2JPTA

Structural changes induced in apo-s100a1 protein by the disulphide formation between its cys85 residue and b-mercaptoethanol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDEDGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Structural and motional changes induced in apo-S100A1 protein by the disulfide formation between its Cys 85 residue and beta-mercaptoethanol
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jptA00
1KFUS 1CM4A 2WORA 3A8RA 1CFDA 3I5HC 3VRPA 4YI8A 1XA5A 1LA3A 1WDCB 1YVLA 3LLEA 2JQ6A 2JPTA 2LHLA 1AJ4A 1PSRA 1K9PA 2HQ8A 2M97A 5CPVA 4M2PA 1OZSA 4N1FA 1S6JA 5I8NA 2H61C 4TNCA 1JBAA 3EKJA 1DJGA 2KAXA 3KO0A 1E8AA 2LHIA 1ODBA 4MBEA 4L9MA 1JWDA 4UPGA 1ZFSA 1IG5A 5G08A 3EVUA 3QRXA 5HKZA 1XFZO 5JJGA 1SCMB 5DKQA 2PSRA 1QJTA 3M0WA 2KNEA 1SW8A 1WRLA 3DVKA 2JT8A 4FTGA 5CSIA 3CWGA 1AHRA 2OTGB 1OSAA 1GGWA 1QASA 5D7FA 3SJSA 1PVAA 1V1FA 1QX7A 2LMTA 2M7LA 2KBMA 1FI5A 2WCEA 1BF5A 1NPQA 2ZN8A 2K2FA 4NQGA 1OMVA 1CTRA 1J7RA 2CTNA 4P2YB 1TRFA 4CLNA 1OMDA 3EVRA 1EH2A 1JFJA 4C0KA 2LE9B 2V53A 4DUQA 1HT9A 3CTNA 3TS5B 4YGCB 2BCAA 1RECA 1J1EA 1K93D 2FCEA 1M46A 3IQQA 1AK8A 4Q04A 2KHNA 2LMVA 1NWDA 3LCPC 3O4YA 2I94A 3OX5A 1CKKA 1OQPA 1Y1XA 1KWOB 2LLUA 2CCMA 2Y5IA 1WDCC 2JU0A 1UURA 2LMUA 3JVTB 1WLMA 4OCIA 1IWQA 1DJYA 3VRRA 2KOTA 1BJFA 1K9UA 5GQQC 1DF0B 1XVJA 5ER4X 1CFCA 1DTLA 3JTDB 4P5OE 1SCVA 1JC2A 1AJ5A 2LV7A 2KFGA 1HQVA 4N5XA 3NSKA 4GAOA 5HKYA 1YRTB 2KI6D 4PE7A 1A4PA 5CSFA 4PHMA 5KSZA 1EG4A 1IQ3A 1DJWA 5ER5A 1S6IA 1G33A 1LINA 2K7DA 2LAPA 1SCMC 2F8PA 3BXKA 4DS7A 4QJ5B 1KFXS 4HREE 1DJHA 1KSMA 1EJ3A 1BLQA 1NCZA 1NCYA 4MVFA 1S26D 3PALA 2OTGC 3AAKA 2ZRTA 3MSEB 1BODA 1FF1A 1PSBA 3IQOA 1U5IA 1SKTA 3BQ3A 4GUKA 2JT0A 2JTZA 2MLEC 2OS8C 2WC8A 4PHJA 1A03A 2K7CA 1SPYA 1OOJA 2L51A 4XJKA 4GPLB 1Y1AA 3FWBA 4A4BA 1CNPA 3TS5C 5DKRA 1WLZA 3HX4A 4M2OA 1VRKA 2MLFC 3DD4A 5AFPA 1CLBA 4WQ3A 2O60A 1OE9B 2MAZA 1KWOC 2ZRSA 1MR8A 2ZNDA 1EG3A 1DJXA 1X02A 1TIZA 1B9AA 3JVTC 2CT9A 1NSHA 1ZUZA 3WXAA 1IJ5A 3KEVA 1C07A 4GFTA 2Y1NA 2JXLA 2RGIA 4USLA 2BCBA 1CMFA 2OPOA 1UHNA 2ZKMX 4OR9B 2JNFA 3FS7A 3JTDC 1G4YR 4YGDB 3GOFA 5AEQA 2BKHB 4CIDA 2I2RE 5HKWA 2M29A 1M39A 1WRKA 4U8DA 1YURA 1B7TY 2CBLA 4PALA 4AQJA 1F4QA 1LA0A 4PE0A 2HQWA 3OHMB 3TDIA 1CMGA 3SIAA 4ICBA 4R1EA 2NXQA 2GGZA 5JOLA 2HF5A 1IJ6A 1SL9A 3SG5A 3D0YB 3LK1A 1K2HA 1RWYA 4PE4A 4PHNA 5CSNA 2KBIA 4C0LA 2MRDA 1JFKA 3NXAA 3PN7B 1Y6WA 4CFQA 2LVKA 1QX2A 2MA2A 1PULA 3SG2A 1EL4A 2I7AA 2CXJA 4GGFC 1YX7A 3I5IB 4F0ZB 2M0RA 4ORCB 4I5LB 1CM1A 2MHHA 4PHKA 5KTYA 3PM8A 1TNXA 3AKAA 1QVIY 1NUBA 1NX2A 3SG4A 1MF8B 5HLOA 4JPZB 1N2DA 1NX3A 1NCXA 3BUOB 2L50A 3NSLA 3SG6A 1EXRA 2COLB 1K9KA 5I2OA 1JF2A 3SG7A 3K21A 1H4BA 5AERA 3WHTB 3BUWB 1ALVA 3CGAA 1H8BA 1KK7Z 4YGAA 2JRFA 1NX1A 1Y1UA 2EHBA 2NCPA 1B1GA 2JT3A 3PLFB 1N65A 2KI4B 3DF0B 4MRXA 3VRNA 2LM5A 3F45A 1K8UA 1GGZA 1V1GA 1QIWA 1FBVA 2LLSA 4MZKA 2KYCA 3GK1A 3VGOA 1CFPA 3AKBA 1NP8A 1SL7A 2BBMA 1RK9A 2WOSA 3DVJA 5TNCA 1S36A 2KDHA 2AUCA 4YRUA 1DVIA 4GNKB 3OX6A 2MBXA 1C7WA 3GK4X 4HSZA 2K8MB 3EK8A 3NSIA 3NSOA 4NDBA 2FCDA 1MUXA 1XYDA 1B7TZ 1BT6A 1K95A 4MEWA 3PN7C 1NIWA 1KQMB 2M1KB 2E6WA 3C1VA 1CDNA 1PVBA 1CDPA 1AVSA 1WY9A 1YUUA 1TTXA 2GGMA 1DF0A 3WNXB 2K0JA 2M3WA 1TCOB 4I5NB 4FQOA 3CLNA 3LL8B 5I2QA 4M2QA 2KFHA 2JTTA 1XK4C 1J1DA 3I5GB 2TN4A 3OB1B 3AAJA 4AQIA 4DIRA 4DRWA 5K89A 1AUIB 1S1EA 1SY9A 1J55A 1XFWO 1W7IB 2F33A 2LANA 2LC5A 2M9GA 5AXIA 1IH0A 1A75B 1MWNA 4OKHA 1J7PA 2M1UA 1QS7A 1KQVA 3D10A 1XFYO 3FWCA 1KK8B 4ZCUA 3A4UB 3TUYB 2L0PA 1QVIZ 2EC6B 2M49B 3BOWB 1ZMZA 2LNKA 2KI4C 2Q4UA 1U5IB 2EGDA 3OP0A 3CS1A 5PALA 2FJUB 3O78A 1NYAA 2H61A 1YVHA 2P6BB 2R2IA 4XJKB 5J3XA 2WNDA 2PRUA 3FIAA 3IF7A 4GBAA 1KK7Y 4ORBB 1BG1A 1YX8A 2QPTA 4BY5A 1FI6A 4GGFA 1S3PA 2LCPA 3EVVA 3H4SE 3EK4A 3O6BA 3PATA 3SG3A 1L2OB 1TNPA 2Y4QA 3BUNB 1MXLC 1B8LA 3SIBA 3ZNIA 1N0YA 4PCWA 2LVJA 1TNQA 2AAOA 1RTP1 4HRGA 2LP3A 3TDZA 3LK0A 2JNXA 1DGUA 3BYAA 1KFUL 3KPXA 1XFUO 1TNWA 3EK7A 1ZACA 4QJ4B 2JZIA 5HYDA 2JOJA 3I5GC 2VRGA 3CZTX 2BE4A 4YI9A 4YGEB 3EKHA 2PMYA 2K7BA 5AANA 4NDCA 1F54A 1QLSA 1QXPA 2CNPA 3GK2A 4I5JA 2LUXA 1YTZC 2KAYA 4IL1A 5HLVA 2KYFA 2ISDA 4OVNF 1SK6D 1DMOA 1UP5A 1KK8C 1RROA 3BUMB 1B4CA 4WRIA 3HCMA 1PALA 3TUYC 2EC6C 1FW4A 1B8RA 2AMIA 2L4HA 3CR4X 4MSPA 2HPSA 1JUOA 1M31A 2H2KA 2BE6A 1K90D 2ZNEA 1F55A 1XFVO 1C7VA 3KF9A 5CSJA 3O2PA 1TOPA 1R2UA 1KCYA 1L2OC 1YRUB 1BOCA 1GQMA 1PK0D 1XK4A 1A2XA 2F2PA 4YGBB 1K96A 1UUSA 2K2AA 2PASA 2KI6C 1CDMA 1AP4A 2SCPA 1S5GY 2BKIB 4D1EA 1UWOA 3OB2B 2DOQA 5F6TA 4ETOA 2Q91A 4PE1A 2L5XB 1Q80A 1QTXA 2KGBC 1CB1A 1BU3A 2LUCA 4BY4A 2L2EA 3CR5X 3DF0A 1L7ZA 2NZ0A 1S6CA 1CDLA 2M7NA 2OS8B 1B47A 2G2BA 1JSAA 2D8NA 1LXFC 1ZOTB 2F3ZA 2ZN9A 2E30A 3ZWHA 1MQ1A 4ORAB 1ALWA 1F8HA 2K7OA 5IBWA 4YBHB 1MXEA 2A4JA 2KQ6A 1F4OA 4A4CA 1QV0A 4HRHA 1TN4A 4WQ2A 4DCKA 2LVVA 1CLLA 1QIVA 1SNLA 3KHEA 4MZLA 1RFJA 1LVCD 3I5IC 3PSRA 1KFXL 3VROA 2L98A 1Y0VH 2BCXA 2KGRA 4QJ3B 4AOMA 2WCFA 2QACA 1BMOA 2LP2A 1K94A 2JXCA 2G9BA 1R6PA 1UHJA 2NCOA 5B8IB 2BL0B 3TZ1A 3PFVA 1SR6B 4MZJA 2LLTA 3CR2A 4JQ0D 1UHHA 2HETA 1DGVA 1M63B 1BR4B 1NX0A 2WCBA 5FYXA 5BPJA 1XFXO 5I2LA 1A75A 2BBNA 3I5FB 1OZOA 3RLZA 5D69A 2IS9A 1KSOA 1TCFA 2M8UA 2B1UA 3I5HB 1QV1A 3BOWA 4ZCVA 1M45A 4MLWA 1A29A 2I18A 1IKUA 1YR5A 2PVBA 1CFFA 4CFRA 1B8CA 1DT7B 3ICBA 1WRZA 1IGVA 1S5GZ 2KQYA 4MRYA 2K61A 2L4IA 5DKNA 4C0JA 1JF0A 2JWWA 2NLNA 2GV5A 2BECA 4XYNA 3TDUA 1UHKA 4CPVA 1BR1B 4N1GA 4E68A 1KQMC 1F70A 4I5KA 3WHUB 4NDDA 1J7OA 1SRAA 1SYMA 3DVEA 1SMGA 2KAVA 2FOTA 1CLMA 2ZFDA 5KU1A 2JULA 3BUXB 1OMRA 1DJZA 1SBJA 1YUSA 1GJYA 1SL8A 2LVIA 2F3YA 4PDZA 1YUTA 1QLKA 3VRQA 3RM1A 2O5GA 4JWQA 1IRJA 1IQ5A 4OV2A 1W7JB 2MJWB 4MN0A 2BL0C 1MHOA 1DJIA 1UHIA 2F2OA 2PALA 2Y1MA 1RJVA 3DVMA 1SR6C 4GGNA 1QX5B 1J7QA 1FPWA 1G8IA 1XO5A 2SASA 2KFFA 1LKJA 3E3RA 1QATA 1PRWA 2JC2A 3D0YA 1D1OA 3I5FC 1F71A 2KSPA
