGO A;  1J7O A;  2OS8 C;  3I5G C;  2LM5 A;  1RRO A;  3O78 A;  3BUO B;  1OZS A;  2M29 A;  2HQW A;  1EG3 A;  2LCP A;  2NZ0 A;  2LLU A;  2E6W A;  1YVH A;  3OHM B; 
#chains in the Genus database with same CATH topology
 5HKW A;  4WQ3 A;  1K9U A;  3E3R A;  2SAS A;  4AOM A;  1DGU A;  1NIW A;  2COL B;  3BJH A;  5I8N A;  5AER A;  2PSR A;  2L51 A;  1SCM C;  1TWO A;  1CLL A;  2MRD A;  1S6I A;  1SSE B;  3BUX B;  3CZ2 A;  1TCO B;  1IWQ A;  1NX0 A;  3DVM A;  2KAY A;  2KPH A;  3S0B A;  5AAN A;  2KBI A;  1BT6 A;  3OB2 B;  5BPJ A;  2TN4 A;  5PAL A;  2CT9 A;  2LLT A;  1CM1 A;  3FWC A;  1G8I A;  1K9P A;  1XK4 C;  3L4A A;  1J7Q A;  2NLN A;  4PCW A;  2QEH A;  1FI6 A;  4DUQ A;  2M9G A;  1C07 A;  4JD9 A;  1YUT A;  3WHU B;  2MA2 A;  2NXQ A;  2JOJ A;  1W9Z A;  2LMT A;  1C3Z A;  4NDC A;  1K96 A;  2KQY A;  3D77 A;  2KFF A;  1JBA A;  1XA5 A;  3DVE A;  4PE1 A;  2LVV A;  3VRO A;  4I5J A;  3EKJ A;  2AMI A;  2KHN A;  1CFD A;  3CS1 A;  3V2L A;  3RZS A;  3EK7 A;  1AK8 A;  1A75 A;  1RK9 A;  3DF0 A;  4MSP A;  4PDZ A;  1XFV O;  1NPQ A;  1M46 A;  3IF7 A;  2LAN A;  1DEK A;  4JKT A;  2NCO A;  1NCZ A;  1Y1U A;  2E30 A;  1B8C A;  1DJW A;  3NSL A;  4GUK A;  1CFF A;  1XFZ O;  2KFH A;  1CB1 A;  5AFP A;  1TNW A;  2NCP A;  1JUO A;  3TDZ A;  2BE4 A;  1DJH A;  3OX5 A;  3SJS A;  2WCL A;  4YGD B;  2FCE A;  2LLS A;  1A4P A;  1PSB A;  2ERB A;  4AQJ A;  3CZ0 A;  2KGB C;  1XYD A;  4IL1 A;  2L4H A;  4FQO A;  1J7R A;  2DOQ A;  1DQE A;  2IS9 A;  3LL8 B;  2WCE A;  1QLK A;  3I5H B;  3WHT B;  1QV1 A;  3BQ3 A;  1Z2C B;  2EGD A;  1KFX S;  3FE8 A;  4MLW A;  1SPY A;  2P71 A;  2ZND A;  3DXL A;  3KO0 A;  1A29 A;  2WOR A;  1WLZ A;  2F3Z A;  2K7D A;  3VRN A;  2K2A A;  4I5N B;  4IJ7 A;  3S0E A;  3O4X A;  1TN4 A;  1CFC A;  4F0Z B;  2KGR A;  1A75 B;  1AJ5 A;  1XFX O;  2CTN A;  2HF5 A;  1ZFS A;  5D3O A;  3EK4 A;  1QJT A;  1T14 A;  1XK4 A;  3NGV A;  3H4S E;  2FJY A;  4ETO A;  2AAO A;  1U5I A;  1NSH A;  4MN0 A;  4A4C A;  1B1G A;  1LA3 A;  4I5L B;  5GQQ C;  2K7B A;  1KFU S;  4OVN F;  1PVB A;  1C7V A;  2PRU A;  5HKZ A;  2OS8 B;  1OSA A;  2I2R E;  3OB1 B;  3PJI A;  1WRK A;  4PHJ A;  1ZUZ A;  2VRG A;  3LK1 A;  3I5H C;  2LMU A;  1V1G A;  1QIV A;  