1SPYA

Regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Muscle protein
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1spyA00
3FIAA 2K61A 1WLMA 2M7NA 1NCXA 2I7AA 2LVJA 3HX4A 2ZN8A 1TNQA 1SCMC 3BYAA 4CFRA 1OMRA 1Y1AA 3VRQA 3CWGA 3EVVA 1CDPA 5HLVA 1F71A 3ICBA 3FWBA 2M0RA 4YI8A 3BQ3A 1IGVA 2K7CA 2BECA 2KDHA 1B8RA 2DOQA 4MZJA 5FYXA 5B8IB 1SCMB 2G9BA 2FCDA 2K7OA 1SMGA 2BCXA 2AMIA 1M45A 5AEQA 2LCPA 1CDMA 4GFTA 3GOFA 5DKNA 1YR5A 1NP8A 3AKAA 3AAKA 4AQIA 4NDCA 3I5GC 4YGDB 1GGWA 2FOTA 2JZIA 1QIWA 1Q80A 3BOWA 1QIVA 2CNPA 2LC5A 3OB2B 3CS1A 1MR8A 3SG5A 1L2OC 1OMDA 4MZKA 3HCMA 4BY4A 3OB1B 1SL7A 2LHIA 3I5GB 4WQ2A 1K2HA 3CZTX 1G33A 3VRNA 1CFDA 4UPGA 5KSZA 2BCAA 2KFFA 3TS5C 3BOWB 1KK7Z 4GPLB 1QX2A 1CKKA 2JC2A 3EK8A 1S5GY 1L2OB 4U8DA 4I5LB 4AQJA 2F2OA 1XK4A 1XK4C 3BUXB 1QJTA 2KHNA 4QJ4B 3DVJA 3KEVA 4NDDA 3TS5B 2P6BB 2KAYA 2WNDA 1N2DA 4YI9A 1IJ6A 3H4SE 2JRFA 1UWOA 1K95A 1RFJA 4M2PA 4FTGA 4OV2A 2KI4C 1CDNA 1SBJA 5I2OA 2FJUB 1WLZA 4MVFA 2LANA 2F3YA 4DUQA 2LVVA 3DF0A 3VGOA 5CSNA 3BUWB 1EXRA 2LP2A 2MLFC 2Y4QA 3OX6A 4CLNA 2H61C 1CDLA 2QPTA 3FS7A 5I8NA 1RK9A 4C0JA 2KI4B 1BT6A 2CXJA 1CFCA 4GAOA 5HLOA 3IQQA 1CFPA 4C0KA 2HQ8A 1TN4A 2Q4UA 3DF0B 1F70A 2Y1NA 3EVRA 1YX7A 4C0LA 1LA0A 1M46A 2FCEA 4MRYA 1BR1B 2Y5IA 1QXPA 3RM1A 2H2KA 1NCZA 3IQOA 2HPSA 1OSAA 1B8CA 4YGBB 2BBNA 1B9AA 1S1EA 1DJWA 2KNEA 1XFXO 2L51A 1JWDA 5PALA 1OQPA 2PSRA 1OZSA 4FQOA 1GGZA 3EK4A 5DKQA 1RJVA 1BOCA 1PK0D 2IS9A 3QRXA 2BE6A 1KK8C 4HRGA 2ZRSA 2M7LA 2L2EA 2OPOA 1R6PA 3I5FC 1B7TZ 1DGVA 1N0YA 1TTXA 1SPYA 2VRGA 2ZNDA 3A8RA 4GGFC 4GGFA 4P5OE 4Q04A 2LUCA 3EKJA 1K93D 1NX1A 1NSHA 2MHHA 1S6IA 4L9MA 3BXKA 1AP4A 1NX2A 4CFQA 1C7WA 1KK8B 2JT3A 5K89A 2JXCA 1Y6WA 4GUKA 1QV0A 3I5FB 1AJ5A 1U5IA 1ZACA 1DJHA 2BKIB 1ALVA 2M1KB 1WRZA 3PN7C 1IRJA 1SNLA 1DF0A 1G4YR 1YUSA 5ER4X 1QX7A 2JU0A 1H4BA 4PE0A 1QVIY 1UHJA 2M3WA 3PALA 1MWNA 1V1GA 2LM5A 4ORCB 3VRPA 4CIDA 1K96A 4DS7A 3PN7B 5BPJA 1A75A 1DVIA 4PDZA 5HYDA 3D0YA 5G08A 1DJXA 2KQYA 3NSOA 2K7DA 2L4HA 1M63B 1WRLA 5CPVA 1FI6A 3NXAA 1ODBA 2GGMA 2MLEC 2BBMA 1W7IB 3LCPC 2K8MB 4OCIA 4PE4A 2KSPA 1A75B 1Y1XA 1YUUA 3I5IC 2ZFDA 2WCBA 3D0YB 1XFWO 1IQ3A 1B1GA 1BODA 4PHKA 1TCFA 2QACA 2LMUA 2K2AA 4MZLA 3WXAA 5CSJA 3E3RA 2R2IA 1SK6D 1DT7B 4WQ3A 1YX8A 4P2YB 3SG2A 1EG3A 1AUIB 2M29A 1S6CA 2F8PA 2ISDA 3I5IB 4D1EA 2KFHA 1J7OA 2CTNA 2KFGA 2ZN9A 1S26D 1SW8A 4NDBA 4CPVA 2KYCA 1WDCC 1CMGA 2MBXA 1S3PA 1TIZA 1YVLA 4USLA 3D10A 1PSRA 2E6WA 4PE1A 2MJWB 1JUOA 1W7JB 3GK1A 2ZRTA 5JOLA 2EGDA 4MLWA 3WHUB 1J7RA 4PALA 1WDCB 3CR5X 2BL0C 1KFUS 3LK0A 4MBEA 2KBIA 1ZFSA 2G2BA 1IH0A 3OP0A 4I5KA 2KYFA 2BCBA 3AKBA 4JQ0D 2LNKA 2O60A 4IL1A 4N1FA 1MQ1A 5CSFA 2ZNEA 4PCWA 1CTRA 2BL0B 3F45A 1EG4A 1SKTA 1M39A 1NPQA 1XFUO 3PLFB 4F0ZB 1S5GZ 1MXEA 4ZCVA 2GGZA 1MXLC 1IKUA 1N65A 4TNCA 1PVAA 2F3ZA 1DJIA 1B8LA 3LLEA 2BE4A 4JPZB 2EHBA 3JVTC 2EC6C 1UURA 5F6TA 3O78A 4ORAB 1BF5A 4HREE 3AAJA 3EVUA 4XYNA 5J3XA 1J55A 2KGRA 2PMYA 2L5XB 2JT8A 1ZOTB 2WCEA 4DCKA 2PVBA 2I18A 3OX5A 5KTYA 3JVTB 1B47A 1QV1A 2EC6B 1XFVO 4WRIA 2PRUA 1H8BA 2LAPA 2LP3A 1SYMA 1JFKA 4I5NB 4ORBB 2E30A 2V53A 1Y0VH 3SIBA 1K9PA 1DJZA 2KQ6A 1G8IA 1HT9A 1GJYA 4JWQA 2JT0A 3C1VA 3NSIA 4N1GA 4NQGA 1KFXL 3I5HC 1YUTA 2NZ0A 4M2OA 1DGUA 1A2XA 1JF0A 1BG1A 2M1UA 3DD4A 2JTTA 2JXLA 5D7FA 3TZ1A 1XFYO 1CMFA 2JPTA 3TDZA 1KWOC 3VROA 3I5HB 1XA5A 3DVKA 3CR4X 5HKYA 1QTXA 1KCYA 1QATA 1HQVA 2M49B 3O6BA 1CLLA 1ALWA 3ZNIA 2LLSA 1LKJA 1FBVA 1J7QA 1KWOB 3SJSA 4A4BA 1SR6C 3SG6A 4MRXA 1UHIA 2LVIA 1RTP1 1PRWA 1UHHA 1U5IB 2WCFA 1NWDA 3DVMA 5AFPA 2HQWA 2OS8C 3WHTB 1OMVA 1TOPA 2TN4A 4ETOA 2B1UA 1F55A 1SR6B 4N5XA 1OE9B 1FW4A 1DF0B 1JFJA 1EL4A 4PHMA 2JOJA 1CM4A 1BJFA 1UUSA 4OR9B 1CFFA 2OS8B 1CM1A 2LLTA 2AAOA 4YGCB 1LINA 2JULA 3SIAA 1QVIZ 1SRAA 1K94A 1KQVA 1BU3A 2I94A 1IWQA 1IQ5A 2HETA 3A4UB 3KO0A 3M0WA 1BLQA 1C07A 1VRKA 1BR4B 1QLSA 3WNXB 1F54A 1GQMA 1NYAA 1JSAA 2LMVA 2M8UA 4E68A 2KOTA 1MUXA 4MN0A 1SL9A 2Q91A 3TDUA 1LXFC 1UHKA 1XVJA 1LVCD 2F33A 3SG4A 2KI6C 2LVKA 1F4QA 1YURA 1YVHA 1AVSA 2CCMA 2KGBC 3CR2A 3PM8A 3GK2A 4GNKB 1B4CA 2LUXA 3LL8B 1S6JA 1XO5A 2JTZA 3CGAA 1TNPA 4YBHB 2D8NA 1YTZC 1E8AA 1PSBA 2LLUA 1AJ4A 5AXIA 1JBAA 1FPWA 3SG3A 3NSLA 2PALA 1FF1A 2KAVA 1PULA 5CSIA 2JWWA 3TDIA 1A29A 2MRDA 2M97A 2CBLA 1KK7Y 1K9KA 2JNXA 4ZCUA 1C7VA 1LA3A 2NLNA 3IF7A 1NCYA 3O2PA 1RECA 4PHJA 4M2QA 4YRUA 3VRRA 4BY5A 1UP5A 1L7ZA 1J1DA 2K2FA 1NUBA 4PE7A 3EKHA 1OOJA 2A4JA 1DJYA 2ZKMX 4HRHA 4DRWA 3NSKA 3PFVA 1DJGA 2LE9B 1BMOA 1K90D 2KI6D 3ZWHA 4AOMA 4QJ5B 1XFZO 3PSRA 4XJKA 1KFXS 2O5GA 5D69A 4PHNA 1KSOA 5JJGA 3DVEA 2OTGC 1NX3A 5I2QA 4MSPA 1KQMC 4XJKB 2WORA 1TNWA 1YRUB 1TRFA 4ICBA 2Y1MA 1ZUZA 4I5JA 2H61A 2NXQA 1NX0A 4R1EA 4A4CA 1KFUL 2K0JA 2MA2A 2WOSA 1YRTB 2OTGB 1JC2A 1KQMB 1WRKA 1K8UA 2PASA 3JTDC 4YGEB 5HKZA 1DTLA 2GV5A 2LMTA 1RWYA 2NCPA 1MF8B 1UHNA 5I2LA 3LK1A 1F8HA 2L98A 4YGAA 3O4YA 1EJ3A 1MHOA 2K7BA 3GK4X 2BKHB 1JF2A 1TCOB 1IJ5A 3CLNA 1NIWA 3JTDB 2NCOA 5GQQC 1PALA 2CT9A 2L4IA 4QJ3B 5AERA 1B7TY 5HKWA 3RLZA 1QS7A 3KPXA 3KF9A 5KU1A 2LV7A 1KSMA 1PVBA 3CTNA 1CLMA 4HSZA 1SY9A 4GBAA 2COLB 2SCPA 1XYDA 2MAZA 2I2RE 3BUNB 1OZOA 1QASA 1AK8A 2SASA 1FI5A 3KHEA 2LHLA 1X02A 2F2PA 5DKRA 5ER5A 2JNFA 2L0PA 1A03A 3K21A 2HF5A 2JQ6A 1J1EA 1AHRA 1IG5A 1SL8A 1V1FA 1DMOA 1M31A 2KBMA 4OKHA 5AANA 5TNCA 1S36A 1QX5B 3FWCA 4GGNA 2L50A 1F4OA 1CB1A 1CLBA 1R2UA 1SCVA 1TNXA 1QLKA 3MSEB 3SG7A 1RROA 1ZMZA 3TUYC 1D1OA 4OVNF 1CNPA 1A4PA 2KAXA 3OHMB 1Y1UA 3PATA 3BUOB 2RGIA 3BUMB 2M9GA 5IBWA 2WC8A 3EK7A 1WY9A 2AUCA 3TUYB 4DIRA 4MEWA 1J7PA 1K9UA 1EH2A
