2JPTA

Structural changes induced in apo-s100a1 protein by the disulphide formation between its cys85 residue and b-mercaptoethanol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDEDGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Structural and motional changes induced in apo-S100A1 protein by the disulfide formation between its Cys 85 residue and beta-mercaptoethanol
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jptA00
1JFKA 2EGDA 1BU3A 3I5FC 2M0RA 1ODBA 4JQ0D 4XJKB 4CIDA 4C0KA 4ZCVA 3C1VA 4GGFA 1NUBA 1RECA 1M39A 2M8UA 2O5GA 3OB2B 1S1EA 3EK4A 3NSLA 1WLMA 1FPWA 1J7PA 1PVBA 2MAZA 1PALA 2MHHA 1KCYA 3HCMA 3SJSA 2CXJA 2DOQA 4MN0A 1IQ3A 2PRUA 2BCBA 3RM1A 3I5HC 1RROA 2M1KB 3O6BA 1L2OB 2Y1NA 3NSIA 2KHNA 1RK9A 1RWYA 1K90D 1IRJA 1Y1UA 1OMRA 1XFUO 2NZ0A 1Q80A 2PVBA 1PRWA 3I5FB 1BJFA 1S6IA 1FF1A 1JSAA 5D7FA 2KOTA 4N5XA 1BG1A 2M3WA 2HQWA 1K8UA 4GAOA 3D10A 2HPSA 3PALA 2KFFA 3VROA 1CKKA 2K2AA 2NCOA 4E68A 3I5IC 1YUSA 1EJ3A 3CWGA 3I5HB 5KSZA 5DKRA 3EVRA 5I2LA 1C7VA 1YRUB 4I5LB 2BE6A 1B8CA 1SL8A 2WCFA 3JVTC 4XYNA 1CDNA 3LL8B 3NSKA 1J7QA 1MF8B 2LLSA 1KQMC 2JOJA 1XO5A 1JC2A 3FWCA 1D1OA 2NLNA 3PN7C 3LLEA 5HLOA 3EK7A 1TTXA 2ZN9A 1SCMC 1UWOA 4BY4A 1CFDA 2BECA 3I5IB 1GGZA 1NX1A 1RJVA 4PE1A 2MA2A 2CNPA 3BUXB 1UP5A 5HKYA 5J3XA 1MHOA 1WRKA 1A29A 4OCIA 1SY9A 2MLEC 1MXEA 3JVTB 5HKWA 2LP3A 1PK0D 3ZWHA 1J1DA 1F4QA 1MUXA 5DKNA 1KQMB 1JWDA 2GGMA 4C0LA 1SKTA 1YVHA 3PN7B 2JTZA 1SCMB 4HSZA 1WRZA 2KAVA 3SG4A 3TS5C 2JT3A 1KQVA 4YI8A 1B47A 1WLZA 2BL0C 2BKHB 3FWBA 2ZKMX 1JF0A 3IQQA 2K7CA 5K89A 4GNKB 2KQ6A 4YGDB 4CFRA 2FCDA 4GPLB 1HQVA 1KSOA 2EC6C 2OTGC 2WORA 1SPYA 1TNXA 2KSPA 1XFYO 2KGRA 3VRPA 2JU0A 2K7BA 2LLTA 3GK1A 2BCAA 3VRRA 4WQ2A 2BKIB 2NXQA 1KFUL 4Q04A 1X02A 2AUCA 1G33A 2JRFA 1BR1B 4DIRA 4YBHB 2BL0B 4DUQA 1N65A 1UURA 2JZIA 3FS7A 3WNXB 5HYDA 1B4CA 5FYXA 1EG4A 1QX5B 2M9GA 5CSJA 2OTGB 3M0WA 2K2FA 1IWQA 2LHIA 3PATA 2EHBA 1YX8A 3SG3A 4OVNF 1U5IA 1CM4A 3NXAA 3SIBA 1AHRA 4DS7A 3A4UB 2WCEA 2M29A 1DF0A 3BYAA 2GV5A 1SCVA 1KFXL 1JBAA 4F0ZB 5I8NA 3O2PA 2R2IA 1DTLA 2K0JA 3CLNA 2I7AA 1K2HA 2KI6C 3DF0B 3DVJA 1K95A 4L9MA 1G8IA 3WHTB 3KO0A 4U8DA 1NP8A 2FJUB 3E3RA 1S5GZ 1J1EA 4MVFA 2MRDA 2IS9A 3PM8A 1TN4A 2H61A 3EVVA 4A4CA 1G4YR 3WHUB 1LA3A 1CNPA 3GOFA 4ORCB 1NX3A 5JJGA 3DVMA 1EL4A 2TN4A 2LP2A 1QS7A 1TOPA 1NYAA 4PE4A 3MSEB 2KBIA 4HRGA 2F3YA 1CMGA 1CLLA 2JXLA 2L4HA 1TIZA 4PHMA 2JT8A 3LK0A 3WXAA 1OQPA 2ZFDA 1QVIY 3BOWA 1S6CA 1SW8A 2L51A 3TDZA 1QIWA 1GGWA 1K96A 2F2PA 4YRUA 1LVCD 4GGFC 1DJZA 5DKQA 1YRTB 2QPTA 2HETA 2PASA 2Q4UA 1B1GA 2KQYA 2MJWB 4M2QA 2F33A 5AANA 4TNCA 2I94A 2KNEA 2PMYA 1DF0B 4PE0A 1DVIA 3ZNIA 4QJ5B 2OPOA 1CM1A 2G2BA 3OX6A 2K7OA 1ALWA 1F70A 1XK4A 1DJHA 4A4BA 2KFHA 2LHLA 1K9KA 4DCKA 1QLKA 4GBAA 3D0YA 1BODA 3F45A 4GUKA 1DJGA 4HRHA 2LVVA 4ZCUA 1YUUA 2LVJA 3JTDC 1CFCA 3BQ3A 3I5GC 3GK2A 4HREE 1ZMZA 1VRKA 1DGUA 3OB1B 3BXKA 5KU1A 1F71A 2JQ6A 2LCPA 1V1FA 1E8AA 4MRYA 2LMUA 4GFTA 1XFZO 5B8IB 1KK7Y 4YI9A 5AERA 1M45A 5IBWA 2JNXA 1BF5A 1CDLA 1S5GY 1QTXA 2LVIA 3IF7A 1UHNA 1Y1XA 4DRWA 2WNDA 1AK8A 2P6BB 3KF9A 3JTDB 4OKHA 1ALVA 1CTRA 2PALA 3TDIA 1TRFA 3I5GB 1CFFA 1IJ5A 2LVKA 1A75A 2KBMA 4QJ3B 5AXIA 1YR5A 4IL1A 2ZRSA 1W7IB 4MBEA 4ORBB 1WRLA 1TNWA 1QVIZ 1SMGA 4NDCA 4AQIA 2AAOA 3VRQA 1LINA 1PSBA 1ZUZA 4GGNA 2CT9A 2SCPA 1SNLA 2HF5A 2L98A 2JXCA 4JPZB 1ZOTB 1K93D 4PE7A 4XJKA 2L50A 3DVEA 4FQOA 5AEQA 5HKZA 1XFVO 3KPXA 3OX5A 1M46A 3PFVA 5KTYA 5I2OA 4PALA 2L5XB 1R6PA 2M49B 1OSAA 1CB1A 5CPVA 2HQ8A 1R2UA 3D0YB 3TUYC 1RTP1 2Y1MA 1UHHA 3BUNB 1UUSA 1FI5A 1SK6D 2SASA 2LANA 2Y4QA 1NWDA 1N0YA 2I2RE 1IGVA 1IH0A 2ZRTA 3CZTX 3PLFB 2VRGA 1F55A 3ICBA 1M63B 3OP0A 1LXFC 2WC8A 1GQMA 1J7OA 1SRAA 1QIVA 4MZLA 3CTNA 5CSFA 3KHEA 3RLZA 1KK7Z 2B1UA 1QV1A 2JULA 4MEWA 1CFPA 4C0JA 4UPGA 2K7DA 4P5OE 1ZACA 1KK8C 1LKJA 3LK1A 1PVAA 3VRNA 1SL7A 3TUYB 1F4OA 2JTTA 2BBMA 1DJXA 1EH2A 1CMFA 1KWOC 5HLVA 1S6JA 1Y1AA 1QLSA 2LE9B 4YGBB 2CTNA 1JF2A 2LM5A 2ZN8A 1DMOA 1H8BA 1IKUA 1KFUS 4P2YB 1KSMA 4M2PA 3CR2A 4YGAA 4MLWA 1FBVA 1QATA 4AQJA 5TNCA 2CBLA 1OMVA 1S26D 1LA0A 5F6TA 3A8RA 3AKAA 3IQOA 1KK8B 2M7NA 1SL9A 3HX4A 2KI4C 1B7TZ 1BT6A 2BE4A 2M97A 4PHJA 1IQ5A 3BUWB 2LLUA 2ISDA 1W7JB 1WY9A 2LC5A 3GK4X 4PCWA 1KWOB 2MBXA 4CPVA 1B8LA 2LUCA 1NX2A 4N1FA 5I2QA 1F54A 1B9AA 1OMDA 1XA5A 1NCXA 1NCZA 4I5NB 5CSIA 1BLQA 1GJYA 2FCEA 2JNFA 2KYFA 4NQGA 2KFGA 4ICBA 2LMTA 5JOLA 3TZ1A 4CFQA 1KFXS 1BOCA 1U5IB 1TCFA 2H61C 2LUXA 2Q91A 1MQ1A 2LNKA 1DJYA 2KYCA 3DVKA 3CS1A 3NSOA 2M1UA 1J55A 4I5KA 2G9BA 1HT9A 3BUMB 2KI4B 1SYMA 1DJWA 3VGOA 1TNPA 1EXRA 2F3ZA 4I5JA 2LV7A 2M7LA 2F8PA 1UHIA 1A03A 4YGEB 2BCXA 1NPQA 2AMIA 1PULA 2A4JA 1OOJA 1EG3A 1L7ZA 2MLFC 1BR4B 4OV2A 3DD4A 1DJIA 2PSRA 1SR6C 2GGZA 3EVUA 1CDMA 2KAXA 1K9UA 2COLB 2ZNEA 1IG5A 2LAPA 4USLA 3FIAA 1XVJA 5G08A 1SBJA 2D8NA 1QX2A 4FTGA 3H4SE 2QACA 1K94A 4MSPA 4MZKA 4ETOA 1PSRA 3CR4X 1TCOB 1AUIB 1Y0VH 5D69A 3AAKA 1V1GA 4NDBA 1UHJA 3QRXA 1A2XA 3BUOB 4M2OA 1YURA 4PHKA 1QX7A 2E6WA 1XK4C 4YGCB 2L0PA 3BOWB 1SR6B 2KDHA 1M31A 1YX7A 5GQQC 3EKJA 4ORAB 3LCPC 1XFXO 1YUTA 1AJ5A 3CGAA 1OZOA 3DF0A 1C7WA 1WDCC 1K9PA 2KI6D 3SG5A 5PALA 3SG7A 2H2KA 1H4BA 1NX0A 1S3PA 2WOSA 1B7TY 2NCPA 2K8MB 1AVSA 2ZNDA 1MXLC 1DT7B 2OS8C 1CLMA 4BY5A 1OZSA 2Y5IA 1XYDA 1IJ6A 2JC2A 4JWQA 1QASA 4D1EA 1MR8A 3EKHA 3CR5X 3K21A 4PDZA 1QV0A 4AOMA 1NCYA 2L4IA 1AP4A 1JUOA 2RGIA 3PSRA 4WRIA 1DGVA 1ZFSA 1AJ4A 2I18A 2JT0A 2O60A 5ER5A 1WDCB 2BBNA 1RFJA 4R1EA 3AKBA 1MWNA 3TS5B 5BPJA 1J7RA 2JWWA 2OS8B 4N1GA 4PHNA 1FI6A 1CDPA 3KEVA 4WQ3A 1TNQA 5ER4X 1UHKA 1B8RA 1NIWA 1CLBA 4MRXA 1F8HA 4CLNA 2E30A 2EC6B 2JPTA 3SIAA 2L2EA 1Y6WA 2V53A 3O78A 1N2DA 3AAJA 4MZJA 3EK8A 2LMVA 3SG2A 1JFJA 4NDDA 1YVLA 1YTZC 1NSHA 3OHMB 2K61A 2F2OA 4QJ4B 2KGBC 2CCMA 1BMOA 3O4YA 1A75B 5AFPA 1FW4A 1XFWO 3SG6A 1QXPA 3TDUA 1QJTA 1C07A 2FOTA 1OE9B 1A4PA 2WCBA 2KAYA 1S36A 4OR9B 5CSNA 1L2OC