chains in the Genus database with same CATH superfamily
1KFUS 1CM4A 2WORA 3A8RA 1CFDA 3I5HC 3VRPA 4YI8A 1XA5A 3B87A 1LA3A 1WDCB 1YVLA 3L4AA 4JD9A 3LLEA 2JQ6A 2JPTA 2LHLA 1AJ4A 1PSRA 1K9PA 2HQ8A 2M97A 5CPVA 5I94A 4FQTA 4M2PA 1OZSA 4N1FA 1S6JA 5I8NA 2H61C 4TNCA 1JBAA 3EKJA 1DJGA 3D76A 2KAXA 3KO0A 1E8AA 1OOHA 2LHIA 1ODBA 4MBEA 4L9MA 1JWDA 4UPGA 1ZFSA 1IG5A 3CYZA 5G08A 3EVUA 3QRXA 5HKZA 1XFZO 2PYQA 5JJGA 1SCMB 5DKQA 2PSRA 1QJTA 1P28A 3M0WA 2KNEA 1SW8A 1WRLA 3DVKA 2JT8A 4FTGA 5CSIA 3CWGA 1AHRA 2OTGB 1OSAA 1GGWA 1QASA 5D7FA 3SJSA 1PVAA 1V1FA 1QX7A 2LMTA 2M7LA 2KBMA 1FI5A 2WCEA 1BF5A 1NPQA 2ZN8A 2K2FA 4NQGA 1OMVA 1CTRA 1J7RA 2CTNA 4P2YB 1TRFA 3R1OA 1OMDA 3EVRA 4CLNA 1EH2A 4C0KA 2LE9B 2V53A 4DUQA 1HT9A 3CTNA 3TS5B 2WCKA 4YGCB 2BCAA 1RECA 1J1EA 1K93D 3EG5B 2FCEA 1M46A 3IQQA 1AK8A 1DEKA 4Q04A 2KHNA 2LMVA 1NWDA 3CDNA 3BFAA 3LCPC 3O4YA 2I94A 3OX5A 1CKKA 1OQPA 1Y1XA 1KWOB 2LLUA 2CCMA 2Y5IA 1WDCC 2JU0A 1UURA 2LMUA 3JVTB 1WLMA 4OCIA 1IWQA 1DJYA 2QEBA 2KOTA 3VRRA 1BJFA 1K9UA 5GQQC 1DF0B 1XVJA 5ER4X 1CFCA 1DTLA 3JTDB 4P5OE 1SCVA 1JC2A 1AJ5A 2LV7A 2KFGA 1HQVA 2P71A 3NSKA 4GAOA 2YGUA 4N5XA 5HKYA 2WCJA 1YRTB 2KI6D 4PE7A 1A4PA 3FE9A 5CSFA 2H8VA 4PHMA 1EG4A 5KSZA 1TWOA 1IQ3A 1DJWA 5ER5A 3S0FA 1S6IA 3CABA 1G33A 1LINA 2K7DA 2LAPA 2WC5A 1SCMC 2F8PA 5FI6A 3BXKA 3L47A 4DS7A 1KFXS 1OOIX 1DJHA 1KSMA 1EJ3A 3B6XA 4HREE 1NCZA 1BLQA 1NCYA 4MVFA 1S26D 3PALA 2OTGC 3SS4A 2BAPA 3AAKA 2ZRTA 3MSEB 1BODA 1FF1A 1PSBA 3R1VA 3IQOA 1U5IA 1SKTA 3BQ3A 4GUKA 2JT0A 2JTZA 2MLEC 2OS8C 2WC8A 4PHJA 1A03A 2K7CA 1SPYA 1OOJA 3D75A 2L51A 4XJKA 4GPLB 1Y1AA 3FWBA 4A4BA 1CNPA 2ERBA 3TS5C 5DKRA 1WLZA 4KYNA 3HX4A 4M2OA 1VRKA 2MLFC 2QDIA 3DD4A 5AFPA 1CLBA 4WQ3A 2O60A 2WCMA 1OE9B 2MAZA 3D74A 1KWOC 2ZRSA 5HL1A 1MR8A 2ZNDA 1EG3A 1DJXA 1X02A 1TIZA 1B9AA 3JVTC 1IIOA 2QEOA 2CT9A 1NSHA 1ZUZA 3WXAA 3R1PA 1IJ5A 3KEVA 1C07A 4GFTA 2Y1NA 2JXLA 2RGIA 4USLA 2BCBA 1CMFA 2OPOA 1UHNA 2ZKMX 1C3ZA 2JNFA 4OR9B 3FS7A 3JTDC 1G4YR 4YGDB 3GOFA 5AEQA 2BKHB 4CIDA 2I2RE 5HKWA 2L2CA 2M29A 1M39A 1WRKA 4U8DA 1YURA 1B7TY 2CBLA 4PALA 4AQJA 1F4QA 1LA0A 4PE0A 2HQWA 3OHMB 3TDIA 1CMGA 3SIAA 4ICBA 3PM2A 4R1EA 2NXQA 2GGZA 5JOLA 2HF5A 1IJ6A 1SL9A 3SG5A 1DQEA 3Q8IA 2BNXA 3D0YB 3LK1A 1K2HA 1RWYA 4PE4A 4PHNA 5CSNA 2KBIA 1T14A 4C0LA 2MRDA 1JFKA 3NXAA 3RZSA 3PN7B 2JPOA 1Y6WA 4CFQA 2LVKA 3BFBA 3UNWA 1QX2A 2MA2A 1PULA 3SG2A 1EL4A 2I7AA 2CXJA 4F7FA 4GGFC 1YX7A 3I5IB 4F0ZB 2M0RA 4ORCB 4I5LB 5FI2A 1CM1A 2MHHA 4PHKA 5KTYA 3PM8A 1TNXA 3AKAA 1QVIY 1NUBA 1NX2A 3SG4A 1MF8B 5HLOA 4JPZB 1N2DA 1NX3A 1NCXA 3BUOB 2L50A 3NSLA 3SG6A 1EXRA 2COLB 1K9KA 1TUZA 3QMEA 5I2OA 1JF2A 3SG7A 3K21A 1H4BA 5AERA 3WHTB 3BUWB 1ALVA 3CGAA 1XFRA 1H8BA 1KK7Z 4YGAA 2JRFA 1NX1A 1Y1UA 2EHBA 2NCPA 2PQLA 1B1GA 2JT3A 3PLFB 1N65A 2KI4B 3DF0B 4MRXA 3VRNA 2LM5A 3K1EA 3F45A 1K8UA 1GGZA 1V1GA 1QIWA 3D78A 1FBVA 2LLSA 4MZKA 2KYCA 3GK1A 3VGOA 4OZDA 3S0GA 1CFPA 3AKBA 1NP8A 1SL7A 2BBMA 3OBVA 1RK9A 2WOSA 3DVJA 5TNCA 1S36A 2KDHA 2AUCA 4YRUA 1DVIA 4GNKB 3OX6A 3BJHA 2MBXA 1C7WA 3GK4X 4HSZA 2K8MB 3D73A 3EK8A 3NSIA 3NSOA 4IJ7A 4NDBA 2FCDA 1MUXA 1XYDA 3S0DA 1B7TZ 3DYEA 1BT6A 1K95A 4MEWA 3PN7C 1NIWA 1KQMB 2M1KB 1ORGA 2E6WA 3C1VA 1CDNA 1PVBA 1CDPA 1AVSA 1WY9A 1YUUA 1TTXA 2GGMA 1DF0A 3R72A 3WNXB 5EL2A 2K0JA 2M3WA 1TCOB 1W9ZA 4I5NB 4FQOA 3CLNA 3LL8B 5I2QA 1C3YA 4M2QA 2KFHA 2JTTA 1XK4C 1J1DA 3I5GB 2TN4A 3OB1B 3AAJA 4AQIA 4DIRA 4DRWA 5K89A 1AUIB 1S1EA 1SY9A 3N7HA 1J55A 1XFWO 1W7IB 2F33A 2LANA 2LC5A 2M9GA 5AXIA 1IH0A 1A75B 1MWNA 4OKHA 1J7PA 2M1UA 1QS7A 2P70A 3D10A 1KQVA 1XFYO 3FWCA 1KK8B 2QEVA 3A4UB 4ZCUA 3TUYB 2L0PA 1QVIZ 2EC6B 2M49B 3BOWB 1ZMZA 2LNKA 2KI4C 2Q4UA 1U5IB 2EGDA 3OP0A 3CS1A 5PALA 2FJUB 3O78A 1NYAA 2H61A 1YVHA 2P6BB 1SSEB 2R2IA 4XJKB 5J3XA 2WNDA 2PRUA 3FIAA 3IF7A 4GBAA 1KK7Y 1LS8A 4ORBB 1BG1A 1YX8A 2QPTA 3S0EA 4BY5A 1FI6A 4GGFA 1S3PA 2LCPA 2KLEA 3EVVA 3H4SE 4QJ5B 3EK4A 3O6BA 3PATA 3SG3A 1L2OB 3DXLA 1TNPA 2Y4QA 3BUNB 1MXLC 1B8LA 3DZTA 3SIBA 3ZNIA 3NHTA 1N0YA 4PCWA 2LVJA 1TNQA 2AAOA 3V2LA 1RTP1 4HRGA 2LP3A 3TDZA 3IVTA 2JNXA 3LK0A 3VB1A 1DGUA 3BYAA 1KFUL 3KPXA 1XFUO 1JFJA 1TNWA 3EK7A 1ZACA 4QJ4B 2JZIA 5HYDA 2JOJA 3I5GC 3FE8A 2VRGA 3CZTX 1TUJA 2BE4A 4YI9A 3NGVA 4YGEB 3EKHA 2PMYA 2K7BA 5AANA 1DC1A 4NDCA 1F54A 1QLSA 1QXPA 2CNPA 3GK2A 4I5JA 2LUXA 1YTZC 2KAYA 4IL1A 5HLVA 2KYFA 2ISDA 4OVNF 1SK6D 1DMOA 1UP5A 1KK8C 1RROA 3BUMB 1B4CA 2L5YA 3HCMA 1PALA 4WRIA 3TUYC 2EC6C 1FW4A 1B8RA 2AMIA 2L4HA 3CR4X 4MSPA 2HPSA 2GTEA 1JUOA 1M31A 3NHIA 2H2KA 2BE6A 1K90D 2ZNEA 1F55A 1XFVO 1C7VA 3KF9A 5CSJA 3O2PA 3S0AA 1TOPA 1R2UA 1KCYA 3S0BA 2WC6A 1L2OC 1YRUB 1Z2CB 1DELA 1BOCA 1GQMA 1PK0D 1XK4A 1A2XA 2F2PA 4YGBB 1K96A 1UUSA 2K2AA 2PASA 2KI6C 1CDMA 3CZ2A 2SCPA 1S5GY 1AP4A 2BKIB 4D1EA 1UWOA 1OOFA 2DOQA 3O4XA 3OB2B 5F6TA 4ETOA 2Q91A 4PE1A 2L5XB 1QWVA 1Q80A 1QTXA 2KGBC 1CB1A 1BU3A 2LUCA 4BY4A 2L2EA 3CR5X 3DF0A 1L7ZA 3PJIA 1Z4HA 2NZ0A 2K60A 1S6CA 1CDLA 2M7NA 2OS8B 3DY9A 1B47A 2G2BA 1JSAA 2D8NA 1LXFC 1ZOTB 2F3ZA 2ZN9A 2E30A 