chains in the Genus database with same CATH superfamily
1XFRA 2K61A 3FIAA 1WLMA 2M7NA 1NCXA 2I7AA 2LVJA 1Z2CB 2ZN8A 3HX4A 3DY9A 1TNQA 1SCMC 3BYAA 4CFRA 1OMRA 1Y1AA 3R1PA 4INWA 3VRQA 3CWGA 3EVVA 1CDPA 5HLVA 2WCJA 1F71A 3ICBA 3FWBA 2M0RA 4YI8A 3BQ3A 3CDNA 1IGVA 2K7CA 3NGVA 2BECA 2KDHA 1B8RA 2DOQA 4FQTA 4MZJA 1TUZA 2PYQA 1SCMB 2G9BA 2FCDA 2K7OA 1SMGA 5FYXA 2BCXA 2AMIA 1M45A 5AEQA 2LCPA 1CDMA 4GFTA 3BJHA 3GOFA 5DKNA 1YR5A 1NP8A 3AKAA 3AAKA 4AQIA 4NDCA 1LS8A 3I5GC 4YGDB 1GGWA 2FOTA 2JZIA 1QIWA 1Q80A 3BOWA 1QIVA 2CNPA 2LC5A 3OB2B 3CS1A 1MR8A 3SG5A 1L2OC 1OMDA 4MZKA 3HCMA 4BY4A 3OB1B 1SL7A 2LHIA 3I5GB 4WQ2A 1K2HA 3CZTX 1G33A 3VRNA 1CFDA 4UPGA 5KSZA 2BCAA 2KFFA 3TS5C 3BOWB 1KK7Z 4GPLB 1C3YA 1QX2A 1CKKA 2JC2A 3EK8A 1S5GY 1L2OB 4U8DA 4I5LB 4AQJA 2F2OA 1XK4A 1XK4C 3BUXB 1QJTA 2KHNA 4QJ4B 3DVJA 2P70A 3KEVA 4NDDA 3TS5B 2P6BB 2KAYA 2WNDA 1N2DA 4YI9A 1C3ZA 1IJ6A 3H4SE 2JRFA 1UWOA 1K95A 1RFJA 4M2PA 4FTGA 3B87A 2KI4C 4OV2A 1CDNA 1SBJA 5I2OA 2FJUB 1WLZA 4MVFA 3B88A 2LANA 2F3YA 4DUQA 5DICA 2LVVA 3DF0A 3VGOA 5CSNA 3BUWB 1EXRA 2LP2A 2MLFC 2Y4QA 3OX6A 4CLNA 2H61C 1CDLA 2QPTA 3FS7A 5I8NA 3VB1A 1RK9A 4C0JA 2KI4B 3D74A 1BT6A 2CXJA 1CFCA 4GAOA 5HLOA 3IQQA 1CFPA 4C0KA 2HQ8A 1TN4A 2L5YA 3UNWA 3D78A 2Q4UA 3DF0B 3N7HA 1F70A 2Y1NA 3EVRA 1YX7A 4C0LA 1LA0A 4KYNA 1M46A 2FCEA 4MRYA 1BR1B 2Y5IA 1QXPA 3PJIA 3RM1A 2H2KA 1NCZA 3FE8A 3IQOA 2HPSA 1OSAA 1B8CA 4YGBB 2BBNA 2QDIA 1B9AA 1S1EA 1DJWA 2KNEA 1XFXO 2L51A 5FI2A 1JWDA 5PALA 1OQPA 2PSRA 3SS4A 1OZSA 4FQOA 1GGZA 3EK4A 5DKQA 1RJVA 1BOCA 1PK0D 2IS9A 2KLDA 2BE6A 1KK8C 3QRXA 4HRGA 2ZRSA 1ORGA 2M7LA 2L2EA 2OPOA 1R6PA 3I5FC 1B7TZ 1DGVA 1N0YA 1TTXA 1SPYA 2VRGA 2ZNDA 3A8RA 4GGFC 4GGFA 4P5OE 4Q04A 2LUCA 3EKJA 1K93D 1NX1A 1P28A 1NSHA 2MHHA 1S6IA 4L9MA 3BXKA 1AP4A 1NX2A 4CFQA 1C7WA 1KK8B 2JT3A 1TUJA 2JXCA 5K89A 1Y6WA 3D77A 1QV0A 4GUKA 3I5FB 1AJ5A 1U5IA 1ZACA 1DJHA 2BKIB 1ALVA 2M1KB 1WRZA 3PN7C 1IRJA 1SNLA 1DF0A 1G4YR 1YUSA 5ER4X 2WCMA 1QX7A 2JU0A 1H4BA 4PE0A 1QVIY 1UHJA 2M3WA 3PALA 1MWNA 1V1GA 2LM5A 4ORCB 3VRPA 4CIDA 1K96A 4DS7A 3PN7B 5BPJA 1A75A 4F7FA 1DVIA 4PDZA 5HYDA 3D0YA 5G08A 1DJXA 2KQYA 3NSOA 2K7DA 2L4HA 1M63B 1WRLA 5CPVA 1FI6A 3NXAA 1ODBA 2GGMA 2BAPA 2BBMA 1W7IB 2MLEC 3LCPC 2K8MB 4OCIA 4PE4A 2KSPA 1A75B 1Y1XA 5FI7A 1YUUA 3I5IC 2ZFDA 2WCBA 3D0YB 1XFWO 1IQ3A 1B1GA 1BODA 4PHKA 1TCFA 2QACA 2LMUA 2K2AA 4MZLA 3WXAA 5CSJA 3E3RA 2R2IA 1SK6D 1DT7B 4WQ3A 1YX8A 3S0AA 4P2YB 3SG2A 3IVTA 1EG3A 1AUIB 2M29A 1S6CA 2F8PA 2ISDA 3BFHA 3I5IB 1IIOA 4D1EA 2KFHA 1J7OA 2CTNA 2KFGA 2ZN9A 1S26D 1SW8A 4NDBA 4CPVA 2KYCA 2P71A 3EG5B 3S0BA 1WDCC 1CMGA 2MBXA 1S3PA 1TIZA 1YVLA 4USLA 3D10A 1PSRA 2E6WA 4PE1A 2MJWB 1JUOA 1W7JB 3R1OA 3D73A 3GK1A 2ZRTA 5JOLA 2EGDA 4MLWA 3WHUB 1J7RA 4PALA 1WDCB 3CR5X 2BL0C 1KFUS 3LK0A 4MBEA 2KBIA 1OOHA 1ZFSA 2WCHA 3S0FA 1DQEA 2G2BA 3QMEA 1IH0A 3OP0A 4I5KA 2KYFA 2BCBA 3AKBA 4JQ0D 2LNKA 2O60A 4IL1A 4N1FA 1MQ1A 5CSFA 2ZNEA 4PCWA 1CTRA 2BL0B 3F45A 1EG4A 3V2LA 1SKTA 1M39A 1NPQA 1XFUO 4JD9A 3PLFB 4F0ZB 1S5GZ 1MXEA 3TDUA 4ZCVA 2WC6A 2GGZA 1MXLC 1IKUA 1N65A 2KLEA 4TNCA 1PVAA 2F3ZA 3B6XA 1DJIA 1B8LA 2QEBA 3LLEA 2BE4A 4JPZB 2EHBA 3JVTC 2EC6C 1UURA 5F6TA 3O78A 4ORAB 1BF5A 2BNXA 4HREE 3AAJA 3EVUA 4XYNA 5J3XA 1J55A 2KGRA 2KPHA 2PMYA 2L5XB 3D76A 2JT8A 1ZOTB 2WCEA 4DCKA 2PVBA 2QEHA 2I18A 3OX5A 5KTYA 3JVTB 1B47A 1QV1A 2EC6B 1XFVO 4WRIA 2PRUA 1H8BA 2LAPA 2LP3A 1SYMA 1JFKA 4I5NB 4ORBB 2E30A 2V53A 1Y0VH 3SIBA 1K9PA 1DJZA 2KQ6A 1G8IA 1HT9A 3BFAA 1GJYA 4JWQA 2JT0A 3C1VA 3NSIA 4N1GA 4NQGA 1W9ZA 1KFXL 1GM0A 3I5HC 1YUTA 2NZ0A 4M2OA 1DGUA 1A2XA 2PQLA 1JF0A 3SS3A 3CZ0A 1BG1A 3NHIA 4INXA 2M1UA 3DD4A 2JTTA 2JXLA 5D7FA 3TZ1A 1XFYO 1CMFA 2JPTA 3TDZA 4PT1A 1KWOC 3VROA 3I5HB 3L4AA 3L4LA 1XA5A 3DVKA 3CR4X 5HKYA 1QTXA 1KCYA 1QATA 1HQVA 2M49B 1DC1A 3CYZA 3O6BA 1CLLA 1ALWA 1Z4HA 2LLSA 3ZNIA 1LKJA 1FBVA 1J7QA 1KWOB 3SJSA 4A4BA 1SR6C 3S0DA 4MRXA 3SG6A 1UHIA 2LVIA 1RTP1 1PRWA 1UHHA 1U5IB 2WCFA 1NWDA 3DVMA 5AFPA 2HQWA 2OS8C 3WHTB 3O4XA 1OMVA 1TOPA 2TN4A 4ETOA 2B1UA 1F55A 1SR6B 4N5XA 1OE9B 2WCKA 1FW4A 1DF0B 1JFJA 1EL4A 4PHMA 3L47A 2JOJA 2ERBA 1CM4A 1BJFA 1UUSA 4OR9B 1CFFA 2H8VA 2OS8B 1CM1A 2LLTA 2AAOA 4YGCB 1LINA 2JULA 3SIAA 1QVIZ 1T14A 1SRAA 3CZ2A 1K94A 1KQVA 1BU3A 2I94A 1IWQA 1IQ5A 2HETA 3A4UB 3KO0A 3M0WA 1BLQA 1C07A 1VRKA 1BR4B 1QLSA 3WNXB 1F54A 1GQMA 1NYAA 1JSAA 2LMVA 2M8UA 4E68A 2KOTA 1MUXA 4MN0A 3NHTA 1SSEB 1SL9A 1OOFA 2Q91A 1LXFC 1UHKA 1XVJA 1LVCD 2F33A 3DZTA 3SG4A 2KI6C 2LVKA 1F4QA 1YURA 1YVHA 1AVSA 2CCMA 2KGBC 3CR2A 3PM8A 3R72A 3GK2A 4GNKB 1B4CA 2LUXA 5EL2A 3LL8B 1S6JA 1XO5A 2JTZA 3CGAA 1TNPA 4YBHB 2D8NA 1YTZC 1E8AA 1PSBA 2LLUA 1AJ4A 5AXIA 1JBAA 1FPWA 3SG3A 3NSLA 2PALA 1FF1A 2KAVA 1PULA 5CSIA 2JWWA 2QEOA 3TDIA 1A29A 2MRDA 2M97A 2CBLA 1KK7Y 1K9KA 2JNXA 4ZCUA 1C7VA 1LA3A 2NLNA 3IF7A 4JKTA 3FE9A 4IJ7A 1NCYA 2WCLA 3O2PA 1DELA 1RECA 4PHJA 4M2QA 4YRUA 3VRRA 4BY5A 1OW4A 3UO9A 1UP5A 1L7ZA 1J1DA 2K2FA 1NUBA 2GTEA 4PE7A 3EKHA 1OOJA 2A4JA 1DJYA 2QEVA 2ZKMX 1TWOA 4HRHA 1DEKA 4DRWA 3NSKA 3PFVA 1DJGA 2LE9B 1BMOA 1K90D 2KI6D 2WC5A 3ZWHA 4AOMA 4QJ5B 1XFZO 3PSRA 4XJKA 1KFXS 2FJYA 2O5GA 5D69A 4PHNA 1KSOA 3RZSA 5JJGA 3DVEA 2OTGC 1NX3A 5I2QA 4MSPA 1KQMC 2JPOA 4XJKB 5D3OA 2WORA 1TNWA 1YRUB 3DXLA 1TRFA 