4UPG A;  1OOG A;  4C0J A;  4ICB A;  4N5X A;  2ZN9 A;  2CXJ A;  5K89 A;  3KPX A;  3BUM B;  2KFG A;  3RLZ A;  1B4C A;  5I94 A;  1G4Y R;  3LLE A;  1XO5 A;  2WC6 A;  2JNX A;  1B7T Z;  3SG5 A;  2JPO A;  2LAP A;  5AEQ A;  2M7L A;  3SS3 A;  3B88 A;  1OMV A;  1OZO A;  3L47 A;  3D0Y B;  4XYN A;  5CSI A;  1MHO A;  1DTL A;  2WC5 A;  2H2K A;  2JTZ A;  2HET A;  1Y0V H;  1BU3 A;  1OMR A;  4FTG A;  3TS5 B;  1DJZ A;  3TZ1 A;  1OE9 B;  3OP0 A;  1DJG A;  1OOI X;  4GFT A;  1NP8 A;  4GAO A;  1B47 A;  2BCA A;  1QX5 B;  2MHH A;  3KEV A;  1BF5 A;  4MZJ A;  3EVU A;  2HQ8 A;  4QJ5 B;  2MLF C;  2K60 A;  4TNC A;  1PK0 D;  2WCB A;  1S6C A;  1Y6W A;  1YX8 A;  3HCM A;  1RTP 1;  1TUJ A;  2JXL A;  3B7A A;  5CPV A;  1YX7 A;  3L4L A;  4DS7 A;  1M63 B;  3CZT X;  1LXF C;  1DJX A;  2WCK A;  1YUU A;  1EH2 A;  2LV7 A;  4E68 A;  1DEL A;  5CSJ A;  2KI6 C;  1HQV A;  1JWD A;  3SG2 A;  4NQG A;  1IRJ A;  1M31 A;  1OOJ A;  2LVJ A;  2JT8 A;  2ZRS A;  3VRP A;  1CMG A;  2KQ6 A;  3CDN A;  3B86 A;  3I5F C;  2M7N A;  3CYZ A;  1BJF A;  3PN7 C;  4MBE A;  1BOD A;  1SMG A;  1ZMZ A;  1XFU O;  1QAT A;  2LE9 B;  3CZ1 A;  2L2E A;  3R1V A;  3PAL A;  4N1F A;  3PFV A;  5DKN A;  2V53 A;  3C1V A;  1UP5 A;  2F33 A;  4M2P A;  1SK6 D;  3NHT A;  4P5O E;  3TS5 C;  2JUL A;  5D7F A;  3FE6 A;  1SR6 C;  3BUN B;  2BL0 B;  2WND A;  1CDM A;  2WCJ A;  1REC A;  2WC8 A;  2BNX A;  3DYE A;  1F71 A;  5DIC A;  1N0Y A;  1YR5 A;  3N7H A;  1TRF A;  3KHE A;  1K94 A;  2QPT A;  3D75 A;  1WRL A;  1NCY A;  5AXI A;  1DMO A;  2MLE C;  2QAC A;  1CDN A;  3EKH A;  2Y1M A;  3D10 A;  2Q4U A;  3AKA A;  2QEB A;  3DVJ A;  1IKU A;  1J7P A;  3IQQ A;  1SYM A;  4YI8 A;  2JT0 A;  1B9A A;  1YUR A;  2FJU B;  2ISD A;  1ORG A;  2KYF A;  1RJV A;  4JWQ A;  5KSZ A;  5FYX A;  4YGE B;  1BR4 B;  3SS4 A;  2GTE A;  1FI5 A;  1G33 A;  4ORA B;  2L2C A;  1A03 A;  4R1E A;  4OV2 A;  1YUS A;  1F55 A;  3JTD C;  2KDH A;  2K2F A;  1OQP A;  4OCI A;  5HKY A;  3VRR A;  1H8B A;  1K93 D;  1BR1 B;  2O60 A;  1PSR A;  2BL0 C;  1UHJ A;  2WCH A;  1IG5 A;  1SL7 A;  4WRI A;  4XJK A;  1J1E A;  3S0G A;  3SIA A;  3R1P A;  1TTX A;  3AAK A;  3IQO A;  2PAS A;  4MEW A;  4ORC B;  4NDB A;  1TNX A;  5EL2 A;  3M0W