2JPTA

Structural changes induced in apo-s100a1 protein by the disulphide formation between its cys85 residue and b-mercaptoethanol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDEDGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title Structural and motional changes induced in apo-S100A1 protein by the disulfide formation between its Cys 85 residue and beta-mercaptoethanol
pubmed doi rcsb
source organism Bos taurus
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jptA00
1CFCA 1SYMA 1M31A 2JT3A 3VRRA 1YVHA 1OMDA 1CKKA 3EK4A 2M7NA 3KEVA 1UHHA 2PVBA 1XFYO 2KHNA 1TNWA 2M0RA 2WCEA 3CLNA 3BOWA 4GUKA 3SG6A 2LV7A 1LXFC 1OQPA 3HCMA 1WLZA 3PATA 4WQ2A 2KAYA 2R2IA 1KFUS 1SCMC 4I5KA 2JNFA 2K2AA 1ZUZA 2M1UA 1J1DA 5JJGA 2PALA 1AHRA 5B8IB 4OVNF 3I5FB 1F4OA 3AAJA 1G4YR 1N2DA 2O5GA 1BG1A 2M49B 2LMTA 4JPZB 1BOCA 1K9PA 2I94A 4YI8A 2OTGB 2E6WA 1CM4A 1CMFA 2HETA 1NX0A 4NQGA 2KYCA 1MXEA 1DTLA 2K61A 2LM5A 1BU3A 5CSFA 1U5IB 3KHEA 1YUSA 4YGBB 1TTXA 1EL4A 1DJHA 1J1EA 3TS5B 2LUCA 3KO0A 2LC5A 4FQOA 1DVIA 3JVTC 1BF5A 2JT8A 4DIRA 2I2RE 3CTNA 2FOTA 1OSAA 3PALA 4P5OE 1SBJA 2HQ8A 1QATA 2KYFA 2QACA 3WNXB 4OKHA 3I5HB 1WY9A 3SJSA 2BCXA 2QPTA 2JRFA 1DJZA 2WCFA 4BY5A 1KK7Y 1S5GZ 1QTXA 1IQ5A 2WC8A 3TDIA 2OTGC 2K8MB 3AKAA 1FI6A 4PDZA 1OOJA 4GBAA 5I8NA 2K7BA 4CIDA 1IGVA 1A75B 1E8AA 1WRKA 4DS7A 1F55A 2SCPA 1B7TY 1QV1A 2I18A 4N5XA 2M9GA 1FBVA 3TS5C 5G08A 4NDBA 3BYAA 2Q91A 3ICBA 5TNCA 1TCFA 4WRIA 2L4HA 4PALA 1L7ZA 4MBEA 1J55A 2KBMA 2FCDA 2BCAA 1JWDA 3CR2A 1G8IA 2LCPA 3O4YA 1GQMA 1DF0A 1NX2A 1DJXA 5I2LA 3EVUA 1CFPA 1Y6WA 2BKIB 1TIZA 4MEWA 1OZSA 1UHKA 2F3ZA 1KQMC 2M97A 1N65A 1EG4A 3GOFA 3RM1A 1XFWO 1IKUA 1JC2A 1OMVA 1S26D 1UWOA 5HLVA 1QV0A 1SK6D 2BE4A 2EC6C 3EK8A 4ETOA 3ZNIA 2MAZA 2CBLA 4USLA 2FCEA 4GNKB 4IL1A 3IQQA 1RTP1 1FW4A 1RJVA 1CM1A 2O60A 1NP8A 2JNXA 3A8RA 3CR5X 1F8HA 1YRTB 2I7AA 3DF0B 2K7DA 4PCWA 2F33A 1B8CA 1HQVA 1RWYA 2JC2A 1IG5A 3CR4X 3D0YA 5HKWA 4QJ5B 4MZLA 1GGZA 2MLEC 1Y1XA 3O6BA 5AFPA 1YUUA 1BR1B 1SCVA 2E30A 4XJKA 1YRUB 5GQQC 1LVCD 3ZWHA 1NPQA 2Y1NA 1BLQA 1UHIA 1B47A 1SCMB 2MHHA 3M0WA 4HSZA 2PSRA 1CDNA 1NCZA 1WDCB 1BT6A 1F4QA 1MUXA 2RGIA 2HF5A 1KSMA 4MVFA 2KAVA 1DJIA 1MHOA 1NCYA 2CNPA 4E68A 3F45A 3CWGA 2KQ6A 3JTDB 3OB2B 4ZCVA 2L0PA 3WHUB 2KFGA 3FWBA 4MZJA 4MN0A 1XFVO 1YUTA 1CNPA 2JTTA 2LP2A 1TNXA 4F0ZB 1DMOA 1H4BA 2JZIA 2ZNDA 1MWNA 3DVJA 3BUNB 3O2PA 4C0LA 2H2KA 5HKYA 3CGAA 3DVMA 1V1FA 2NZ0A 4YGDB 3JVTB 5CSNA 1JFKA 5CPVA 1Q80A 3SG7A 1CLBA 4GGFC 3EK7A 1WDCC 2AUCA 1FF1A 4M2QA 1KFXS 1CFDA 1TRFA 3KPXA 1TN4A 2BE6A 2M1KB 4CFQA 2H61A 2L51A 5AERA 5KU1A 2VRGA 2F2OA 1RROA 1MR8A 3O78A 3JTDC 2JULA 1S6JA 2ZKMX 1VRKA 2DOQA 3C1VA 1KK8C 1K8UA 2JQ6A 2M3WA 3QRXA 3PSRA 5IBWA 2MA2A 1NSHA 2WORA 3GK4X 1F71A 1H8BA 2LHLA 2NLNA 1YX7A 1FPWA 1SR6C 1LA0A 5CSIA 4MLWA 1JF2A 1S36A 1B9AA 2KBIA 2P6BB 2BBMA 2AMIA 1KWOC 1LKJA 1DT7B 2OPOA 5I2OA 1TNQA 1OZOA 1AP4A 1EG3A 1QX2A 2M7LA 4ZCUA 3SG3A 3OX5A 2LVIA 4QJ3B 1KQMB 1NIWA 5DKNA 4AOMA 1R6PA 3CS1A 2KFHA 3TDZA 2JOJA 3DVEA 4U8DA 1B8RA 1QX7A 3NSKA 1C7WA 2EC6B 1D1OA 2JT0A 1AVSA 3SIAA 1JSAA 2NCPA 1A03A 3SG4A 1BR4B 1ALVA 4YGCB 3PN7C 3BQ3A 1HT9A 1NX1A 4YBHB 3SIBA 1Y0VH 3WXAA 1S5GY 2SASA 1PVBA 4AQJA 3VGOA 1KFUL 1M39A 5KTYA 2L4IA 1FI5A 2G2BA 2L2EA 1S3PA 2MJWB 1U5IA 3VROA 1B4CA 1DGUA 1DJWA 1UHNA 1YX8A 3FS7A 4DUQA 2EHBA 5HYDA 1J7OA 1KQVA 1XFZO 2F2PA 2COLB 4GAOA 3RLZA 1CDMA 1A4PA 1Y1UA 3OHMB 1R2UA 2GGZA 2K2FA 1K96A 2LMUA 4GGNA 1QS7A 1PRWA 1S6CA 4N1FA 1EH2A 2LANA 3LLEA 2NCOA 4I5LB 4L9MA 2KI4B 3LK1A 2CCMA 1SW8A 1CFFA 4UPGA 3E3RA 5PALA 1ZFSA 1KCYA 1G33A 2G9BA 2KI6D 3TZ1A 3BUXB 5HKZA 1A75A 3BUMB 5HLOA 1JF0A 1JUOA 1UHJA 1XK4C 1K9KA 2JXLA 4JWQA 3BOWB 1XVJA 4FTGA 4YRUA 2L50A 1N0YA 3BUOB 2NXQA 3I5GB 2LLSA 2LVJA 1SMGA 1DJGA 3MSEB 1AJ5A 3OP0A 2BKHB 1QVIZ 1NX3A 2ZN9A 1DGVA 1TCOB 2LP3A 2MLFC 4MZKA 3IF7A 1GGWA 1DJYA 2KI4C 4M2PA 4CFRA 4PHKA 2GV5A 1XA5A 1KK8B 2KI6C 2WOSA 3SG5A 4ORCB 1CLLA 1C07A 2K7OA 2PRUA 1J7PA 4N1GA 2BECA 4NDCA 4P2YB 2WNDA 3CZTX 2ZFDA 4R1EA 1J7QA 1SR6B 2FJUB 3NSLA 1K2HA 2Q4UA 2ZN8A 3EKHA 4PHJA 5D7FA 2OS8C 4PE1A 5JOLA 2LUXA 4ORAB 1BJFA 1WRZA 2JU0A 1KWOB 1MXLC 2BCBA 3I5GC 4BY4A 2KQYA 3DF0A 4HRHA 4DRWA 3VRQA 2ZRTA 4D1EA 2H61C 3DVKA 3NXAA 1Y1AA 2LMVA 5D69A 3LK0A 3EKJA 1UURA 1K9UA 2F8PA 2LAPA 5AEQA 3PM8A 1QXPA 4GFTA 2HPSA 1BMOA 4OCIA 3D10A 1RK9A 3PLFB 2AAOA 5I2QA 2LVVA 1IWQA 4CPVA 1ODBA 4XYNA 1LA3A 1WRLA 4AQIA 1SKTA 4ORBB 1MQ1A 2TN4A 1LINA 2Y1MA 2HQWA 1CDLA 2WCBA 