chains in the Genus database with same CATH superfamily
3N7HA 1JFKA 3Q8IA 2EGDA 1BU3A 3I5FC 2M0RA 1ODBA 4JQ0D 4XJKB 4CIDA 4C0KA 4ZCVA 3C1VA 4GGFA 1NUBA 1RECA 1Z2CB 1M39A 2BNXA 2M8UA 2O5GA 3D74A 3OB2B 1DQEA 3UO9A 4F7FA 1S1EA 3EK4A 3NSLA 1WLMA 1FPWA 1J7PA 1PVBA 2MAZA 1PALA 1OOHA 2MHHA 1KCYA 3HCMA 3SJSA 2CXJA 2DOQA 4MN0A 1IQ3A 2PRUA 2BCBA 3RM1A 3I5HC 1RROA 2M1KB 3O6BA 2QEHA 1L2OB 2Y1NA 3NSIA 2KHNA 1RK9A 1RWYA 1K90D 1IRJA 1Y1UA 1OMRA 1XFUO 2NZ0A 1Q80A 2PVBA 1PRWA 3I5FB 1BJFA 2WCLA 1S6IA 1FF1A 1JSAA 5D7FA 2KOTA 4N5XA 1BG1A 2M3WA 1QWVA 2HQWA 1K8UA 4GAOA 3D10A 2HPSA 3PALA 2KFFA 3VROA 1CKKA 2K2AA 2NCOA 3V2LA 4E68A 3R72A 3I5IC 1YUSA 1EJ3A 3CWGA 3I5HB 5KSZA 5DKRA 3EVRA 1T14A 5I2LA 1C7VA 1YRUB 4I5LB 2BE6A 1B8CA 1ORGA 3S0BA 1SL8A 2WCFA 3JVTC 4XYNA 1CDNA 3LL8B 3DYEA 3NSKA 1J7QA 1MF8B 2LLSA 1KQMC 2JOJA 3L4LA 1XO5A 2H8VA 1JC2A 3FWCA 3OBVA 1D1OA 2NLNA 3PN7C 3LLEA 4INWA 3PJIA 3EK7A 5HLOA 1TTXA 2ZN9A 1SCMC 1UWOA 4BY4A 4JKTA 1CFDA 2BECA 3I5IB 1GGZA 1NX1A 1RJVA 4PE1A 2MA2A 2CNPA 3BUXB 1UP5A 2QEVA 5J3XA 5HKYA 1MHOA 1WRKA 1A29A 2P71A 1TWOA 4OCIA 1SY9A 2MLEC 1MXEA 3JVTB 5HKWA 2LP3A 1PK0D 3ZWHA 1J1DA 1F4QA 1MUXA 3B6XA 5DKNA 1KQMB 1JWDA 2GGMA 4C0LA 1SKTA 1YVHA 3PN7B 2JTZA 1SCMB 4HSZA 1WRZA 2KAVA 3SG4A 3TS5C 2JT3A 1KQVA 4YI8A 1B47A 1WLZA 2BL0C 2BKHB 3FWBA 2ZKMX 1JF0A 3IQQA 2K7CA 5K89A 4GNKB 1TUJA 2KQ6A 4YGDB 4IJ7A 4CFRA 2FCDA 4GPLB 1HQVA 1KSOA 2EC6C 2OTGC 2WORA 1SPYA 1TNXA 2KSPA 1XFYO 2KGRA 3VRPA 2JU0A 2K7BA 2LLTA 3GK1A 2BCAA 3VRRA 4WQ2A 2BKIB 2NXQA 1KFUL 2PYQA 4Q04A 1X02A 2AUCA 1G33A 3OGNA 2JRFA 1BR1B 4DIRA 4YBHB 2BL0B 4KYNA 4DUQA 1N65A 1UURA 2JZIA 3FS7A 3WNXB 5HYDA 3FE9A 1B4CA 5FYXA 1EG4A 3CDNA 1QX5B 2M9GA 5CSJA 2OTGB 3M0WA 3CZ1A 2K2FA 1IWQA 2LHIA 1OOFA 2EHBA 3PATA 1YX8A 3SG3A 4OVNF 5FI2A 1U5IA 1CM4A 3NXAA 3SIBA 1AHRA 4DS7A 3A4UB 2WCEA 2M29A 3VB1A 1DF0A 3BYAA 5HL1A 2GV5A 1SCVA 1KFXL 1JBAA 4F0ZB 5I8NA 3O2PA 2R2IA 1DTLA 2K0JA 3CLNA 2I7AA 1K2HA 2KI6C 3DF0B 3DVJA 1K95A 3R1VA 4L9MA 1G8IA 3WHTB 3DZTA 3KO0A 4U8DA 2L5YA 1NP8A 2FJUB 3E3RA 1S5GZ 1J1EA 4MVFA 2MRDA 2IS9A 1IIOA 3PM8A 1TN4A 2H61A 3EVVA 4A4CA 1G4YR 3WHUB 1LA3A 3O4XA 1CNPA 3GOFA 4ORCB 1NX3A 5JJGA 2P70A 3DVMA 1EL4A 2WC6A 2TN4A 3BJHA 2LP2A 1QS7A 5DICA 1TOPA 1NYAA 4PE4A 3MSEB 2KBIA 4HRGA 2F3YA 1CMGA 1CLLA 1XFRA 2JXLA 2L4HA 1TIZA 4PHMA 2JT8A 3LK0A 3NGVA 2PQLA 3WXAA 3CZ0A 1OQPA 2ZFDA 1QVIY 3BOWA 3DXLA 3IVTA 1S6CA 3NHIA 1SW8A 2L51A 3TDZA 1QIWA 4JD9A 1K96A 1GGWA 2F2PA 4YRUA 1LVCD 4GGFC 1DEKA 1DJZA 5DKQA 1YRTB 2QPTA 2HETA 2PASA 2Q4UA 1B1GA 2KQYA 2MJWB 4M2QA 2F33A 5AANA 4TNCA 2I94A 1OOGA 5I94A 2KNEA 2PMYA 1DF0B 4PE0A 1DVIA 3ZNIA 4QJ5B 2OPOA 3BFHA 1CM1A 2G2BA 3OX6A 2K7OA 1ALWA 1F70A 1XK4A 1DJHA 4A4BA 2QDIA 2KFHA 1OOIX 2LHLA 1K9KA 4DCKA 1QLKA 4GBAA 3D0YA 5FI7A 1BODA 3F45A 4GUKA 3S0EA 3UNWA 1DJGA 4HRHA 2LVVA 4ZCUA 1YUUA 2LVJA 3JTDC 1CFCA 3BQ3A 3I5GC 3GK2A 4HREE 1ZMZA 1VRKA 1DGUA 3OB1B 3BXKA 5KU1A 1F71A 5FI6A 2JQ6A 2LCPA 1V1FA 1E8AA 4MRYA 2LMUA 4GFTA 1XFZO 5EL2A 5B8IB 3R1OA 1KK7Y 4YI9A 3D73A 5AERA 1M45A 5IBWA 2JNXA 1BF5A 1CDLA 1S5GY 1QTXA 2LVIA 3IF7A 3L47A 1UHNA 1Y1XA 4DRWA 2WNDA 2K60A 2P6BB 3EG5B 3KF9A 1AK8A 3JTDB 4OKHA 1ALVA 1CTRA 2PALA 3SS5A 3TDIA 1TRFA 3I5GB 2GTEA 2KLEA 1CFFA 1IJ5A 2LVKA 1A75A 2KBMA 4QJ3B 3NHTA 5AXIA 1YR5A 4IL1A 2ZRSA 1W7IB 4MBEA 4ORBB 3FE6A 3S0GA 1WRLA 1TNWA 1QVIZ 1SMGA 1LS8A 4NDCA 2AAOA 3D75A 3VRQA 4AQIA 1LINA 1PSBA 4PT1A 1ZUZA 4GGNA 2CT9A 2SCPA 1SNLA 2HF5A 2L98A 2JXCA 3R1PA 4JPZB 1ZOTB 1K93D 1GM0A 4PE7A 4XJKA 2L50A 3DVEA 4FQOA 5AEQA 3B87A 5HKZA 1XFVO 3KPXA 1P28A 3OX5A 1M46A 3PM2A 3PFVA 5KTYA 5I2OA 4PALA 2L5XB 3DY9A 1R6PA 2M49B 2YGUA 1OSAA 1CB1A 5CPVA 2HQ8A 1R2UA 3D0YB 3TUYC 1RTP1 2Y1MA 1UHHA 3BUNB 1UUSA 1FI5A 1SK6D 2SASA 2LANA 2Y4QA 1NWDA 1N0YA 2I2RE 1IGVA 1DC1A 4INXA 1IH0A 2ZRTA 3S0DA 3CZTX 3PLFB 2VRGA 1F55A 3ICBA 1M63B 3D76A 3OP0A 1LXFC 2WC8A 1GQMA 1J7OA 1SRAA 1QIVA 4MZLA 3CTNA 5CSFA 3KHEA 3RLZA 1C3ZA 1KK7Z 2B1UA 1QV1A 2JULA 4MEWA 1CFPA 4C0JA 4UPGA 2K7DA 4P5OE 1ZACA 1KK8C 1LKJA 3LK1A 1PVAA 3VRNA 1SL7A 3B88A 3TUYB 1F4OA 2JTTA 2BBMA 1DJXA 1EH2A 1CMFA 1KWOC 3BFBA 5HLVA 3D77A 1S6JA 1Y1AA 1QLSA 1W9ZA 2LE9B 4YGBB 2CTNA 1JF2A 2LM5A 2ZN8A 1DMOA 3QMEA 1IKUA 1KFUS 1H8BA 4P2YB 3B7AA 1KSMA 4M2PA 3CR2A 4YGAA 4MLWA 1FBVA 1QATA 4AQJA 5TNCA 2CBLA 1OMVA 1S26D 1LA0A 5F6TA 3A8RA 3AKAA 3IQOA 1KK8B 2M7NA 2QEBA 1C3YA 1SL9A 3HX4A 2KI4C 1B7TZ 1BT6A 2BE4A 2M97A 4PHJA 1IQ5A 3BUWB 2LLUA 2ISDA 1W7JB 1WY9A 2LC5A 3GK4X 4PCWA 1KWOB 2MBXA 4CPVA 1B8LA 2LUCA 1NX2A 4N1FA 5I2QA 1F54A 1B9AA 1OMDA 1XA5A 1NCXA 1NCZA 1TUZA 4I5NB 2WCHA 1GJYA 2FCEA 2JNFA 2KYFA 4NQGA 2KFGA 4ICBA 2LMTA 5JOLA 3TZ1A 4CFQA 1KFXS 1BOCA 1U5IB 2QEOA 1TCFA 2H61C 2LUXA 2Q91A 1MQ1A 2ERBA 2WCMA 2LNKA 1DJYA 5CSIA 2KYCA 3DVKA 1DELA 3CS1A 3NSOA 2M1UA 1J55A 4I5KA 2G9BA 1HT9A 3BUMB 2KI4B 1SYMA 1DJWA 3VGOA 1TNPA 1EXRA 2F3ZA 4I5JA 3S0FA 2LV7A 2WCJA 2M7LA 2F8PA 1UHIA 1A03A 4YGEB 2BCXA 1NPQA 2AMIA 3RZSA 1PULA 2A4JA 1OOJA 3S0AA 1EG3A 1L7ZA 2MLFC 1BR4B 4OV2A 2KLDA 1DJIA 