A;  1GGW A;  2M49 B;  5FI7 A;  5HL1 A;  1TNP A;  1EG4 A;  4QJ3 B;  2A4J A;  4FQT A;  1IJ5 A;  1QX2 A;  1SW8 A;  2JRF A;  1TCF A;  1JFJ A;  1JF0 A;  1WY9 A;  2LP3 A;  3O6B A;  1PUL A;  2JU0 A;  2ZRT A;  1AHR A;  4JQ0 D;  1F54 A;  3NXA A;  2I18 A;  1Y1X A;  2BBM A;  1KSO A;  2K7O A;  3CLN A;  1W7J B;  3EK8 A;  3TUY B;  1CNP A;  2MAZ A;  2BEC A;  4M2Q A;  1F8H A;  1QWV A;  3D0Y A;  2M1U A;  2F2O A;  5ER4 X;  1KWO B;  3S0D A;  5FI2 A;  1OOH A;  1SKT A;  1B7T Y;  3PM8 A;  4PHK A;  1MF8 B;  2PAL A;  1UUR A;  4D1E A;  2K61 A;  3SG7 A;  1XVJ A;  3NSI A;  1K90 D;  2M1K B;  3WNX B;  1F4Q A;  1LS8 A;  3CR2 A;  3FE9 A;  3K1E A;  3PSR A;  1SRA A;  3SG6 A;  4XJK B;  2JPT A;  4GGF C;  2H8V A;  3CGA A;  4INX A;  2Y5I A;  1C7W A;  3MSE B;  1IIO A;  4OZD A;  3S0F A;  4PHM A;  2M97 A;  3S0A A;  1KFX L;  1YVL A;  3VB1 A;  2O5G A;  3O4Y A;  1C3Y A;  3R1O A;  3HX4 A;  1YRU B;  1MQ1 A;  1F4O A;  1L2O C;  4HRH A;  3ZWH A;  1M45 A;  1R2U A;  3I5F B;  5DKR A;  1SCV A;  3TUY C;  3PN7 B;  1H4B A;  2JXC A;  1B8R A;  1Y1A A;  1UHH A;  3DZT A;  3KF9 A;  3TDU A;  1XFW O;  1SNL A;  2LHI A;  1KWO C;  3EVV A;  4L9M A;  1S26 D;  2ZN8 A;  3ICB A;  1B8L A;  2K7C A;  2ZNE A;  3NHI A;  4M2O A;  1SR6 B;  2BE6 A;  2KI4 B;  2KOT A;  1K95 A;  1KFU L;  1BMO A;  4PE0 A;  5G08 A;  5I2Q A;  2F8P A;  2PVB A;  5D69 A;  2JZI A;  3GOF A;  1XFR A;  4BY4 A;  1MXE A;  4BY5 A;  4OR9 B;  2K0J A;  1DGV A;  2L98 A;  5JJG A;  1MUX A;  2LHL A;  1FBV A;  3CR5 X;  1EJ3 A;  1ALW A;  4YGA A;  5J3X A;  2PQL A;  2LMV A;  1IJ6 A;  1QAS A;  3BOW A;  4PHN A;  3O2P A;  1F70 A;  3DVK A;  1NX2 A;  3SS5 A;  1NUB A;  1D1O A;  1Q80 A;  2JT3 A;  1YRT B;  2PMY A;  1UHN A;  1JSA A;  2I94 A;  4P2Y B;  1JFK A;  1DF0 A;  2LP2 A;  2WCM A;  1ALV A;  4USL A;  1R6P A;  3D74 A;  4N1G A;  4YGB B;  1BOC A;  1PAL A;  1WDC B;  1GQM A;  2L0P A;  1OMD A;  1NYA A;  2QDI A;  3JTD B;  2MJW B;  1KCY A;  1KQM C;  4GPL B;  1QX7 A;  2H61 C;  1IGV A;  2M8U A;  3SIB A;  2L5X B;  2WOS A;  3GK4 X;  2KI4 C;  1S5G Y;  2Y1N A;  5I2L A;  4GGF A;  4DCK A;  3EVR A;  2WCF A;  4KYN A;  3NSK A;  2MBX A;  3RM1 A;  1N2D A;  1FW4 A;  2OTG B;  2KSP A;  4CFQ A;  1CLM A;  3FS7 A;  2M0R