5BPJA 1F54A 1W7JB 1SPYA 1IJ5A 2ZRSA 4GGFA 1SL9A 4OR9B 4PE4A 1M63B 1RFJA 5ER4X 1CMGA 2GGMA 1K95A 3PN7B 3TUYB 3EVRA 1QX5B 5DKRA 1SNLA 1QIVA 3GK2A 1DF0B 3KF9A 4MRXA 1L2OB 2CTNA 1S6IA 1YTZC 2JXCA 1JBAA 1AJ4A 1EJ3A 2BL0B 1KK7Z 2K7CA 1QLKA 2LLTA 1OMRA 1PULA 3TDUA 3I5IB 4WQ3A 2BBNA 3VRNA 3DD4A 4M2OA 3A4UB 2KNEA 2CXJA 2EGDA 4DCKA 4PHMA 2LLUA 1YR5A 3GK1A 1A29A 1B7TZ 3AKBA 2F3YA 2LVKA 4PE7A 1OE9B 1F70A 2ISDA 1ALWA 4C0KA 1XYDA 2PMYA 1WLMA 3I5FC 3TUYC 1C7VA 1QIWA 2CT9A 2MRDA 3FIAA 4OV2A 1EXRA 2LHIA 1PSBA 3BUWB 1L2OC 5KSZA 1XFUO 1YVLA 3K21A 4CLNA 3AAKA 3D0YB 3IQOA 2PASA 2BL0C 3LCPC 2JWWA 3EVVA 1J7RA 2Y4QA 1KFXL 1PVAA 4XJKB 3I5IC 4A4CA 2LE9B 1IH0A 5AANA 1QLSA 4C0JA 1NYAA 3OB1B 4HREE 1IQ3A 4YGAA 2KFFA 1TNPA 5F6TA 1SL8A 4PHNA 1UP5A 1AK8A 3I5HC 2A4JA 1YURA 2L5XB 1CTRA 1GJYA 2KGBC 1K93D 1ZOTB 1NWDA 1ZMZA 5ER5A 1CB1A 2KDHA 1A2XA 4PE0A 4QJ4B 3VRPA 1KSOA 1QASA 3OX6A 4ICBA 1ZACA 1B1GA 1BODA 1UUSA 2KOTA 1V1GA 1M45A 4MSPA 3H4SE 2D8NA 3PFVA 4JQ0D 1NUBA 1IJ6A 2KAXA 2JTZA 2M29A 2OS8B 4I5JA 5J3XA 1NCXA 4NDDA 3BXKA 5CSJA 2ZNEA 3FWCA 4HRGA 4I5NB 1IRJA 1K90D 1XFXO 1SL7A 1B8LA 4A4BA 4YI9A 4MRYA 1SRAA 2LNKA 5K89A 1MF8B 1AUIB 1X02A 1K94A 3LL8B 3NSOA 5AXIA 1M46A 2KSPA 2B1UA 1XK4A 1W7IB 1RECA 1XO5A 1PK0D 3HX4A 4Q04A 2Y5IA 1PALA 1PSRA 1TOPA 2V53A 5DKQA 5FYXA 3SG2A 1QJTA 3NSIA 2K0JA 3WHTB 4YGEB 1SY9A 2M8UA 1JFJA 4GPLB 1CLMA 2KGRA 1QVIY 4TNCA 2MBXA 2JPTA 2IS9A 2L98A 1CDPA 1S1EA
chains in the Genus database with same CATH superfamily
1CFCA 1SYMA 2PYQA 1M31A 2JT3A 1DQEA 3VRRA 1YVHA 1OMDA 3FE8A 3EK4A 2M7NA 1CKKA 2QEOA 1UHHA 3KEVA 2PVBA 1XFYO 2KHNA 3D74A 1TNWA 2M0RA 2WCEA 3CLNA 3BOWA 4GUKA 3O4XA 2LV7A 1LXFC 1OQPA 1C3ZA 3HCMA 3SG6A 1WLZA 3FE9A 3PATA 4WQ2A 2KAYA 2R2IA 1KFUS 1TWOA 1SCMC 3R1OA 2JNFA 2K2AA 4I5KA 1ZUZA 2M1UA 1J1DA 5JJGA 2PALA 2BNXA 1AHRA 5B8IB 2ERBA 4OVNF 3I5FB 1F4OA 3AAJA 1G4YR 1N2DA 2O5GA 1BG1A 2M49B 2LMTA 1P28A 4JPZB 1BOCA 1K9PA 2I94A 4YI8A 2OTGB 2E6WA 1CM4A 1CMFA 2HETA 1NX0A 3L4LA 4NQGA 2KYCA 1MXEA 1DTLA 2K61A 2LM5A 1BU3A 5CSFA 1U5IB 3KHEA 1YUSA 4YGBB 1TTXA 1EL4A 1DJHA 1J1EA 3TS5B 2LUCA 3DYEA 3SS5A 3KO0A 2LC5A 4FQOA 1DVIA 3JVTC 1BF5A 2JT8A 1OOGA 4DIRA 2I2RE 3CTNA 2FOTA 1OSAA 5HL1A 1DELA 3PALA 4P5OE 1SBJA 2WCLA 2HQ8A 1QATA 2KYFA 2QACA 3WNXB 4OKHA 3I5HB 1WY9A 3SJSA 2BCXA 2QPTA 2JRFA 1DJZA 2WCFA 4BY5A 1KK7Y 1S5GZ 1QTXA 3S0FA 1IQ5A 2WC8A 3TDIA 2OTGC 2K8MB 3AKAA 3EG5B 1FI6A 3L4AA 4PDZA 1OOJA 4GBAA 5I8NA 2K7BA 4CIDA 1IGVA 1A75B 1E8AA 1WRKA 4DS7A 1F55A 2SCPA 1B7TY 1QV1A 2I18A 4N5XA 2M9GA 2BAPA 1FBVA 3TS5C 5G08A 3NGVA 4NDBA 3BYAA 2Q91A 3ICBA 5TNCA 1TCFA 4WRIA 2L4HA 4PALA 1L7ZA 4MBEA 1J55A 2KBMA 2FCDA 2BCAA 1JWDA 3CR2A 3L47A 1G8IA 2LCPA 3O4YA 1GQMA 1DF0A 1NX2A 1DJXA 5I2LA 3EVUA 1CFPA 1Y6WA 2BKIB 3CDNA 1TIZA 4MEWA 1OZSA 1UHKA 2F3ZA 1KQMC 2M97A 1N65A 1EG4A 3GOFA 3RM1A 1XFWO 1IKUA 1JC2A 2WCMA 2FJYA 1OMVA 1S26D 1UWOA 5HLVA 1QV0A 1SK6D 2BE4A 3UO9A 2EC6C 3EK8A 1SSEB 4ETOA 3ZNIA 2MAZA 2CBLA 2YGUA 4USLA 2FCEA 4GNKB 4IL1A 3IQQA 1RTP1 1FW4A 1RJVA 1CM1A 2KLDA 2O60A 5DICA 1NP8A 2JNXA 3A8RA 3CR5X 1F8HA 1YRTB 2I7AA 3DF0B 2K7DA 4FQTA 4PCWA 2F33A 1B8CA 1HQVA 1RWYA 2JC2A 1IG5A 3CR4X 3D0YA 5HKWA 4QJ5B 4MZLA 1GGZA 2MLEC 1Y1XA 3S0DA 2QDIA 3O6BA 5AFPA 3S0AA 1YUUA 1BR1B 1SCVA 2E30A 2H8VA 1YRUB 4XJKA 5GQQC 1LVCD 3ZWHA 1NPQA 2Y1NA 1BLQA 1UHIA 4IJ7A 1B47A 1SCMB 2MHHA 3M0WA 4HSZA 3B88A 2PSRA 1CDNA 1NCZA 2JPOA 1WDCB 1BT6A 1F4QA 1MUXA 2RGIA 4PT1A 2HF5A 1KSMA 4MVFA 3N7HA 2KAVA 1DJIA 1MHOA 1NCYA 2CNPA 4E68A 3F45A 3CWGA 2KQ6A 3JTDB 3OB2B 2GTEA 4ZCVA 2L0PA 2L5YA 2KFGA 3FWBA 4MZJA 4MN0A 3WHUB 1XFVO 1YUTA 1CNPA 2JTTA 2LP2A 1TNXA 4F0ZB 1DMOA 1H4BA 2JZIA 2ZNDA 3S0BA 1MWNA 3DVJA 3BUNB 3O2PA 4C0LA 2H2KA 5HKYA 3CGAA 3DVMA 1V1FA 2NZ0A 4YGDB 3FE6A 3D78A 3JVTB 5CSNA 1JFKA 5CPVA 1Q80A 3SG7A 1CLBA 4GGFC 3EK7A 1WDCC 2AUCA 1FF1A 4M2QA 1KFXS 1CFDA 1TRFA 3KPXA 1TN4A 2BE6A 2M1KB 4CFQA 2H61A 2L51A 5AERA 5KU1A 2VRGA 2F2OA 1RROA 1MR8A 3O78A 3JTDC 2JULA 1S6JA 2QEVA 2ZKMX 1VRKA 2DOQA 3C1VA 3S0EA 3R1PA 4OZDA 1KK8C 1K8UA 2JQ6A 2M3WA 3QRXA 2PQLA 1QWVA 3K1EA 3PSRA 5IBWA 2MA2A 1NSHA 2WORA 3GK4X 1F71A 1H8BA 2LHLA 2NLNA 1YX7A 1FPWA 1SR6C 1LA0A 5CSIA 4MLWA 1JF2A 1S36A 1B9AA 2KBIA 2P6BB 2BBMA 3DXLA 2AMIA 1KWOC 1LKJA 1DT7B 5FI6A 2OPOA 5I2OA 1TNQA 1OZOA 3CZ1A 1AP4A 1EG3A 3CZ0A 1QX2A 2M7LA 4ZCUA 3SG3A 1OOFA 3OX5A 2LVIA 4QJ3B 1KQMB 1NIWA 5DKNA 4AOMA 1R6PA 3CS1A 2KFHA 3TDZA 2JOJA 3DVEA 4U8DA 1B8RA 1QX7A 3NSKA 3BFAA 1C7WA 2EC6B 1D1OA 2JT0A 3RZSA 