3DD4A 4FQTA 2PSRA 1SR6C 2GGZA 3EVUA 1CDMA 2KAXA 1K9UA 2COLB 2ZNEA 1IG5A 2LAPA 4USLA 3FIAA 1XVJA 5G08A 1SBJA 5D3OA 2D8NA 1QX2A 4FTGA 3H4SE 3SS3A 2QACA 1K94A 4MSPA 4MZKA 4ETOA 1PSRA 3CR4X 1TCOB 1AUIB 1Y0VH 5D69A 3AAKA 1V1GA 4NDBA 1UHJA 3QRXA 1A2XA 3BUOB 4M2OA 1SSEB 1YURA 4PHKA 2WCKA 1QX7A 2E6WA 1BLQA 1XK4C 4OZDA 4YGCB 2L0PA 3BOWB 1SR6B 2KDHA 1M31A 1YX7A 5GQQC 3EKJA 2L2CA 3LCPC 4ORAB 1XFXO 1YUTA 1AJ5A 3CGAA 1OZOA 3DF0A 1C7WA 1WDCC 1K9PA 2KI6D 1OW4A 3SG5A 5PALA 3SG7A 2H2KA 1H4BA 1NX0A 1S3PA 2WOSA 1B7TY 2NCPA 2K8MB 1AVSA 2ZNDA 1MXLC 1DT7B 2OS8C 1CLMA 1Z4HA 1OZSA 2Y5IA 1XYDA 4BY5A 1IJ6A 2JC2A 4JWQA 1QASA 4D1EA 1MR8A 3EKHA 3CR5X 3K21A 4PDZA 1QV0A 2BAPA 4AOMA 1NCYA 2L4IA 1AP4A 1JUOA 2RGIA 3PSRA 4WRIA 1DGVA 1ZFSA 2JPOA 3CABA 1AJ4A 2I18A 2JT0A 2O60A 5ER5A 1WDCB 3B86A 2BBNA 1RFJA 4R1EA 2FJYA 3D78A 3AKBA 1MWNA 3TS5B 5BPJA 1J7RA 2JWWA 2OS8B 4N1GA 4PHNA 1FI6A 1CDPA 3KEVA 4WQ3A 1TNQA 5ER4X 1UHKA 1B8RA 1NIWA 1CLBA 4MRXA 1F8HA 4CLNA 2E30A 2EC6B 2JPTA 3BFAA 3SIAA 2L2EA 1Y6WA 2V53A 3O78A 1N2DA 3AAJA 4MZJA 3EK8A 2LMVA 3SG2A 1JFJA 3L4AA 4NDDA 1YVLA 1YTZC 1NSHA 3CZ2A 3OHMB 2K61A 2F2OA 4QJ4B 2KGBC 2CCMA 3CYZA 1BMOA 3O4YA 1A75B 5AFPA 1FW4A 1XFWO 3SG6A 1QXPA 3TDUA 1QJTA 1C07A 2FOTA 1OE9B 1A4PA 2KPHA 2WC5A 2WCBA 2KAYA 3FE8A 1S36A 3SS4A 3K1EA 4OR9B 5CSNA 1L2OC
chains in the Genus database with same CATH topology
1JFKA 2EGDA 1BU3A 3I5FC 2M0RA 1ODBA 4JQ0D 4XJKB 4CIDA 4C0KA 4ZCVA 3C1VA 4GGFA 1NUBA 1RECA 1M39A 2M8UA 2O5GA 3OB2B 1S1EA 3EK4A 3NSLA 1WLMA 1FPWA 1J7PA 1PVBA 2MAZA 1PALA 2MHHA 1KCYA 3HCMA 3SJSA 2CXJA 2DOQA 4MN0A 1IQ3A 2PRUA 2BCBA 3RM1A 3I5HC 1RROA 2M1KB 3O6BA 1L2OB 2Y1NA 3NSIA 2KHNA 1RK9A 1RWYA 1K90D 1IRJA 1Y1UA 1OMRA 1XFUO 2NZ0A 1Q80A 2PVBA 1PRWA 3I5FB 1BJFA 1S6IA 1FF1A 1JSAA 5D7FA 2KOTA 4N5XA 1BG1A 2M3WA 2HQWA 1K8UA 4GAOA 3D10A 2HPSA 3PALA 2KFFA 3VROA 1CKKA 2K2AA 2NCOA 4E68A 3I5IC 1YUSA 1EJ3A 3CWGA 3I5HB 5KSZA 5DKRA 3EVRA 5I2LA 1C7VA 1YRUB 4I5LB 2BE6A 1B8CA 1SL8A 2WCFA 3JVTC 4XYNA 1CDNA 3LL8B 3NSKA 1J7QA 1MF8B 2LLSA 1KQMC 2JOJA 1XO5A 1JC2A 3FWCA 1D1OA 2NLNA 3PN7C 3LLEA 5HLOA 3EK7A 1TTXA 2ZN9A 1SCMC 1UWOA 4BY4A 1CFDA 2BECA 3I5IB 1GGZA 1NX1A 1RJVA 4PE1A 2MA2A 2CNPA 3BUXB 1UP5A 5HKYA 5J3XA 1MHOA 1WRKA 1A29A 4OCIA 1SY9A 2MLEC 1MXEA 3JVTB 5HKWA 2LP3A 1PK0D 3ZWHA 1J1DA 1F4QA 1MUXA 5DKNA 1KQMB 1JWDA 2GGMA 4C0LA 1SKTA 1YVHA 3PN7B 2JTZA 1SCMB 4HSZA 1WRZA 2KAVA 3SG4A 3TS5C 2JT3A 1KQVA 4YI8A 1B47A 1WLZA 2BL0C 2BKHB 3FWBA 2ZKMX 1JF0A 3IQQA 2K7CA 5K89A 4GNKB 2KQ6A 4YGDB 4CFRA 2FCDA 4GPLB 1HQVA 1KSOA 2EC6C 2OTGC 2WORA 1SPYA 1TNXA 2KSPA 1XFYO 2KGRA 3VRPA 2JU0A 2K7BA 2LLTA 3GK1A 2BCAA 3VRRA 4WQ2A 2BKIB 2NXQA 1KFUL 4Q04A 1X02A 2AUCA 1G33A 2JRFA 1BR1B 4DIRA 4YBHB 2BL0B 4DUQA 1N65A 1UURA 2JZIA 3FS7A 3WNXB 5HYDA 1B4CA 5FYXA 1EG4A 1QX5B 2M9GA 5CSJA 2OTGB 3M0WA 2K2FA 1IWQA 2LHIA 3PATA 2EHBA 1YX8A 3SG3A 4OVNF 1U5IA 1CM4A 3NXAA 3SIBA 1AHRA 4DS7A 3A4UB 2WCEA 2M29A 1DF0A 3BYAA 2GV5A 1SCVA 1KFXL 1JBAA 4F0ZB 5I8NA 3O2PA 2R2IA 1DTLA 2K0JA 3CLNA 2I7AA 1K2HA 2KI6C 3DF0B 3DVJA 1K95A 4L9MA 1G8IA 3WHTB 3KO0A 4U8DA 1NP8A 2FJUB 3E3RA 1S5GZ 1J1EA 4MVFA 2MRDA 2IS9A 3PM8A 1TN4A 2H61A 3EVVA 4A4CA 1G4YR 3WHUB 1LA3A 1CNPA 3GOFA 4ORCB 1NX3A 5JJGA 3DVMA 1EL4A 2TN4A 2LP2A 1QS7A 1TOPA 1NYAA 4PE4A 3MSEB 2KBIA 4HRGA 2F3YA 1CMGA 1CLLA 2JXLA 2L4HA 1TIZA 4PHMA 2JT8A 3LK0A 3WXAA 1OQPA 2ZFDA 1QVIY 3BOWA 1S6CA 1SW8A 2L51A 3TDZA 1QIWA 1GGWA 1K96A 2F2PA 4YRUA 1LVCD 4GGFC 1DJZA 5DKQA 1YRTB 2QPTA 2HETA 2PASA 2Q4UA 1B1GA 2KQYA 2MJWB 4M2QA 2F33A 5AANA 4TNCA 2I94A 2KNEA 2PMYA 1DF0B 4PE0A 1DVIA 3ZNIA 4QJ5B 2OPOA 1CM1A 2G2BA 3OX6A 2K7OA 1ALWA 1F70A 1XK4A 1DJHA 4A4BA 2KFHA 2LHLA 1K9KA 4DCKA 1QLKA 4GBAA 3D0YA 1BODA 3F45A 4GUKA 1DJGA 4HRHA 2LVVA 4ZCUA 1YUUA 2LVJA 3JTDC 1CFCA 3BQ3A 3I5GC 3GK2A 4HREE 1ZMZA 1VRKA 1DGUA 3OB1B 3BXKA 5KU1A 1F71A 2JQ6A 2LCPA 1V1FA 1E8AA 4MRYA 2LMUA 4GFTA 1XFZO 5B8IB 1KK7Y 4YI9A 5AERA 1M45A 5IBWA 2JNXA 1BF5A 1CDLA 1S5GY 1QTXA 2LVIA 3IF7A 1UHNA 1Y1XA 4DRWA 2WNDA 1AK8A 2P6BB 3KF9A 3JTDB 4OKHA 1ALVA 1CTRA 2PALA 3TDIA 1TRFA 3I5GB 1CFFA 1IJ5A 2LVKA 1A75A 2KBMA 4QJ3B 5AXIA 1YR5A 4IL1A 2ZRSA 1W7IB 4MBEA 4ORBB 1WRLA 1TNWA 1QVIZ 1SMGA 4NDCA 4AQIA 2AAOA 3VRQA 1LINA 1PSBA 1ZUZA 4GGNA 2CT9A 2SCPA 1SNLA 2HF5A 2L98A 2JXCA 4JPZB 1ZOTB 1K93D 4PE7A 4XJKA 2L50A 3DVEA 4FQOA 5AEQA 5HKZA 1XFVO 3KPXA 3OX5A 1M46A 3PFVA 5KTYA 5I2OA 4PALA 2L5XB 1R6PA 2M49B 1OSAA 1CB1A 5CPVA 2HQ8A 1R2UA 3D0YB 3TUYC 1RTP1 2Y1MA 1UHHA 3BUNB 1UUSA 1FI5A 1SK6D 2SASA 2LANA 2Y4QA 1NWDA 1N0YA 2I2RE 1IGVA 1IH0A 2ZRTA 3CZTX 3PLFB 2VRGA 1F55A 3ICBA 1M63B 3OP0A 1LXFC 2WC8A 1GQMA 1J7OA 1SRAA 1QIVA 4MZLA 3CTNA 5CSFA 3KHEA 3RLZA 1KK7Z 2B1UA 1QV1A 2JULA 4MEWA 1CFPA 4C0JA 4UPGA 2K7DA 4P5OE 1ZACA 1KK8C 1LKJA 3LK1A 1PVAA 3VRNA 1SL7A 3TUYB 1F4OA 2JTTA 2BBMA 1DJXA 1EH2A 1CMFA 1KWOC 5HLVA 1S6JA 1Y1AA 1QLSA 2LE9B 4YGBB 2CTNA 1JF2A 2LM5A 2ZN8A 1DMOA 1H8BA 1IKUA 1KFUS 4P2YB 1KSMA 4M2PA 3CR2A 4YGAA 4MLWA 1FBVA 1QATA 4AQJA 5TNCA 2CBLA 1OMVA 1S26D 1LA0A 5F6TA 3A8RA 3AKAA 3IQOA 1KK8B 2M7NA 1SL9A 3HX4A 2KI4C 1B7TZ 1BT6A 2BE4A 2M97A 4PHJA 1IQ5A 3BUWB 2LLUA 2ISDA 1W7JB 1WY9A 2LC5A 3GK4X 4PCWA 1KWOB 2MBXA 4CPVA 1B8LA 2LUCA 1NX2A 4N1FA 5I2QA 1F54A 1B9AA 1OMDA 1XA5A 1NCXA 1NCZA 4I5NB 5CSIA 1BLQA 1GJYA 2FCEA 2JNFA 2KYFA 4NQGA 2KFGA 4ICBA 2LMTA 5JOLA 3TZ1A 4CFQA 1KFXS 1BOCA 1U5IB 1TCFA 2H61C 2LUXA 2Q91A 1MQ1A 2LNKA 1DJYA 2KYCA 3DVKA 3CS1A 3NSOA 2M1UA 1J55A 4I5KA 2G9BA 