3ZWHA 1MQ1A 4ORAB 1ALWA 2WCLA 1F8HA 2K7OA 5IBWA 4YBHB 1MXEA 2A4JA 1OOGA 1F4OA 2KQ6A 4A4CA 2KLDA 1QV0A 4HRHA 1TN4A 4WQ2A 4DCKA 2LVVA 1CLLA 1QIVA 1SNLA 3KHEA 4MZLA 1RFJA 2FJYA 1LVCD 3I5IC 3BFHA 3PSRA 1KFXL 3VROA 2L98A 1Y0VH 2BCXA 2KGRA 4QJ3B 4AOMA 2WCFA 2QACA 1BMOA 4JKTA 2LP2A 1GM0A 1K94A 2JXCA 2G9BA 1R6PA 1UHJA 2NCOA 5B8IB 2BL0B 3TZ1A 3PFVA 1SR6B 4MZJA 2LLTA 3CR2A 4JQ0D 1UHHA 2HETA 1DGVA 4INWA 1M63B 1BR4B 1NX0A 2WCBA 5FYXA 5BPJA 1XFXO 5I2LA 2WCHA 1A75A 2BBNA 3B86A 3I5FB 1OZOA 3RLZA 3SS3A 3B7AA 3CZ0A 3L4LA 5D69A 2IS9A 1KSOA 1TCFA 2M8UA 3SS5A 2B1UA 3I5HB 3UO9A 1QV1A 3BOWA 4ZCVA 1M45A 4MLWA 1A29A 2I18A 1IKUA 1YR5A 2PVBA 4PT1A 1CFFA 4CFRA 1B8CA 3B88A 1DT7B 3ICBA 1WRZA 1IGVA 1S5GZ 2KQYA 4MRYA 2K61A 2L4IA 5DKNA 4C0JA 1JF0A 2JWWA 2QEHA 2NLNA 2GV5A 2BECA 4XYNA 3TDUA 1UHKA 4CPVA 1BR1B 4N1GA 4E68A 1KQMC 1F70A 4I5KA 2KPHA 3WHUB 4NDDA 1J7OA 1SRAA 1SYMA 3DVEA 1OW4A 1SMGA 2FOTA 1CLMA 2KAVA 2ZFDA 2JULA 5D3OA 5KU1A 3BUXB 1OMRA 1DJZA 1SBJA 1YUSA 1GJYA 4INXA 1SL8A 2LVIA 5FI7A 2F3YA 4PDZA 1YUTA 1QLKA 3VRQA 3RM1A 2O5GA 5DICA 4JWQA 1IRJA 1IQ5A 4OV2A 3D77A 1W7JB 2MJWB 4MN0A 2BL0C 1MHOA 1DJIA 1UHIA 2F2OA 2PALA 2Y1MA 1RJVA 3DVMA 1SR6C 4GGNA 1QX5B 1J7QA 3CZ1A 3OGNA 1FPWA 1G8IA 1XO5A 2SASA 2KFFA 1LKJA 3E3RA 1QATA 1PRWA 2JC2A 3FE6A 3D0YA 1D1OA 3I5FC 1F71A 2KSPA
chains in the Genus database with same CATH topology
1KFUS 1CM4A 2WORA 3A8RA 1CFDA 3I5HC 3VRPA 4YI8A 1XA5A 1LA3A 1WDCB 1YVLA 3LLEA 2JQ6A 2JPTA 2LHLA 1AJ4A 1PSRA 1K9PA 2HQ8A 2M97A 5CPVA 4M2PA 1OZSA 4N1FA 1S6JA 5I8NA 2H61C 4TNCA 1JBAA 3EKJA 1DJGA 2KAXA 3KO0A 1E8AA 2LHIA 1ODBA 4MBEA 4L9MA 1JWDA 4UPGA 1ZFSA 1IG5A 5G08A 3EVUA 3QRXA 5HKZA 1XFZO 5JJGA 1SCMB 5DKQA 2PSRA 1QJTA 3M0WA 2KNEA 1SW8A 1WRLA 3DVKA 2JT8A 4FTGA 5CSIA 3CWGA 1AHRA 2OTGB 1OSAA 1GGWA 1QASA 5D7FA 3SJSA 1PVAA 1V1FA 1QX7A 2LMTA 2M7LA 2KBMA 1FI5A 2WCEA 1BF5A 1NPQA 2ZN8A 2K2FA 4NQGA 1OMVA 1CTRA 1J7RA 2CTNA 4P2YB 1TRFA 4CLNA 1OMDA 3EVRA 1EH2A 1JFJA 4C0KA 2LE9B 2V53A 4DUQA 1HT9A 3CTNA 3TS5B 4YGCB 2BCAA 1RECA 1J1EA 1K93D 2FCEA 1M46A 3IQQA 1AK8A 4Q04A 2KHNA 2LMVA 1NWDA 3LCPC 3O4YA 2I94A 3OX5A 1CKKA 1OQPA 1Y1XA 1KWOB 2LLUA 2CCMA 2Y5IA 1WDCC 2JU0A 1UURA 2LMUA 3JVTB 1WLMA 4OCIA 1IWQA 1DJYA 3VRRA 2KOTA 1BJFA 1K9UA 5GQQC 1DF0B 1XVJA 5ER4X 1CFCA 1DTLA 3JTDB 4P5OE 1SCVA 1JC2A 1AJ5A 2LV7A 2KFGA 1HQVA 4N5XA 3NSKA 4GAOA 5HKYA 1YRTB 2KI6D 4PE7A 1A4PA 5CSFA 4PHMA 5KSZA 1EG4A 1IQ3A 1DJWA 5ER5A 1S6IA 1G33A 1LINA 2K7DA 2LAPA 1SCMC 2F8PA 3BXKA 4DS7A 4QJ5B 1KFXS 4HREE 1DJHA 1KSMA 1EJ3A 1BLQA 1NCZA 1NCYA 4MVFA 1S26D 3PALA 2OTGC 3AAKA 2ZRTA 3MSEB 1BODA 1FF1A 1PSBA 3IQOA 1U5IA 1SKTA 3BQ3A 4GUKA 2JT0A 2JTZA 2MLEC 2OS8C 2WC8A 4PHJA 1A03A 2K7CA 1SPYA 1OOJA 2L51A 4XJKA 4GPLB 1Y1AA 3FWBA 4A4BA 1CNPA 3TS5C 5DKRA 1WLZA 3HX4A 4M2OA 1VRKA 2MLFC 3DD4A 5AFPA 1CLBA 4WQ3A 2O60A 1OE9B 2MAZA 1KWOC 2ZRSA 1MR8A 2ZNDA 1EG3A 1DJXA 1X02A 1TIZA 1B9AA 3JVTC 2CT9A 1NSHA 1ZUZA 3WXAA 1IJ5A 3KEVA 1C07A 4GFTA 2Y1NA 2JXLA 2RGIA 4USLA 2BCBA 1CMFA 2OPOA 1UHNA 2ZKMX 4OR9B 2JNFA 3FS7A 3JTDC 1G4YR 4YGDB 3GOFA 5AEQA 2BKHB 4CIDA 2I2RE 5HKWA 2M29A 1M39A 1WRKA 4U8DA 1YURA 1B7TY 2CBLA 4PALA 4AQJA 1F4QA 1LA0A 4PE0A 2HQWA 3OHMB 3TDIA 1CMGA 3SIAA 4ICBA 4R1EA 2NXQA 2GGZA 5JOLA 2HF5A 1IJ6A 1SL9A 3SG5A 3D0YB 3LK1A 1K2HA 1RWYA 4PE4A 4PHNA 5CSNA 2KBIA 4C0LA 2MRDA 1JFKA 3NXAA 3PN7B 1Y6WA 4CFQA 2LVKA 1QX2A 2MA2A 1PULA 3SG2A 1EL4A 2I7AA 2CXJA 4GGFC 1YX7A 3I5IB 4F0ZB 2M0RA 4ORCB 4I5LB 1CM1A 2MHHA 4PHKA 5KTYA 3PM8A 1TNXA 3AKAA 1QVIY 1NUBA 1NX2A 3SG4A 1MF8B 5HLOA 4JPZB 1N2DA 1NX3A 1NCXA 3BUOB 2L50A 3NSLA 3SG6A 1EXRA 2COLB 1K9KA 5I2OA 1JF2A 3SG7A 3K21A 1H4BA 5AERA 3WHTB 3BUWB 1ALVA 3CGAA 1H8BA 1KK7Z 4YGAA 2JRFA 1NX1A 1Y1UA 2EHBA 2NCPA 1B1GA 2JT3A 3PLFB 1N65A 2KI4B 3DF0B 4MRXA 3VRNA 2LM5A 3F45A 1K8UA 1GGZA 1V1GA 1QIWA 1FBVA 2LLSA 4MZKA 2KYCA 3GK1A 3VGOA 1CFPA 3AKBA 1NP8A 1SL7A 2BBMA 1RK9A 2WOSA 3DVJA 5TNCA 1S36A 2KDHA 2AUCA 4YRUA 1DVIA 4GNKB 3OX6A 2MBXA 1C7WA 3GK4X 4HSZA 2K8MB 3EK8A 3NSIA 3NSOA 4NDBA 2FCDA 1MUXA 1XYDA 1B7TZ 1BT6A 1K95A 4MEWA 3PN7C 1NIWA 1KQMB 2M1KB 2E6WA 3C1VA 1CDNA 1PVBA 1CDPA 1AVSA 1WY9A 1YUUA 1TTXA 2GGMA 1DF0A 3WNXB 2K0JA 2M3WA 1TCOB 4I5NB 4FQOA 3CLNA 3LL8B 5I2QA 4M2QA 2KFHA 2JTTA 1XK4C 1J1DA 3I5GB 2TN4A 3OB1B 3AAJA 4AQIA 4DIRA 4DRWA 5K89A 1AUIB 1S1EA 1SY9A 1J55A 1XFWO 1W7IB 2F33A 2LANA 2LC5A 2M9GA 5AXIA 1IH0A 1A75B 1MWNA 4OKHA 1J7PA 2M1UA 1QS7A 1KQVA 3D10A 1XFYO 3FWCA 1KK8B 4ZCUA 3A4UB 3TUYB 2L0PA 1QVIZ 2EC6B 2M49B 3BOWB 1ZMZA 2LNKA 2KI4C 2Q4UA 1U5IB 2EGDA 3OP0A 3CS1A 5PALA 2FJUB 3O78A 1NYAA 2H61A 1YVHA 2P6BB 2R2IA 4XJKB 5J3XA 2WNDA 2PRUA 3FIAA 3IF7A 4GBAA 1KK7Y 4ORBB 1BG1A 1YX8A 2QPTA 4BY5A 1FI6A 4GGFA 1S3PA 2LCPA 3EVVA 3H4SE 3EK4A 3O6BA 3PATA 3SG3A 1L2OB 1TNPA 2Y4QA 3BUNB 1MXLC 1B8LA 3SIBA 3ZNIA 1N0YA 4PCWA 2LVJA 1TNQA 2AAOA 1RTP1 4HRGA 2LP3A 3TDZA 3LK0A 2JNXA 1DGUA 3BYAA 1KFUL 3KPXA 1XFUO 1TNWA 3EK7A 1ZACA 4QJ4B 2JZIA 5HYDA 2JOJA 3I5GC 2VRGA 3CZTX 2BE4A 4YI9A 4YGEB 3EKHA 2PMYA 2K7BA 5AANA 4NDCA 1F54A 1QLSA 1QXPA 2CNPA 3GK2A 4I5JA 2LUXA 1YTZC 2KAYA 4IL1A 5HLVA 2KYFA 2ISDA 4OVNF 1SK6D 1DMOA 1UP5A 1KK8C 1RROA 3BUMB 1B4CA 4WRIA 3HCMA 1PALA 3TUYC 2EC6C 1FW4A 1B8RA 2AMIA 2L4HA 3CR4X 4MSPA 2HPSA 1JUOA 1M31A 2H2KA 2BE6A 1K90D 2ZNEA 1F55A 1XFVO 1C7VA 3KF9A 5CSJA 3O2PA 1TOPA 1R2UA 1KCYA 1L2OC 1YRUB 1BOCA 1GQMA 1PK0D 1XK4A 1A2XA 2F2PA 4YGBB 1K96A 1UUSA 2K2AA 2PASA 2KI6C 1CDMA 1AP4A 2SCPA 1S5GY 2BKIB 4D1EA 1UWOA 