1AVSA 2P71A 3SIAA 1JSAA 2QEBA 2NCPA 1A03A 5FI7A 3SG4A 1BR4B 1ALVA 3UNWA 4YGCB 3PN7C 3BQ3A 3PM2A 1HT9A 1NX1A 4YBHB 1XFRA 1Y0VH 3SIBA 3WXAA 1S5GY 3D73A 2SASA 1PVBA 4AQJA 3VGOA 1KFUL 1OW4A 1M39A 3NHIA 3VB1A 2L4IA 1W9ZA 5KTYA 1FI5A 2G2BA 2L2EA 1LS8A 1S3PA 2MJWB 1U5IA 3VROA 1B4CA 1DGUA 1DJWA 1UHNA 1YX8A 3BFBA 3FS7A 4DUQA 2EHBA 5HYDA 1J7OA 1KQVA 1XFZO 2F2PA 2WCKA 2COLB 2P70A 4GAOA 3RLZA 1CDMA 1A4PA 1Y1UA 3OHMB 1R2UA 2GGZA 2KLEA 2K2FA 1K96A 2LMUA 4GGNA 1QS7A 4F7FA 1PRWA 1S6CA 4N1FA 1C3YA 1EH2A 2LANA 3LLEA 2NCOA 4I5LB 4L9MA 1DC1A 2KI4B 3LK1A 2CCMA 1SW8A 3B7AA 1CFFA 4UPGA 3E3RA 5PALA 1ZFSA 1KCYA 1G33A 2G9BA 2KI6D 3TZ1A 3BUXB 5HKZA 3DY9A 1A75A 3BUMB 5HLOA 1JF0A 1JUOA 1UHJA 1XK4C 1K9KA 2JXLA 4JWQA 3BOWB 1XVJA 4FTGA 4YRUA 2L50A 1N0YA 3BUOB 2NXQA 3CYZA 3I5GB 2LLSA 2LVJA 1SMGA 1DJGA 3MSEB 1AJ5A 3OP0A 2BKHB 1QVIZ 1NX3A 2ZN9A 1DGVA 1TCOB 2LP3A 2MLFC 3OGNA 3IF7A 1Z4HA 4MZKA 1DJYA 2KI4C 4M2PA 1GGWA 4CFRA 3D77A 4PHKA 2GV5A 3PJIA 2K60A 1XA5A 1KK8B 2KI6C 2WOSA 3SG5A 4ORCB 1CLLA 1C07A 2K7OA 2PRUA 1J7PA 4N1GA 2BECA 4NDCA 4P2YB 5FI2A 2WNDA 3CZTX 2ZFDA 3B87A 3D76A 4R1EA 1J7QA 3OBVA 1SR6B 2FJUB 3NSLA 1K2HA 2Q4UA 2ZN8A 3EKHA 4PHJA 5D7FA 2OS8C 4PE1A 5JOLA 2LUXA 4ORAB 1BJFA 1WRZA 2JU0A 1KWOB 1MXLC 2BCBA 3I5GC 4INWA 4BY4A 2KQYA 1Z2CB 3DF0A 4HRHA 4DRWA 3VRQA 2ZRTA 4D1EA 2H61C 3DVKA 3NXAA 1Y1AA 2LMVA 5D69A 3LK0A 3EKJA 1UURA 1K9UA 2F8PA 2LAPA 5AEQA 3PM8A 1QXPA 3SS4A 4GFTA 2HPSA 1BMOA 4OCIA 3D10A 1RK9A 3PLFB 2AAOA 5I2QA 2LVVA 1IWQA 4CPVA 1ODBA 3BJHA 4XYNA 1LA3A 1WRLA 4AQIA 1SKTA 4ORBB 1MQ1A 2TN4A 1LINA 2Y1MA 2WCHA 1IIOA 2HQWA 1CDLA 2WCBA 5BPJA 1F54A 1W7JB 1SPYA 1IJ5A 2ZRSA 1T14A 3CABA 1SL9A 4GGFA 4OR9B 4PE4A 1M63B 1RFJA 5ER4X 1CMGA 2GGMA 1K95A 3PN7B 3R72A 3TUYB 3EVRA 1QX5B 5DKRA 3R1VA 2KPHA 1SNLA 1QIVA 3GK2A 1DF0B 3KF9A 4MRXA 1L2OB 2CTNA 1S6IA 1YTZC 2JXCA 1JBAA 1AJ4A 1EJ3A 2BL0B 1KK7Z 2K7CA 5I94A 1QLKA 2LLTA 1OMRA 1PULA 3TDUA 3I5IB 1OOHA 3Q8IA 2BBNA 4WQ3A 3VRNA 3DD4A 4M2OA 3A4UB 2KNEA 3SS3A 3QMEA 2CXJA 2EGDA 4DCKA 4PHMA 2LLUA 1YR5A 5EL2A 2QEHA 3GK1A 1A29A 1B7TZ 3AKBA 2F3YA 2LVKA 4PE7A 1OE9B 1F70A 2ISDA 1ALWA 4C0KA 1XYDA 2PMYA 1WLMA 3I5FC 3TUYC 4JKTA 1C7VA 1QIWA 2CT9A 2MRDA 3FIAA 4OV2A 1EXRA 2LHIA 1PSBA 3BUWB 1L2OC 5KSZA 1XFUO 1YVLA 3DZTA 1ORGA 3AAKA 3K21A 3D0YB 3IQOA 4CLNA 2L2CA 2PASA 1DEKA 2BL0C 3LCPC 2JWWA 2WCJA 1J7RA 2Y4QA 3EVVA 1KFXL 1PVAA 2WC5A 3I5IC 4XJKB 4A4CA 2LE9B 1IH0A 5AANA 4INXA 1QLSA 4C0JA 1NYAA 3OB1B 4HREE 3S0GA 4YGAA 1IQ3A 2KFFA 1TNPA 1TUZA 5F6TA 1SL8A 4PHNA 1UP5A 1AK8A 3I5HC 2A4JA 1YURA 2L5XB 1CTRA 1GJYA 2KGBC 1GM0A 1K93D 1ZOTB 1NWDA 1ZMZA 3B6XA 5ER5A 1CB1A 2KDHA 1A2XA 4PE0A 4QJ4B 3VRPA 1KSOA 1QASA 3OX6A 4ICBA 1ZACA 1B1GA 1BODA 1UUSA 2KOTA 3CZ2A 1V1GA 1M45A 1TUJA 4MSPA 3H4SE 2D8NA 3PFVA 4JQ0D 1NUBA 1IJ6A 2KAXA 2JTZA 3BFHA 2M29A 2OS8B 4I5JA 5J3XA 1NCXA 4NDDA 3BXKA 5CSJA 2ZNEA 3FWCA 4HRGA 4I5NB 1IRJA 1K90D 1XFXO 1SL7A 1B8LA 4A4BA 4YI9A 4MRYA 1SRAA 2LNKA 5K89A 1MF8B 1AUIB 1X02A 1K94A 3IVTA 3LL8B 3NSOA 1M46A 3D75A 5AXIA 2KSPA 2B1UA 1XK4A 1W7IB 1RECA 1XO5A 1PK0D 3HX4A 4Q04A 2Y5IA 1PALA 1PSRA 1TOPA 2V53A 5D3OA 4KYNA 5DKQA 5FYXA 1QJTA 3SG2A 3V2LA 3NSIA 2K0JA 3WHTB 4YGEB 1SY9A 2M8UA 3NHTA 4GPLB 1CLMA 1JFJA 2KGRA 1QVIY 4TNCA 2MBXA 2WC6A 2JPTA 3B86A 2IS9A 2L98A 1OOIX 1CDPA 1S1EA 4JD9A
chains in the Genus database with same CATH topology
1CFCA 1SYMA 1M31A 2JT3A 3VRRA 1YVHA 1OMDA 1CKKA 3EK4A 2M7NA 3KEVA 1UHHA 2PVBA 1XFYO 2KHNA 1TNWA 2M0RA 2WCEA 3CLNA 3BOWA 4GUKA 3SG6A 2LV7A 1LXFC 1OQPA 3HCMA 1WLZA 3PATA 4WQ2A 2KAYA 2R2IA 1KFUS 1SCMC 4I5KA 2JNFA 2K2AA 1ZUZA 2M1UA 1J1DA 5JJGA 2PALA 1AHRA 5B8IB 4OVNF 3I5FB 1F4OA 3AAJA 1G4YR 1N2DA 2O5GA 1BG1A 2M49B 2LMTA 4JPZB 1BOCA 1K9PA 2I94A 4YI8A 2OTGB 2E6WA 1CM4A 1CMFA 2HETA 1NX0A 4NQGA 2KYCA 1MXEA 1DTLA 2K61A 2LM5A 1BU3A 5CSFA 1U5IB 3KHEA 1YUSA 4YGBB 1TTXA 1EL4A 1DJHA 1J1EA 3TS5B 2LUCA 3KO0A 2LC5A 4FQOA 1DVIA 3JVTC 1BF5A 2JT8A 4DIRA 2I2RE 3CTNA 2FOTA 1OSAA 3PALA 4P5OE 1SBJA 2HQ8A 1QATA 2KYFA 2QACA 3WNXB 4OKHA 3I5HB 1WY9A 3SJSA 2BCXA 2QPTA 2JRFA 1DJZA 2WCFA 4BY5A 1KK7Y 1S5GZ 1QTXA 1IQ5A 2WC8A 3TDIA 2OTGC 2K8MB 3AKAA 1FI6A 4PDZA 1OOJA 4GBAA 5I8NA 2K7BA 4CIDA 1IGVA 1A75B 1E8AA 1WRKA 4DS7A 1F55A 2SCPA 1B7TY 1QV1A 2I18A 4N5XA 2M9GA 1FBVA 3TS5C 5G08A 4NDBA 3BYAA 2Q91A 3ICBA 5TNCA 1TCFA 4WRIA 2L4HA 4PALA 1L7ZA 4MBEA 1J55A 2KBMA 2FCDA 2BCAA 1JWDA 3CR2A 1G8IA 2LCPA 3O4YA 1GQMA 1DF0A 1NX2A 1DJXA 5I2LA 3EVUA 1CFPA 1Y6WA 2BKIB 1TIZA 4MEWA 1OZSA 1UHKA 2F3ZA 1KQMC 2M97A 1N65A 1EG4A 3GOFA 3RM1A 1XFWO 1IKUA 1JC2A 1OMVA 1S26D 1UWOA 5HLVA 1QV0A 1SK6D 2BE4A 2EC6C 3EK8A 4ETOA 3ZNIA 2MAZA 2CBLA 4USLA 2FCEA 4GNKB 4IL1A 3IQQA 1RTP1 1FW4A 1RJVA 1CM1A 2O60A 1NP8A 2JNXA 3A8RA 3CR5X 1F8HA 1YRTB 2I7AA 3DF0B 2K7DA 4PCWA 2F33A 1B8CA 1HQVA 1RWYA 2JC2A 1IG5A 3CR4X 3D0YA 5HKWA 4QJ5B 4MZLA 1GGZA 2MLEC 1Y1XA 3O6BA 5AFPA 1YUUA 1BR1B 1SCVA 2E30A 4XJKA 1YRUB 5GQQC 1LVCD 3ZWHA 1NPQA 2Y1NA 1BLQA 1UHIA 1B47A 1SCMB 2MHHA 3M0WA 4HSZA 2PSRA 1CDNA 1NCZA 1WDCB 1BT6A 1F4QA 1MUXA 2RGIA 2HF5A 1KSMA 4MVFA 2KAVA 1DJIA 1MHOA 1NCYA 2CNPA 4E68A 3F45A 3CWGA 2KQ6A 3JTDB 3OB2B 4ZCVA 2L0PA 3WHUB 2KFGA 3FWBA 4MZJA 4MN0A 1XFVO 1YUTA 1CNPA 2JTTA 2LP2A 1TNXA 4F0ZB 1DMOA 1H4BA 2JZIA 2ZNDA 1MWNA 3DVJA 3BUNB 3O2PA 4C0LA 2H2KA 5HKYA 3CGAA 3DVMA 1V1FA 2NZ0A 4YGDB 3JVTB 5CSNA 1JFKA 5CPVA 1Q80A 3SG7A 1CLBA 4GGFC 3EK7A 1WDCC 2AUCA 1FF1A 4M2QA 1KFXS 1CFDA 1TRFA 3KPXA 1TN4A 2BE6A 2M1KB 4CFQA 2H61A 2L51A 5AERA 5KU1A 2VRGA 2F2OA 1RROA 1MR8A 3O78A 3JTDC 2JULA 1S6JA 2ZKMX 1VRKA 2DOQA 3C1VA 1KK8C 1K8UA 2JQ6A 2M3WA 3QRXA 3PSRA 5IBWA 2MA2A 1NSHA 2WORA 3GK4X 1F71A 1H8BA 2LHLA 2NLNA 1YX7A 1FPWA 1SR6C 1LA0A 5CSIA 4MLWA 1JF2A 1S36A 1B9AA 2KBIA 2P6BB 2BBMA 2AMIA 1KWOC 1LKJA 1DT7B 2OPOA 5I2OA 1TNQA 1OZOA 1AP4A 1EG3A 1QX2A 2M7LA 4ZCUA 3SG3A 3OX5A 2LVIA 4QJ3B 1KQMB 1NIWA 5DKNA 4AOMA 1R6PA 3CS1A 2KFHA 3TDZA 2JOJA 3DVEA 4U8DA 1B8RA 1QX7A 3NSKA 1C7WA 2EC6B 1D1OA 2JT0A 1AVSA 3SIAA 1JSAA 2NCPA 1A03A 3SG4A 1BR4B 1ALVA 4YGCB 3PN7C 3BQ3A 1HT9A 1NX1A 4YBHB 3SIBA 1Y0VH 3WXAA 1S5GY 2SASA 1PVBA 4AQJA 3VGOA 1KFUL 1M39A 5KTYA 2L4IA 1FI5A 2G2BA 2L2EA 1S3PA 2MJWB 1U5IA 3VROA 1B4CA 1DGUA 1DJWA 1UHNA 1YX8A 3FS7A 4DUQA 2EHBA 5HYDA 1J7OA 1KQVA 1XFZO 2F2PA 2COLB 4GAOA 3RLZA 1CDMA 1A4PA 1Y1UA 3OHMB 1R2UA 2GGZA 2K2FA 1K96A 2LMUA 4GGNA 1QS7A 1PRWA 1S6CA 4N1FA 1EH2A 2LANA 3LLEA 2NCOA 4I5LB 4L9MA 2KI4B 3LK1A 2CCMA 1SW8A 1CFFA 4UPGA 3E3RA 5PALA 1ZFSA 1KCYA 1G33A 2G9BA 2KI6D 3TZ1A 3BUXB 5HKZA 1A75A 3BUMB 5HLOA 1JF0A 1JUOA 1UHJA 1XK4C 1K9KA 2JXLA 4JWQA 3BOWB 1XVJA 4FTGA 4YRUA 2L50A 1N0YA 3BUOB 2NXQA 3I5GB 2LLSA 2LVJA 1SMGA 1DJGA 3MSEB 1AJ5A 3OP0A 2BKHB 1QVIZ 1NX3A 2ZN9A 1DGVA 1TCOB 2LP3A 2MLFC 4MZKA 3IF7A 1GGWA 1DJYA 2KI4C 4M2PA 4CFRA 4PHKA 2GV5A 1XA5A 1KK8B 2KI6C 2WOSA 3SG5A 4ORCB 1CLLA 1C07A 2K7OA 2PRUA 1J7PA 4N1GA 2BECA 4NDCA 4P2YB 2WNDA 3CZTX 2ZFDA 4R1EA 1J7QA 1SR6B 2FJUB 3NSLA 1K2HA 2Q4UA 2ZN8A 3EKHA 4PHJA 5D7FA 2OS8C 4PE1A 5JOLA 2LUXA 4ORAB 1BJFA 1WRZA 2JU0A 1KWOB 1MXLC 2BCBA 3I5GC 4BY4A 2KQYA 3DF0A 4HRHA 4DRWA 3VRQA 2ZRTA 4D1EA 2H61C 3DVKA 3NXAA 1Y1AA 2LMVA 5D69A 3LK0A 3EKJA 1UURA 1K9UA 2F8PA 2LAPA 5AEQA 3PM8A 1QXPA 4GFTA 2HPSA 1BMOA 4OCIA 3D10A 1RK9A 3PLFB 2AAOA 5I2QA 2LVVA 1IWQA 4CPVA 1ODBA 4XYNA 1LA3A 1WRLA 4AQIA 1SKTA 4ORBB 1MQ1A 2TN4A 1LINA 2Y1MA 2HQWA 1CDLA 2WCBA 5BPJA 1F54A 1W7JB 1SPYA 1IJ5A 2ZRSA 4GGFA 1SL9A 4OR9B 4PE4A 1M63B 1RFJA 5ER4X 1CMGA 2GGMA 1K95A 3PN7B 3TUYB 3EVRA 1QX5B 5DKRA 1SNLA 1QIVA 3GK2A 1DF0B 3KF9A 4MRXA 1L2OB 2CTNA 1S6IA 1YTZC 2JXCA 1JBAA 1AJ4A 1EJ3A 2BL0B 1KK7Z 2K7CA 1QLKA 2LLTA 1OMRA 1PULA 3TDUA 3I5IB 4WQ3A 2BBNA 3VRNA 3DD4A 4M2OA 3A4UB 2KNEA 2CXJA 2EGDA 4DCKA 4PHMA 2LLUA 1YR5A 3GK1A 1A29A 1B7TZ 3AKBA 2F3YA 2LVKA 4PE7A 1OE9B 1F70A 2ISDA 1ALWA 4C0KA 1XYDA 2PMYA 1WLMA 3I5FC 3TUYC 1C7VA 1QIWA 2CT9A 2MRDA 3FIAA 4OV2A 1EXRA 2LHIA 1PSBA 3BUWB 1L2OC 5KSZA 1XFUO 1YVLA 3K21A 4CLNA 3AAKA 3D0YB 3IQOA 2PASA 2BL0C 3LCPC 2JWWA 3EVVA 1J7RA 2Y4QA 1KFXL 1PVAA 4XJKB 3I5IC 4A4CA 2LE9B 1IH0A 5AANA 1QLSA 4C0JA 1NYAA 3OB1B 4HREE 1IQ3A 4YGAA 2KFFA 1TNPA 5F6TA 1SL8A 4PHNA 1UP5A 1AK8A 3I5HC 2A4JA 1YURA 2L5XB 1CTRA 1GJYA 2KGBC 1K93D 1ZOTB 1NWDA 1ZMZA 5ER5A 1CB1A 2KDHA 1A2XA 4PE0A 4QJ4B 3VRPA 1KSOA 1QASA 3OX6A 4ICBA 1ZACA 1B1GA 1BODA 1UUSA 2KOTA 1V1GA 1M45A 4MSPA 3H4SE 2D8NA 3PFVA 4JQ0D 1NUBA 1IJ6A 2KAXA 2JTZA 2M29A 2OS8B 4I5JA 5J3XA 1NCXA 4NDDA 3BXKA 5CSJA 2ZNEA 3FWCA 4HRGA 4I5NB 1IRJA 1K90D 1XFXO 1SL7A 1B8LA 4A4BA 4YI9A 4MRYA 1SRAA 2LNKA 5K89A 1MF8B 1AUIB 1X02A 1K94A 3LL8B 3NSOA 5AXIA 1M46A 2KSPA 2B1UA 1XK4A 1W7IB 1RECA 1XO5A 1PK0D 3HX4A 4Q04A 2Y5IA 1PALA 1PSRA 1TOPA 2V53A 5DKQA 5FYXA 3SG2A 1QJTA 3NSIA 2K0JA 3WHTB 4YGEB 1SY9A 2M8UA 1JFJA 4GPLB 1CLMA 2KGRA 1QVIY 4TNCA 2MBXA 2JPTA 2IS9A 2L98A 1CDPA 1S1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFC A;  1SYM A;  1M31 A;  2JT3 A;  3VRR A;  1YVH A;  1OMD A;  1CKK A;  3EK4 A;  2M7N A;  3KEV A;  1UHH A;  2PVB A;  1XFY O;  2KHN