A;  4YI9 A;  3CWG A;  4AQI A;  1GGZ A;  1CKK A;  1QXP A;  1WLM A;  5CSF A;  1CTR A;  1QLS A;  2D8N A;  1HT9 A;  1MWN A;  1K8U A;  3QME A;  4GNK B;  1SY9 A;  3SG4 A;  4DIR A;  1DT7 B;  3BOW B;  4A4B A;  1J55 A;  2LUX A;  2BBN A;  1XFY O;  1K9K A;  1MXL C;  2CNP A;  4PE7 A;  1KK8 B;  1FF1 A;  1DF0 B;  1S5G Z;  1UWO A;  3ZNI A;  1PRW A;  2KYC A;  4MZK A;  2LNK A;  3GK2 A;  1MR8 A;  3LCP C;  3JVT C;  3LK0 A;  1IQ5 A;  1AUI B;  2BCB A;  3B6X A;  1DJI A;  3CR4 X;  4HRG A;  4MRX A;  1IH0 A;  1WDC C;  1TNQ A;  3BXK A;  4ZCU A;  2HPS A;  1CLB A;  2EC6 B;  1CFP A;  1KQV A;  5FI6 A;  4DRW A;  2RGI A;  3A4U B;  2G2B A;  4GBA A;  1PVA A;  1DJY A;  4CFR A;  1BG1 A;  3I5I B;  3PM2 A;  2JQ6 A;  3AAJ A;  2QEV A;  2OTG C;  3BUW B;  1LVC D;  5DKQ A;  5KU1 A;  2KLD A;  3TDI A;  3PAT A;  1UHK A;  3DD4 A;  4Q04 A;  2LVK A;  5JOL A;  3D73 A;  3A8R A;  2KAV A;  2FOT A;  1S1E A;  3EG5 B;  4NDD A;  1L2O B;  2Y4Q A;  3AKB A;  1DVI A;  4QJ4 B;  1JC2 A;  3OBV A;  5CSN A;  1E8A A;  1KK8 C;  3FWB A;  3OGN A;  3CAB A;  1S3P A;  1LIN A;  2LVI A;  1QIW A;  5HLV A;  2H61 A;  3OX6 A;  2F2P A;  2GGM A;  1CDP A;  3CTN A;  2KAX A;  3PLF B;  1L7Z A;  2CCM A;  3UO9 A;  1SBJ A;  2EC6 C;  2M3W A;  4OKH A;  1NX1 A;  3R72 A;  1RWY A;  2JWW A;  1FPW A;  4ORB B;  5TNC A;  2QEO A;  1S36 A;  1AJ4 A;  1KK7 Y;  1TIZ A;  3I5I C;  2B1U A;  3BFH A;  4MZL A;  1QVI Y;  1TOP A;  4PAL A;  4CPV A;  1DC1 A;  2F3Y A;  4PE4 A;  3BYA A;  1EL4 A;  3DF0 B;  3QRX A;  1QV0 A;  3F45 A;  4YBH B;  4JPZ B;  1QTX A;  1ZAC A;  2AUC A;  1M39 A;  1Z4H A;  1OOF A;  2LC5 A;  2KI6 D;  4MRY A;  2P70 A;  2ZKM X;  5IBW A;  4I5K A;  1ZOT B;  3Q8I A;  2BKH B;  2G9B A;  2KNE A;  3D78 A;  2L50 A;  3GK1 A;  1YTZ C;  2SCP A;  3UNW A;  3B87 A;  1KSM A;  4F7F A;  1X02 A;  1GJY A;  1S6J A;  1NWD A;  1KK7 Z;  1NX3 A;  1UHI A;  2L4I A;  1SL8 A;  3I5G B;  4HSZ A;  4HRE E;  1QVI Z;  1KQM B;  4YGC B;  3SG3 A;  1P28 A;  1K2H A;  4GGN A;  2JTT A;  2CBL A;  4C0K A;  3VRQ A;  2LUC A;  5HLO A;  2BAP A;  2I7A A;  2FCD A;  1AVS A;  1SL9 A;  1N65 A;  1VRK A;  2KLE A;  2L5Y A;  5F6T A;  4ZCV A;  4U8D A;  4C0L A;  4WQ2 A;  5I2O A;  1EXR A;  1J1D A;  2K8M B;  1BLQ A;  3WXA