3OB2B 2DOQA 5F6TA 4ETOA 2Q91A 4PE1A 2L5XB 1Q80A 1QTXA 2KGBC 1CB1A 1BU3A 2LUCA 4BY4A 2L2EA 3CR5X 3DF0A 1L7ZA 2NZ0A 1S6CA 1CDLA 2M7NA 2OS8B 1B47A 2G2BA 1JSAA 2D8NA 1LXFC 1ZOTB 2F3ZA 2ZN9A 2E30A 3ZWHA 1MQ1A 4ORAB 1ALWA 1F8HA 2K7OA 5IBWA 4YBHB 1MXEA 2A4JA 2KQ6A 1F4OA 4A4CA 1QV0A 4HRHA 1TN4A 4WQ2A 4DCKA 2LVVA 1CLLA 1QIVA 1SNLA 3KHEA 4MZLA 1RFJA 1LVCD 3I5IC 3PSRA 1KFXL 3VROA 2L98A 1Y0VH 2BCXA 2KGRA 4QJ3B 4AOMA 2WCFA 2QACA 1BMOA 2LP2A 1K94A 2JXCA 2G9BA 1R6PA 1UHJA 2NCOA 5B8IB 2BL0B 3TZ1A 3PFVA 1SR6B 4MZJA 2LLTA 3CR2A 4JQ0D 1UHHA 2HETA 1DGVA 1M63B 1BR4B 1NX0A 2WCBA 5FYXA 5BPJA 1XFXO 5I2LA 1A75A 2BBNA 3I5FB 1OZOA 3RLZA 5D69A 2IS9A 1KSOA 1TCFA 2M8UA 2B1UA 3I5HB 1QV1A 3BOWA 4ZCVA 1M45A 4MLWA 1A29A 2I18A 1IKUA 1YR5A 2PVBA 1CFFA 4CFRA 1B8CA 1DT7B 3ICBA 1WRZA 1IGVA 1S5GZ 2KQYA 4MRYA 2K61A 2L4IA 5DKNA 4C0JA 1JF0A 2JWWA 2NLNA 2GV5A 2BECA 4XYNA 3TDUA 1UHKA 4CPVA 1BR1B 4N1GA 4E68A 1KQMC 1F70A 4I5KA 3WHUB 4NDDA 1J7OA 1SRAA 1SYMA 3DVEA 1SMGA 2KAVA 2FOTA 1CLMA 2ZFDA 5KU1A 2JULA 3BUXB 1OMRA 1DJZA 1SBJA 1YUSA 1GJYA 1SL8A 2LVIA 2F3YA 4PDZA 1YUTA 1QLKA 3VRQA 3RM1A 2O5GA 4JWQA 1IRJA 1IQ5A 4OV2A 1W7JB 2MJWB 4MN0A 2BL0C 1MHOA 1DJIA 1UHIA 2F2OA 2PALA 2Y1MA 1RJVA 3DVMA 1SR6C 4GGNA 1QX5B 1J7QA 1FPWA 1G8IA 1XO5A 2SASA 2KFFA 1LKJA 3E3RA 1QATA 1PRWA 2JC2A 3D0YA 1D1OA 3I5FC 1F71A 2KSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU S;  1CM4 A;  2WOR A;  3A8R A;  1CFD A;  3I5H C;  3VRP A;  4YI8 A;  1XA5 A;  1LA3 A;  1WDC B;  1YVL A;  3LLE A;  2JQ6 A;  2JPT A;  2LHL A;  1AJ4 A;  1PSR A;  1K9P A;  2HQ8 A;  2M97 A;  5CPV A;  4M2P A;  1OZS A;  4N1F A;  1S6J A;  5I8N A;  2H61 C;  4TNC A;  1JBA A;  3EKJ A;  1DJG A;  2KAX A;  3KO0 A;  1E8A A;  2LHI A;  1ODB A;  4MBE A;  4L9M A;  1JWD A;  4UPG A;  1ZFS A;  1IG5 A;  5G08 A;  3EVU A;  3QRX A;  5HKZ A;  1XFZ O;  5JJG A;  1SCM B;  5DKQ A;  2PSR A;  1QJT A;  3M0W A;  2KNE A;  1SW8 A;  1WRL A;  3DVK A;  2JT8 A;  4FTG A;  5CSI A;  3CWG A;  1AHR A;  2OTG B;  1OSA A;  1GGW A;  1QAS A;  5D7F A;  3SJS A;  1PVA A;  1V1F A;  1QX7 A;  2LMT A;  2M7L A;  2KBM A;  1FI5 A;  2WCE A;  1BF5 A;  1NPQ A;  2ZN8 A;  2K2F A;  4NQG A;  1OMV A;  1CTR A;  1J7R A;  2CTN A;  4P2Y B;  1TRF A;  4CLN A;  1OMD A;  3EVR A;  1EH2 A;  1JFJ A;  4C0K A;  2LE9 B;  2V53 A;  4DUQ A;  1HT9 A;  3CTN A;  3TS5 B;  4YGC B;  2BCA A;  1REC A;  1J1E A;  1K93 D;  2FCE A;  1M46 A;  3IQQ A;  1AK8 A;  4Q04 A;  2KHN A;  2LMV A;  1NWD A;  3LCP C;  3O4Y A;  2I94 A;  3OX5 A;  1CKK A;  1OQP A;  1Y1X A;  1KWO B;  2LLU A;  2CCM A;  2Y5I A;  1WDC C;  2JU0 A;  1UUR A;  2LMU A;  3JVT B;  1WLM A;  4OCI A;  1IWQ A;  1DJY A;  3VRR A;  2KOT A;  1BJF A;  1K9U A;  5GQQ C;  1DF0 B;  1XVJ A;  5ER4 X;  1CFC A;  1DTL A;  3JTD B;  4P5O E;  1SCV A;  1JC2 A;  1AJ5 A;  2LV7 A;  2KFG A;  1HQV A;  4N5X A;  3NSK A;  4GAO A;  5HKY A;  1YRT B;  2KI6 D;  4PE7 A;  1A4P A;  5CSF A;  4PHM A;  5KSZ A;  1EG4 A;  1IQ3 A;  1DJW A;  5ER5 A;  1S6I A;  1G33 A;  1LIN A;  2K7D A;  2LAP A;  1SCM C;  2F8P A;  3BXK A;  4DS7 A;  4QJ5 B;  1KFX S;  4HRE E;  1DJH A;  1KSM A;  1EJ3 A;  1BLQ A;  1NCZ A;  1NCY A;  4MVF A;  1S26 D;  3PAL A;  2OTG C;  3AAK A;  2ZRT A;  3MSE B;  1BOD A;  1FF1 A;  1PSB A;  3IQO A;  1U5I A;  1SKT A;  3BQ3 A;  4GUK A;  2JT0 A;  2JTZ A;  2MLE C;  2OS8 C;  2WC8 A;  4PHJ A;  1A03 A;  2K7C A;  1SPY A;  1OOJ A;  2L51 A;  4XJK A;  4GPL B;  1Y1A A;  3FWB A;  4A4B A;  1CNP A;  3TS5 C;  5DKR A;  1WLZ A;  3HX4 A;  4M2O A;  1VRK A;  2MLF C;  3DD4 A;  5AFP A;  1CLB A;  4WQ3 A;  2O60 A;  1OE9 B;  2MAZ A;  1KWO C;  2ZRS A;  1MR8 A;  2ZND A;  1EG3 A;  1DJX A;  1X02 A;  1TIZ A;  1B9A A;  3JVT C;  2CT9 A;  1NSH A;  1ZUZ A;  3WXA A;  1IJ5 A;  3KEV A;  1C07 A;  4GFT A;  2Y1N A;  2JXL A;  2RGI A;  4USL A;  2BCB A;  1CMF A;  2OPO A;  1UHN A;  2ZKM X;  4OR9 B;  2JNF A;  3FS7 A;  3JTD C;  1G4Y R;  4YGD B;  3GOF A;  5AEQ A;  2BKH B;  4CID A;  2I2R E;  5HKW A;  2M29 A;  1M39 A;  1WRK A;  4U8D A;  1YUR A;  1B7T Y;  2CBL A;  4PAL A;  4AQJ A;  1F4Q A;  1LA0 A;  4PE0 A;  2HQW A;  3OHM B;  3TDI A;  1CMG A;  3SIA A;  4ICB A;  4R1E A;  2NXQ A;  2GGZ A;  5JOL A;  2HF5 A;  1IJ6 A;  1SL9 A;  3SG5 A;  3D0Y B;  3LK1 A;  1K2H A;  1RWY A;  4PE4 A;  4PHN A;  5CSN A;  2KBI A;  4C0L A;  2MRD A;  1JFK A;  3NXA A;  3PN7 B;  1Y6W A;  4CFQ A;  2LVK A;  1QX2 A;  2MA2 A;  1PUL A;  3SG2 A;  1EL4 A;  2I7A A;  2CXJ A;  4GGF C;  1YX7 A;  3I5I B;  4F0Z B;  2M0R A;  4ORC B;  4I5L B;  1CM1 A;  2MHH A;  4PHK A;  5KTY A;  3PM8 A;  1TNX A;  3AKA A;  1QVI Y;  1NUB A;  1NX2 A;  3SG4 A;  1MF8 B;  5HLO A;  4JPZ B;  1N2D A;  1NX3 A;  1NCX A;  3BUO B;  2L50 A;  3NSL A;  3SG6 A;  1EXR A;  2COL B;  1K9K A;  5I2O A;  1JF2 A;  3SG7 A;  3K21 A;  1H4B A;  5AER A;  3WHT B;  3BUW B;  1ALV A;  3CGA A;  1H8B A;  1KK7 Z;  4YGA A;  2JRF A;  1NX1 A;  1Y1U A;  2EHB A;  2NCP A;  1B1G A;  2JT3 A;  3PLF B;  1N65 A;  2KI4 B;  3DF0 B;  4MRX A;  3VRN A;  2LM5 A;  3F45 A;  1K8U A;  1GGZ A;  1V1G A;  1QIW A;  1FBV A;  2LLS A;  4MZK A;  2KYC A;  3GK1 A;  3VGO A;  1CFP A;  3AKB A;  1NP8 A;  1SL7 A;  2BBM A;  1RK9 A;  2WOS A;  3DVJ A;  5TNC A;  1S36 A;  2KDH A;  2AUC A;  4YRU A;  1DVI A;  4GNK B;  3OX6 A;  2MBX A;  1C7W A;  3GK4 X;  4HSZ A;  2K8M B;  3EK8 A;  3NSI A;  3NSO A;  4NDB A;  2FCD A;  1MUX A;  1XYD A;  1B7T Z;  1BT6 A;  1K95 A;  4MEW A;  3PN7 C;  1NIW A;  1KQM B;  2M1K B;  