A;  1TNW A;  2M0R A;  2WCE A;  3CLN A;  3BOW A;  4GUK A;  3SG6 A;  2LV7 A;  1LXF C;  1OQP A;  3HCM A;  1WLZ A;  3PAT A;  4WQ2 A;  2KAY A;  2R2I A;  1KFU S;  1SCM C;  4I5K A;  2JNF A;  2K2A A;  1ZUZ A;  2M1U A;  1J1D A;  5JJG A;  2PAL A;  1AHR A;  5B8I B;  4OVN F;  3I5F B;  1F4O A;  3AAJ A;  1G4Y R;  1N2D A;  2O5G A;  1BG1 A;  2M49 B;  2LMT A;  4JPZ B;  1BOC A;  1K9P A;  2I94 A;  4YI8 A;  2OTG B;  2E6W A;  1CM4 A;  1CMF A;  2HET A;  1NX0 A;  4NQG A;  2KYC A;  1MXE A;  1DTL A;  2K61 A;  2LM5 A;  1BU3 A;  5CSF A;  1U5I B;  3KHE A;  1YUS A;  4YGB B;  1TTX A;  1EL4 A;  1DJH A;  1J1E A;  3TS5 B;  2LUC A;  3KO0 A;  2LC5 A;  4FQO A;  1DVI A;  3JVT C;  1BF5 A;  2JT8 A;  4DIR A;  2I2R E;  3CTN A;  2FOT A;  1OSA A;  3PAL A;  4P5O E;  1SBJ A;  2HQ8 A;  1QAT A;  2KYF A;  2QAC A;  3WNX B;  4OKH A;  3I5H B;  1WY9 A;  3SJS A;  2BCX A;  2QPT A;  2JRF A;  1DJZ A;  2WCF A;  4BY5 A;  1KK7 Y;  1S5G Z;  1QTX A;  1IQ5 A;  2WC8 A;  3TDI A;  2OTG C;  2K8M B;  3AKA A;  1FI6 A;  4PDZ A;  1OOJ A;  4GBA A;  5I8N A;  2K7B A;  4CID A;  1IGV A;  1A75 B;  1E8A A;  1WRK A;  4DS7 A;  1F55 A;  2SCP A;  1B7T Y;  1QV1 A;  2I18 A;  4N5X A;  2M9G A;  1FBV A;  3TS5 C;  5G08 A;  4NDB A;  3BYA A;  2Q91 A;  3ICB A;  5TNC A;  1TCF A;  4WRI A;  2L4H A;  4PAL A;  1L7Z A;  4MBE A;  1J55 A;  2KBM A;  2FCD A;  2BCA A;  1JWD A;  3CR2 A;  1G8I A;  2LCP A;  3O4Y A;  1GQM A;  1DF0 A;  1NX2 A;  1DJX A;  5I2L A;  3EVU A;  1CFP A;  1Y6W A;  2BKI B;  1TIZ A;  4MEW A;  1OZS A;  1UHK A;  2F3Z A;  1KQM C;  2M97 A;  1N65 A;  1EG4 A;  3GOF A;  3RM1 A;  1XFW O;  1IKU A;  1JC2 A;  1OMV A;  1S26 D;  1UWO A;  5HLV A;  1QV0 A;  1SK6 D;  2BE4 A;  2EC6 C;  3EK8 A;  4ETO A;  3ZNI A;  2MAZ A;  2CBL A;  4USL A;  2FCE A;  4GNK B;  4IL1 A;  3IQQ A;  1RTP 1;  1FW4 A;  1RJV A;  1CM1 A;  2O60 A;  1NP8 A;  2JNX A;  3A8R A;  3CR5 X;  1F8H A;  1YRT B;  2I7A A;  3DF0 B;  2K7D A;  4PCW A;  2F33 A;  1B8C A;  1HQV A;  1RWY A;  2JC2 A;  1IG5 A;  3CR4 X;  3D0Y A;  5HKW A;  4QJ5 B;  4MZL A;  1GGZ A;  2MLE C;  1Y1X A;  3O6B A;  5AFP A;  1YUU A;  1BR1 B;  1SCV A;  2E30 A;  4XJK A;  1YRU B;  5GQQ C;  1LVC D;  3ZWH A;  1NPQ A;  2Y1N A;  1BLQ A;  1UHI A;  1B47 A;  1SCM B;  2MHH A;  3M0W A;  4HSZ A;  2PSR A;  1CDN A;  1NCZ A;  1WDC B;  1BT6 A;  1F4Q A;  1MUX A;  2RGI A;  2HF5 A;  1KSM A;  4MVF A;  2KAV A;  1DJI A;  1MHO A;  1NCY A;  2CNP A;  4E68 A;  3F45 A;  3CWG A;  2KQ6 A;  3JTD B;  3OB2 B;  4ZCV A;  2L0P A;  3WHU B;  2KFG A;  3FWB A;  4MZJ A;  4MN0 A;  1XFV O;  1YUT A;  1CNP A;  2JTT A;  2LP2 A;  1TNX A;  4F0Z B;  1DMO A;  1H4B A;  2JZI A;  2ZND A;  1MWN A;  3DVJ A;  3BUN B;  3O2P A;  4C0L A;  2H2K A;  5HKY A;  3CGA A;  3DVM A;  1V1F A;  2NZ0 A;  4YGD B;  3JVT B;  5CSN A;  1JFK A;  5CPV A;  1Q80 A;  3SG7 A;  1CLB A;  4GGF C;  3EK7 A;  1WDC C;  2AUC A;  1FF1 A;  4M2Q A;  1KFX S;  1CFD A;  1TRF A;  3KPX A;  1TN4 A;  2BE6 A;  2M1K B;  4CFQ A;  2H61 A;  2L51 A;  5AER A;  5KU1 A;  2VRG A;  2F2O A;  1RRO A;  1MR8 A;  3O78 A;  3JTD C;  2JUL A;  1S6J A;  2ZKM X;  1VRK A;  2DOQ A;  3C1V A;  1KK8 C;  1K8U A;  2JQ6 A;  2M3W A;  3QRX A;  3PSR A;  5IBW A;  2MA2 A;  1NSH A;  2WOR A;  3GK4 X;  1F71 A;  1H8B A;  2LHL A;  2NLN A;  1YX7 A;  1FPW A;  1SR6 C;  1LA0 A;  5CSI A;  4MLW A;  1JF2 A;  1S36 A;  1B9A A;  2KBI A;  2P6B B;  2BBM A;  2AMI A;  1KWO C;  1LKJ A;  1DT7 B;  2OPO A;  5I2O A;  1TNQ A;  1OZO A;  1AP4 A;  1EG3 A;  1QX2 A;  2M7L A;  4ZCU A;  3SG3 A;  3OX5 A;  2LVI A;  4QJ3 B;  1KQM B;  1NIW A;  5DKN A;  4AOM A;  1R6P A;  3CS1 A;  2KFH A;  3TDZ A;  2JOJ A;  3DVE A;  4U8D A;  1B8R A;  1QX7 A;  3NSK A;  1C7W A;  2EC6 B;  1D1O A;  2JT0 A;  1AVS A;  3SIA A;  1JSA A;  2NCP A;  1A03 A;  3SG4 A;  1BR4 B;  1ALV A;  4YGC B;  3PN7 C;  3BQ3 A;  1HT9 A;  1NX1 A;  4YBH B;  3SIB A;  1Y0V H;  3WXA A;  1S5G Y;  2SAS A;  1PVB A;  4AQJ A;  3VGO A;  1KFU L;  1M39 A;  5KTY A;  2L4I A;  1FI5 A;  2G2B A;  2L2E A;  1S3P A;  2MJW B;  1U5I A;  3VRO A;  1B4C A;  1DGU A;  1DJW A;  1UHN A;  1YX8 A;  3FS7 A;  4DUQ A;  2EHB A;  5HYD A;  1J7O A;  1KQV A;  1XFZ O;  2F2P A;  2COL B;  4GAO A;  3RLZ A;  1CDM A;  1A4P A;  1Y1U A;  3OHM B;  1R2U A;  2GGZ A;  2K2F A;  1K96 A;  2LMU A;  4GGN A;  1QS7 A;  1PRW A;  1S6C A;  4N1F A;  1EH2 A;  2LAN A;  3LLE A;  2NCO A;  4I5L B;  4L9M A;  2KI4 B;  3LK1 A;  2CCM A;  1SW8 A;  1CFF A;  4UPG A;  3E3R A;  5PAL A;  1ZFS A;  1KCY A;  1G33 