A;  5HYD A;  1JF2 A;  4CID A;  1NCX A;  2JC2 A;  1SCM B;  1V1F A;  3BFB A;  2GV5 A;  3IVT A;  4PT1 A;  1AP4 A;  1GM0 A;  4YRU A;  1UUS A;  2JNF A;  1LKJ A;  1W7I B;  2PYQ A;  2Q91 A;  5B8I B;  3K21 A;  1CDL A;  3D76 A;  5KTY A;  1IQ3 A;  2GGZ A;  4MVF A;  4CLN A;  1ODB A;  1TUZ A;  2EHB A;  1U5I B;  1A2X A;  1OW4 A;  2P6B B;  1WRZ A;  3NSO A;  2ZFD A;  1CM4 A;  2BCX A;  2OPO A;  3FIA A;  5ER5 A;  2YGU A;  2KBM A;  2R2I A;  1LA0 A;  3JVT B;  1CMF A;  1QS7 A;  1RFJ A;  2BKI B;  3BFA A;  3VGO A;  1J7O A;  2OS8 C;  3I5G C;  2LM5 A;  1RRO A;  3O78 A;  3BUO B;  1OZS A;  4INW A;  2M29 A;  2HQW A;  1EG3 A;  2LCP A;  2NZ0 A;  2LLU A;  2E6W A;  3DY9 A;  1YVH A;  3OHM B; 
#chains in the Genus database with same CATH homology
 5HKW A;  4WQ3 A;  1K9U A;  3E3R A;  2SAS A;  4AOM A;  1DGU A;  1NIW A;  2COL B;  5I8N A;  5AER A;  2PSR A;  2L51 A;  1SCM C;  2MRD A;  1CLL A;  1S6I A;  3BUX B;  3DVM A;  1TCO B;  1IWQ A;  1NX0 A;  2KAY A;  5AAN A;  2KBI A;  1BT6 A;  3OB2 B;  5BPJ A;  2TN4 A;  5PAL A;  2CT9 A;  2LLT A;  1CM1 A;  3FWC A;  1G8I A;  1K9P A;  1XK4 C;  1J7Q A;  2NLN A;  4PCW A;  1FI6 A;  4DUQ A;  2M9G A;  1C07 A;  1YUT A;  3WHU B;  2MA2 A;  2NXQ A;  2JOJ A;  2LMT A;  4NDC A;  1K96 A;  2KQY A;  2KFF A;  1JBA A;  1XA5 A;  3DVE A;  4PE1 A;  2LVV A;  3VRO A;  4I5J A;  3EKJ A;  2AMI A;  2KHN A;  1CFD A;  3CS1 A;  3EK7 A;  1AK8 A;  1A75 A;  1RK9 A;  3DF0 A;  4MSP A;  4PDZ A;  1XFV O;  1NPQ A;  1M46 A;  3IF7 A;  2LAN A;  4JPZ B;  2NCO A;  1NCZ A;  1Y1U A;  2E30 A;  1B8C A;  1DJW A;  3NSL A;  4GUK A;  1CFF A;  1XFZ O;  2KFH A;  1CB1 A;  5AFP A;  1TNW A;  2NCP A;  1JUO A;  3TDZ A;  2BE4 A;  1DJH A;  3OX5 A;  3SJS A;  4YGD B;  2FCE A;  2LLS A;  1A4P A;  1PSB A;  4AQJ A;  2KGB C;  1XYD A;  4IL1 A;  2L4H A;  4FQO A;  1J7R A;  2DOQ A;  2IS9 A;  3LL8 B;  2WCE A;  1QLK A;  3I5H B;  3WHT B;  1QV1 A;  3BQ3 A;  2EGD A;  4MLW A;  1KFX S;  1SPY A;  2ZND A;  3KO0 A;  1A29 A;  2WOR A;  1WLZ A;  2F3Z A;  2K7D A;  3VRN A;  2K2A A;  4I5N B;  1TN4 A;  1CFC A;  4F0Z B;  2KGR A;  1A75 B;  1AJ5 A;  1XFX O;  2CTN A;  2HF5 A;  1ZFS A;  3EK4 A;  1QJT A;  1XK4 A;  3H4S E;  4ETO A;  2AAO A;  1U5I A;  1NSH A;  