4ICBA 2Y1MA 2YGUA 1ZUZA 4I5JA 2H61A 2NXQA 3S0GA 1NX0A 4R1EA 4A4CA 1KFUL 2K0JA 2MA2A 3CABA 2WOSA 1YRTB 2OTGB 3BFBA 5FI6A 1JC2A 1KQMB 1WRKA 1K8UA 2PASA 3FE6A 3JTDC 4YGEB 1DTLA 5HKZA 1QWVA 2L2CA 2GV5A 2LMTA 1RWYA 2NCPA 1MF8B 1UHNA 5I2LA 3LK1A 1F8HA 3OBVA 2L98A 4YGAA 3SS5A 3O4YA 1EJ3A 1MHOA 2K7BA 3GK4X 1TCOB 1JF2A 2BKHB 1IJ5A 3CLNA 1NIWA 3JTDB 2NCOA 5GQQC 1PALA 2CT9A 2L4IA 4QJ3B 5AERA 1B7TY 5HKWA 3RLZA 1QS7A 3KPXA 3KF9A 5KU1A 2LV7A 1KSMA 1OOIX 1PVBA 3CTNA 3D75A 1CLMA 4HSZA 1SY9A 3CZ1A 4GBAA 5HL1A 2COLB 2SCPA 1XYDA 4OZDA 2MAZA 2I2RE 3BUNB 1OZOA 3K1EA 1QASA 1AK8A 2SASA 1FI5A 3KHEA 2LHLA 2K60A 1X02A 2F2PA 5DKRA 5ER5A 2JNFA 2L0PA 3DYEA 1A03A 3B86A 3K21A 2HF5A 2JQ6A 1J1EA 1AHRA 1IG5A 1V1FA 1SL8A 1DMOA 1M31A 2KBMA 4OKHA 5AANA 5TNCA 1S36A 1QX5B 3FWCA 4GGNA 2L50A 3PM2A 5B8IB 1F4OA 1CB1A 1CLBA 1R2UA 3S0EA 1OOGA 1SCVA 1TNXA 1QLKA 3MSEB 3SG7A 1RROA 1ZMZA 3TUYC 1D1OA 4OVNF 1CNPA 1A4PA 3R1VA 2KAXA 3OHMB 1Y1UA 3PATA 3OGNA 3BUOB 2RGIA 3BUMB 5I94A 2M9GA 5IBWA 2WC8A 3EK7A 3Q8IA 1WY9A 2AUCA 3TUYB 4DIRA 4MEWA 1J7PA 1K9UA 1EH2A 3B7AA
chains in the Genus database with same CATH topology
3FIAA 2K61A 1WLMA 2M7NA 1NCXA 2I7AA 2LVJA 3HX4A 2ZN8A 1TNQA 1SCMC 3BYAA 4CFRA 1OMRA 1Y1AA 3VRQA 3CWGA 3EVVA 1CDPA 5HLVA 1F71A 3ICBA 3FWBA 2M0RA 4YI8A 3BQ3A 1IGVA 2K7CA 2BECA 2KDHA 1B8RA 2DOQA 4MZJA 5FYXA 5B8IB 1SCMB 2G9BA 2FCDA 2K7OA 1SMGA 2BCXA 2AMIA 1M45A 5AEQA 2LCPA 1CDMA 4GFTA 3GOFA 5DKNA 1YR5A 1NP8A 3AKAA 3AAKA 4AQIA 4NDCA 3I5GC 4YGDB 1GGWA 2FOTA 2JZIA 1QIWA 1Q80A 3BOWA 1QIVA 2CNPA 2LC5A 3OB2B 3CS1A 1MR8A 3SG5A 1L2OC 1OMDA 4MZKA 3HCMA 4BY4A 3OB1B 1SL7A 2LHIA 3I5GB 4WQ2A 1K2HA 3CZTX 1G33A 3VRNA 1CFDA 4UPGA 5KSZA 2BCAA 2KFFA 3TS5C 3BOWB 1KK7Z 4GPLB 1QX2A 1CKKA 2JC2A 3EK8A 1S5GY 1L2OB 4U8DA 4I5LB 4AQJA 2F2OA 1XK4A 1XK4C 3BUXB 1QJTA 2KHNA 4QJ4B 3DVJA 3KEVA 4NDDA 3TS5B 2P6BB 2KAYA 2WNDA 1N2DA 4YI9A 1IJ6A 3H4SE 2JRFA 1UWOA 1K95A 1RFJA 4M2PA 4FTGA 4OV2A 2KI4C 1CDNA 1SBJA 5I2OA 2FJUB 1WLZA 4MVFA 2LANA 2F3YA 4DUQA 2LVVA 3DF0A 3VGOA 5CSNA 3BUWB 1EXRA 2LP2A 2MLFC 2Y4QA 3OX6A 4CLNA 2H61C 1CDLA 2QPTA 3FS7A 5I8NA 1RK9A 4C0JA 2KI4B 1BT6A 2CXJA 1CFCA 4GAOA 5HLOA 3IQQA 1CFPA 4C0KA 2HQ8A 1TN4A 2Q4UA 3DF0B 1F70A 2Y1NA 3EVRA 1YX7A 4C0LA 1LA0A 1M46A 2FCEA 4MRYA 1BR1B 2Y5IA 1QXPA 3RM1A 2H2KA 1NCZA 3IQOA 2HPSA 1OSAA 1B8CA 4YGBB 2BBNA 1B9AA 1S1EA 1DJWA 2KNEA 1XFXO 2L51A 1JWDA 5PALA 1OQPA 2PSRA 1OZSA 4FQOA 1GGZA 3EK4A 5DKQA 1RJVA 1BOCA 1PK0D 2IS9A 3QRXA 2BE6A 1KK8C 4HRGA 2ZRSA 2M7LA 2L2EA 2OPOA 1R6PA 3I5FC 1B7TZ 1DGVA 1N0YA 1TTXA 1SPYA 2VRGA 2ZNDA 3A8RA 4GGFC 4GGFA 4P5OE 4Q04A 2LUCA 3EKJA 1K93D 1NX1A 1NSHA 2MHHA 1S6IA 4L9MA 3BXKA 1AP4A 1NX2A 4CFQA 1C7WA 1KK8B 2JT3A 5K89A 2JXCA 1Y6WA 4GUKA 1QV0A 3I5FB 1AJ5A 1U5IA 1ZACA 1DJHA 2BKIB 1ALVA 2M1KB 1WRZA 3PN7C 1IRJA 1SNLA 1DF0A 1G4YR 1YUSA 5ER4X 1QX7A 2JU0A 1H4BA 4PE0A 1QVIY 1UHJA 2M3WA 3PALA 1MWNA 1V1GA 2LM5A 4ORCB 3VRPA 4CIDA 1K96A 4DS7A 3PN7B 5BPJA 1A75A 1DVIA 4PDZA 5HYDA 3D0YA 5G08A 1DJXA 2KQYA 3NSOA 2K7DA 2L4HA 1M63B 1WRLA 5CPVA 1FI6A 3NXAA 1ODBA 2GGMA 2MLEC 2BBMA 1W7IB 3LCPC 2K8MB 4OCIA 4PE4A 2KSPA 1A75B 1Y1XA 1YUUA 3I5IC 2ZFDA 2WCBA 3D0YB 1XFWO 1IQ3A 1B1GA 1BODA 4PHKA 1TCFA 2QACA 2LMUA 2K2AA 4MZLA 3WXAA 5CSJA 3E3RA 2R2IA 1SK6D 1DT7B 4WQ3A 1YX8A 4P2YB 3SG2A 1EG3A 1AUIB 2M29A 1S6CA 2F8PA 2ISDA 3I5IB 4D1EA 2KFHA 1J7OA 2CTNA 2KFGA 2ZN9A 1S26D 1SW8A 4NDBA 4CPVA 2KYCA 1WDCC 1CMGA 2MBXA 1S3PA 1TIZA 1YVLA 4USLA 3D10A 1PSRA 2E6WA 4PE1A 2MJWB 1JUOA 1W7JB 3GK1A 2ZRTA 5JOLA 2EGDA 4MLWA 3WHUB 1J7RA 4PALA 1WDCB 3CR5X 2BL0C 1KFUS 3LK0A 4MBEA 2KBIA 1ZFSA 2G2BA 1IH0A 3OP0A 4I5KA 2KYFA 2BCBA 3AKBA 4JQ0D 2LNKA 2O60A 4IL1A 4N1FA 1MQ1A 5CSFA 2ZNEA 4PCWA 1CTRA 2BL0B 3F45A 1EG4A 1SKTA 1M39A 1NPQA 1XFUO 3PLFB 4F0ZB 1S5GZ 1MXEA 4ZCVA 2GGZA 1MXLC 1IKUA 1N65A 4TNCA 1PVAA 2F3ZA 1DJIA 1B8LA 3LLEA 2BE4A 4JPZB 2EHBA 3JVTC 2EC6C 1UURA 5F6TA 3O78A 4ORAB 1BF5A 4HREE 3AAJA 3EVUA 4XYNA 5J3XA 1J55A 2KGRA 2PMYA 2L5XB 2JT8A 1ZOTB 2WCEA 4DCKA 2PVBA 2I18A 3OX5A 5KTYA 3JVTB 1B47A 1QV1A 2EC6B 1XFVO 4WRIA 2PRUA 1H8BA 2LAPA 2LP3A 1SYMA 1JFKA 4I5NB 4ORBB 2E30A 2V53A 1Y0VH 3SIBA 1K9PA 1DJZA 2KQ6A 1G8IA 1HT9A 1GJYA 4JWQA 2JT0A 3C1VA 3NSIA 4N1GA 4NQGA 1KFXL 3I5HC 1YUTA 2NZ0A 4M2OA 1DGUA 1A2XA 1JF0A 1BG1A 2M1UA 3DD4A 2JTTA 2JXLA 5D7FA 3TZ1A 1XFYO 1CMFA 2JPTA 3TDZA 1KWOC 3VROA 3I5HB 1XA5A 3DVKA 3CR4X 5HKYA 1QTXA 1KCYA 1QATA 1HQVA 2M49B 3O6BA 1CLLA 1ALWA 3ZNIA 2LLSA 1LKJA 1FBVA 1J7QA 1KWOB 3SJSA 4A4BA 1SR6C 3SG6A 4MRXA 1UHIA 2LVIA 1RTP1 1PRWA 1UHHA 1U5IB 2WCFA 1NWDA 3DVMA 5AFPA 2HQWA 2OS8C 3WHTB 1OMVA 1TOPA 2TN4A 4ETOA 2B1UA 1F55A 1SR6B 4N5XA 1OE9B 1FW4A 1DF0B 1JFJA 1EL4A 4PHMA 2JOJA 1CM4A 1BJFA 1UUSA 4OR9B 1CFFA 2OS8B 1CM1A 2LLTA 2AAOA 4YGCB 1LINA 2JULA 3SIAA 1QVIZ 1SRAA 1K94A 1KQVA 1BU3A 2I94A 1IWQA 1IQ5A 2HETA 3A4UB 3KO0A 3M0WA 1BLQA 1C07A 1VRKA 1BR4B 1QLSA 3WNXB 1F54A 1GQMA 1NYAA 1JSAA 2LMVA 2M8UA 4E68A 2KOTA 1MUXA 4MN0A 1SL9A 2Q91A 3TDUA 1LXFC 1UHKA 1XVJA 1LVCD 2F33A 3SG4A 2KI6C 2LVKA 1F4QA 1YURA 1YVHA 1AVSA 2CCMA 2KGBC 3CR2A 3PM8A 3GK2A 4GNKB 1B4CA 2LUXA 3LL8B 1S6JA 1XO5A 2JTZA 3CGAA 1TNPA 4YBHB 2D8NA 1YTZC 1E8AA 1PSBA 2LLUA 1AJ4A 5AXIA 1JBAA 1FPWA 3SG3A 3NSLA 2PALA 1FF1A 2KAVA 1PULA 5CSIA 2JWWA 3TDIA 1A29A 2MRDA 2M97A 2CBLA 1KK7Y 1K9KA 2JNXA 4ZCUA 1C7VA 1LA3A 2NLNA 3IF7A 1NCYA 3O2PA 1RECA 4PHJA 4M2QA 4YRUA 3VRRA 4BY5A 1UP5A 1L7ZA 1J1DA 2K2FA 1NUBA 