A;  2G9B A;  2KI6 D;  3TZ1 A;  3BUX B;  5HKZ A;  1A75 A;  3BUM B;  5HLO A;  1JF0 A;  1JUO A;  1UHJ A;  1XK4 C;  1K9K A;  2JXL A;  4JWQ A;  3BOW B;  1XVJ A;  4FTG A;  4YRU A;  2L50 A;  1N0Y A;  3BUO B;  2NXQ A;  3I5G B;  2LLS A;  2LVJ A;  1SMG A;  1DJG A;  3MSE B;  1AJ5 A;  3OP0 A;  2BKH B;  1QVI Z;  1NX3 A;  2ZN9 A;  1DGV A;  1TCO B;  2LP3 A;  2MLF C;  4MZK A;  3IF7 A;  1GGW A;  1DJY A;  2KI4 C;  4M2P A;  4CFR A;  4PHK A;  2GV5 A;  1XA5 A;  1KK8 B;  2KI6 C;  2WOS A;  3SG5 A;  4ORC B;  1CLL A;  1C07 A;  2K7O A;  2PRU A;  1J7P A;  4N1G A;  2BEC A;  4NDC A;  4P2Y B;  2WND A;  3CZT X;  2ZFD A;  4R1E A;  1J7Q A;  1SR6 B;  2FJU B;  3NSL A;  1K2H A;  2Q4U A;  2ZN8 A;  3EKH A;  4PHJ A;  5D7F A;  2OS8 C;  4PE1 A;  5JOL A;  2LUX A;  4ORA B;  1BJF A;  1WRZ A;  2JU0 A;  1KWO B;  1MXL C;  2BCB A;  3I5G C;  4BY4 A;  2KQY A;  3DF0 A;  4HRH A;  4DRW A;  3VRQ A;  2ZRT A;  4D1E A;  2H61 C;  3DVK A;  3NXA A;  1Y1A A;  2LMV A;  5D69 A;  3LK0 A;  3EKJ A;  1UUR A;  1K9U A;  2F8P A;  2LAP A;  5AEQ A;  3PM8 A;  1QXP A;  4GFT A;  2HPS A;  1BMO A;  4OCI A;  3D10 A;  1RK9 A;  3PLF B;  2AAO A;  5I2Q A;  2LVV A;  1IWQ A;  4CPV A;  1ODB A;  4XYN A;  1LA3 A;  1WRL A;  4AQI A;  1SKT A;  4ORB B;  1MQ1 A;  2TN4 A;  1LIN A;  2Y1M A;  2HQW A;  1CDL A;  2WCB A;  5BPJ A;  1F54 A;  1W7J B;  1SPY A;  1IJ5 A;  2ZRS A;  4GGF A;  1SL9 A;  4OR9 B;  4PE4 A;  1M63 B;  1RFJ A;  5ER4 X;  1CMG A;  2GGM A;  1K95 A;  3PN7 B;  3TUY B;  3EVR A;  1QX5 B;  5DKR A;  1SNL A;  1QIV A;  3GK2 A;  1DF0 B;  3KF9 A;  4MRX A;  1L2O B;  2CTN A;  1S6I A;  1YTZ C;  2JXC A;  1JBA A;  1AJ4 A;  1EJ3 A;  2BL0 B;  1KK7 Z;  2K7C A;  1QLK A;  2LLT A;  1OMR A;  1PUL A;  3TDU A;  3I5I B;  4WQ3 A;  2BBN A;  3VRN A;  3DD4 A;  4M2O A;  3A4U B;  2KNE A;  2CXJ A;  2EGD A;  4DCK A;  4PHM A;  2LLU A;  1YR5 A;  3GK1 A;  1A29 A;  1B7T Z;  3AKB A;  2F3Y A;  2LVK A;  4PE7 A;  1OE9 B;  1F70 A;  2ISD A;  1ALW A;  4C0K A;  1XYD A;  2PMY A;  1WLM A;  3I5F C;  3TUY C;  1C7V A;  1QIW A;  2CT9 A;  2MRD A;  3FIA A;  4OV2 A;  1EXR A;  2LHI A;  1PSB A;  3BUW B;  1L2O C;  5KSZ A;  1XFU O;  1YVL A;  3K21 A;  4CLN A;  3AAK A;  3D0Y B;  3IQO A;  2PAS A;  2BL0 C;  3LCP C;  2JWW A;  3EVV A;  1J7R A;  2Y4Q A;  1KFX L;  1PVA A;  4XJK B;  3I5I C;  4A4C A;  2LE9 B;  1IH0 A;  5AAN A;  1QLS A;  4C0J A;  1NYA A;  3OB1 B;  4HRE E;  1IQ3 A;  4YGA A;  2KFF A;  1TNP A;  5F6T A;  1SL8 A;  4PHN A;  1UP5 A;  1AK8 A;  3I5H C;  2A4J A;  1YUR A;  2L5X B;  1CTR A;  1GJY A;  2KGB C;  1K93 D;  1ZOT B;  1NWD A;  1ZMZ A;  5ER5 A;  1CB1 A;  2KDH A;  1A2X A;  4PE0 A;  4QJ4 B;  3VRP A;  1KSO A;  1QAS A;  3OX6 A;  4ICB A;  1ZAC A;  1B1G A;  1BOD A;  1UUS A;  2KOT A;  1V1G A;  1M45 A;  4MSP A;  3H4S E;  2D8N A;  3PFV A;  4JQ0 D;  1NUB A;  1IJ6 A;  2KAX A;  2JTZ A;  2M29 A;  2OS8 B;  4I5J A;  5J3X A;  1NCX A;  4NDD A;  3BXK A;  5CSJ A;  2ZNE A;  3FWC A;  4HRG A;  4I5N B;  1IRJ A;  1K90 D;  1XFX O;  1SL7 A;  1B8L A;  4A4B A;  4YI9 A;  4MRY A;  1SRA A;  2LNK A;  5K89 A;  1MF8 B;  1AUI B;  1X02 A;  1K94 A;  3LL8 B;  3NSO A;  5AXI A;  1M46 A;  2KSP A;  2B1U A;  1XK4 A;  1W7I B;  1REC A;  1XO5 A;  1PK0 D;  3HX4 A;  4Q04 A;  2Y5I A;  1PAL A;  1PSR A;  1TOP A;  2V53 A;  5DKQ A;  5FYX A;  3SG2 A;  1QJT A;  3NSI A;  2K0J A;  3WHT B;  4YGE B;  1SY9 A;  2M8U A;  1JFJ A;  4GPL B;  1CLM A;  2KGR A;  1QVI Y;  4TNC A;  2MBX A;  2JPT A;  2IS9 A;  2L98 A;  1CDP A;  1S1E A; 
#chains in the Genus database with same CATH topology
 1CFC A;  1SYM A;  2PYQ A;  1M31 A;  2JT3 A;  1DQE A;  3VRR A;  1YVH A;  1OMD A;  3FE8 A;  3EK4 A;  2M7N A;  1CKK A;  2QEO A;  1UHH A;  3KEV A;  2PVB A;  1XFY O;  2KHN A;  3D74 A;  1TNW A;  2M0R A;  2WCE A;  3CLN A;  3BOW A;  4GUK A;  3O4X A;  2LV7 A;  1LXF C;  1OQP A;  1C3Z A;  3HCM A;  3SG6 A;  1WLZ A;  3FE9 A;  3PAT A;  4WQ2 A;  2KAY A;  2R2I A;  1KFU S;  1TWO A;  1SCM C;  3R1O A;  2JNF A;  2K2A A;  4I5K A;  1ZUZ A;  2M1U A;  1J1D A;  5JJG A;  2PAL A;  2BNX A;  1AHR A;  5B8I B;  2ERB A;  4OVN F;  3I5F B;  1F4O A;  3AAJ A;  1G4Y R;  1N2D A;  2O5G A;  1BG1 A;  2M49 B;  2LMT A;  1P28 A;  4JPZ B;  1BOC A;  1K9P A;  2I94 A;  4YI8 A;  2OTG B;  2E6W A;  1CM4 A;  1CMF A;  2HET A;  1NX0 A;  3L4L A;  4NQG A;  2KYC A;  1MXE A;  1DTL A;  2K61 A;  2LM5 A;  1BU3 A;  5CSF A;  1U5I B;  3KHE A;  1YUS A;  4YGB B;  1TTX A;  1EL4 A;  1DJH A;  1J1E A;  3TS5 B;  2LUC A;  3DYE A;  3SS5 