4MN0 A;  4A4C A;  1B1G A;  1LA3 A;  4I5L B;  5GQQ C;  2K7B A;  1KFU S;  4OVN F;  1PVB A;  1C7V A;  2PRU A;  5HKZ A;  2OS8 B;  1OSA A;  2I2R E;  3OB1 B;  1WRK A;  4PHJ A;  1ZUZ A;  2VRG A;  3LK1 A;  3I5H C;  2LMU A;  1V1G A;  1QIV A;  4UPG A;  5K89 A;  4C0J A;  4ICB A;  4N5X A;  2ZN9 A;  2CXJ A;  3KPX A;  3BUM B;  2KFG A;  3RLZ A;  1B4C A;  1G4Y R;  3LLE A;  1XO5 A;  2JNX A;  1B7T Z;  3SG5 A;  2LAP A;  5AEQ A;  2M7L A;  1OMV A;  1OZO A;  3D0Y B;  4XYN A;  5CSI A;  1MHO A;  1DTL A;  2H2K A;  2JTZ A;  2HET A;  1Y0V H;  1BU3 A;  1OMR A;  4FTG A;  3TS5 B;  1DJZ A;  3TZ1 A;  1OE9 B;  3OP0 A;  1DJG A;  4GFT A;  1NP8 A;  4GAO A;  1B47 A;  2BCA A;  1QX5 B;  2MHH A;  3KEV A;  1BF5 A;  4MZJ A;  3EVU A;  2HQ8 A;  4QJ5 B;  2MLF C;  4TNC A;  1PK0 D;  2WCB A;  1S6C A;  1Y6W A;  1YX8 A;  3HCM A;  1RTP 1;  2JXL A;  5CPV A;  1YX7 A;  4DS7 A;  1M63 B;  3CZT X;  1LXF C;  1DJX A;  1YUU A;  1EH2 A;  2LV7 A;  4E68 A;  5CSJ A;  2KI6 C;  1HQV A;  1JWD A;  3SG2 A;  4NQG A;  1IRJ A;  1M31 A;  1OOJ A;  2LVJ A;  2JT8 A;  2ZRS A;  3VRP A;  1CMG A;  2KQ6 A;  3I5F C;  2M7N A;  1BJF A;  3PN7 C;  4MBE A;  1BOD A;  1SMG A;  1ZMZ A;  1XFU O;  1QAT A;  2LE9 B;  2L2E A;  4N1F A;  3PAL A;  5DKN A;  3PFV A;  2V53 A;  3C1V A;  1UP5 A;  2F33 A;  4M2P A;  1SK6 D;  4P5O E;  3TS5 C;  2JUL A;  5D7F A;  1SR6 C;  3BUN B;  2BL0 B;  2WND A;  1CDM A;  1REC A;  2WC8 A;  1F71 A;  1N0Y A;  1YR5 A;  1TRF A;  3KHE A;  1K94 A;  2QPT A;  1WRL A;  1NCY A;  5AXI A;  1DMO A;  2MLE C;  2QAC A;  1CDN A;  3EKH A;  2Y1M A;  3D10 A;  2Q4U A;  3AKA A;  3DVJ A;  1IKU A;  1J7P A;  3IQQ A;  1SYM A;  4YI8 A;  2JT0 A;  1B9A A;  1YUR A;  2FJU B;  2ISD A;  2KYF A;  1RJV A;  4JWQ A;  5KSZ A;  5FYX A;  4YGE B;  1BR4 B;  1FI5 A;  1G33 A;  4ORA B;  1A03 A;  4R1E A;  4OV2 A;  1YUS A;  1F55 A;  3JTD C;  2KDH A;  2K2F A;  1OQP A;  4OCI A;  5HKY A;  3VRR A;  1H8B A;  1K93 D;  1BR1 B;  2O60 A;  1PSR A;  2BL0 C;  1UHJ A;  4WRI A;  1IG5 A;  1SL7 A;  4XJK A;  3SIA A;  1J1E A;  1TTX A;  3AAK A;  3IQO A;  2PAS A;  4MEW A;  4ORC B;  4NDB A;  1TNX A;  3M0W A;  1GGW A;  2M49 B;  1TNP A;  1EG4 A;  4QJ3 B;  2A4J A;  1IJ5 A;  1QX2 A;  1SW8 A;  2JRF A;  1TCF A;  