4PE7A 3EKHA 1OOJA 2A4JA 1DJYA 2ZKMX 4HRHA 4DRWA 3NSKA 3PFVA 1DJGA 2LE9B 1BMOA 1K90D 2KI6D 3ZWHA 4AOMA 4QJ5B 1XFZO 3PSRA 4XJKA 1KFXS 2O5GA 5D69A 4PHNA 1KSOA 5JJGA 3DVEA 2OTGC 1NX3A 5I2QA 4MSPA 1KQMC 4XJKB 2WORA 1TNWA 1YRUB 1TRFA 4ICBA 2Y1MA 1ZUZA 4I5JA 2H61A 2NXQA 1NX0A 4R1EA 4A4CA 1KFUL 2K0JA 2MA2A 2WOSA 1YRTB 2OTGB 1JC2A 1KQMB 1WRKA 1K8UA 2PASA 3JTDC 4YGEB 5HKZA 1DTLA 2GV5A 2LMTA 1RWYA 2NCPA 1MF8B 1UHNA 5I2LA 3LK1A 1F8HA 2L98A 4YGAA 3O4YA 1EJ3A 1MHOA 2K7BA 3GK4X 2BKHB 1JF2A 1TCOB 1IJ5A 3CLNA 1NIWA 3JTDB 2NCOA 5GQQC 1PALA 2CT9A 2L4IA 4QJ3B 5AERA 1B7TY 5HKWA 3RLZA 1QS7A 3KPXA 3KF9A 5KU1A 2LV7A 1KSMA 1PVBA 3CTNA 1CLMA 4HSZA 1SY9A 4GBAA 2COLB 2SCPA 1XYDA 2MAZA 2I2RE 3BUNB 1OZOA 1QASA 1AK8A 2SASA 1FI5A 3KHEA 2LHLA 1X02A 2F2PA 5DKRA 5ER5A 2JNFA 2L0PA 1A03A 3K21A 2HF5A 2JQ6A 1J1EA 1AHRA 1IG5A 1SL8A 1V1FA 1DMOA 1M31A 2KBMA 4OKHA 5AANA 5TNCA 1S36A 1QX5B 3FWCA 4GGNA 2L50A 1F4OA 1CB1A 1CLBA 1R2UA 1SCVA 1TNXA 1QLKA 3MSEB 3SG7A 1RROA 1ZMZA 3TUYC 1D1OA 4OVNF 1CNPA 1A4PA 2KAXA 3OHMB 1Y1UA 3PATA 3BUOB 2RGIA 3BUMB 2M9GA 5IBWA 2WC8A 3EK7A 1WY9A 2AUCA 3TUYB 4DIRA 4MEWA 1J7PA 1K9UA 1EH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIA A;  2K61 A;  1WLM A;  2M7N A;  1NCX A;  2I7A A;  2LVJ A;  3HX4 A;  2ZN8 A;  1TNQ A;  1SCM C;  3BYA A;  4CFR A;  1OMR A;  1Y1A A;  3VRQ A;  3CWG A;  3EVV A;  1CDP A;  5HLV A;  1F71 A;  3ICB A;  3FWB A;  2M0R A;  4YI8 A;  3BQ3 A;  1IGV A;  2K7C A;  2BEC A;  2KDH A;  1B8R A;  2DOQ A;  4MZJ A;  5FYX A;  5B8I B;  1SCM B;  2G9B A;  2FCD A;  2K7O A;  1SMG A;  2BCX A;  2AMI A;  1M45 A;  5AEQ A;  2LCP A;  1CDM A;  4GFT A;  3GOF A;  5DKN A;  1YR5 A;  1NP8 A;  3AKA A;  3AAK A;  4AQI A;  4NDC A;  3I5G C;  4YGD B;  1GGW A;  2FOT A;  2JZI A;  1QIW A;  1Q80 A;  3BOW A;  1QIV A;  2CNP A;  2LC5 A;  3OB2 B;  3CS1 A;  1MR8 A;  3SG5 A;  1L2O C;  1OMD A;  4MZK A;  3HCM A;  4BY4 A;  3OB1 B;  1SL7 A;  2LHI A;  3I5G B;  4WQ2 A;  1K2H A;  3CZT X;  1G33 A;  3VRN A;  1CFD A;  4UPG A;  5KSZ A;  2BCA A;  2KFF A;  3TS5 C;  3BOW B;  1KK7 Z;  4GPL B;  1QX2 A;  1CKK A;  2JC2 A;  3EK8 A;  1S5G Y;  1L2O B;  4U8D A;  4I5L B;  4AQJ A;  2F2O A;  1XK4 A;  1XK4 C;  3BUX B;  1QJT A;  2KHN A;  4QJ4 B;  3DVJ A;  3KEV A;  4NDD A;  3TS5 B;  2P6B B;  2KAY A;  2WND A;  1N2D A;  4YI9 A;  1IJ6 A;  3H4S E;  2JRF A;  1UWO A;  1K95 A;  1RFJ A;  4M2P A;  4FTG A;  4OV2 A;  2KI4 C;  1CDN A;  1SBJ A;  5I2O A;  2FJU B;  1WLZ A;  4MVF A;  2LAN A;  2F3Y A;  4DUQ A;  2LVV A;  3DF0 A;  3VGO A;  5CSN A;  3BUW B;  1EXR A;  2LP2 A;  2MLF C;  2Y4Q A;  3OX6 A;  4CLN A;  2H61 C;  1CDL A;  2QPT A;  3FS7 A;  5I8N A;  1RK9 A;  4C0J A;  2KI4 B;  1BT6 A;  2CXJ A;  1CFC A;  4GAO A;  5HLO A;  3IQQ A;  1CFP A;  4C0K A;  2HQ8 A;  1TN4 A;  2Q4U A;  3DF0 B;  1F70 A;  2Y1N A;  3EVR A;  1YX7 A;  4C0L A;  1LA0 A;  1M46 A;  2FCE A;  4MRY A;  1BR1 B;  2Y5I A;  1QXP A;  3RM1 A;  2H2K A;  1NCZ A;  3IQO A;  2HPS A;  1OSA A;  1B8C A;  4YGB B;  2BBN A;  1B9A A;  1S1E A;  1DJW A;  2KNE A;  1XFX O;  2L51 A;  1JWD A;  5PAL A;  1OQP A;  2PSR A;  1OZS A;  4FQO A;  1GGZ A;  3EK4 A;  5DKQ A;  1RJV A;  1BOC A;  1PK0 D;  2IS9 A;  3QRX A;  2BE6 A;  1KK8 C;  4HRG A;  2ZRS A;  2M7L A;  2L2E A;  2OPO A;  1R6P A;  3I5F C;  1B7T Z;  1DGV A;  1N0Y A;  1TTX A;  1SPY A;  2VRG A;  2ZND A;  3A8R A;  4GGF C;  4GGF A;  4P5O E;  4Q04 A;  2LUC A;  3EKJ A;  1K93 D;  1NX1 A;  1NSH A;  2MHH A;  1S6I A;  4L9M A;  3BXK A;  1AP4 A;  1NX2 A;  4CFQ A;  1C7W A;  1KK8 B;  2JT3 A;  5K89 A;  2JXC A;  1Y6W A;  4GUK A;  1QV0 A;  3I5F B;  1AJ5 A;  1U5I A;  1ZAC A;  1DJH A;  2BKI B;  1ALV A;  2M1K B;  1WRZ A;  3PN7 C;  1IRJ A;  1SNL A;  1DF0 A;  1G4Y R;  1YUS A;  5ER4 X;  1QX7 A;  2JU0 A;  1H4B A;  4PE0 A;  1QVI Y;  1UHJ A;  2M3W A;  3PAL A;  1MWN A;  1V1G A;  2LM5 A;  4ORC B;  3VRP A;  4CID A;  1K96 A;  4DS7 A;  3PN7 B;  5BPJ A;  1A75 A;  1DVI A;  4PDZ A;  5HYD A;  3D0Y A;  5G08 A;  1DJX A;  2KQY A;  3NSO A;  2K7D A;  2L4H A;  1M63 B;  1WRL A;  5CPV A;  1FI6 A;  3NXA A;  1ODB A;  2GGM A;  2MLE C;  2BBM A;  1W7I B;  3LCP C;  2K8M B;  4OCI A;  4PE4 A;  2KSP A;  1A75 B;  1Y1X A;  1YUU A;  3I5I C;  2ZFD A;  2WCB A;  3D0Y B;  1XFW O;  1IQ3 A;  1B1G A;  1BOD A;  4PHK A;  1TCF A;  2QAC A;  2LMU A;  2K2A A;  4MZL A;  3WXA A;  5CSJ A;  3E3R A;  2R2I A;  1SK6 D;  1DT7 B;  4WQ3 A;  1YX8 A;  4P2Y B;  3SG2 A;  1EG3 A;  1AUI B;  2M29 A;  1S6C A;  2F8P A;  2ISD A;  3I5I B;  4D1E A;  2KFH A;  1J7O A;  2CTN A;  2KFG A;  2ZN9 A;  1S26 D;  1SW8 A;  4NDB A;  4CPV A;  2KYC A;  1WDC C;  1CMG A;  2MBX A;  1S3P A;  1TIZ A;  1YVL A;  4USL A;  3D10 A;  1PSR A;  2E6W A;  4PE1 A;  2MJW B;  1JUO A;  1W7J B;  3GK1 A;  2ZRT A;  5JOL A;  2EGD A;  4MLW A;  3WHU B;  1J7R A;  4PAL A;  1WDC B;  3CR5 X;  2BL0 C;  1KFU S;  3LK0 A;  4MBE A;  2KBI A;  1ZFS A;  2G2B A;  1IH0 A;  3OP0 A;  4I5K A;  2KYF A;  2BCB A;  3AKB A;  4JQ0 D;  2LNK A;  2O60 A;  4IL1 A;  4N1F A;  1MQ1 A;  5CSF A;  2ZNE A;  4PCW A;  1CTR A;  2BL0 B;  3F45 A;  1EG4 A;  1SKT A;  1M39 A;  1NPQ A;  1XFU O;  3PLF B;  4F0Z B;  1S5G Z;  1MXE A;  4ZCV A;  2GGZ A;  1MXL C;  1IKU A;  1N65 A;  4TNC A;  1PVA A;  2F3Z A;  1DJI A;  1B8L A;  3LLE A;  2BE4 A;  4JPZ B;  2EHB A;  3JVT C;  2EC6 C;  1UUR A;  5F6T A;  3O78 A;  4ORA B;  1BF5 A;  4HRE E;  3AAJ A;  3EVU A;  4XYN A;  5J3X A;  1J55 