1HT9A 3BUMB 2KI4B 1SYMA 1DJWA 3VGOA 1TNPA 1EXRA 2F3ZA 4I5JA 2LV7A 2M7LA 2F8PA 1UHIA 1A03A 4YGEB 2BCXA 1NPQA 2AMIA 1PULA 2A4JA 1OOJA 1EG3A 1L7ZA 2MLFC 1BR4B 4OV2A 3DD4A 1DJIA 2PSRA 1SR6C 2GGZA 3EVUA 1CDMA 2KAXA 1K9UA 2COLB 2ZNEA 1IG5A 2LAPA 4USLA 3FIAA 1XVJA 5G08A 1SBJA 2D8NA 1QX2A 4FTGA 3H4SE 2QACA 1K94A 4MSPA 4MZKA 4ETOA 1PSRA 3CR4X 1TCOB 1AUIB 1Y0VH 5D69A 3AAKA 1V1GA 4NDBA 1UHJA 3QRXA 1A2XA 3BUOB 4M2OA 1YURA 4PHKA 1QX7A 2E6WA 1XK4C 4YGCB 2L0PA 3BOWB 1SR6B 2KDHA 1M31A 1YX7A 5GQQC 3EKJA 4ORAB 3LCPC 1XFXO 1YUTA 1AJ5A 3CGAA 1OZOA 3DF0A 1C7WA 1WDCC 1K9PA 2KI6D 3SG5A 5PALA 3SG7A 2H2KA 1H4BA 1NX0A 1S3PA 2WOSA 1B7TY 2NCPA 2K8MB 1AVSA 2ZNDA 1MXLC 1DT7B 2OS8C 1CLMA 4BY5A 1OZSA 2Y5IA 1XYDA 1IJ6A 2JC2A 4JWQA 1QASA 4D1EA 1MR8A 3EKHA 3CR5X 3K21A 4PDZA 1QV0A 4AOMA 1NCYA 2L4IA 1AP4A 1JUOA 2RGIA 3PSRA 4WRIA 1DGVA 1ZFSA 1AJ4A 2I18A 2JT0A 2O60A 5ER5A 1WDCB 2BBNA 1RFJA 4R1EA 3AKBA 1MWNA 3TS5B 5BPJA 1J7RA 2JWWA 2OS8B 4N1GA 4PHNA 1FI6A 1CDPA 3KEVA 4WQ3A 1TNQA 5ER4X 1UHKA 1B8RA 1NIWA 1CLBA 4MRXA 1F8HA 4CLNA 2E30A 2EC6B 2JPTA 3SIAA 2L2EA 1Y6WA 2V53A 3O78A 1N2DA 3AAJA 4MZJA 3EK8A 2LMVA 3SG2A 1JFJA 4NDDA 1YVLA 1YTZC 1NSHA 3OHMB 2K61A 2F2OA 4QJ4B 2KGBC 2CCMA 1BMOA 3O4YA 1A75B 5AFPA 1FW4A 1XFWO 3SG6A 1QXPA 3TDUA 1QJTA 1C07A 2FOTA 1OE9B 1A4PA 2WCBA 2KAYA 1S36A 4OR9B 5CSNA 1L2OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFK A;  2EGD A;  1BU3 A;  3I5F C;  2M0R A;  1ODB A;  4JQ0 D;  4XJK B;  4CID A;  4C0K A;  4ZCV A;  3C1V A;  4GGF A;  1NUB A;  1REC A;  1M39 A;  2M8U A;  2O5G A;  3OB2 B;  1S1E A;  3EK4 A;  3NSL A;  1WLM A;  1FPW A;  1J7P A;  1PVB A;  2MAZ A;  1PAL A;  2MHH A;  1KCY A;  3HCM A;  3SJS A;  2CXJ A;  2DOQ A;  4MN0 A;  1IQ3 A;  2PRU A;  2BCB A;  3RM1 A;  3I5H C;  1RRO A;  2M1K B;  3O6B A;  1L2O B;  2Y1N A;  3NSI A;  2KHN A;  1RK9 A;  1RWY A;  1K90 D;  1IRJ A;  1Y1U A;  1OMR A;  1XFU O;  2NZ0 A;  1Q80 A;  2PVB A;  1PRW A;  3I5F B;  1BJF A;  1S6I A;  1FF1 A;  1JSA A;  5D7F A;  2KOT A;  4N5X A;  1BG1 A;  2M3W A;  2HQW A;  1K8U A;  4GAO A;  3D10 A;  2HPS A;  3PAL A;  2KFF A;  3VRO A;  1CKK A;  2K2A A;  2NCO A;  4E68 A;  3I5I C;  1YUS A;  1EJ3 A;  3CWG A;  3I5H B;  5KSZ A;  5DKR A;  3EVR A;  5I2L A;  1C7V A;  1YRU B;  4I5L B;  2BE6 A;  1B8C A;  1SL8 A;  2WCF A;  3JVT C;  4XYN A;  1CDN A;  3LL8 B;  3NSK A;  1J7Q A;  1MF8 B;  2LLS A;  1KQM C;  2JOJ A;  1XO5 A;  1JC2 A;  3FWC A;  1D1O A;  2NLN A;  3PN7 C;  3LLE A;  5HLO A;  3EK7 A;  1TTX A;  2ZN9 A;  1SCM C;  1UWO A;  4BY4 A;  1CFD A;  2BEC A;  3I5I B;  1GGZ A;  1NX1 A;  1RJV A;  4PE1 A;  2MA2 A;  2CNP A;  3BUX B;  1UP5 A;  5HKY A;  5J3X A;  1MHO A;  1WRK A;  1A29 A;  4OCI A;  1SY9 A;  2MLE C;  1MXE A;  3JVT B;  5HKW A;  2LP3 A;  1PK0 D;  3ZWH A;  1J1D A;  1F4Q A;  1MUX A;  5DKN A;  1KQM B;  1JWD A;  2GGM A;  4C0L A;  1SKT A;  1YVH A;  3PN7 B;  2JTZ A;  1SCM B;  4HSZ A;  1WRZ A;  2KAV A;  3SG4 A;  3TS5 C;  2JT3 A;  1KQV A;  4YI8 A;  1B47 A;  1WLZ A;  2BL0 C;  2BKH B;  3FWB A;  2ZKM X;  1JF0 A;  3IQQ A;  2K7C A;  5K89 A;  4GNK B;  2KQ6 A;  4YGD B;  4CFR A;  2FCD A;  4GPL B;  1HQV A;  1KSO A;  2EC6 C;  2OTG C;  2WOR A;  1SPY A;  1TNX A;  2KSP A;  1XFY O;  2KGR A;  3VRP A;  2JU0 A;  2K7B A;  2LLT A;  3GK1 A;  2BCA A;  3VRR A;  4WQ2 A;  2BKI B;  2NXQ A;  1KFU L;  4Q04 A;  1X02 A;  2AUC A;  1G33 A;  2JRF A;  1BR1 B;  4DIR A;  4YBH B;  2BL0 B;  4DUQ A;  1N65 A;  1UUR A;  2JZI A;  3FS7 A;  3WNX B;  5HYD A;  1B4C A;  5FYX A;  1EG4 A;  1QX5 B;  2M9G A;  5CSJ A;  2OTG B;  3M0W A;  2K2F A;  1IWQ A;  2LHI A;  3PAT A;  2EHB A;  1YX8 A;  3SG3 A;  4OVN F;  1U5I A;  1CM4 A;  3NXA A;  3SIB A;  1AHR A;  4DS7 A;  3A4U B;  2WCE A;  2M29 A;  1DF0 A;  3BYA A;  2GV5 A;  1SCV A;  1KFX L;  1JBA A;  4F0Z B;  5I8N A;  3O2P A;  2R2I A;  1DTL A;  2K0J A;  3CLN A;  2I7A A;  1K2H A;  2KI6 C;  3DF0 B;  3DVJ A;  1K95 A;  4L9M A;  1G8I A;  3WHT B;  3KO0 A;  4U8D A;  1NP8 A;  2FJU B;  3E3R A;  1S5G Z;  1J1E A;  4MVF A;  2MRD A;  2IS9 A;  3PM8 A;  1TN4 A;  2H61 A;  3EVV A;  4A4C A;  1G4Y R;  3WHU B;  1LA3 A;  1CNP A;  3GOF A;  4ORC B;  1NX3 A;  5JJG A;  3DVM A;  1EL4 A;  2TN4 A;  2LP2 A;  1QS7 A;  1TOP A;  1NYA A;  4PE4 A;  3MSE B;  2KBI A;  4HRG A;  2F3Y A;  1CMG A;  1CLL A;  2JXL A;  2L4H A;  1TIZ A;  4PHM A;  2JT8 A;  3LK0 A;  3WXA A;  1OQP A;  2ZFD A;  1QVI Y;  3BOW A;  1S6C A;  1SW8 A;  2L51 A;  3TDZ A;  1QIW A;  1GGW A;  1K96 A;  2F2P A;  4YRU A;  1LVC D;  4GGF C;  1DJZ A;  5DKQ A;  1YRT B;  2QPT A;  2HET A;  2PAS A;  2Q4U A;  1B1G A;  2KQY A;  2MJW B;  4M2Q A;  2F33 A;  5AAN A;  4TNC A;  2I94 A;  2KNE A;  2PMY A;  1DF0 B;  4PE0 A;  1DVI A;  3ZNI A;  4QJ5 B;  2OPO A;  1CM1 A;  2G2B A;  3OX6 A;  2K7O A;  1ALW A;  1F70 A;  1XK4 A;  1DJH A;  4A4B A;  2KFH A;  2LHL A;  1K9K A;  4DCK A;  1QLK A;  4GBA A;  3D0Y A;  1BOD A;  3F45 A;  4GUK A;  1DJG A;  4HRH A;  2LVV A;  4ZCU A;  1YUU A;  2LVJ A;  3JTD C;  1CFC A;  3BQ3 A;  3I5G C;  3GK2 A;  4HRE E;  1ZMZ A;  1VRK A;  1DGU A;  3OB1 B;  3BXK A;  5KU1 A;  1F71 A;  2JQ6 A;  2LCP A;  1V1F A;  1E8A A;  4MRY A;  2LMU A;  4GFT A;  1XFZ O;  5B8I B;  1KK7 Y;  4YI9 A;  5AER A;  1M45 A;  5IBW A;  2JNX A;  1BF5 A;  1CDL A;  1S5G Y;  1QTX A;  2LVI A;  3IF7 A;  1UHN A;  1Y1X A;  4DRW A;  2WND A;  1AK8 A;  2P6B B;  3KF9 A;  3JTD B;  4OKH A;  1ALV A;  1CTR A;  2PAL A;  3TDI A;  1TRF A;  3I5G B;  1CFF A;  