1JFJ A;  1JF0 A;  1WY9 A;  2LP3 A;  3O6B A;  1PUL A;  2JU0 A;  2ZRT A;  1AHR A;  4JQ0 D;  1F54 A;  3NXA A;  2I18 A;  1Y1X A;  2BBM A;  1KSO A;  2K7O A;  3CLN A;  1W7J B;  3EK8 A;  3TUY B;  1CNP A;  2MAZ A;  2BEC A;  4M2Q A;  1F8H A;  3D0Y A;  2M1U A;  2F2O A;  5ER4 X;  1KWO B;  1SKT A;  1B7T Y;  3PM8 A;  4PHK A;  1MF8 B;  2PAL A;  1UUR A;  4D1E A;  2K61 A;  3SG7 A;  1XVJ A;  3NSI A;  1K90 D;  2M1K B;  3WNX B;  1F4Q A;  3CR2 A;  3PSR A;  1SRA A;  3SG6 A;  4XJK B;  2JPT A;  4GGF C;  3CGA A;  2Y5I A;  1C7W A;  3MSE B;  4PHM A;  2M97 A;  1KFX L;  1YVL A;  2O5G A;  3O4Y A;  3HX4 A;  1YRU B;  1MQ1 A;  1F4O A;  1L2O C;  4HRH A;  3ZWH A;  1M45 A;  1R2U A;  3I5F B;  5DKR A;  1SCV A;  3TUY C;  3PN7 B;  1H4B A;  2JXC A;  1B8R A;  1Y1A A;  1UHH A;  3KF9 A;  3TDU A;  1XFW O;  1SNL A;  2LHI A;  1KWO C;  3EVV A;  4L9M A;  1S26 D;  2ZN8 A;  3ICB A;  1B8L A;  2K7C A;  2ZNE A;  4M2O A;  1SR6 B;  2BE6 A;  2KI4 B;  2KOT A;  1K95 A;  1KFU L;  1BMO A;  4PE0 A;  5G08 A;  5I2Q A;  2F8P A;  2PVB A;  5D69 A;  2JZI A;  3GOF A;  4BY4 A;  1MXE A;  4BY5 A;  4OR9 B;  2K0J A;  1DGV A;  2L98 A;  5JJG A;  1MUX A;  2LHL A;  1FBV A;  3CR5 X;  1EJ3 A;  1ALW A;  4YGA A;  5J3X A;  2LMV A;  1IJ6 A;  1QAS A;  3BOW A;  4PHN A;  3O2P A;  1F70 A;  3DVK A;  1NX2 A;  1NUB A;  1D1O A;  1Q80 A;  2JT3 A;  1YRT B;  2PMY A;  1UHN A;  1JSA A;  2I94 A;  4P2Y B;  1JFK A;  1DF0 A;  2LP2 A;  1ALV A;  4USL A;  1R6P A;  4N1G A;  4YGB B;  1BOC A;  1PAL A;  1WDC B;  1GQM A;  2L0P A;  1OMD A;  1NYA A;  3JTD B;  1KCY A;  2MJW B;  1KQM C;  4GPL B;  1QX7 A;  2H61 C;  1IGV A;  2M8U A;  3SIB A;  2L5X B;  2WOS A;  3GK4 X;  2KI4 C;  1S5G Y;  2Y1N A;  5I2L A;  4GGF A;  4DCK A;  3EVR A;  2WCF A;  3NSK A;  2MBX A;  3RM1 A;  1N2D A;  1FW4 A;  2OTG B;  2KSP A;  4CFQ A;  1CLM A;  3FS7 A;  2M0R A;  4YI9 A;  3CWG A;  4AQI A;  1GGZ A;  1CKK A;  1QXP A;  1WLM A;  5CSF A;  1CTR A;  1QLS A;  2D8N A;  1HT9 A;  1MWN A;  1K8U A;  4GNK B;  4DIR A;  1SY9 A;  3SG4 A;  1DT7 B;  3BOW B;  4A4B A;  1J55 A;  2LUX A;  2BBN A;  1XFY O;  1K9K A;  1MXL C;  2CNP A;  4PE7 A;  1KK8 B;  1FF1 A;  1DF0 B;  1S5G Z;  1UWO A;  3ZNI A;  1PRW A;  2KYC A;  4MZK A;  2LNK A;  