A;  2KGR A;  2PMY A;  2L5X B;  2JT8 A;  1ZOT B;  2WCE A;  4DCK A;  2PVB A;  2I18 A;  3OX5 A;  5KTY A;  3JVT B;  1B47 A;  1QV1 A;  2EC6 B;  1XFV O;  4WRI A;  2PRU A;  1H8B A;  2LAP A;  2LP3 A;  1SYM A;  1JFK A;  4I5N B;  4ORB B;  2E30 A;  2V53 A;  1Y0V H;  3SIB A;  1K9P A;  1DJZ A;  2KQ6 A;  1G8I A;  1HT9 A;  1GJY A;  4JWQ A;  2JT0 A;  3C1V A;  3NSI A;  4N1G A;  4NQG A;  1KFX L;  3I5H C;  1YUT A;  2NZ0 A;  4M2O A;  1DGU A;  1A2X A;  1JF0 A;  1BG1 A;  2M1U A;  3DD4 A;  2JTT A;  2JXL A;  5D7F A;  3TZ1 A;  1XFY O;  1CMF A;  2JPT A;  3TDZ A;  1KWO C;  3VRO A;  3I5H B;  1XA5 A;  3DVK A;  3CR4 X;  5HKY A;  1QTX A;  1KCY A;  1QAT A;  1HQV A;  2M49 B;  3O6B A;  1CLL A;  1ALW A;  3ZNI A;  2LLS A;  1LKJ A;  1FBV A;  1J7Q A;  1KWO B;  3SJS A;  4A4B A;  1SR6 C;  3SG6 A;  4MRX A;  1UHI A;  2LVI A;  1RTP 1;  1PRW A;  1UHH A;  1U5I B;  2WCF A;  1NWD A;  3DVM A;  5AFP A;  2HQW A;  2OS8 C;  3WHT B;  1OMV A;  1TOP A;  2TN4 A;  4ETO A;  2B1U A;  1F55 A;  1SR6 B;  4N5X A;  1OE9 B;  1FW4 A;  1DF0 B;  1JFJ A;  1EL4 A;  4PHM A;  2JOJ A;  1CM4 A;  1BJF A;  1UUS A;  4OR9 B;  1CFF A;  2OS8 B;  1CM1 A;  2LLT A;  2AAO A;  4YGC B;  1LIN A;  2JUL A;  3SIA A;  1QVI Z;  1SRA A;  1K94 A;  1KQV A;  1BU3 A;  2I94 A;  1IWQ A;  1IQ5 A;  2HET A;  3A4U B;  3KO0 A;  3M0W A;  1BLQ A;  1C07 A;  1VRK A;  1BR4 B;  1QLS A;  3WNX B;  1F54 A;  1GQM A;  1NYA A;  1JSA A;  2LMV A;  2M8U A;  4E68 A;  2KOT A;  1MUX A;  4MN0 A;  1SL9 A;  2Q91 A;  3TDU A;  1LXF C;  1UHK A;  1XVJ A;  1LVC D;  2F33 A;  3SG4 A;  2KI6 C;  2LVK A;  1F4Q A;  1YUR A;  1YVH A;  1AVS A;  2CCM A;  2KGB C;  3CR2 A;  3PM8 A;  3GK2 A;  4GNK B;  1B4C A;  2LUX A;  3LL8 B;  1S6J A;  1XO5 A;  2JTZ A;  3CGA A;  1TNP A;  4YBH B;  2D8N A;  1YTZ C;  1E8A A;  1PSB A;  2LLU A;  1AJ4 A;  5AXI A;  1JBA A;  1FPW A;  3SG3 A;  3NSL A;  2PAL A;  1FF1 A;  2KAV A;  1PUL A;  5CSI A;  2JWW A;  3TDI A;  1A29 A;  2MRD A;  2M97 A;  2CBL A;  1KK7 Y;  1K9K A;  2JNX A;  4ZCU A;  1C7V A;  1LA3 A;  2NLN A;  3IF7 A;  1NCY A;  3O2P A;  1REC A;  4PHJ A;  4M2Q A;  4YRU A;  3VRR A;  4BY5 A;  1UP5 A;  1L7Z A;  1J1D A;  2K2F A;  1NUB A;  4PE7 A;  3EKH A;  1OOJ A;  2A4J A;  1DJY A;  2ZKM X;  4HRH A;  4DRW A;  3NSK A;  3PFV A;  1DJG A;  2LE9 B;  1BMO A;  1K90 D;  2KI6 D;  3ZWH A;  4AOM A;  4QJ5 B;  1XFZ O;  3PSR A;  4XJK A;  1KFX S;  2O5G A;  5D69 A;  4PHN A;  1KSO A;  5JJG A;  3DVE A;  2OTG C;  1NX3 A;  5I2Q A;  4MSP A;  1KQM C;  4XJK B;  2WOR A;  1TNW A;  1YRU B;  1TRF A;  4ICB A;  2Y1M A;  1ZUZ A;  4I5J A;  2H61 A;  2NXQ A;  1NX0 A;  4R1E A;  4A4C A;  1KFU L;  2K0J A;  2MA2 A;  2WOS A;  1YRT B;  2OTG B;  1JC2 A;  1KQM B;  1WRK A;  1K8U A;  2PAS A;  3JTD C;  4YGE B;  5HKZ A;  1DTL A;  2GV5 A;  2LMT A;  1RWY A;  2NCP A;  1MF8 B;  1UHN A;  5I2L A;  3LK1 A;  1F8H A;  2L98 A;  4YGA A;  3O4Y A;  1EJ3 A;  1MHO A;  2K7B A;  3GK4 X;  2BKH B;  1JF2 A;  1TCO B;  1IJ5 A;  3CLN A;  1NIW A;  3JTD B;  2NCO A;  5GQQ C;  1PAL A;  2CT9 A;  2L4I A;  4QJ3 B;  5AER A;  1B7T Y;  5HKW A;  3RLZ A;  1QS7 A;  3KPX A;  3KF9 A;  5KU1 A;  2LV7 A;  1KSM A;  1PVB A;  3CTN A;  1CLM A;  4HSZ A;  1SY9 A;  4GBA A;  2COL B;  2SCP A;  1XYD A;  2MAZ A;  2I2R E;  3BUN B;  1OZO A;  1QAS A;  1AK8 A;  2SAS A;  1FI5 A;  3KHE A;  2LHL A;  1X02 A;  2F2P A;  5DKR A;  5ER5 A;  2JNF A;  2L0P A;  1A03 A;  3K21 A;  2HF5 A;  2JQ6 A;  1J1E A;  1AHR A;  1IG5 A;  1SL8 A;  1V1F A;  1DMO A;  1M31 A;  2KBM A;  4OKH A;  5AAN A;  5TNC A;  1S36 A;  1QX5 B;  3FWC A;  4GGN A;  2L50 A;  1F4O A;  1CB1 A;  1CLB A;  1R2U A;  1SCV A;  1TNX A;  1QLK A;  3MSE B;  3SG7 A;  1RRO A;  1ZMZ A;  3TUY C;  1D1O A;  4OVN F;  1CNP A;  1A4P A;  2KAX A;  3OHM B;  1Y1U A;  3PAT A;  3BUO B;  2RGI A;  3BUM B;  2M9G A;  5IBW A;  2WC8 A;  3EK7 A;  1WY9 A;  2AUC A;  3TUY B;  4DIR A;  4MEW A;  1J7P A;  1K9U A;  1EH2 A; 
#chains in the Genus database with same CATH topology
 1XFR A;  2K61 A;  3FIA A;  1WLM A;  2M7N A;  1NCX A;  2I7A A;  2LVJ A;  1Z2C B;  2ZN8 A;  3HX4 A;  3DY9 A;  1TNQ A;  1SCM C;  3BYA A;  4CFR A;  1OMR A;  1Y1A A;  3R1P A;  4INW A;  3VRQ A;  3CWG A;  3EVV A;  1CDP A;  5HLV A;  2WCJ A;  1F71 A;  3ICB A;  3FWB A;  2M0R A;  4YI8 A;  3BQ3 A;  3CDN A;  1IGV A;  2K7C A;  3NGV A;  2BEC A;  2KDH A;  1B8R A;  2DOQ A;  4FQT A;  4MZJ A;  1TUZ A;  2PYQ A;  1SCM B;  2G9B A;  2FCD A;  2K7O A;  1SMG A;  5FYX A;  2BCX A;  2AMI A;  1M45 A;  5AEQ A;  2LCP A;  1CDM A;  4GFT A;  3BJH A;  3GOF A;  5DKN A;  1YR5 A;  1NP8 A;  3AKA A;  3AAK A;  4AQI A;  4NDC A;  1LS8 A;  3I5G C;  4YGD B;  1GGW A;  2FOT A;  2JZI A;  1QIW A;  1Q80 A;  3BOW A;  1QIV A;  2CNP A;  2LC5 A;  3OB2 B;  3CS1 A;  1MR8 A;  3SG5 A;  1L2O C;  1OMD A;  4MZK A;  3HCM A;  4BY4 A;  3OB1 B;  1SL7 A;  2LHI A;  3I5G B;  4WQ2 A;  1K2H A;  3CZT X;  1G33 A;  3VRN A;  1CFD A;  4UPG A;  5KSZ A;  2BCA A;  2KFF A;  3TS5 C;  3BOW B;  1KK7 Z;  4GPL B;  1C3Y A;  1QX2 A;  1CKK A;  2JC2 A;  3EK8 A;  1S5G Y;  1L2O B;  4U8D A;  4I5L B;  4AQJ A;  2F2O A;  1XK4 A;  1XK4 C;  3BUX B;  1QJT A;  2KHN A;  4QJ4 B;  3DVJ A;  2P70 A;  3KEV A;  4NDD A;  3TS5 B;  2P6B B;  2KAY A;  2WND A;  1N2D A;  4YI9 A;  1C3Z A;  1IJ6 A;  3H4S E;  2JRF A;  1UWO A;  1K95 A;  1RFJ A;  4M2P A;  4FTG A;  3B87 A;  2KI4 C;  4OV2 A;  1CDN A;  1SBJ A;  5I2O A;  2FJU B;  1WLZ A;  4MVF A;  