2E6W A;  3C1V A;  1CDN A;  1PVB A;  1CDP A;  1AVS A;  1WY9 A;  1YUU A;  1TTX A;  2GGM A;  1DF0 A;  3WNX B;  2K0J A;  2M3W A;  1TCO B;  4I5N B;  4FQO A;  3CLN A;  3LL8 B;  5I2Q A;  4M2Q A;  2KFH A;  2JTT A;  1XK4 C;  1J1D A;  3I5G B;  2TN4 A;  3OB1 B;  3AAJ A;  4AQI A;  4DIR A;  4DRW A;  5K89 A;  1AUI B;  1S1E A;  1SY9 A;  1J55 A;  1XFW O;  1W7I B;  2F33 A;  2LAN A;  2LC5 A;  2M9G A;  5AXI A;  1IH0 A;  1A75 B;  1MWN A;  4OKH A;  1J7P A;  2M1U A;  1QS7 A;  1KQV A;  3D10 A;  1XFY O;  3FWC A;  1KK8 B;  4ZCU A;  3A4U B;  3TUY B;  2L0P A;  1QVI Z;  2EC6 B;  2M49 B;  3BOW B;  1ZMZ A;  2LNK A;  2KI4 C;  2Q4U A;  1U5I B;  2EGD A;  3OP0 A;  3CS1 A;  5PAL A;  2FJU B;  3O78 A;  1NYA A;  2H61 A;  1YVH A;  2P6B B;  2R2I A;  4XJK B;  5J3X A;  2WND A;  2PRU A;  3FIA A;  3IF7 A;  4GBA A;  1KK7 Y;  4ORB B;  1BG1 A;  1YX8 A;  2QPT A;  4BY5 A;  1FI6 A;  4GGF A;  1S3P A;  2LCP A;  3EVV A;  3H4S E;  3EK4 A;  3O6B A;  3PAT A;  3SG3 A;  1L2O B;  1TNP A;  2Y4Q A;  3BUN B;  1MXL C;  1B8L A;  3SIB A;  3ZNI A;  1N0Y A;  4PCW A;  2LVJ A;  1TNQ A;  2AAO A;  1RTP 1;  4HRG A;  2LP3 A;  3TDZ A;  3LK0 A;  2JNX A;  1DGU A;  3BYA A;  1KFU L;  3KPX A;  1XFU O;  1TNW A;  3EK7 A;  1ZAC A;  4QJ4 B;  2JZI A;  5HYD A;  2JOJ A;  3I5G C;  2VRG A;  3CZT X;  2BE4 A;  4YI9 A;  4YGE B;  3EKH A;  2PMY A;  2K7B A;  5AAN A;  4NDC A;  1F54 A;  1QLS A;  1QXP A;  2CNP A;  3GK2 A;  4I5J A;  2LUX A;  1YTZ C;  2KAY A;  4IL1 A;  5HLV A;  2KYF A;  2ISD A;  4OVN F;  1SK6 D;  1DMO A;  1UP5 A;  1KK8 C;  1RRO A;  3BUM B;  1B4C A;  4WRI A;  3HCM A;  1PAL A;  3TUY C;  2EC6 C;  1FW4 A;  1B8R A;  2AMI A;  2L4H A;  3CR4 X;  4MSP A;  2HPS A;  1JUO A;  1M31 A;  2H2K A;  2BE6 A;  1K90 D;  2ZNE A;  1F55 A;  1XFV O;  1C7V A;  3KF9 A;  5CSJ A;  3O2P A;  1TOP A;  1R2U A;  1KCY A;  1L2O C;  1YRU B;  1BOC A;  1GQM A;  1PK0 D;  1XK4 A;  1A2X A;  2F2P A;  4YGB B;  1K96 A;  1UUS A;  2K2A A;  2PAS A;  2KI6 C;  1CDM A;  1AP4 A;  2SCP A;  1S5G Y;  2BKI B;  4D1E A;  1UWO A;  3OB2 B;  2DOQ A;  5F6T A;  4ETO A;  2Q91 A;  4PE1 A;  2L5X B;  1Q80 A;  1QTX A;  2KGB C;  1CB1 A;  1BU3 A;  2LUC A;  4BY4 A;  2L2E A;  3CR5 X;  3DF0 A;  1L7Z A;  2NZ0 A;  1S6C A;  1CDL A;  2M7N A;  2OS8 B;  1B47 A;  2G2B A;  1JSA A;  2D8N A;  1LXF C;  1ZOT B;  2F3Z A;  2ZN9 A;  2E30 A;  3ZWH A;  1MQ1 A;  4ORA B;  1ALW A;  1F8H A;  2K7O A;  5IBW A;  4YBH B;  1MXE A;  2A4J A;  2KQ6 A;  1F4O A;  4A4C A;  1QV0 A;  4HRH A;  1TN4 A;  4WQ2 A;  4DCK A;  2LVV A;  1CLL A;  1QIV A;  1SNL A;  3KHE A;  4MZL A;  1RFJ A;  1LVC D;  3I5I C;  3PSR A;  1KFX L;  3VRO A;  2L98 A;  1Y0V H;  2BCX A;  2KGR A;  4QJ3 B;  4AOM A;  2WCF A;  2QAC A;  1BMO A;  2LP2 A;  1K94 A;  2JXC A;  2G9B A;  1R6P A;  1UHJ A;  2NCO A;  5B8I B;  2BL0 B;  3TZ1 A;  3PFV A;  1SR6 B;  4MZJ A;  2LLT A;  3CR2 A;  4JQ0 D;  1UHH A;  2HET A;  1DGV A;  1M63 B;  1BR4 B;  1NX0 A;  2WCB A;  5FYX A;  5BPJ A;  1XFX O;  5I2L A;  1A75 A;  2BBN A;  3I5F B;  1OZO A;  3RLZ A;  5D69 A;  2IS9 A;  1KSO A;  1TCF A;  2M8U A;  2B1U A;  3I5H B;  1QV1 A;  3BOW A;  4ZCV A;  1M45 A;  4MLW A;  1A29 A;  2I18 A;  1IKU A;  1YR5 A;  2PVB A;  1CFF A;  4CFR A;  1B8C A;  1DT7 B;  3ICB A;  1WRZ A;  1IGV A;  1S5G Z;  2KQY A;  4MRY A;  2K61 A;  2L4I A;  5DKN A;  4C0J A;  1JF0 A;  2JWW A;  2NLN A;  2GV5 A;  2BEC A;  4XYN A;  3TDU A;  1UHK A;  4CPV A;  1BR1 B;  4N1G A;  4E68 A;  1KQM C;  1F70 A;  4I5K A;  3WHU B;  4NDD A;  1J7O A;  1SRA A;  1SYM A;  3DVE A;  1SMG A;  2KAV A;  2FOT A;  1CLM A;  2ZFD A;  5KU1 A;  2JUL A;  3BUX B;  1OMR A;  1DJZ A;  1SBJ A;  1YUS A;  1GJY A;  1SL8 A;  2LVI A;  2F3Y A;  4PDZ A;  1YUT A;  1QLK A;  3VRQ A;  3RM1 A;  2O5G A;  4JWQ A;  1IRJ A;  1IQ5 A;  4OV2 A;  1W7J B;  2MJW B;  4MN0 A;  2BL0 C;  1MHO A;  1DJI A;  1UHI A;  2F2O A;  2PAL A;  2Y1M A;  1RJV A;  3DVM A;  1SR6 C;  4GGN A;  1QX5 B;  1J7Q A;  1FPW A;  1G8I A;  1XO5 A;  2SAS A;  2KFF A;  1LKJ A;  3E3R A;  1QAT A;  1PRW A;  2JC2 A;  3D0Y A;  1D1O A;  3I5F C;  1F71 A;  2KSP A; 
#chains in the Genus database with same CATH topology
 1KFU S;  1CM4 A;  2WOR A;  3A8R A;  1CFD A;  3I5H C;  3VRP A;  4YI8 A;  1XA5 A;  3B87 A;  1LA3 A;  1WDC B;  1YVL A;  3L4A A;  4JD9 A;  3LLE A;  2JQ6 A;  2JPT A;  2LHL A;  1AJ4 A;  1PSR A;  1K9P A;  2HQ8 A;  2M97 A;  5CPV A;  5I94 A;  4FQT A;  4M2P A;  1OZS A;  4N1F A;  1S6J A;  5I8N A;  2H61 C;  4TNC A;  1JBA A;  3EKJ A;  1DJG A;  3D76 A;  2KAX A;  3KO0 A;  1E8A A;  1OOH A;  2LHI A;  1ODB A;  4MBE A;  4L9M A;  1JWD A;  4UPG A;  1ZFS A;  1IG5 A;  3CYZ A;  5G08 A;  3EVU A;  3QRX A;  5HKZ A;  1XFZ O;  2PYQ A;  5JJG A;  1SCM B;  5DKQ A;  2PSR A;  1QJT A;  1P28 A;  3M0W A;  2KNE A;  1SW8 A;  1WRL A;  3DVK A;  2JT8 A;  4FTG A;  5CSI A;  3CWG A;  1AHR A;  2OTG B;  1OSA A;  1GGW A;  1QAS A;  5D7F A;  3SJS A;  1PVA A;  1V1F A;  1QX7 A;  2LMT A;  2M7L A;  2KBM A;  1FI5 A;  2WCE A;  1BF5 A;  1NPQ A;  2ZN8 A;  2K2F A;  4NQG A;  1OMV A;  1CTR A;  1J7R A;  2CTN A;  4P2Y B;  1TRF A;  3R1O A;  1OMD A;  3EVR A;  4CLN A;  1EH2 A;  4C0K A;  2LE9 B;  2V53 A;  4DUQ A;  1HT9 A;  3CTN A;  3TS5 B;  2WCK A;  4YGC B;  2BCA A;  1REC A;  1J1E A;  1K93 D;  3EG5 B;  2FCE A;  1M46 A;  3IQQ A;  1AK8 A;  1DEK A;  4Q04 A;  2KHN A;  2LMV A;  1NWD A;  3CDN A;  3BFA A;  3LCP C;  3O4Y A;  2I94 A;  3OX5 A;  1CKK A;  1OQP A;  1Y1X A;  1KWO B;  2LLU A;  2CCM