3GK2 A;  1MR8 A;  3LCP C;  3JVT C;  3LK0 A;  1IQ5 A;  1AUI B;  2BCB A;  4HRG A;  1DJI A;  3CR4 X;  4MRX A;  1IH0 A;  1WDC C;  1TNQ A;  3BXK A;  4ZCU A;  2HPS A;  1CLB A;  2EC6 B;  1CFP A;  1KQV A;  4DRW A;  2RGI A;  3A4U B;  2G2B A;  4GBA A;  1PVA A;  1DJY A;  4CFR A;  1BG1 A;  3I5I B;  2JQ6 A;  3AAJ A;  2OTG C;  3BUW B;  1LVC D;  5DKQ A;  5KU1 A;  3TDI A;  3PAT A;  1UHK A;  3DD4 A;  4Q04 A;  2LVK A;  5JOL A;  3A8R A;  2KAV A;  2FOT A;  1S1E A;  4NDD A;  1L2O B;  2Y4Q A;  3AKB A;  1DVI A;  4QJ4 B;  1JC2 A;  5CSN A;  1E8A A;  1KK8 C;  3FWB A;  1S3P A;  1LIN A;  2LVI A;  1QIW A;  5HLV A;  2H61 A;  3OX6 A;  2F2P A;  2GGM A;  1CDP A;  3CTN A;  2KAX A;  3PLF B;  1L7Z A;  2CCM A;  1SBJ A;  2EC6 C;  2M3W A;  4OKH A;  1NX1 A;  1RWY A;  2JWW A;  1FPW A;  4ORB B;  5TNC A;  1S36 A;  1AJ4 A;  1KK7 Y;  1TIZ A;  3I5I C;  2B1U A;  4MZL A;  4PAL A;  1QVI Y;  1TOP A;  4CPV A;  2F3Y A;  4PE4 A;  3BYA A;  1EL4 A;  3DF0 B;  3QRX A;  1QV0 A;  3F45 A;  4YBH B;  1QTX A;  1ZAC A;  2AUC A;  1M39 A;  2LC5 A;  2KI6 D;  4MRY A;  2ZKM X;  5IBW A;  4I5K A;  1ZOT B;  2BKH B;  2G9B A;  2KNE A;  2L50 A;  3GK1 A;  1YTZ C;  2SCP A;  1KSM A;  1X02 A;  1GJY A;  1S6J A;  1NWD A;  1KK7 Z;  1NX3 A;  1UHI A;  2L4I A;  1SL8 A;  3I5G B;  4HSZ A;  4HRE E;  1QVI Z;  1KQM B;  4YGC B;  3SG3 A;  1K2H A;  4GGN A;  2JTT A;  2CBL A;  4C0K A;  3VRQ A;  2LUC A;  5HLO A;  2I7A A;  2FCD A;  1AVS A;  1SL9 A;  1N65 A;  1VRK A;  5F6T A;  4ZCV A;  4U8D A;  4C0L A;  4WQ2 A;  5I2O A;  1EXR A;  1J1D A;  2K8M B;  1BLQ A;  3WXA A;  5HYD A;  1JF2 A;  4CID A;  1NCX A;  2JC2 A;  1SCM B;  1V1F A;  2GV5 A;  1AP4 A;  4YRU A;  1UUS A;  2JNF A;  1LKJ A;  1W7I B;  2Q91 A;  5B8I B;  3K21 A;  1CDL A;  5KTY A;  1IQ3 A;  2GGZ A;  4MVF A;  4CLN A;  1ODB A;  2EHB A;  1U5I B;  1A2X A;  2P6B B;  1WRZ A;  3NSO A;  2ZFD A;  1CM4 A;  2BCX A;  2OPO A;  3FIA A;  5ER5 A;  2KBM A;  2R2I A;  1LA0 A;  3JVT B;  1CMF A;  1QS7 A;  1RFJ A;  2BKI B;  3VGO A;  1J7O A;  2OS8 C;  3I5G C;  2LM5 A;  1RRO A;  3O78 A;  3BUO B;  1OZS A;  2M29 A;  2HQW A;  1EG3 A;  2LCP A;  2NZ0 A;  2LLU A;  2E6W A;  1YVH A;  3OHM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...