3B88 A;  2LAN A;  2F3Y A;  4DUQ A;  5DIC A;  2LVV A;  3DF0 A;  3VGO A;  5CSN A;  3BUW B;  1EXR A;  2LP2 A;  2MLF C;  2Y4Q A;  3OX6 A;  4CLN A;  2H61 C;  1CDL A;  2QPT A;  3FS7 A;  5I8N A;  3VB1 A;  1RK9 A;  4C0J A;  2KI4 B;  3D74 A;  1BT6 A;  2CXJ A;  1CFC A;  4GAO A;  5HLO A;  3IQQ A;  1CFP A;  4C0K A;  2HQ8 A;  1TN4 A;  2L5Y A;  3UNW A;  3D78 A;  2Q4U A;  3DF0 B;  3N7H A;  1F70 A;  2Y1N A;  3EVR A;  1YX7 A;  4C0L A;  1LA0 A;  4KYN A;  1M46 A;  2FCE A;  4MRY A;  1BR1 B;  2Y5I A;  1QXP A;  3PJI A;  3RM1 A;  2H2K A;  1NCZ A;  3FE8 A;  3IQO A;  2HPS A;  1OSA A;  1B8C A;  4YGB B;  2BBN A;  2QDI A;  1B9A A;  1S1E A;  1DJW A;  2KNE A;  1XFX O;  2L51 A;  5FI2 A;  1JWD A;  5PAL A;  1OQP A;  2PSR A;  3SS4 A;  1OZS A;  4FQO A;  1GGZ A;  3EK4 A;  5DKQ A;  1RJV A;  1BOC A;  1PK0 D;  2IS9 A;  2KLD A;  2BE6 A;  1KK8 C;  3QRX A;  4HRG A;  2ZRS A;  1ORG A;  2M7L A;  2L2E A;  2OPO A;  1R6P A;  3I5F C;  1B7T Z;  1DGV A;  1N0Y A;  1TTX A;  1SPY A;  2VRG A;  2ZND A;  3A8R A;  4GGF C;  4GGF A;  4P5O E;  4Q04 A;  2LUC A;  3EKJ A;  1K93 D;  1NX1 A;  1P28 A;  1NSH A;  2MHH A;  1S6I A;  4L9M A;  3BXK A;  1AP4 A;  1NX2 A;  4CFQ A;  1C7W A;  1KK8 B;  2JT3 A;  1TUJ A;  2JXC A;  5K89 A;  1Y6W A;  3D77 A;  1QV0 A;  4GUK A;  3I5F B;  1AJ5 A;  1U5I A;  1ZAC A;  1DJH A;  2BKI B;  1ALV A;  2M1K B;  1WRZ A;  3PN7 C;  1IRJ A;  1SNL A;  1DF0 A;  1G4Y R;  1YUS A;  5ER4 X;  2WCM A;  1QX7 A;  2JU0 A;  1H4B A;  4PE0 A;  1QVI Y;  1UHJ A;  2M3W A;  3PAL A;  1MWN A;  1V1G A;  2LM5 A;  4ORC B;  3VRP A;  4CID A;  1K96 A;  4DS7 A;  3PN7 B;  5BPJ A;  1A75 A;  4F7F A;  1DVI A;  4PDZ A;  5HYD A;  3D0Y A;  5G08 A;  1DJX A;  2KQY A;  3NSO A;  2K7D A;  2L4H A;  1M63 B;  1WRL A;  5CPV A;  1FI6 A;  3NXA A;  1ODB A;  2GGM A;  2BAP A;  2BBM A;  1W7I B;  2MLE C;  3LCP C;  2K8M B;  4OCI A;  4PE4 A;  2KSP A;  1A75 B;  1Y1X A;  5FI7 A;  1YUU A;  3I5I C;  2ZFD A;  2WCB A;  3D0Y B;  1XFW O;  1IQ3 A;  1B1G A;  1BOD A;  4PHK A;  1TCF A;  2QAC A;  2LMU A;  2K2A A;  4MZL A;  3WXA A;  5CSJ A;  3E3R A;  2R2I A;  1SK6 D;  1DT7 B;  4WQ3 A;  1YX8 A;  3S0A A;  4P2Y B;  3SG2 A;  3IVT A;  1EG3 A;  1AUI B;  2M29 A;  1S6C A;  2F8P A;  2ISD A;  3BFH A;  3I5I B;  1IIO A;  4D1E A;  2KFH A;  1J7O A;  2CTN A;  2KFG A;  2ZN9 A;  1S26 D;  1SW8 A;  4NDB A;  4CPV A;  2KYC A;  2P71 A;  3EG5 B;  3S0B A;  1WDC C;  1CMG A;  2MBX A;  1S3P A;  1TIZ A;  1YVL A;  4USL A;  3D10 A;  1PSR A;  2E6W A;  4PE1 A;  2MJW B;  1JUO A;  1W7J B;  3R1O A;  3D73 A;  3GK1 A;  2ZRT A;  5JOL A;  2EGD A;  4MLW A;  3WHU B;  1J7R A;  4PAL A;  1WDC B;  3CR5 X;  2BL0 C;  1KFU S;  3LK0 A;  4MBE A;  2KBI A;  1OOH A;  1ZFS A;  2WCH A;  3S0F A;  1DQE A;  2G2B A;  3QME A;  1IH0 A;  3OP0 A;  4I5K A;  2KYF A;  2BCB A;  3AKB A;  4JQ0 D;  2LNK A;  2O60 A;  4IL1 A;  4N1F A;  1MQ1 A;  5CSF A;  2ZNE A;  4PCW A;  1CTR A;  2BL0 B;  3F45 A;  1EG4 A;  3V2L A;  1SKT A;  1M39 A;  1NPQ A;  1XFU O;  4JD9 A;  3PLF B;  4F0Z B;  1S5G Z;  1MXE A;  3TDU A;  4ZCV A;  2WC6 A;  2GGZ A;  1MXL C;  1IKU A;  1N65 A;  2KLE A;  4TNC A;  1PVA A;  2F3Z A;  3B6X A;  1DJI A;  1B8L A;  2QEB A;  3LLE A;  2BE4 A;  4JPZ B;  2EHB A;  3JVT C;  2EC6 C;  1UUR A;  5F6T A;  3O78 A;  4ORA B;  1BF5 A;  2BNX A;  4HRE E;  3AAJ A;  3EVU A;  4XYN A;  5J3X A;  1J55 A;  2KGR A;  2KPH A;  2PMY A;  2L5X B;  3D76 A;  2JT8 A;  1ZOT B;  2WCE A;  4DCK A;  2PVB A;  2QEH A;  2I18 A;  3OX5 A;  5KTY A;  3JVT B;  1B47 A;  1QV1 A;  2EC6 B;  1XFV O;  4WRI A;  2PRU A;  1H8B A;  2LAP A;  2LP3 A;  1SYM A;  1JFK A;  4I5N B;  4ORB B;  2E30 A;  2V53 A;  1Y0V H;  3SIB A;  1K9P A;  1DJZ A;  2KQ6 A;  1G8I A;  1HT9 A;  3BFA A;  1GJY A;  4JWQ A;  2JT0 A;  3C1V A;  3NSI A;  4N1G A;  4NQG A;  1W9Z A;  1KFX L;  1GM0 A;  3I5H C;  1YUT A;  2NZ0 A;  4M2O A;  1DGU A;  1A2X A;  2PQL A;  1JF0 A;  3SS3 A;  3CZ0 A;  1BG1 A;  3NHI A;  4INX A;  2M1U A;  3DD4 A;  2JTT A;  2JXL A;  5D7F A;  3TZ1 A;  1XFY O;  1CMF A;  2JPT A;  3TDZ A;  4PT1 A;  1KWO C;  3VRO A;  3I5H B;  3L4A A;  3L4L A;  1XA5 A;  3DVK A;  3CR4 X;  5HKY A;  1QTX A;  1KCY A;  1QAT A;  1HQV A;  2M49 B;  1DC1 A;  3CYZ A;  3O6B A;  1CLL A;  1ALW A;  1Z4H A;  2LLS A;  3ZNI A;  1LKJ A;  1FBV A;  1J7Q A;  1KWO B;  3SJS A;  4A4B A;  1SR6 C;  3S0D A;  4MRX A;  3SG6 A;  1UHI A;  2LVI A;  1RTP 1;  1PRW A;  1UHH A;  1U5I B;  2WCF A;  1NWD A;  3DVM A;  5AFP A;  2HQW A;  2OS8 C;  3WHT B;  3O4X A;  1OMV A;  1TOP A;  2TN4 A;  4ETO A;  2B1U A;  1F55 A;  1SR6 B;  4N5X A;  1OE9 B;  2WCK A;  1FW4 A;  1DF0 B;  1JFJ A;  1EL4 A;  4PHM A;  3L47 A;  2JOJ A;  2ERB A;  1CM4 A;  1BJF A;  1UUS A;  4OR9 B;  1CFF A;  2H8V A;  2OS8 B;  1CM1 A;  2LLT A;  2AAO A;  4YGC B;  1LIN A;  2JUL A;  3SIA A;  1QVI Z;  1T14 A;  1SRA A;  3CZ2 A;  1K94 A;  1KQV A;  1BU3 A;  2I94 A;  1IWQ A;  1IQ5 A;  2HET A;  3A4U B;  3KO0 A;  3M0W A;  1BLQ A;  1C07 A;  1VRK A;  1BR4 B;  1QLS A;  3WNX B;  1F54 A;  1GQM A;  1NYA A;  1JSA A;  2LMV A;  2M8U A;  4E68 A;  2KOT A;  1MUX A;  4MN0 A;  3NHT A;  1SSE B;  1SL9 A;  1OOF A;  2Q91 A;  1LXF C;  1UHK A;  1XVJ A;  1LVC D;  2F33 A;  3DZT A;  3SG4 A;  2KI6 C;  2LVK A;  1F4Q A;  1YUR A;  1YVH A;  1AVS A;  2CCM A;  2KGB C;  3CR2 A;  3PM8 A;  3R72 A;  3GK2 A;  4GNK B;  1B4C A;  2LUX A;  5EL2 A;  3LL8 B;  1S6J A;  1XO5 A;  2JTZ A;  3CGA A;  1TNP A;  4YBH