A;  2Y5I A;  1WDC C;  2JU0 A;  1UUR A;  2LMU A;  3JVT B;  1WLM A;  4OCI A;  1IWQ A;  1DJY A;  2QEB A;  2KOT A;  3VRR A;  1BJF A;  1K9U A;  5GQQ C;  1DF0 B;  1XVJ A;  5ER4 X;  1CFC A;  1DTL A;  3JTD B;  4P5O E;  1SCV A;  1JC2 A;  1AJ5 A;  2LV7 A;  2KFG A;  1HQV A;  2P71 A;  3NSK A;  4GAO A;  2YGU A;  4N5X A;  5HKY A;  2WCJ A;  1YRT B;  2KI6 D;  4PE7 A;  1A4P A;  3FE9 A;  5CSF A;  2H8V A;  4PHM A;  1EG4 A;  5KSZ A;  1TWO A;  1IQ3 A;  1DJW A;  5ER5 A;  3S0F A;  1S6I A;  3CAB A;  1G33 A;  1LIN A;  2K7D A;  2LAP A;  2WC5 A;  1SCM C;  2F8P A;  5FI6 A;  3BXK A;  3L47 A;  4DS7 A;  1KFX S;  1OOI X;  1DJH A;  1KSM A;  1EJ3 A;  3B6X A;  4HRE E;  1NCZ A;  1BLQ A;  1NCY A;  4MVF A;  1S26 D;  3PAL A;  2OTG C;  3SS4 A;  2BAP A;  3AAK A;  2ZRT A;  3MSE B;  1BOD A;  1FF1 A;  1PSB A;  3R1V A;  3IQO A;  1U5I A;  1SKT A;  3BQ3 A;  4GUK A;  2JT0 A;  2JTZ A;  2MLE C;  2OS8 C;  2WC8 A;  4PHJ A;  1A03 A;  2K7C A;  1SPY A;  1OOJ A;  3D75 A;  2L51 A;  4XJK A;  4GPL B;  1Y1A A;  3FWB A;  4A4B A;  1CNP A;  2ERB A;  3TS5 C;  5DKR A;  1WLZ A;  4KYN A;  3HX4 A;  4M2O A;  1VRK A;  2MLF C;  2QDI A;  3DD4 A;  5AFP A;  1CLB A;  4WQ3 A;  2O60 A;  2WCM A;  1OE9 B;  2MAZ A;  3D74 A;  1KWO C;  2ZRS A;  5HL1 A;  1MR8 A;  2ZND A;  1EG3 A;  1DJX A;  1X02 A;  1TIZ A;  1B9A A;  3JVT C;  1IIO A;  2QEO A;  2CT9 A;  1NSH A;  1ZUZ A;  3WXA A;  3R1P A;  1IJ5 A;  3KEV A;  1C07 A;  4GFT A;  2Y1N A;  2JXL A;  2RGI A;  4USL A;  2BCB A;  1CMF A;  2OPO A;  1UHN A;  2ZKM X;  1C3Z A;  2JNF A;  4OR9 B;  3FS7 A;  3JTD C;  1G4Y R;  4YGD B;  3GOF A;  5AEQ A;  2BKH B;  4CID A;  2I2R E;  5HKW A;  2L2C A;  2M29 A;  1M39 A;  1WRK A;  4U8D A;  1YUR A;  1B7T Y;  2CBL A;  4PAL A;  4AQJ A;  1F4Q A;  1LA0 A;  4PE0 A;  2HQW A;  3OHM B;  3TDI A;  1CMG A;  3SIA A;  4ICB A;  3PM2 A;  4R1E A;  2NXQ A;  2GGZ A;  5JOL A;  2HF5 A;  1IJ6 A;  1SL9 A;  3SG5 A;  1DQE A;  3Q8I A;  2BNX A;  3D0Y B;  3LK1 A;  1K2H A;  1RWY A;  4PE4 A;  4PHN A;  5CSN A;  2KBI A;  1T14 A;  4C0L A;  2MRD A;  1JFK A;  3NXA A;  3RZS A;  3PN7 B;  2JPO A;  1Y6W A;  4CFQ A;  2LVK A;  3BFB A;  3UNW A;  1QX2 A;  2MA2 A;  1PUL A;  3SG2 A;  1EL4 A;  2I7A A;  2CXJ A;  4F7F A;  4GGF C;  1YX7 A;  3I5I B;  4F0Z B;  2M0R A;  4ORC B;  4I5L B;  5FI2 A;  1CM1 A;  2MHH A;  4PHK A;  5KTY A;  3PM8 A;  1TNX A;  3AKA A;  1QVI Y;  1NUB A;  1NX2 A;  3SG4 A;  1MF8 B;  5HLO A;  4JPZ B;  1N2D A;  1NX3 A;  1NCX A;  3BUO B;  2L50 A;  3NSL A;  3SG6 A;  1EXR A;  2COL B;  1K9K A;  1TUZ A;  3QME A;  5I2O A;  1JF2 A;  3SG7 A;  3K21 A;  1H4B A;  5AER A;  3WHT B;  3BUW B;  1ALV A;  3CGA A;  1XFR A;  1H8B A;  1KK7 Z;  4YGA A;  2JRF A;  1NX1 A;  1Y1U A;  2EHB A;  2NCP A;  2PQL A;  1B1G A;  2JT3 A;  3PLF B;  1N65 A;  2KI4 B;  3DF0 B;  4MRX A;  3VRN A;  2LM5 A;  3K1E A;  3F45 A;  1K8U A;  1GGZ A;  1V1G A;  1QIW A;  3D78 A;  1FBV A;  2LLS A;  4MZK A;  2KYC A;  3GK1 A;  3VGO A;  4OZD A;  3S0G A;  1CFP A;  3AKB A;  1NP8 A;  1SL7 A;  2BBM A;  3OBV A;  1RK9 A;  2WOS A;  3DVJ A;  5TNC A;  1S36 A;  2KDH A;  2AUC A;  4YRU A;  1DVI A;  4GNK B;  3OX6 A;  3BJH A;  2MBX A;  1C7W A;  3GK4 X;  4HSZ A;  2K8M B;  3D73 A;  3EK8 A;  3NSI A;  3NSO A;  4IJ7 A;  4NDB A;  2FCD A;  1MUX A;  1XYD A;  3S0D A;  1B7T Z;  3DYE A;  1BT6 A;  1K95 A;  4MEW A;  3PN7 C;  1NIW A;  1KQM B;  2M1K B;  1ORG A;  2E6W A;  3C1V A;  1CDN A;  1PVB A;  1CDP A;  1AVS A;  1WY9 A;  1YUU A;  1TTX A;  2GGM A;  1DF0 A;  3R72 A;  3WNX B;  5EL2 A;  2K0J A;  2M3W A;  1TCO B;  1W9Z A;  4I5N B;  4FQO A;  3CLN A;  3LL8 B;  5I2Q A;  1C3Y A;  4M2Q A;  2KFH A;  2JTT A;  1XK4 C;  1J1D A;  3I5G B;  2TN4 A;  3OB1 B;  3AAJ A;  4AQI A;  4DIR A;  4DRW A;  5K89 A;  1AUI B;  1S1E A;  1SY9 A;  3N7H A;  1J55 A;  1XFW O;  1W7I B;  2F33 A;  2LAN A;  2LC5 A;  2M9G A;  5AXI A;  1IH0 A;  1A75 B;  1MWN A;  4OKH A;  1J7P A;  2M1U A;  1QS7 A;  2P70 A;  3D10 A;  1KQV A;  1XFY O;  3FWC A;  1KK8 B;  2QEV A;  3A4U B;  4ZCU A;  3TUY B;  2L0P A;  1QVI Z;  2EC6 B;  2M49 B;  3BOW B;  1ZMZ A;  2LNK A;  2KI4 C;  2Q4U A;  1U5I B;  2EGD A;  3OP0 A;  3CS1 A;  5PAL A;  2FJU B;  3O78 A;  1NYA A;  2H61 A;  1YVH A;  2P6B B;  1SSE B;  2R2I A;  4XJK B;  5J3X A;  2WND A;  2PRU A;  3FIA A;  3IF7 A;  4GBA A;  1KK7 Y;  1LS8 A;  4ORB B;  1BG1 A;  1YX8 A;  2QPT A;  3S0E A;  4BY5 A;  1FI6 A;  4GGF A;  1S3P A;  2LCP A;  2KLE A;  3EVV A;  3H4S E;  4QJ5 B;  3EK4 A;  3O6B A;  3PAT A;  3SG3 A;  1L2O B;  3DXL A;  1TNP A;  2Y4Q A;  3BUN B;  1MXL C;  1B8L A;  3DZT A;  3SIB A;  3ZNI A;  3NHT A;  1N0Y A;  4PCW A;  2LVJ A;  1TNQ A;  2AAO A;  3V2L A;  1RTP 1;  4HRG A;  2LP3 A;  3TDZ A;  3IVT A;  2JNX A;  3LK0 A;  3VB1 A;  1DGU A;  3BYA A;  1KFU L;  3KPX A;  1XFU O;  1JFJ A;  1TNW A;  3EK7 A;  1ZAC A;  4QJ4 B;  2JZI A;  5HYD A;  2JOJ A;  3I5G C;  3FE8 A;  2VRG A;  3CZT X;  1TUJ A;  2BE4 A;  4YI9 A;  3NGV A;  4YGE B;  3EKH A;  2PMY A;  2K7B A;  5AAN A;  1DC1 A;  4NDC A;  1F54 A;  1QLS A;  1QXP A;  2CNP A;  3GK2 A;  4I5J A;  2LUX A;  1YTZ C;  2KAY A;  4IL1 A;  5HLV A;  2KYF A;  2ISD A;  4OVN F;  1SK6 D;  1DMO A;  1UP5 A;  1KK8 C;  1RRO A;  3BUM B;  1B4C A;  2L5Y A;  3HCM A;  1PAL A;  4WRI A;  3TUY C;  2EC6 C;  1FW4 A;  1B8R A;  2AMI A;  2L4H A;  3CR4 X;  4MSP A;  2HPS A;  2GTE A;  1JUO A;  1M31 A;  3NHI A;  2H2K A;  2BE6 A;  1K90 D;  2ZNE A;  1F55 A;  1XFV O;  1C7V A;  3KF9 A;  5CSJ A;  