1IJ5 A;  2LVK A;  1A75 A;  2KBM A;  4QJ3 B;  5AXI A;  1YR5 A;  4IL1 A;  2ZRS A;  1W7I B;  4MBE A;  4ORB B;  1WRL A;  1TNW A;  1QVI Z;  1SMG A;  4NDC A;  4AQI A;  2AAO A;  3VRQ A;  1LIN A;  1PSB A;  1ZUZ A;  4GGN A;  2CT9 A;  2SCP A;  1SNL A;  2HF5 A;  2L98 A;  2JXC A;  4JPZ B;  1ZOT B;  1K93 D;  4PE7 A;  4XJK A;  2L50 A;  3DVE A;  4FQO A;  5AEQ A;  5HKZ A;  1XFV O;  3KPX A;  3OX5 A;  1M46 A;  3PFV A;  5KTY A;  5I2O A;  4PAL A;  2L5X B;  1R6P A;  2M49 B;  1OSA A;  1CB1 A;  5CPV A;  2HQ8 A;  1R2U A;  3D0Y B;  3TUY C;  1RTP 1;  2Y1M A;  1UHH A;  3BUN B;  1UUS A;  1FI5 A;  1SK6 D;  2SAS A;  2LAN A;  2Y4Q A;  1NWD A;  1N0Y A;  2I2R E;  1IGV A;  1IH0 A;  2ZRT A;  3CZT X;  3PLF B;  2VRG A;  1F55 A;  3ICB A;  1M63 B;  3OP0 A;  1LXF C;  2WC8 A;  1GQM A;  1J7O A;  1SRA A;  1QIV A;  4MZL A;  3CTN A;  5CSF A;  3KHE A;  3RLZ A;  1KK7 Z;  2B1U A;  1QV1 A;  2JUL A;  4MEW A;  1CFP A;  4C0J A;  4UPG A;  2K7D A;  4P5O E;  1ZAC A;  1KK8 C;  1LKJ A;  3LK1 A;  1PVA A;  3VRN A;  1SL7 A;  3TUY B;  1F4O A;  2JTT A;  2BBM A;  1DJX A;  1EH2 A;  1CMF A;  1KWO C;  5HLV A;  1S6J A;  1Y1A A;  1QLS A;  2LE9 B;  4YGB B;  2CTN A;  1JF2 A;  2LM5 A;  2ZN8 A;  1DMO A;  1H8B A;  1IKU A;  1KFU S;  4P2Y B;  1KSM A;  4M2P A;  3CR2 A;  4YGA A;  4MLW A;  1FBV A;  1QAT A;  4AQJ A;  5TNC A;  2CBL A;  1OMV A;  1S26 D;  1LA0 A;  5F6T A;  3A8R A;  3AKA A;  3IQO A;  1KK8 B;  2M7N A;  1SL9 A;  3HX4 A;  2KI4 C;  1B7T Z;  1BT6 A;  2BE4 A;  2M97 A;  4PHJ A;  1IQ5 A;  3BUW B;  2LLU A;  2ISD A;  1W7J B;  1WY9 A;  2LC5 A;  3GK4 X;  4PCW A;  1KWO B;  2MBX A;  4CPV A;  1B8L A;  2LUC A;  1NX2 A;  4N1F A;  5I2Q A;  1F54 A;  1B9A A;  1OMD A;  1XA5 A;  1NCX A;  1NCZ A;  4I5N B;  5CSI A;  1BLQ A;  1GJY A;  2FCE A;  2JNF A;  2KYF A;  4NQG A;  2KFG A;  4ICB A;  2LMT A;  5JOL A;  3TZ1 A;  4CFQ A;  1KFX S;  1BOC A;  1U5I B;  1TCF A;  2H61 C;  2LUX A;  2Q91 A;  1MQ1 A;  2LNK A;  1DJY A;  2KYC A;  3DVK A;  3CS1 A;  3NSO A;  2M1U A;  1J55 A;  4I5K A;  2G9B A;  1HT9 A;  3BUM B;  2KI4 B;  1SYM A;  1DJW A;  3VGO A;  1TNP A;  1EXR A;  2F3Z A;  4I5J A;  2LV7 A;  2M7L A;  2F8P A;  1UHI A;  1A03 A;  4YGE B;  2BCX A;  1NPQ A;  2AMI A;  1PUL A;  2A4J A;  1OOJ A;  1EG3 A;  1L7Z A;  2MLF C;  1BR4 B;  4OV2 A;  3DD4 A;  1DJI A;  2PSR A;  1SR6 C;  2GGZ A;  3EVU A;  1CDM A;  2KAX A;  1K9U A;  2COL B;  2ZNE A;  1IG5 A;  2LAP A;  4USL A;  3FIA A;  1XVJ A;  5G08 A;  1SBJ A;  2D8N A;  1QX2 A;  4FTG A;  3H4S E;  2QAC A;  1K94 A;  4MSP A;  4MZK A;  4ETO A;  1PSR A;  3CR4 X;  1TCO B;  1AUI B;  1Y0V H;  5D69 A;  3AAK A;  1V1G A;  4NDB A;  1UHJ A;  3QRX A;  1A2X A;  3BUO B;  4M2O A;  1YUR A;  4PHK A;  1QX7 A;  2E6W A;  1XK4 C;  4YGC B;  2L0P A;  3BOW B;  1SR6 B;  2KDH A;  1M31 A;  1YX7 A;  5GQQ C;  3EKJ A;  4ORA B;  3LCP C;  1XFX O;  1YUT A;  1AJ5 A;  3CGA A;  1OZO A;  3DF0 A;  1C7W A;  1WDC C;  1K9P A;  2KI6 D;  3SG5 A;  5PAL A;  3SG7 A;  2H2K A;  1H4B A;  1NX0 A;  1S3P A;  2WOS A;  1B7T Y;  2NCP A;  2K8M B;  1AVS A;  2ZND A;  1MXL C;  1DT7 B;  2OS8 C;  1CLM A;  4BY5 A;  1OZS A;  2Y5I A;  1XYD A;  1IJ6 A;  2JC2 A;  4JWQ A;  1QAS A;  4D1E A;  1MR8 A;  3EKH A;  3CR5 X;  3K21 A;  4PDZ A;  1QV0 A;  4AOM A;  1NCY A;  2L4I A;  1AP4 A;  1JUO A;  2RGI A;  3PSR A;  4WRI A;  1DGV A;  1ZFS A;  1AJ4 A;  2I18 A;  2JT0 A;  2O60 A;  5ER5 A;  1WDC B;  2BBN A;  1RFJ A;  4R1E A;  3AKB A;  1MWN A;  3TS5 B;  5BPJ A;  1J7R A;  2JWW A;  2OS8 B;  4N1G A;  4PHN A;  1FI6 A;  1CDP A;  3KEV A;  4WQ3 A;  1TNQ A;  5ER4 X;  1UHK A;  1B8R A;  1NIW A;  1CLB A;  4MRX A;  1F8H A;  4CLN A;  2E30 A;  2EC6 B;  2JPT A;  3SIA A;  2L2E A;  1Y6W A;  2V53 A;  3O78 A;  1N2D A;  3AAJ A;  4MZJ A;  3EK8 A;  2LMV A;  3SG2 A;  1JFJ A;  4NDD A;  1YVL A;  1YTZ C;  1NSH A;  3OHM B;  2K61 A;  2F2O A;  4QJ4 B;  2KGB C;  2CCM A;  1BMO A;  3O4Y A;  1A75 B;  5AFP A;  1FW4 A;  1XFW O;  3SG6 A;  1QXP A;  3TDU A;  1QJT A;  1C07 A;  2FOT A;  1OE9 B;  1A4P A;  2WCB A;  2KAY A;  1S36 A;  4OR9 B;  5CSN A;  1L2O C; 
#chains in the Genus database with same CATH topology
 3N7H A;  1JFK A;  3Q8I A;  2EGD A;  1BU3 A;  3I5F C;  2M0R A;  1ODB A;  4JQ0 D;  4XJK B;  4CID A;  4C0K A;  4ZCV A;  3C1V A;  4GGF A;  1NUB A;  1REC A;  1Z2C B;  1M39 A;  2BNX A;  2M8U A;  2O5G A;  3D74 A;  3OB2 B;  1DQE A;  3UO9 A;  4F7F A;  1S1E A;  3EK4 A;  3NSL A;  1WLM A;  1FPW A;  1J7P A;  1PVB A;  2MAZ A;  1PAL A;  1OOH A;  2MHH A;  1KCY A;  3HCM A;  3SJS A;  2CXJ A;  2DOQ A;  4MN0 A;  1IQ3 A;  2PRU A;  2BCB A;  3RM1 A;  3I5H C;  1RRO A;  2M1K B;  3O6B A;  2QEH A;  1L2O B;  2Y1N A;  3NSI A;  2KHN A;  1RK9 A;  1RWY A;  1K90 D;  1IRJ A;  1Y1U A;  1OMR A;  1XFU O;  2NZ0 A;  1Q80 A;  2PVB A;  1PRW A;  3I5F B;  1BJF A;  2WCL A;  1S6I A;  1FF1 A;  1JSA A;  5D7F A;  2KOT A;  4N5X A;  1BG1 A;  2M3W A;  1QWV A;  2HQW A;  1K8U A;  4GAO A;  3D10 A;  2HPS A;  3PAL A;  2KFF A;  3VRO A;  1CKK A;  2K2A A;  2NCO A;  3V2L A;  4E68 A;  3R72 A;  3I5I C;  1YUS A;  1EJ3 A;  3CWG A;  3I5H B;  5KSZ A;  5DKR A;  3EVR A;  1T14 A;  5I2L A;  1C7V A;  1YRU B;  4I5L B;  2BE6 A;  1B8C A;  1ORG A;  3S0B A;  1SL8 A;  2WCF A;  3JVT C;  4XYN A;  1CDN A;  3LL8 B;  3DYE A;  3NSK A;  1J7Q A;  1MF8 B;  2LLS A;  1KQM C;  2JOJ A;  3L4L A;  1XO5 A;  2H8V A;  1JC2 A;  3FWC A;  3OBV A;  1D1O A;  2NLN A;  3PN7 C;  3LLE A;  4INW A;  3PJI A;  3EK7 A;  5HLO