B;  2D8N A;  1YTZ C;  1E8A A;  1PSB A;  2LLU A;  1AJ4 A;  5AXI A;  1JBA A;  1FPW A;  3SG3 A;  3NSL A;  2PAL A;  1FF1 A;  2KAV A;  1PUL A;  5CSI A;  2JWW A;  2QEO A;  3TDI A;  1A29 A;  2MRD A;  2M97 A;  2CBL A;  1KK7 Y;  1K9K A;  2JNX A;  4ZCU A;  1C7V A;  1LA3 A;  2NLN A;  3IF7 A;  4JKT A;  3FE9 A;  4IJ7 A;  1NCY A;  2WCL A;  3O2P A;  1DEL A;  1REC A;  4PHJ A;  4M2Q A;  4YRU A;  3VRR A;  4BY5 A;  1OW4 A;  3UO9 A;  1UP5 A;  1L7Z A;  1J1D A;  2K2F A;  1NUB A;  2GTE A;  4PE7 A;  3EKH A;  1OOJ A;  2A4J A;  1DJY A;  2QEV A;  2ZKM X;  1TWO A;  4HRH A;  1DEK A;  4DRW A;  3NSK A;  3PFV A;  1DJG A;  2LE9 B;  1BMO A;  1K90 D;  2KI6 D;  2WC5 A;  3ZWH A;  4AOM A;  4QJ5 B;  1XFZ O;  3PSR A;  4XJK A;  1KFX S;  2FJY A;  2O5G A;  5D69 A;  4PHN A;  1KSO A;  3RZS A;  5JJG A;  3DVE A;  2OTG C;  1NX3 A;  5I2Q A;  4MSP A;  1KQM C;  2JPO A;  4XJK B;  5D3O A;  2WOR A;  1TNW A;  1YRU B;  3DXL A;  1TRF A;  4ICB A;  2Y1M A;  2YGU A;  1ZUZ A;  4I5J A;  2H61 A;  2NXQ A;  3S0G A;  1NX0 A;  4R1E A;  4A4C A;  1KFU L;  2K0J A;  2MA2 A;  3CAB A;  2WOS A;  1YRT B;  2OTG B;  3BFB A;  5FI6 A;  1JC2 A;  1KQM B;  1WRK A;  1K8U A;  2PAS A;  3FE6 A;  3JTD C;  4YGE B;  1DTL A;  5HKZ A;  1QWV A;  2L2C A;  2GV5 A;  2LMT A;  1RWY A;  2NCP A;  1MF8 B;  1UHN A;  5I2L A;  3LK1 A;  1F8H A;  3OBV A;  2L98 A;  4YGA A;  3SS5 A;  3O4Y A;  1EJ3 A;  1MHO A;  2K7B A;  3GK4 X;  1TCO B;  1JF2 A;  2BKH B;  1IJ5 A;  3CLN A;  1NIW A;  3JTD B;  2NCO A;  5GQQ C;  1PAL A;  2CT9 A;  2L4I A;  4QJ3 B;  5AER A;  1B7T Y;  5HKW A;  3RLZ A;  1QS7 A;  3KPX A;  3KF9 A;  5KU1 A;  2LV7 A;  1KSM A;  1OOI X;  1PVB A;  3CTN A;  3D75 A;  1CLM A;  4HSZ A;  1SY9 A;  3CZ1 A;  4GBA A;  5HL1 A;  2COL B;  2SCP A;  1XYD A;  4OZD A;  2MAZ A;  2I2R E;  3BUN B;  1OZO A;  3K1E A;  1QAS A;  1AK8 A;  2SAS A;  1FI5 A;  3KHE A;  2LHL A;  2K60 A;  1X02 A;  2F2P A;  5DKR A;  5ER5 A;  2JNF A;  2L0P A;  3DYE A;  1A03 A;  3B86 A;  3K21 A;  2HF5 A;  2JQ6 A;  1J1E A;  1AHR A;  1IG5 A;  1V1F A;  1SL8 A;  1DMO A;  1M31 A;  2KBM A;  4OKH A;  5AAN A;  5TNC A;  1S36 A;  1QX5 B;  3FWC A;  4GGN A;  2L50 A;  3PM2 A;  5B8I B;  1F4O A;  1CB1 A;  1CLB A;  1R2U A;  3S0E A;  1OOG A;  1SCV A;  1TNX A;  1QLK A;  3MSE B;  3SG7 A;  1RRO A;  1ZMZ A;  3TUY C;  1D1O A;  4OVN F;  1CNP A;  1A4P A;  3R1V A;  2KAX A;  3OHM B;  1Y1U A;  3PAT A;  3OGN A;  3BUO B;  2RGI A;  3BUM B;  5I94 A;  2M9G A;  5IBW A;  2WC8 A;  3EK7 A;  3Q8I A;  1WY9 A;  2AUC A;  3TUY B;  4DIR A;  4MEW A;  1J7P A;  1K9U A;  1EH2 A;  3B7A A; 
#chains in the Genus database with same CATH homology
 3FIA A;  2K61 A;  1WLM A;  2M7N A;  1NCX A;  2I7A A;  2LVJ A;  3HX4 A;  2ZN8 A;  1TNQ A;  1SCM C;  3BYA A;  4CFR A;  1OMR A;  1Y1A A;  3VRQ A;  3CWG A;  3EVV A;  1CDP A;  5HLV A;  1F71 A;  3ICB A;  3FWB A;  2M0R A;  4YI8 A;  3BQ3 A;  1IGV A;  2K7C A;  2BEC A;  2KDH A;  1B8R A;  2DOQ A;  4MZJ A;  5FYX A;  5B8I B;  1SCM B;  2G9B A;  2FCD A;  2K7O A;  1SMG A;  2BCX A;  2AMI A;  1M45 A;  5AEQ A;  2LCP A;  1CDM A;  4GFT A;  3GOF A;  5DKN A;  1YR5 A;  1NP8 A;  3AKA A;  3AAK A;  4AQI A;  4NDC A;  3I5G C;  4YGD B;  1GGW A;  2FOT A;  2JZI A;  1QIW A;  1Q80 A;  3BOW A;  1QIV A;  2CNP A;  2LC5 A;  3OB2 B;  3CS1 A;  1MR8 A;  3SG5 A;  1L2O C;  1OMD A;  4MZK A;  3HCM A;  4BY4 A;  3OB1 B;  1SL7 A;  2LHI A;  3I5G B;  4WQ2 A;  1K2H A;  3CZT X;  1G33 A;  3VRN A;  1CFD A;  4UPG A;  5KSZ A;  2BCA A;  2KFF A;  3TS5 C;  3BOW B;  1KK7 Z;  4GPL B;  1QX2 A;  1CKK A;  2JC2 A;  3EK8 A;  1S5G Y;  1L2O B;  4U8D A;  4I5L B;  4AQJ A;  2F2O A;  1XK4 A;  1XK4 C;  3BUX B;  1QJT A;  2KHN A;  4QJ4 B;  3DVJ A;  3KEV A;  4NDD A;  3TS5 B;  2P6B B;  2KAY A;  2WND A;  1N2D A;  4YI9 A;  1IJ6 A;  3H4S E;  2JRF A;  1UWO A;  1K95 A;  1RFJ A;  4M2P A;  4FTG A;  4OV2 A;  2KI4 C;  1CDN A;  1SBJ A;  5I2O A;  2FJU B;  1WLZ A;  4MVF A;  2LAN A;  2F3Y A;  4DUQ A;  2LVV A;  3DF0 A;  3VGO A;  5CSN A;  3BUW B;  1EXR A;  2LP2 A;  2MLF C;  2Y4Q A;  3OX6 A;  4CLN A;  2H61 C;  1CDL A;  2QPT A;  3FS7 A;  5I8N A;  1RK9 A;  4C0J A;  2KI4 B;  1BT6 A;  2CXJ A;  1CFC A;  4GAO A;  5HLO A;  3IQQ A;  1CFP A;  4C0K A;  2HQ8 A;  1TN4 A;  2Q4U A;  3DF0 B;  1F70 A;  2Y1N A;  3EVR A;  1YX7 A;  4C0L A;  1LA0 A;  1M46 A;  2FCE A;  4MRY A;  1BR1 B;  2Y5I A;  1QXP A;  3RM1 A;  2H2K A;  1NCZ A;  3IQO A;  2HPS A;  1OSA A;  1B8C A;  4YGB B;  2BBN A;  1B9A A;  1S1E A;  1DJW A;  2KNE A;  1XFX O;  2L51 A;  1JWD A;  5PAL A;  1OQP A;  2PSR A;  1OZS A;  4FQO A;  1GGZ A;  3EK4 A;  5DKQ A;  1RJV A;  1BOC A;  1PK0 D;  2IS9 A;  3QRX A;  2BE6 A;  1KK8 C;  4HRG A;  2ZRS A;  2M7L A;  2L2E A;  2OPO A;  1R6P A;  3I5F C;  1B7T Z;  1DGV A;  1N0Y A;  1TTX A;  1SPY A;  2VRG A;  2ZND A;  3A8R A;  4GGF C;  4GGF A;  4P5O E;  4Q04 A;  2LUC A;  3EKJ A;  1K93 D;  1NX1 A;  1NSH A;  2MHH A;  1S6I A;  4L9M A;  3BXK A;  1AP4 A;  1NX2 A;  4CFQ A;  1C7W A;  1KK8 B;  2JT3 A;  5K89 A;  2JXC A;  1Y6W A;  4GUK A;  1QV0 A;  3I5F B;  1AJ5 A;  1U5I A;  1ZAC A;  1DJH A;  2BKI B;  1ALV A;  2M1K B;  1WRZ A;  3PN7 C;  1IRJ A;  1SNL A;  1DF0 A;  1G4Y R;  1YUS A;  5ER4 X;  1QX7 A;  2JU0 A;  1H4B A;  4PE0 A;  1QVI Y;  1UHJ A;  2M3W A;  3PAL A;  1MWN A;  1V1G A;  2LM5 A;  4ORC B;  3VRP A;  4CID A;  1K96 A;  4DS7 A;  3PN7 B;  5BPJ A;  1A75 A;  1DVI A;  4PDZ A;  5HYD A;  3D0Y A;  