3O2P A;  3S0A A;  1TOP A;  1R2U A;  1KCY A;  3S0B A;  2WC6 A;  1L2O C;  1YRU B;  1Z2C B;  1DEL A;  1BOC A;  1GQM A;  1PK0 D;  1XK4 A;  1A2X A;  2F2P A;  4YGB B;  1K96 A;  1UUS A;  2K2A A;  2PAS A;  2KI6 C;  1CDM A;  3CZ2 A;  2SCP A;  1S5G Y;  1AP4 A;  2BKI B;  4D1E A;  1UWO A;  1OOF A;  2DOQ A;  3O4X A;  3OB2 B;  5F6T A;  4ETO A;  2Q91 A;  4PE1 A;  2L5X B;  1QWV A;  1Q80 A;  1QTX A;  2KGB C;  1CB1 A;  1BU3 A;  2LUC A;  4BY4 A;  2L2E A;  3CR5 X;  3DF0 A;  1L7Z A;  3PJI A;  1Z4H A;  2NZ0 A;  2K60 A;  1S6C A;  1CDL A;  2M7N A;  2OS8 B;  3DY9 A;  1B47 A;  2G2B A;  1JSA A;  2D8N A;  1LXF C;  1ZOT B;  2F3Z A;  2ZN9 A;  2E30 A;  3ZWH A;  1MQ1 A;  4ORA B;  1ALW A;  2WCL A;  1F8H A;  2K7O A;  5IBW A;  4YBH B;  1MXE A;  2A4J A;  1OOG A;  1F4O A;  2KQ6 A;  4A4C A;  2KLD A;  1QV0 A;  4HRH A;  1TN4 A;  4WQ2 A;  4DCK A;  2LVV A;  1CLL A;  1QIV A;  1SNL A;  3KHE A;  4MZL A;  1RFJ A;  2FJY A;  1LVC D;  3I5I C;  3BFH A;  3PSR A;  1KFX L;  3VRO A;  2L98 A;  1Y0V H;  2BCX A;  2KGR A;  4QJ3 B;  4AOM A;  2WCF A;  2QAC A;  1BMO A;  4JKT A;  2LP2 A;  1GM0 A;  1K94 A;  2JXC A;  2G9B A;  1R6P A;  1UHJ A;  2NCO A;  5B8I B;  2BL0 B;  3TZ1 A;  3PFV A;  1SR6 B;  4MZJ A;  2LLT A;  3CR2 A;  4JQ0 D;  1UHH A;  2HET A;  1DGV A;  4INW A;  1M63 B;  1BR4 B;  1NX0 A;  2WCB A;  5FYX A;  5BPJ A;  1XFX O;  5I2L A;  2WCH A;  1A75 A;  2BBN A;  3B86 A;  3I5F B;  1OZO A;  3RLZ A;  3SS3 A;  3B7A A;  3CZ0 A;  3L4L A;  5D69 A;  2IS9 A;  1KSO A;  1TCF A;  2M8U A;  3SS5 A;  2B1U A;  3I5H B;  3UO9 A;  1QV1 A;  3BOW A;  4ZCV A;  1M45 A;  4MLW A;  1A29 A;  2I18 A;  1IKU A;  1YR5 A;  2PVB A;  4PT1 A;  1CFF A;  4CFR A;  1B8C A;  3B88 A;  1DT7 B;  3ICB A;  1WRZ A;  1IGV A;  1S5G Z;  2KQY A;  4MRY A;  2K61 A;  2L4I A;  5DKN A;  4C0J A;  1JF0 A;  2JWW A;  2QEH A;  2NLN A;  2GV5 A;  2BEC A;  4XYN A;  3TDU A;  1UHK A;  4CPV A;  1BR1 B;  4N1G A;  4E68 A;  1KQM C;  1F70 A;  4I5K A;  2KPH A;  3WHU B;  4NDD A;  1J7O A;  1SRA A;  1SYM A;  3DVE A;  1OW4 A;  1SMG A;  2FOT A;  1CLM A;  2KAV A;  2ZFD A;  2JUL A;  5D3O A;  5KU1 A;  3BUX B;  1OMR A;  1DJZ A;  1SBJ A;  1YUS A;  1GJY A;  4INX A;  1SL8 A;  2LVI A;  5FI7 A;  2F3Y A;  4PDZ A;  1YUT A;  1QLK A;  3VRQ A;  3RM1 A;  2O5G A;  5DIC A;  4JWQ A;  1IRJ A;  1IQ5 A;  4OV2 A;  3D77 A;  1W7J B;  2MJW B;  4MN0 A;  2BL0 C;  1MHO A;  1DJI A;  1UHI A;  2F2O A;  2PAL A;  2Y1M A;  1RJV A;  3DVM A;  1SR6 C;  4GGN A;  1QX5 B;  1J7Q A;  3CZ1 A;  3OGN A;  1FPW A;  1G8I A;  1XO5 A;  2SAS A;  2KFF A;  1LKJ A;  3E3R A;  1QAT A;  1PRW A;  2JC2 A;  3FE6 A;  3D0Y A;  1D1O A;  3I5F C;  1F71 A;  2KSP A; 
#chains in the Genus database with same CATH homology
 1KFU S;  1CM4 A;  2WOR A;  3A8R A;  1CFD A;  3I5H C;  3VRP A;  4YI8 A;  1XA5 A;  1LA3 A;  1WDC B;  1YVL A;  3LLE A;  2JQ6 A;  2JPT A;  2LHL A;  1AJ4 A;  1PSR A;  1K9P A;  2HQ8 A;  2M97 A;  5CPV A;  4M2P A;  1OZS A;  4N1F A;  1S6J A;  5I8N A;  2H61 C;  4TNC A;  1JBA A;  3EKJ A;  1DJG A;  2KAX A;  3KO0 A;  1E8A A;  2LHI A;  1ODB A;  4MBE A;  4L9M A;  1JWD A;  4UPG A;  1ZFS A;  1IG5 A;  5G08 A;  3EVU A;  3QRX A;  5HKZ A;  1XFZ O;  5JJG A;  1SCM B;  5DKQ A;  2PSR A;  1QJT A;  3M0W A;  2KNE A;  1SW8 A;  1WRL A;  3DVK A;  2JT8 A;  4FTG A;  5CSI A;  3CWG A;  1AHR A;  2OTG B;  1OSA A;  1GGW A;  1QAS A;  5D7F A;  3SJS A;  1PVA A;  1V1F A;  1QX7 A;  2LMT A;  2M7L A;  2KBM A;  1FI5 A;  2WCE A;  1BF5 A;  1NPQ A;  2ZN8 A;  2K2F A;  4NQG A;  1OMV A;  1CTR A;  1J7R A;  2CTN A;  4P2Y B;  1TRF A;  4CLN A;  1OMD A;  3EVR A;  1EH2 A;  1JFJ A;  4C0K A;  2LE9 B;  2V53 A;  4DUQ A;  1HT9 A;  3CTN A;  3TS5 B;  4YGC B;  2BCA A;  1REC A;  1J1E A;  1K93 D;  2FCE A;  1M46 A;  3IQQ A;  1AK8 A;  4Q04 A;  2KHN A;  2LMV A;  1NWD A;  3LCP C;  3O4Y A;  2I94 A;  3OX5 A;  1CKK A;  1OQP A;  1Y1X A;  1KWO B;  2LLU A;  2CCM A;  2Y5I A;  1WDC C;  2JU0 A;  1UUR A;  2LMU A;  3JVT B;  1WLM A;  4OCI A;  1IWQ A;  1DJY A;  3VRR A;  2KOT A;  1BJF A;  1K9U A;  5GQQ C;  1DF0 B;  1XVJ A;  5ER4 X;  1CFC A;  1DTL A;  3JTD B;  4P5O E;  1SCV A;  1JC2 A;  1AJ5 A;  2LV7 A;  2KFG A;  1HQV A;  4N5X A;  3NSK A;  4GAO A;  5HKY A;  1YRT B;  2KI6 D;  4PE7 A;  1A4P A;  5CSF A;  4PHM A;  5KSZ A;  1EG4 A;  1IQ3 A;  1DJW A;  5ER5 A;  1S6I A;  1G33 A;  1LIN A;  2K7D A;  2LAP A;  1SCM C;  2F8P A;  3BXK A;  4DS7 A;  4QJ5 B;  1KFX S;  4HRE E;  1DJH A;  1KSM A;  1EJ3 A;  1BLQ A;  1NCZ A;  1NCY A;  4MVF A;  1S26 D;  3PAL A;  2OTG C;  3AAK A;  2ZRT A;  3MSE B;  1BOD A;  1FF1 A;  1PSB A;  3IQO A;  1U5I A;  1SKT A;  3BQ3 A;  4GUK A;  2JT0 A;  2JTZ A;  2MLE C;  2OS8 C;  2WC8 A;  4PHJ A;  1A03 A;  2K7C A;  1SPY A;  1OOJ A;  2L51 A;  4XJK A;  4GPL B;  1Y1A A;  3FWB A;  4A4B A;  1CNP A;  3TS5 C;  5DKR A;  1WLZ A;  3HX4 A;  4M2O A;  1VRK A;  2MLF C;  3DD4 A;  5AFP A;  1CLB A;  4WQ3 A;  2O60 A;  1OE9 B;  2MAZ A;  1KWO C;  2ZRS A;  1MR8 A;  2ZND A;  1EG3 A;  1DJX A;  1X02 A;  1TIZ A;  1B9A A;  3JVT C;  2CT9 A;  1NSH A;  1ZUZ A;  3WXA A;  1IJ5 A;  3KEV A;  1C07 A;  4GFT A;  2Y1N A;  2JXL A;  2RGI A;  4USL A;  2BCB A;  1CMF A;  2OPO A;  1UHN A;  2ZKM X;  4OR9 B;  2JNF A;  3FS7 A;  3JTD C;  1G4Y R;  4YGD B;  3GOF A;  5AEQ A;  2BKH B;  4CID A;  2I2R E;  5HKW A;  2M29 A;  1M39 A;  1WRK A;  4U8D A;  1YUR A;  1B7T Y;  2CBL A;  4PAL A;  4AQJ A;  1F4Q A;  1LA0 A;  4PE0 A;  2HQW A;  3OHM B;  3TDI A;  1CMG A;  