A;  1TTX A;  2ZN9 A;  1SCM C;  1UWO A;  4BY4 A;  4JKT A;  1CFD A;  2BEC A;  3I5I B;  1GGZ A;  1NX1 A;  1RJV A;  4PE1 A;  2MA2 A;  2CNP A;  3BUX B;  1UP5 A;  2QEV A;  5J3X A;  5HKY A;  1MHO A;  1WRK A;  1A29 A;  2P71 A;  1TWO A;  4OCI A;  1SY9 A;  2MLE C;  1MXE A;  3JVT B;  5HKW A;  2LP3 A;  1PK0 D;  3ZWH A;  1J1D A;  1F4Q A;  1MUX A;  3B6X A;  5DKN A;  1KQM B;  1JWD A;  2GGM A;  4C0L A;  1SKT A;  1YVH A;  3PN7 B;  2JTZ A;  1SCM B;  4HSZ A;  1WRZ A;  2KAV A;  3SG4 A;  3TS5 C;  2JT3 A;  1KQV A;  4YI8 A;  1B47 A;  1WLZ A;  2BL0 C;  2BKH B;  3FWB A;  2ZKM X;  1JF0 A;  3IQQ A;  2K7C A;  5K89 A;  4GNK B;  1TUJ A;  2KQ6 A;  4YGD B;  4IJ7 A;  4CFR A;  2FCD A;  4GPL B;  1HQV A;  1KSO A;  2EC6 C;  2OTG C;  2WOR A;  1SPY A;  1TNX A;  2KSP A;  1XFY O;  2KGR A;  3VRP A;  2JU0 A;  2K7B A;  2LLT A;  3GK1 A;  2BCA A;  3VRR A;  4WQ2 A;  2BKI B;  2NXQ A;  1KFU L;  2PYQ A;  4Q04 A;  1X02 A;  2AUC A;  1G33 A;  3OGN A;  2JRF A;  1BR1 B;  4DIR A;  4YBH B;  2BL0 B;  4KYN A;  4DUQ A;  1N65 A;  1UUR A;  2JZI A;  3FS7 A;  3WNX B;  5HYD A;  3FE9 A;  1B4C A;  5FYX A;  1EG4 A;  3CDN A;  1QX5 B;  2M9G A;  5CSJ A;  2OTG B;  3M0W A;  3CZ1 A;  2K2F A;  1IWQ A;  2LHI A;  1OOF A;  2EHB A;  3PAT A;  1YX8 A;  3SG3 A;  4OVN F;  5FI2 A;  1U5I A;  1CM4 A;  3NXA A;  3SIB A;  1AHR A;  4DS7 A;  3A4U B;  2WCE A;  2M29 A;  3VB1 A;  1DF0 A;  3BYA A;  5HL1 A;  2GV5 A;  1SCV A;  1KFX L;  1JBA A;  4F0Z B;  5I8N A;  3O2P A;  2R2I A;  1DTL A;  2K0J A;  3CLN A;  2I7A A;  1K2H A;  2KI6 C;  3DF0 B;  3DVJ A;  1K95 A;  3R1V A;  4L9M A;  1G8I A;  3WHT B;  3DZT A;  3KO0 A;  4U8D A;  2L5Y A;  1NP8 A;  2FJU B;  3E3R A;  1S5G Z;  1J1E A;  4MVF A;  2MRD A;  2IS9 A;  1IIO A;  3PM8 A;  1TN4 A;  2H61 A;  3EVV A;  4A4C A;  1G4Y R;  3WHU B;  1LA3 A;  3O4X A;  1CNP A;  3GOF A;  4ORC B;  1NX3 A;  5JJG A;  2P70 A;  3DVM A;  1EL4 A;  2WC6 A;  2TN4 A;  3BJH A;  2LP2 A;  1QS7 A;  5DIC A;  1TOP A;  1NYA A;  4PE4 A;  3MSE B;  2KBI A;  4HRG A;  2F3Y A;  1CMG A;  1CLL A;  1XFR A;  2JXL A;  2L4H A;  1TIZ A;  4PHM A;  2JT8 A;  3LK0 A;  3NGV A;  2PQL A;  3WXA A;  3CZ0 A;  1OQP A;  2ZFD A;  1QVI Y;  3BOW A;  3DXL A;  3IVT A;  1S6C A;  3NHI A;  1SW8 A;  2L51 A;  3TDZ A;  1QIW A;  4JD9 A;  1K96 A;  1GGW A;  2F2P A;  4YRU A;  1LVC D;  4GGF C;  1DEK A;  1DJZ A;  5DKQ A;  1YRT B;  2QPT A;  2HET A;  2PAS A;  2Q4U A;  1B1G A;  2KQY A;  2MJW B;  4M2Q A;  2F33 A;  5AAN A;  4TNC A;  2I94 A;  1OOG A;  5I94 A;  2KNE A;  2PMY A;  1DF0 B;  4PE0 A;  1DVI A;  3ZNI A;  4QJ5 B;  2OPO A;  3BFH A;  1CM1 A;  2G2B A;  3OX6 A;  2K7O A;  1ALW A;  1F70 A;  1XK4 A;  1DJH A;  4A4B A;  2QDI A;  2KFH A;  1OOI X;  2LHL A;  1K9K A;  4DCK A;  1QLK A;  4GBA A;  3D0Y A;  5FI7 A;  1BOD A;  3F45 A;  4GUK A;  3S0E A;  3UNW A;  1DJG A;  4HRH A;  2LVV A;  4ZCU A;  1YUU A;  2LVJ A;  3JTD C;  1CFC A;  3BQ3 A;  3I5G C;  3GK2 A;  4HRE E;  1ZMZ A;  1VRK A;  1DGU A;  3OB1 B;  3BXK A;  5KU1 A;  1F71 A;  5FI6 A;  2JQ6 A;  2LCP A;  1V1F A;  1E8A A;  4MRY A;  2LMU A;  4GFT A;  1XFZ O;  5EL2 A;  5B8I B;  3R1O A;  1KK7 Y;  4YI9 A;  3D73 A;  5AER A;  1M45 A;  5IBW A;  2JNX A;  1BF5 A;  1CDL A;  1S5G Y;  1QTX A;  2LVI A;  3IF7 A;  3L47 A;  1UHN A;  1Y1X A;  4DRW A;  2WND A;  2K60 A;  2P6B B;  3EG5 B;  3KF9 A;  1AK8 A;  3JTD B;  4OKH A;  1ALV A;  1CTR A;  2PAL A;  3SS5 A;  3TDI A;  1TRF A;  3I5G B;  2GTE A;  2KLE A;  1CFF A;  1IJ5 A;  2LVK A;  1A75 A;  2KBM A;  4QJ3 B;  3NHT A;  5AXI A;  1YR5 A;  4IL1 A;  2ZRS A;  1W7I B;  4MBE A;  4ORB B;  3FE6 A;  3S0G A;  1WRL A;  1TNW A;  1QVI Z;  1SMG A;  1LS8 A;  4NDC A;  2AAO A;  3D75 A;  3VRQ A;  4AQI A;  1LIN A;  1PSB A;  4PT1 A;  1ZUZ A;  4GGN A;  2CT9 A;  2SCP A;  1SNL A;  2HF5 A;  2L98 A;  2JXC A;  3R1P A;  4JPZ B;  1ZOT B;  1K93 D;  1GM0 A;  4PE7 A;  4XJK A;  2L50 A;  3DVE A;  4FQO A;  5AEQ A;  3B87 A;  5HKZ A;  1XFV O;  3KPX A;  1P28 A;  3OX5 A;  1M46 A;  3PM2 A;  3PFV A;  5KTY A;  5I2O A;  4PAL A;  2L5X B;  3DY9 A;  1R6P A;  2M49 B;  2YGU A;  1OSA A;  1CB1 A;  5CPV A;  2HQ8 A;  1R2U A;  3D0Y B;  3TUY C;  1RTP 1;  2Y1M A;  1UHH A;  3BUN B;  1UUS A;  1FI5 A;  1SK6 D;  2SAS A;  2LAN A;  2Y4Q A;  1NWD A;  1N0Y A;  2I2R E;  1IGV A;  1DC1 A;  4INX A;  1IH0 A;  2ZRT A;  3S0D A;  3CZT X;  3PLF B;  2VRG A;  1F55 A;  3ICB A;  1M63 B;  3D76 A;  3OP0 A;  1LXF C;  2WC8 A;  1GQM A;  1J7O A;  1SRA A;  1QIV A;  4MZL A;  3CTN A;  5CSF A;  3KHE A;  3RLZ A;  1C3Z A;  1KK7 Z;  2B1U A;  1QV1 A;  2JUL A;  4MEW A;  1CFP A;  4C0J A;  4UPG A;  2K7D A;  4P5O E;  1ZAC A;  1KK8 C;  1LKJ A;  3LK1 A;  1PVA A;  3VRN A;  1SL7 A;  3B88 A;  3TUY B;  1F4O A;  2JTT A;  2BBM A;  1DJX A;  1EH2 A;  1CMF A;  1KWO C;  3BFB A;  5HLV A;  3D77 A;  1S6J A;  1Y1A A;  1QLS A;  1W9Z A;  2LE9 B;  4YGB B;  2CTN A;  1JF2 A;  2LM5 A;  2ZN8 A;  1DMO A;  3QME A;  1IKU A;  1KFU S;  1H8B A;  4P2Y B;  3B7A A;  1KSM A;  4M2P A;  3CR2 A;  4YGA A;  4MLW A;  1FBV A;  1QAT A;  4AQJ A;  5TNC A;  2CBL A;  1OMV A;  1S26 D;  1LA0 A;  5F6T A;  3A8R A;  3AKA A;  3IQO A;  1KK8 B;  2M7N A;  2QEB A;  1C3Y A;  1SL9 A;  3HX4 A;  2KI4 C;  1B7T Z;  1BT6 A;  2BE4 A;  2M97 A;  4PHJ A;  1IQ5 A;  3BUW B;  2LLU A;  2ISD A;  1W7J B;  1WY9 A;  2LC5 A;  3GK4 X;  4PCW A;  1KWO B;  2MBX A;  4CPV A;  1B8L A;  2LUC A;  1NX2 A;  4N1F A;  5I2Q A;  1F54 A;  1B9A A;  1OMD A;  1XA5 A;  1NCX A;  1NCZ A;  1TUZ A;  4I5N B;  2WCH A;  1GJY A;  2FCE A;  2JNF A;  2KYF A;  4NQG A;  2KFG A;  4ICB A;  2LMT A;  5JOL A;  3TZ1 A;  4CFQ A;  1KFX S;  1BOC A;  1U5I B;  2QEO A;  1TCF A;  2H61 C;  2LUX A;  2Q91 A;  1MQ1 A;  2ERB A;  2WCM A;  2LNK A;  1DJY A;  5CSI A;  2KYC A;  3DVK A;  1DEL A;  3CS1 A;  3NSO A;  2M1U A;  1J55 A;  4I5K A;  2G9B A;  1HT9 A;  3BUM B;  2KI4 B;  1SYM A;  1DJW A;  3VGO A;  1TNP A;  1EXR A;  2F3Z A;  4I5J A;  3S0F A;  2LV7 A;  2WCJ A;  2M7L A;  2F8P A;  1UHI A;  1A03 A;  4YGE B;  2BCX A;  1NPQ A;  2AMI A;  3RZS A;  1PUL A;  2A4J A;  1OOJ A;  3S0A A;  1EG3 A;  1L7Z A;  2MLF C;  1BR4 B;  4OV2 A;  2KLD A;  1DJI A;  3DD4 A;  4FQT A;  2PSR A;  1SR6 C;  2GGZ A;  3EVU A;  1CDM A;  2KAX A;  1K9U A;  2COL B;  2ZNE A;  1IG5 A;  2LAP A;  4USL A;  3FIA A;  1XVJ A;  5G08 A;  1SBJ A;  5D3O A;  2D8N A;  1QX2 A;  4FTG A;  3H4S E;  3SS3 A;  2QAC A;  1K94 A;  4MSP A;  4MZK A;  4ETO A;  1PSR A;  3CR4 X;  1TCO B;  1AUI B;  1Y0V H;  5D69 A;  3AAK A;  1V1G A;  4NDB A;  1UHJ A;  3QRX A;  1A2X A;  3BUO B;  4M2O A;  1SSE B;  1YUR A;  4PHK A;  2WCK A;  1QX7 A;  2E6W A;  1BLQ A;  1XK4 C;  4OZD A;  4YGC B;  2L0P A;  3BOW B;  1SR6 B;  2KDH A;  1M31 A;  1YX7 A;  5GQQ C;  3EKJ A;  2L2C A;  3LCP C;  4ORA B;  1XFX O;  1YUT A;  1AJ5 A;  3CGA A;  1OZO A;  3DF0 A;  1C7W A;  1WDC C;  1K9P A;  2KI6 D;  1OW4 A;  3SG5 A;  5PAL A;  3SG7 A;  2H2K A;  1H4B A;  1NX0 A;  1S3P A;  2WOS A;  1B7T Y;  2NCP A;  2K8M B;  1AVS A;  2ZND A;  1MXL C;  1DT7 B;  2OS8 C;  1CLM A;  1Z4H A;  1OZS A;  2Y5I A;  1XYD A;  4BY5 A;  1IJ6 A;  2JC2 A;  4JWQ A;  1QAS A;  4D1E A;  1MR8 A;  3EKH A;  3CR5 X;  3K21 A;  4PDZ A;  1QV0 A;  2BAP A;  4AOM A;  1NCY A;  2L4I A;  1AP4 A;  1JUO A;  2RGI A;  3PSR A;  4WRI A;  1DGV A;  1ZFS A;  2JPO A;  3CAB A;  1AJ4 A;  2I18 A;  2JT0 A;  2O60 A;  5ER5 A;  1WDC B;  3B86 A;  2BBN A;  1RFJ A;  4R1E A;  2FJY A;  3D78 A;  3AKB A;  1MWN A;  3TS5 B;  5BPJ A;  1J7R A;  2JWW A;  2OS8 B;  4N1G A;  4PHN A;  1FI6 A;  1CDP A;  3KEV A;  4WQ3 A;  1TNQ A;  5ER4 X;  1UHK A;  1B8R A;  1NIW A;  1CLB A;  4MRX A;  1F8H A;  4CLN A;  2E30 A;  2EC6 B;  2JPT A;  3BFA A;  3SIA A;  2L2E A;  1Y6W A;  2V53 A;  3O78 A;  1N2D A;  3AAJ A;  4MZJ A;  3EK8 A;  2LMV A;  3SG2 A;  1JFJ A;  3L4A A;  4NDD A;  1YVL A;  1YTZ C;  1NSH A;  3CZ2 A;  3OHM B;  2K61 A;  2F2O A;  4QJ4 B;  2KGB C;  2CCM A;  3CYZ A;  1BMO A;  3O4Y A;  1A75 B;  5AFP A;  1FW4 A;  1XFW O;  3SG6 A;  1QXP A;  3TDU A;  1QJT A;  1C07 A;  2FOT A;  1OE9 B;  1A4P A;  2KPH A;  2WC5 A;  2WCB A;  2KAY A;  3FE8 A;  1S36 A;  3SS4 A;  3K1E A;  4OR9 B;  5CSN A;  1L2O C; 
#chains in the Genus database with same CATH homology
 1JFK A;  2EGD A;  1BU3 A;  3I5F C;  2M0R A;  1ODB A;  4JQ0 D;  4XJK B;  4CID A;  4C0K A;  4ZCV A;  3C1V A;  4GGF A;  1NUB A;  1REC A;  1M39 A;  2M8U A;  2O5G A;  3OB2 B;  1S1E A;  3EK4 A;  3NSL A;  1WLM A;  1FPW A;  1J7P A;  1PVB A;  2MAZ A;  1PAL A;  2MHH A;  1KCY A;  3HCM A;  3SJS A;  2CXJ A;  2DOQ A;  4MN0 A;  1IQ3 A;  2PRU A;  2BCB A;  3RM1 A;  3I5H C;  1RRO A;  2M1K B;  3O6B A;  1L2O B;  2Y1N A;  3NSI A;  2KHN A;  1RK9 A;  1RWY A;  1K90 D;  1IRJ A;  1Y1U A;  1OMR A;  1XFU O;  2NZ0 A;  1Q80 A;  2PVB A;  1PRW A;  3I5F B;  1BJF A;  1S6I A;  1FF1 A;  1JSA A;  5D7F A;  2KOT A;  4N5X A;  1BG1 A;  2M3W A;  2HQW A;  1K8U A;  4GAO A;  3D10 A;  2HPS A;  3PAL A;  2KFF A;  3VRO A;  1CKK A;  2K2A A;  2NCO A;  4E68 A;  3I5I C;  1YUS A;  1EJ3 A;  3CWG A;  3I5H B;  5KSZ A;  5DKR A;  3EVR A;  5I2L A;  1C7V A;  1YRU B;  4I5L B;  2BE6 A;  1B8C A;  1SL8 A;  2WCF A;  3JVT C;  4XYN A;  1CDN A;  3LL8 B;  3NSK A;  1J7Q A;  1MF8 B;  2LLS A;  1KQM C;  2JOJ A;  1XO5 A;  1JC2 A;  3FWC A;  1D1O A;  2NLN A;  3PN7 C;  3LLE A;  5HLO A;  3EK7 A;  1TTX A;  2ZN9 A;  1SCM C;  1UWO A;  4BY4 A;  1CFD A;  2BEC A;  3I5I B;  1GGZ A;  1NX1 A;  1RJV A;  4PE1 A;  2MA2 A;  2CNP A;  3BUX B;  1UP5 A;  5HKY A;  5J3X A;  1MHO A;  1WRK A;  1A29 A;  4OCI A;  1SY9 A;  2MLE C;  1MXE A;  3JVT B;  5HKW A;  2LP3 A;  1PK0 D;  3ZWH A;  1J1D A;  1F4Q A;  1MUX A;  5DKN A;  1KQM B;  1JWD A;  2GGM A;  4C0L A;  1SKT A;  1YVH A;  3PN7 B;  2JTZ A;  1SCM B;  4HSZ A;  1WRZ A;  2KAV A;  3SG4 A;  3TS5 C;  2JT3 A;  1KQV A;  4YI8 A;  1B47 A;  1WLZ A;  2BL0 C;  2BKH B;  3FWB A;  2ZKM X;  1JF0 A;  3IQQ A;  2K7C A;  5K89 A;  4GNK B;  2KQ6 A;  4YGD B;  4CFR A;  2FCD A;  4GPL B;  1HQV A;  1KSO A;  2EC6 C;  2OTG C;  2WOR A;  1SPY A;  1TNX A;  2KSP A;  1XFY O;  2KGR A;  3VRP A;  2JU0 A;  2K7B A;  2LLT A;  3GK1 A;  2BCA A;  3VRR A;  4WQ2 A;  2BKI B;  2NXQ A;  1KFU L;  4Q04 A;  1X02 A;  2AUC A;  1G33 A;  2JRF A;  1BR1 B;  4DIR A;  4YBH B;  2BL0 B;  4DUQ A;  1N65 A;  1UUR A;  2JZI A;  3FS7 A;  3WNX B;  5HYD A;  1B4C A;  5FYX A;  1EG4 A;  1QX5 B;  2M9G A;  5CSJ A;  2OTG B;  3M0W A;  2K2F A;  1IWQ A;  2LHI A;  3PAT A;  2EHB A;  1YX8 A;  3SG3 A;  4OVN F;  1U5I A;  1CM4 A;  3NXA A;  3SIB A;  1AHR A;  4DS7 A;  3A4U B;  2WCE A;  2M29 A;  1DF0 A;  3BYA A;  2GV5 A;  1SCV A;  1KFX L;  1JBA A;  4F0Z B;  5I8N A;  3O2P A;  2R2I A;  1DTL A;  2K0J A;  3CLN A;  2I7A A;  1K2H A;  2KI6 C;  3DF0 B;  3DVJ A;  1K95 A;  4L9M A;  1G8I A;  3WHT B;  3KO0 A;  4U8D A;  1NP8 A;  2FJU B;  3E3R A;  1S5G Z;  1J1E A;  4MVF A;  2MRD A;  2IS9 A;  3PM8 A;  1TN4 A;  2H61 A;  3EVV A;  4A4C A;  1G4Y R;  3WHU B;  1LA3 A;  1CNP A;  