A;  3KO0 A;  2LC5 A;  4FQO A;  1DVI A;  3JVT C;  1BF5 A;  2JT8 A;  1OOG A;  4DIR A;  2I2R E;  3CTN A;  2FOT A;  1OSA A;  5HL1 A;  1DEL A;  3PAL A;  4P5O E;  1SBJ A;  2WCL A;  2HQ8 A;  1QAT A;  2KYF A;  2QAC A;  3WNX B;  4OKH A;  3I5H B;  1WY9 A;  3SJS A;  2BCX A;  2QPT A;  2JRF A;  1DJZ A;  2WCF A;  4BY5 A;  1KK7 Y;  1S5G Z;  1QTX A;  3S0F A;  1IQ5 A;  2WC8 A;  3TDI A;  2OTG C;  2K8M B;  3AKA A;  3EG5 B;  1FI6 A;  3L4A A;  4PDZ A;  1OOJ A;  4GBA A;  5I8N A;  2K7B A;  4CID A;  1IGV A;  1A75 B;  1E8A A;  1WRK A;  4DS7 A;  1F55 A;  2SCP A;  1B7T Y;  1QV1 A;  2I18 A;  4N5X A;  2M9G A;  2BAP A;  1FBV A;  3TS5 C;  5G08 A;  3NGV A;  4NDB A;  3BYA A;  2Q91 A;  3ICB A;  5TNC A;  1TCF A;  4WRI A;  2L4H A;  4PAL A;  1L7Z A;  4MBE A;  1J55 A;  2KBM A;  2FCD A;  2BCA A;  1JWD A;  3CR2 A;  3L47 A;  1G8I A;  2LCP A;  3O4Y A;  1GQM A;  1DF0 A;  1NX2 A;  1DJX A;  5I2L A;  3EVU A;  1CFP A;  1Y6W A;  2BKI B;  3CDN A;  1TIZ A;  4MEW A;  1OZS A;  1UHK A;  2F3Z A;  1KQM C;  2M97 A;  1N65 A;  1EG4 A;  3GOF A;  3RM1 A;  1XFW O;  1IKU A;  1JC2 A;  2WCM A;  2FJY A;  1OMV A;  1S26 D;  1UWO A;  5HLV A;  1QV0 A;  1SK6 D;  2BE4 A;  3UO9 A;  2EC6 C;  3EK8 A;  1SSE B;  4ETO A;  3ZNI A;  2MAZ A;  2CBL A;  2YGU A;  4USL A;  2FCE A;  4GNK B;  4IL1 A;  3IQQ A;  1RTP 1;  1FW4 A;  1RJV A;  1CM1 A;  2KLD A;  2O60 A;  5DIC A;  1NP8 A;  2JNX A;  3A8R A;  3CR5 X;  1F8H A;  1YRT B;  2I7A A;  3DF0 B;  2K7D A;  4FQT A;  4PCW A;  2F33 A;  1B8C A;  1HQV A;  1RWY A;  2JC2 A;  1IG5 A;  3CR4 X;  3D0Y A;  5HKW A;  4QJ5 B;  4MZL A;  1GGZ A;  2MLE C;  1Y1X A;  3S0D A;  2QDI A;  3O6B A;  5AFP A;  3S0A A;  1YUU A;  1BR1 B;  1SCV A;  2E30 A;  2H8V A;  1YRU B;  4XJK A;  5GQQ C;  1LVC D;  3ZWH A;  1NPQ A;  2Y1N A;  1BLQ A;  1UHI A;  4IJ7 A;  1B47 A;  1SCM B;  2MHH A;  3M0W A;  4HSZ A;  3B88 A;  2PSR A;  1CDN A;  1NCZ A;  2JPO A;  1WDC B;  1BT6 A;  1F4Q A;  1MUX A;  2RGI A;  4PT1 A;  2HF5 A;  1KSM A;  4MVF A;  3N7H A;  2KAV A;  1DJI A;  1MHO A;  1NCY A;  2CNP A;  4E68 A;  3F45 A;  3CWG A;  2KQ6 A;  3JTD B;  3OB2 B;  2GTE A;  4ZCV A;  2L0P A;  2L5Y A;  2KFG A;  3FWB A;  4MZJ A;  4MN0 A;  3WHU B;  1XFV O;  1YUT A;  1CNP A;  2JTT A;  2LP2 A;  1TNX A;  4F0Z B;  1DMO A;  1H4B A;  2JZI A;  2ZND A;  3S0B A;  1MWN A;  3DVJ A;  3BUN B;  3O2P A;  4C0L A;  2H2K A;  5HKY A;  3CGA A;  3DVM A;  1V1F A;  2NZ0 A;  4YGD B;  3FE6 A;  3D78 A;  3JVT B;  5CSN A;  1JFK A;  5CPV A;  1Q80 A;  3SG7 A;  1CLB A;  4GGF C;  3EK7 A;  1WDC C;  2AUC A;  1FF1 A;  4M2Q A;  1KFX S;  1CFD A;  1TRF A;  3KPX A;  1TN4 A;  2BE6 A;  2M1K B;  4CFQ A;  2H61 A;  2L51 A;  5AER A;  5KU1 A;  2VRG A;  2F2O A;  1RRO A;  1MR8 A;  3O78 A;  3JTD C;  2JUL A;  1S6J A;  2QEV A;  2ZKM X;  1VRK A;  2DOQ A;  3C1V A;  3S0E A;  3R1P A;  4OZD A;  1KK8 C;  1K8U A;  2JQ6 A;  2M3W A;  3QRX A;  2PQL A;  1QWV A;  3K1E A;  3PSR A;  5IBW A;  2MA2 A;  1NSH A;  2WOR A;  3GK4 X;  1F71 A;  1H8B A;  2LHL A;  2NLN A;  1YX7 A;  1FPW A;  1SR6 C;  1LA0 A;  5CSI A;  4MLW A;  1JF2 A;  1S36 A;  1B9A A;  2KBI A;  2P6B B;  2BBM A;  3DXL A;  2AMI A;  1KWO C;  1LKJ A;  1DT7 B;  5FI6 A;  2OPO A;  5I2O A;  1TNQ A;  1OZO A;  3CZ1 A;  1AP4 A;  1EG3 A;  3CZ0 A;  1QX2 A;  2M7L A;  4ZCU A;  3SG3 A;  1OOF A;  3OX5 A;  2LVI A;  4QJ3 B;  1KQM B;  1NIW A;  5DKN A;  4AOM A;  1R6P A;  3CS1 A;  2KFH A;  3TDZ A;  2JOJ A;  3DVE A;  4U8D A;  1B8R A;  1QX7 A;  3NSK A;  3BFA A;  1C7W A;  2EC6 B;  1D1O A;  2JT0 A;  3RZS A;  1AVS A;  2P71 A;  3SIA A;  1JSA A;  2QEB A;  2NCP A;  1A03 A;  5FI7 A;  3SG4 A;  1BR4 B;  1ALV A;  3UNW A;  4YGC B;  3PN7 C;  3BQ3 A;  3PM2 A;  1HT9 A;  1NX1 A;  4YBH B;  1XFR A;  1Y0V H;  3SIB A;  3WXA A;  1S5G Y;  3D73 A;  2SAS A;  1PVB A;  4AQJ A;  3VGO A;  1KFU L;  1OW4 A;  1M39 A;  3NHI A;  3VB1 A;  2L4I A;  1W9Z A;  5KTY A;  1FI5 A;  2G2B A;  2L2E A;  1LS8 A;  1S3P A;  2MJW B;  1U5I A;  3VRO A;  1B4C A;  1DGU A;  1DJW A;  1UHN A;  1YX8 A;  3BFB A;  3FS7 A;  4DUQ A;  2EHB A;  5HYD A;  1J7O A;  1KQV A;  1XFZ O;  2F2P A;  2WCK A;  2COL B;  2P70 A;  4GAO A;  3RLZ A;  1CDM A;  1A4P A;  1Y1U A;  3OHM B;  1R2U A;  2GGZ A;  2KLE A;  2K2F A;  1K96 A;  2LMU A;  4GGN A;  1QS7 A;  4F7F A;  1PRW A;  1S6C A;  4N1F A;  1C3Y A;  1EH2 A;  2LAN A;  3LLE A;  2NCO A;  4I5L B;  4L9M A;  1DC1 A;  2KI4 B;  3LK1 A;  2CCM A;  1SW8 A;  3B7A A;  1CFF A;  4UPG A;  3E3R A;  5PAL A;  1ZFS A;  1KCY A;  