3SIA A;  4ICB A;  4R1E A;  2NXQ A;  2GGZ A;  5JOL A;  2HF5 A;  1IJ6 A;  1SL9 A;  3SG5 A;  3D0Y B;  3LK1 A;  1K2H A;  1RWY A;  4PE4 A;  4PHN A;  5CSN A;  2KBI A;  4C0L A;  2MRD A;  1JFK A;  3NXA A;  3PN7 B;  1Y6W A;  4CFQ A;  2LVK A;  1QX2 A;  2MA2 A;  1PUL A;  3SG2 A;  1EL4 A;  2I7A A;  2CXJ A;  4GGF C;  1YX7 A;  3I5I B;  4F0Z B;  2M0R A;  4ORC B;  4I5L B;  1CM1 A;  2MHH A;  4PHK A;  5KTY A;  3PM8 A;  1TNX A;  3AKA A;  1QVI Y;  1NUB A;  1NX2 A;  3SG4 A;  1MF8 B;  5HLO A;  4JPZ B;  1N2D A;  1NX3 A;  1NCX A;  3BUO B;  2L50 A;  3NSL A;  3SG6 A;  1EXR A;  2COL B;  1K9K A;  5I2O A;  1JF2 A;  3SG7 A;  3K21 A;  1H4B A;  5AER A;  3WHT B;  3BUW B;  1ALV A;  3CGA A;  1H8B A;  1KK7 Z;  4YGA A;  2JRF A;  1NX1 A;  1Y1U A;  2EHB A;  2NCP A;  1B1G A;  2JT3 A;  3PLF B;  1N65 A;  2KI4 B;  3DF0 B;  4MRX A;  3VRN A;  2LM5 A;  3F45 A;  1K8U A;  1GGZ A;  1V1G A;  1QIW A;  1FBV A;  2LLS A;  4MZK A;  2KYC A;  3GK1 A;  3VGO A;  1CFP A;  3AKB A;  1NP8 A;  1SL7 A;  2BBM A;  1RK9 A;  2WOS A;  3DVJ A;  5TNC A;  1S36 A;  2KDH A;  2AUC A;  4YRU A;  1DVI A;  4GNK B;  3OX6 A;  2MBX A;  1C7W A;  3GK4 X;  4HSZ A;  2K8M B;  3EK8 A;  3NSI A;  3NSO A;  4NDB A;  2FCD A;  1MUX A;  1XYD A;  1B7T Z;  1BT6 A;  1K95 A;  4MEW A;  3PN7 C;  1NIW A;  1KQM B;  2M1K B;  2E6W A;  3C1V A;  1CDN A;  1PVB A;  1CDP A;  1AVS A;  1WY9 A;  1YUU A;  1TTX A;  2GGM A;  1DF0 A;  3WNX B;  2K0J A;  2M3W A;  1TCO B;  4I5N B;  4FQO A;  3CLN A;  3LL8 B;  5I2Q A;  4M2Q A;  2KFH A;  2JTT A;  1XK4 C;  1J1D A;  3I5G B;  2TN4 A;  3OB1 B;  3AAJ A;  4AQI A;  4DIR A;  4DRW A;  5K89 A;  1AUI B;  1S1E A;  1SY9 A;  1J55 A;  1XFW O;  1W7I B;  2F33 A;  2LAN A;  2LC5 A;  2M9G A;  5AXI A;  1IH0 A;  1A75 B;  1MWN A;  4OKH A;  1J7P A;  2M1U A;  1QS7 A;  1KQV A;  3D10 A;  1XFY O;  3FWC A;  1KK8 B;  4ZCU A;  3A4U B;  3TUY B;  2L0P A;  1QVI Z;  2EC6 B;  2M49 B;  3BOW B;  1ZMZ A;  2LNK A;  2KI4 C;  2Q4U A;  1U5I B;  2EGD A;  3OP0 A;  3CS1 A;  5PAL A;  2FJU B;  3O78 A;  1NYA A;  2H61 A;  1YVH A;  2P6B B;  2R2I A;  4XJK B;  5J3X A;  2WND A;  2PRU A;  3FIA A;  3IF7 A;  4GBA A;  1KK7 Y;  4ORB B;  1BG1 A;  1YX8 A;  2QPT A;  4BY5 A;  1FI6 A;  4GGF A;  1S3P A;  2LCP A;  3EVV A;  3H4S E;  3EK4 A;  3O6B A;  3PAT A;  3SG3 A;  1L2O B;  1TNP A;  2Y4Q A;  3BUN B;  1MXL C;  1B8L A;  3SIB A;  3ZNI A;  1N0Y A;  4PCW A;  2LVJ A;  1TNQ A;  2AAO A;  1RTP 1;  4HRG A;  2LP3 A;  3TDZ A;  3LK0 A;  2JNX A;  1DGU A;  3BYA A;  1KFU L;  3KPX A;  1XFU O;  1TNW A;  3EK7 A;  1ZAC A;  4QJ4 B;  2JZI A;  5HYD A;  2JOJ A;  3I5G C;  2VRG A;  3CZT X;  2BE4 A;  4YI9 A;  4YGE B;  3EKH A;  2PMY A;  2K7B A;  5AAN A;  4NDC A;  1F54 A;  1QLS A;  1QXP A;  2CNP A;  3GK2 A;  4I5J A;  2LUX A;  1YTZ C;  2KAY A;  4IL1 A;  5HLV A;  2KYF A;  2ISD A;  4OVN F;  1SK6 D;  1DMO A;  1UP5 A;  1KK8 C;  1RRO A;  3BUM B;  1B4C A;  4WRI A;  3HCM A;  1PAL A;  3TUY C;  2EC6 C;  1FW4 A;  1B8R A;  2AMI A;  2L4H A;  3CR4 X;  4MSP A;  2HPS A;  1JUO A;  1M31 A;  2H2K A;  2BE6 A;  1K90 D;  2ZNE A;  1F55 A;  1XFV O;  1C7V A;  3KF9 A;  5CSJ A;  3O2P A;  1TOP A;  1R2U A;  1KCY A;  1L2O C;  1YRU B;  1BOC A;  1GQM A;  1PK0 D;  1XK4 A;  1A2X A;  2F2P A;  4YGB B;  1K96 A;  1UUS A;  2K2A A;  2PAS A;  2KI6 C;  1CDM A;  1AP4 A;  2SCP A;  1S5G Y;  2BKI B;  4D1E A;  1UWO A;  3OB2 B;  2DOQ A;  5F6T A;  4ETO A;  2Q91 A;  4PE1 A;  2L5X B;  1Q80 A;  1QTX A;  2KGB C;  1CB1 A;  1BU3 A;  2LUC A;  4BY4 A;  2L2E A;  3CR5 X;  3DF0 A;  1L7Z A;  2NZ0 A;  1S6C A;  1CDL A;  2M7N A;  2OS8 B;  1B47 A;  2G2B A;  1JSA A;  2D8N A;  1LXF C;  1ZOT B;  2F3Z A;  2ZN9 A;  2E30 A;  3ZWH A;  1MQ1 A;  4ORA B;  1ALW A;  1F8H A;  2K7O A;  5IBW A;  4YBH B;  1MXE A;  2A4J A;  2KQ6 A;  1F4O A;  4A4C A;  1QV0 A;  4HRH A;  1TN4 A;  4WQ2 A;  4DCK A;  2LVV A;  1CLL A;  1QIV A;  1SNL A;  3KHE A;  4MZL A;  1RFJ A;  1LVC D;  3I5I C;  3PSR A;  1KFX L;  3VRO A;  2L98 A;  1Y0V H;  2BCX A;  2KGR A;  4QJ3 B;  4AOM A;  2WCF A;  2QAC A;  1BMO A;  2LP2 A;  1K94 A;  2JXC A;  2G9B A;  1R6P A;  1UHJ A;  2NCO A;  5B8I B;  2BL0 B;  3TZ1 A;  3PFV A;  1SR6 B;  4MZJ A;  2LLT A;  3CR2 A;  4JQ0 D;  1UHH A;  2HET A;  1DGV A;  1M63 B;  1BR4 B;  1NX0 A;  2WCB A;  5FYX A;  5BPJ A;  1XFX O;  5I2L A;  1A75 A;  2BBN A;  3I5F B;  1OZO A;  3RLZ A;  5D69 A;  2IS9 A;  1KSO A;  1TCF A;  2M8U A;  2B1U A;  3I5H B;  1QV1 A;  3BOW A;  4ZCV A;  1M45 A;  4MLW A;  1A29 A;  2I18 A;  1IKU A;  1YR5 A;  2PVB A;  1CFF A;  4CFR A;  1B8C A;  1DT7 B;  3ICB A;  1WRZ A;  1IGV A;  1S5G Z;  2KQY A;  4MRY A;  2K61 A;  2L4I A;  5DKN A;  4C0J A;  1JF0 A;  2JWW A;  2NLN A;  2GV5 A;  2BEC A;  4XYN A;  3TDU A;  1UHK A;  4CPV A;  1BR1 B;  4N1G A;  4E68 A;  1KQM C;  1F70 A;  4I5K A;  3WHU B;  4NDD A;  1J7O A;  1SRA A;  1SYM A;  3DVE A;  1SMG A;  2KAV A;  2FOT A;  1CLM A;  2ZFD A;  5KU1 A;  2JUL A;  3BUX B;  1OMR A;  1DJZ A;  1SBJ A;  1YUS A;  1GJY A;  1SL8 A;  2LVI A;  2F3Y A;  4PDZ A;  1YUT A;  1QLK A;  3VRQ A;  3RM1 A;  2O5G A;  4JWQ A;  1IRJ A;  1IQ5 A;  4OV2 A;  1W7J B;  2MJW B;  4MN0 A;  2BL0 C;  1MHO A;  1DJI A;  1UHI A;  2F2O A;  2PAL A;  2Y1M A;  1RJV A;  3DVM A;  1SR6 C;  4GGN A;  1QX5 B;  1J7Q A;  1FPW A;  1G8I A;  1XO5 A;  2SAS A;  2KFF A;  1LKJ A;  3E3R A;  1QAT A;  1PRW A;  2JC2 A;  3D0Y A;  1D1O A;  3I5F C;  1F71 A;  2KSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...