3GOF A;  4ORC B;  1NX3 A;  5JJG A;  3DVM A;  1EL4 A;  2TN4 A;  2LP2 A;  1QS7 A;  1TOP A;  1NYA A;  4PE4 A;  3MSE B;  2KBI A;  4HRG A;  2F3Y A;  1CMG A;  1CLL A;  2JXL A;  2L4H A;  1TIZ A;  4PHM A;  2JT8 A;  3LK0 A;  3WXA A;  1OQP A;  2ZFD A;  1QVI Y;  3BOW A;  1S6C A;  1SW8 A;  2L51 A;  3TDZ A;  1QIW A;  1GGW A;  1K96 A;  2F2P A;  4YRU A;  1LVC D;  4GGF C;  1DJZ A;  5DKQ A;  1YRT B;  2QPT A;  2HET A;  2PAS A;  2Q4U A;  1B1G A;  2KQY A;  2MJW B;  4M2Q A;  2F33 A;  5AAN A;  4TNC A;  2I94 A;  2KNE A;  2PMY A;  1DF0 B;  4PE0 A;  1DVI A;  3ZNI A;  4QJ5 B;  2OPO A;  1CM1 A;  2G2B A;  3OX6 A;  2K7O A;  1ALW A;  1F70 A;  1XK4 A;  1DJH A;  4A4B A;  2KFH A;  2LHL A;  1K9K A;  4DCK A;  1QLK A;  4GBA A;  3D0Y A;  1BOD A;  3F45 A;  4GUK A;  1DJG A;  4HRH A;  2LVV A;  4ZCU A;  1YUU A;  2LVJ A;  3JTD C;  1CFC A;  3BQ3 A;  3I5G C;  3GK2 A;  4HRE E;  1ZMZ A;  1VRK A;  1DGU A;  3OB1 B;  3BXK A;  5KU1 A;  1F71 A;  2JQ6 A;  2LCP A;  1V1F A;  1E8A A;  4MRY A;  2LMU A;  4GFT A;  1XFZ O;  5B8I B;  1KK7 Y;  4YI9 A;  5AER A;  1M45 A;  5IBW A;  2JNX A;  1BF5 A;  1CDL A;  1S5G Y;  1QTX A;  2LVI A;  3IF7 A;  1UHN A;  1Y1X A;  4DRW A;  2WND A;  1AK8 A;  2P6B B;  3KF9 A;  3JTD B;  4OKH A;  1ALV A;  1CTR A;  2PAL A;  3TDI A;  1TRF A;  3I5G B;  1CFF A;  1IJ5 A;  2LVK A;  1A75 A;  2KBM A;  4QJ3 B;  5AXI A;  1YR5 A;  4IL1 A;  2ZRS A;  1W7I B;  4MBE A;  4ORB B;  1WRL A;  1TNW A;  1QVI Z;  1SMG A;  4NDC A;  4AQI A;  2AAO A;  3VRQ A;  1LIN A;  1PSB A;  1ZUZ A;  4GGN A;  2CT9 A;  2SCP A;  1SNL A;  2HF5 A;  2L98 A;  2JXC A;  4JPZ B;  1ZOT B;  1K93 D;  4PE7 A;  4XJK A;  2L50 A;  3DVE A;  4FQO A;  5AEQ A;  5HKZ A;  1XFV O;  3KPX A;  3OX5 A;  1M46 A;  3PFV A;  5KTY A;  5I2O A;  4PAL A;  2L5X B;  1R6P A;  2M49 B;  1OSA A;  1CB1 A;  5CPV A;  2HQ8 A;  1R2U A;  3D0Y B;  3TUY C;  1RTP 1;  2Y1M A;  1UHH A;  3BUN B;  1UUS A;  1FI5 A;  1SK6 D;  2SAS A;  2LAN A;  2Y4Q A;  1NWD A;  1N0Y A;  2I2R E;  1IGV A;  1IH0 A;  2ZRT A;  3CZT X;  3PLF B;  2VRG A;  1F55 A;  3ICB A;  1M63 B;  3OP0 A;  1LXF C;  2WC8 A;  1GQM A;  1J7O A;  1SRA A;  1QIV A;  4MZL A;  3CTN A;  5CSF A;  3KHE A;  3RLZ A;  1KK7 Z;  2B1U A;  1QV1 A;  2JUL A;  4MEW A;  1CFP A;  4C0J A;  4UPG A;  2K7D A;  4P5O E;  1ZAC A;  1KK8 C;  1LKJ A;  3LK1 A;  1PVA A;  3VRN A;  1SL7 A;  3TUY B;  1F4O A;  2JTT A;  2BBM A;  1DJX A;  1EH2 A;  1CMF A;  1KWO C;  5HLV A;  1S6J A;  1Y1A A;  1QLS A;  2LE9 B;  4YGB B;  2CTN A;  1JF2 A;  2LM5 A;  2ZN8 A;  1DMO A;  1H8B A;  1IKU A;  1KFU S;  4P2Y B;  1KSM A;  4M2P A;  3CR2 A;  4YGA A;  4MLW A;  1FBV A;  1QAT A;  4AQJ A;  5TNC A;  2CBL A;  1OMV A;  1S26 D;  1LA0 A;  5F6T A;  3A8R A;  3AKA A;  3IQO A;  1KK8 B;  2M7N A;  1SL9 A;  3HX4 A;  2KI4 C;  1B7T Z;  1BT6 A;  2BE4 A;  2M97 A;  4PHJ A;  1IQ5 A;  3BUW B;  2LLU A;  2ISD A;  1W7J B;  1WY9 A;  2LC5 A;  3GK4 X;  4PCW A;  1KWO B;  2MBX A;  4CPV A;  1B8L A;  2LUC A;  1NX2 A;  4N1F A;  5I2Q A;  1F54 A;  1B9A A;  1OMD A;  1XA5 A;  1NCX A;  1NCZ A;  4I5N B;  5CSI A;  1BLQ A;  1GJY A;  2FCE A;  2JNF A;  2KYF A;  4NQG A;  2KFG A;  4ICB A;  2LMT A;  5JOL A;  3TZ1 A;  4CFQ A;  1KFX S;  1BOC A;  1U5I B;  1TCF A;  2H61 C;  2LUX A;  2Q91 A;  1MQ1 A;  2LNK A;  1DJY A;  2KYC A;  3DVK A;  3CS1 A;  3NSO A;  2M1U A;  1J55 A;  4I5K A;  2G9B A;  1HT9 A;  3BUM B;  2KI4 B;  1SYM A;  1DJW A;  3VGO A;  1TNP A;  1EXR A;  2F3Z A;  4I5J A;  2LV7 A;  2M7L A;  2F8P A;  1UHI A;  1A03 A;  4YGE B;  2BCX A;  1NPQ A;  2AMI A;  1PUL A;  2A4J A;  1OOJ A;  1EG3 A;  1L7Z A;  2MLF C;  1BR4 B;  4OV2 A;  3DD4 A;  1DJI A;  2PSR A;  1SR6 C;  2GGZ A;  3EVU A;  1CDM A;  2KAX A;  1K9U A;  2COL B;  2ZNE A;  1IG5 A;  2LAP A;  4USL A;  3FIA A;  1XVJ A;  5G08 A;  1SBJ A;  2D8N A;  1QX2 A;  4FTG A;  3H4S E;  2QAC A;  1K94 A;  4MSP A;  4MZK A;  4ETO A;  1PSR A;  3CR4 X;  1TCO B;  1AUI B;  1Y0V H;  5D69 A;  3AAK A;  1V1G A;  4NDB A;  1UHJ A;  3QRX A;  1A2X A;  3BUO B;  4M2O A;  1YUR A;  4PHK A;  1QX7 A;  2E6W A;  1XK4 C;  4YGC B;  2L0P A;  3BOW B;  1SR6 B;  2KDH A;  1M31 A;  1YX7 A;  5GQQ C;  3EKJ A;  4ORA B;  3LCP C;  1XFX O;  1YUT A;  1AJ5 A;  3CGA A;  1OZO A;  3DF0 A;  1C7W A;  1WDC C;  1K9P A;  2KI6 D;  3SG5 A;  5PAL A;  3SG7 A;  2H2K A;  1H4B A;  1NX0 A;  1S3P A;  2WOS A;  1B7T Y;  2NCP A;  2K8M B;  1AVS A;  2ZND A;  1MXL C;  1DT7 B;  2OS8 C;  1CLM A;  4BY5 A;  1OZS A;  2Y5I A;  1XYD A;  1IJ6 A;  2JC2 A;  4JWQ A;  1QAS A;  4D1E A;  1MR8 A;  3EKH A;  3CR5 X;  3K21 A;  4PDZ A;  1QV0 A;  4AOM A;  1NCY A;  2L4I A;  1AP4 A;  1JUO A;  2RGI A;  3PSR A;  4WRI A;  1DGV A;  1ZFS A;  1AJ4 A;  2I18 A;  2JT0 A;  2O60 A;  5ER5 A;  1WDC B;  2BBN A;  1RFJ A;  4R1E A;  3AKB A;  1MWN A;  3TS5 B;  5BPJ A;  1J7R A;  2JWW A;  2OS8 B;  4N1G A;  4PHN A;  1FI6 A;  1CDP A;  3KEV A;  4WQ3 A;  1TNQ A;  5ER4 X;  1UHK A;  1B8R A;  1NIW A;  1CLB A;  4MRX A;  1F8H A;  4CLN A;  2E30 A;  2EC6 B;  2JPT A;  3SIA A;  2L2E A;  1Y6W A;  2V53 A;  3O78 A;  1N2D A;  3AAJ A;  4MZJ A;  3EK8 A;  2LMV A;  3SG2 A;  1JFJ A;  4NDD A;  1YVL A;  1YTZ C;  1NSH A;  3OHM B;  2K61 A;  2F2O A;  4QJ4 B;  2KGB C;  2CCM A;  1BMO A;  3O4Y A;  1A75 B;  5AFP A;  1FW4 A;  1XFW O;  3SG6 A;  1QXP A;  3TDU A;  1QJT A;  1C07 A;  2FOT A;  1OE9 B;  1A4P A;  2WCB A;  2KAY A;  1S36 A;  4OR9 B;  5CSN A;  1L2O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...