5G08 A;  1DJX A;  2KQY A;  3NSO A;  2K7D A;  2L4H A;  1M63 B;  1WRL A;  5CPV A;  1FI6 A;  3NXA A;  1ODB A;  2GGM A;  2MLE C;  2BBM A;  1W7I B;  3LCP C;  2K8M B;  4OCI A;  4PE4 A;  2KSP A;  1A75 B;  1Y1X A;  1YUU A;  3I5I C;  2ZFD A;  2WCB A;  3D0Y B;  1XFW O;  1IQ3 A;  1B1G A;  1BOD A;  4PHK A;  1TCF A;  2QAC A;  2LMU A;  2K2A A;  4MZL A;  3WXA A;  5CSJ A;  3E3R A;  2R2I A;  1SK6 D;  1DT7 B;  4WQ3 A;  1YX8 A;  4P2Y B;  3SG2 A;  1EG3 A;  1AUI B;  2M29 A;  1S6C A;  2F8P A;  2ISD A;  3I5I B;  4D1E A;  2KFH A;  1J7O A;  2CTN A;  2KFG A;  2ZN9 A;  1S26 D;  1SW8 A;  4NDB A;  4CPV A;  2KYC A;  1WDC C;  1CMG A;  2MBX A;  1S3P A;  1TIZ A;  1YVL A;  4USL A;  3D10 A;  1PSR A;  2E6W A;  4PE1 A;  2MJW B;  1JUO A;  1W7J B;  3GK1 A;  2ZRT A;  5JOL A;  2EGD A;  4MLW A;  3WHU B;  1J7R A;  4PAL A;  1WDC B;  3CR5 X;  2BL0 C;  1KFU S;  3LK0 A;  4MBE A;  2KBI A;  1ZFS A;  2G2B A;  1IH0 A;  3OP0 A;  4I5K A;  2KYF A;  2BCB A;  3AKB A;  4JQ0 D;  2LNK A;  2O60 A;  4IL1 A;  4N1F A;  1MQ1 A;  5CSF A;  2ZNE A;  4PCW A;  1CTR A;  2BL0 B;  3F45 A;  1EG4 A;  1SKT A;  1M39 A;  1NPQ A;  1XFU O;  3PLF B;  4F0Z B;  1S5G Z;  1MXE A;  4ZCV A;  2GGZ A;  1MXL C;  1IKU A;  1N65 A;  4TNC A;  1PVA A;  2F3Z A;  1DJI A;  1B8L A;  3LLE A;  2BE4 A;  4JPZ B;  2EHB A;  3JVT C;  2EC6 C;  1UUR A;  5F6T A;  3O78 A;  4ORA B;  1BF5 A;  4HRE E;  3AAJ A;  3EVU A;  4XYN A;  5J3X A;  1J55 A;  2KGR A;  2PMY A;  2L5X B;  2JT8 A;  1ZOT B;  2WCE A;  4DCK A;  2PVB A;  2I18 A;  3OX5 A;  5KTY A;  3JVT B;  1B47 A;  1QV1 A;  2EC6 B;  1XFV O;  4WRI A;  2PRU A;  1H8B A;  2LAP A;  2LP3 A;  1SYM A;  1JFK A;  4I5N B;  4ORB B;  2E30 A;  2V53 A;  1Y0V H;  3SIB A;  1K9P A;  1DJZ A;  2KQ6 A;  1G8I A;  1HT9 A;  1GJY A;  4JWQ A;  2JT0 A;  3C1V A;  3NSI A;  4N1G A;  4NQG A;  1KFX L;  3I5H C;  1YUT A;  2NZ0 A;  4M2O A;  1DGU A;  1A2X A;  1JF0 A;  1BG1 A;  2M1U A;  3DD4 A;  2JTT A;  2JXL A;  5D7F A;  3TZ1 A;  1XFY O;  1CMF A;  2JPT A;  3TDZ A;  1KWO C;  3VRO A;  3I5H B;  1XA5 A;  3DVK A;  3CR4 X;  5HKY A;  1QTX A;  1KCY A;  1QAT A;  1HQV A;  2M49 B;  3O6B A;  1CLL A;  1ALW A;  3ZNI A;  2LLS A;  1LKJ A;  1FBV A;  1J7Q A;  1KWO B;  3SJS A;  4A4B A;  1SR6 C;  3SG6 A;  4MRX A;  1UHI A;  2LVI A;  1RTP 1;  1PRW A;  1UHH A;  1U5I B;  2WCF A;  1NWD A;  3DVM A;  5AFP A;  2HQW A;  2OS8 C;  3WHT B;  1OMV A;  1TOP A;  2TN4 A;  4ETO A;  2B1U A;  1F55 A;  1SR6 B;  4N5X A;  1OE9 B;  1FW4 A;  1DF0 B;  1JFJ A;  1EL4 A;  4PHM A;  2JOJ A;  1CM4 A;  1BJF A;  1UUS A;  4OR9 B;  1CFF A;  2OS8 B;  1CM1 A;  2LLT A;  2AAO A;  4YGC B;  1LIN A;  2JUL A;  3SIA A;  1QVI Z;  1SRA A;  1K94 A;  1KQV A;  1BU3 A;  2I94 A;  1IWQ A;  1IQ5 A;  2HET A;  3A4U B;  3KO0 A;  3M0W A;  1BLQ A;  1C07 A;  1VRK A;  1BR4 B;  1QLS A;  3WNX B;  1F54 A;  1GQM A;  1NYA A;  1JSA A;  2LMV A;  2M8U A;  4E68 A;  2KOT A;  1MUX A;  4MN0 A;  1SL9 A;  2Q91 A;  3TDU A;  1LXF C;  1UHK A;  1XVJ A;  1LVC D;  2F33 A;  3SG4 A;  2KI6 C;  2LVK A;  1F4Q A;  1YUR A;  1YVH A;  1AVS A;  2CCM A;  2KGB C;  3CR2 A;  3PM8 A;  3GK2 A;  4GNK B;  1B4C A;  2LUX A;  3LL8 B;  1S6J A;  1XO5 A;  2JTZ A;  3CGA A;  1TNP A;  4YBH B;  2D8N A;  1YTZ C;  1E8A A;  1PSB A;  2LLU A;  1AJ4 A;  5AXI A;  1JBA A;  1FPW A;  3SG3 A;  3NSL A;  2PAL A;  1FF1 A;  2KAV A;  1PUL A;  5CSI A;  2JWW A;  3TDI A;  1A29 A;  2MRD A;  2M97 A;  2CBL A;  1KK7 Y;  1K9K A;  2JNX A;  4ZCU A;  1C7V A;  1LA3 A;  2NLN A;  3IF7 A;  1NCY A;  3O2P A;  1REC A;  4PHJ A;  4M2Q A;  4YRU A;  3VRR A;  4BY5 A;  1UP5 A;  1L7Z A;  1J1D A;  2K2F A;  1NUB A;  4PE7 A;  3EKH A;  1OOJ A;  2A4J A;  1DJY A;  2ZKM X;  4HRH A;  4DRW A;  3NSK A;  3PFV A;  1DJG A;  2LE9 B;  1BMO A;  1K90 D;  2KI6 D;  3ZWH A;  4AOM A;  4QJ5 B;  1XFZ O;  3PSR A;  4XJK A;  1KFX S;  2O5G A;  5D69 A;  4PHN A;  1KSO A;  5JJG A;  3DVE A;  2OTG C;  1NX3 A;  5I2Q A;  4MSP A;  1KQM C;  4XJK B;  2WOR A;  1TNW A;  1YRU B;  1TRF A;  4ICB A;  2Y1M A;  1ZUZ A;  4I5J A;  2H61 A;  2NXQ A;  1NX0 A;  4R1E A;  4A4C A;  1KFU L;  2K0J A;  2MA2 A;  2WOS A;  1YRT B;  2OTG B;  1JC2 A;  1KQM B;  1WRK A;  1K8U A;  2PAS A;  3JTD C;  4YGE B;  5HKZ A;  1DTL A;  2GV5 A;  2LMT A;  1RWY A;  2NCP A;  1MF8 B;  1UHN A;  5I2L A;  3LK1 A;  1F8H A;  2L98 A;  4YGA A;  3O4Y A;  1EJ3 A;  1MHO A;  2K7B A;  3GK4 X;  2BKH B;  1JF2 A;  1TCO B;  1IJ5 A;  3CLN A;  1NIW A;  3JTD B;  2NCO A;  5GQQ C;  1PAL A;  2CT9 A;  2L4I A;  4QJ3 B;  5AER A;  1B7T Y;  5HKW A;  3RLZ A;  1QS7 A;  3KPX A;  3KF9 A;  5KU1 A;  2LV7 A;  1KSM A;  1PVB A;  3CTN A;  1CLM A;  4HSZ A;  1SY9 A;  4GBA A;  2COL B;  2SCP A;  1XYD A;  2MAZ A;  2I2R E;  3BUN B;  1OZO A;  1QAS A;  1AK8 A;  2SAS A;  1FI5 A;  3KHE A;  2LHL A;  1X02 A;  2F2P A;  5DKR A;  5ER5 A;  2JNF A;  2L0P A;  1A03 A;  3K21 A;  2HF5 A;  2JQ6 A;  1J1E A;  1AHR A;  1IG5 A;  1SL8 A;  1V1F A;  1DMO A;  1M31 A;  2KBM A;  4OKH A;  5AAN A;  5TNC A;  1S36 A;  1QX5 B;  3FWC A;  4GGN A;  2L50 A;  1F4O A;  1CB1 A;  1CLB A;  1R2U A;  1SCV A;  1TNX A;  1QLK A;  3MSE B;  3SG7 A;  1RRO A;  1ZMZ A;  3TUY C;  1D1O A;  4OVN F;  1CNP A;  1A4P A;  2KAX A;  3OHM B;  1Y1U A;  3PAT A;  3BUO B;  2RGI A;  3BUM B;  2M9G A;  5IBW A;  2WC8 A;  3EK7 A;  1WY9 A;  2AUC A;  3TUY B;  4DIR A;  4MEW A;  1J7P A;  1K9U A;  1EH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...