1G33 A;  2G9B A;  2KI6 D;  3TZ1 A;  3BUX B;  5HKZ A;  3DY9 A;  1A75 A;  3BUM B;  5HLO A;  1JF0 A;  1JUO A;  1UHJ A;  1XK4 C;  1K9K A;  2JXL A;  4JWQ A;  3BOW B;  1XVJ A;  4FTG A;  4YRU A;  2L50 A;  1N0Y A;  3BUO B;  2NXQ A;  3CYZ A;  3I5G B;  2LLS A;  2LVJ A;  1SMG A;  1DJG A;  3MSE B;  1AJ5 A;  3OP0 A;  2BKH B;  1QVI Z;  1NX3 A;  2ZN9 A;  1DGV A;  1TCO B;  2LP3 A;  2MLF C;  3OGN A;  3IF7 A;  1Z4H A;  4MZK A;  1DJY A;  2KI4 C;  4M2P A;  1GGW A;  4CFR A;  3D77 A;  4PHK A;  2GV5 A;  3PJI A;  2K60 A;  1XA5 A;  1KK8 B;  2KI6 C;  2WOS A;  3SG5 A;  4ORC B;  1CLL A;  1C07 A;  2K7O A;  2PRU A;  1J7P A;  4N1G A;  2BEC A;  4NDC A;  4P2Y B;  5FI2 A;  2WND A;  3CZT X;  2ZFD A;  3B87 A;  3D76 A;  4R1E A;  1J7Q A;  3OBV A;  1SR6 B;  2FJU B;  3NSL A;  1K2H A;  2Q4U A;  2ZN8 A;  3EKH A;  4PHJ A;  5D7F A;  2OS8 C;  4PE1 A;  5JOL A;  2LUX A;  4ORA B;  1BJF A;  1WRZ A;  2JU0 A;  1KWO B;  1MXL C;  2BCB A;  3I5G C;  4INW A;  4BY4 A;  2KQY A;  1Z2C B;  3DF0 A;  4HRH A;  4DRW A;  3VRQ A;  2ZRT A;  4D1E A;  2H61 C;  3DVK A;  3NXA A;  1Y1A A;  2LMV A;  5D69 A;  3LK0 A;  3EKJ A;  1UUR A;  1K9U A;  2F8P A;  2LAP A;  5AEQ A;  3PM8 A;  1QXP A;  3SS4 A;  4GFT A;  2HPS A;  1BMO A;  4OCI A;  3D10 A;  1RK9 A;  3PLF B;  2AAO A;  5I2Q A;  2LVV A;  1IWQ A;  4CPV A;  1ODB A;  3BJH A;  4XYN A;  1LA3 A;  1WRL A;  4AQI A;  1SKT A;  4ORB B;  1MQ1 A;  2TN4 A;  1LIN A;  2Y1M A;  2WCH A;  1IIO A;  2HQW A;  1CDL A;  2WCB A;  5BPJ A;  1F54 A;  1W7J B;  1SPY A;  1IJ5 A;  2ZRS A;  1T14 A;  3CAB A;  1SL9 A;  4GGF A;  4OR9 B;  4PE4 A;  1M63 B;  1RFJ A;  5ER4 X;  1CMG A;  2GGM A;  1K95 A;  3PN7 B;  3R72 A;  3TUY B;  3EVR A;  1QX5 B;  5DKR A;  3R1V A;  2KPH A;  1SNL A;  1QIV A;  3GK2 A;  1DF0 B;  3KF9 A;  4MRX A;  1L2O B;  2CTN A;  1S6I A;  1YTZ C;  2JXC A;  1JBA A;  1AJ4 A;  1EJ3 A;  2BL0 B;  1KK7 Z;  2K7C A;  5I94 A;  1QLK A;  2LLT A;  1OMR A;  1PUL A;  3TDU A;  3I5I B;  1OOH A;  3Q8I A;  2BBN A;  4WQ3 A;  3VRN A;  3DD4 A;  4M2O A;  3A4U B;  2KNE A;  3SS3 A;  3QME A;  2CXJ A;  2EGD A;  4DCK A;  4PHM A;  2LLU A;  1YR5 A;  5EL2 A;  2QEH A;  3GK1 A;  1A29 A;  1B7T Z;  3AKB A;  2F3Y A;  2LVK A;  4PE7 A;  1OE9 B;  1F70 A;  2ISD A;  1ALW A;  4C0K A;  1XYD A;  2PMY A;  1WLM A;  3I5F C;  3TUY C;  4JKT A;  1C7V A;  1QIW A;  2CT9 A;  2MRD A;  3FIA A;  4OV2 A;  1EXR A;  2LHI A;  1PSB A;  3BUW B;  1L2O C;  5KSZ A;  1XFU O;  1YVL A;  3DZT A;  1ORG A;  3AAK A;  3K21 A;  3D0Y B;  3IQO A;  4CLN A;  2L2C A;  2PAS A;  1DEK A;  2BL0 C;  3LCP C;  2JWW A;  2WCJ A;  1J7R A;  2Y4Q A;  3EVV A;  1KFX L;  1PVA A;  2WC5 A;  3I5I C;  4XJK B;  4A4C A;  2LE9 B;  1IH0 A;  5AAN A;  4INX A;  1QLS A;  4C0J A;  1NYA A;  3OB1 B;  4HRE E;  3S0G A;  4YGA A;  1IQ3 A;  2KFF A;  1TNP A;  1TUZ A;  5F6T A;  1SL8 A;  4PHN A;  1UP5 A;  1AK8 A;  3I5H C;  2A4J A;  1YUR A;  2L5X B;  1CTR A;  1GJY A;  2KGB C;  1GM0 A;  1K93 D;  1ZOT B;  1NWD A;  1ZMZ A;  3B6X A;  5ER5 A;  1CB1 A;  2KDH A;  1A2X A;  4PE0 A;  4QJ4 B;  3VRP A;  1KSO A;  1QAS A;  3OX6 A;  4ICB A;  1ZAC A;  1B1G A;  1BOD A;  1UUS A;  2KOT A;  3CZ2 A;  1V1G A;  1M45 A;  1TUJ A;  4MSP A;  3H4S E;  2D8N A;  3PFV A;  4JQ0 D;  1NUB A;  1IJ6 A;  2KAX A;  2JTZ A;  3BFH A;  2M29 A;  2OS8 B;  4I5J A;  5J3X A;  1NCX A;  4NDD A;  3BXK A;  5CSJ A;  2ZNE A;  3FWC A;  4HRG A;  4I5N B;  1IRJ A;  1K90 D;  1XFX O;  1SL7 A;  1B8L A;  4A4B A;  4YI9 A;  4MRY A;  1SRA A;  2LNK A;  5K89 A;  1MF8 B;  1AUI B;  1X02 A;  1K94 A;  3IVT A;  3LL8 B;  3NSO A;  1M46 A;  3D75 A;  5AXI A;  2KSP A;  2B1U A;  1XK4 A;  1W7I B;  1REC A;  1XO5 A;  1PK0 D;  3HX4 A;  4Q04 A;  2Y5I A;  1PAL A;  1PSR A;  1TOP A;  2V53 A;  5D3O A;  4KYN A;  5DKQ A;  5FYX A;  1QJT A;  3SG2 A;  3V2L A;  3NSI A;  2K0J A;  3WHT B;  4YGE B;  1SY9 A;  2M8U A;  3NHT A;  4GPL B;  1CLM A;  1JFJ A;  2KGR A;  1QVI Y;  4TNC A;  2MBX A;  2WC6 A;  2JPT A;  3B86 A;  2IS9 A;  2L98 A;  1OOI X;  1CDP A;  1S1E A;  4JD9 A; 
#chains in the Genus database with same CATH homology
 1CFC A;  1SYM A;  1M31 A;  2JT3 A;  3VRR A;  1YVH A;  1OMD A;  1CKK A;  3EK4 A;  2M7N A;  3KEV A;  1UHH A;  2PVB A;  1XFY O;  2KHN A;  1TNW A;  2M0R A;  2WCE A;  3CLN A;  3BOW A;  4GUK A;  3SG6 A;  2LV7 A;  1LXF C;  1OQP A;  3HCM A;  1WLZ A;  3PAT A;  4WQ2 A;  2KAY A;  2R2I A;  1KFU S;  1SCM C;  4I5K A;  2JNF A;  2K2A A;  1ZUZ A;  2M1U A;  1J1D A;  5JJG A;  2PAL A;  1AHR A;  5B8I B;  4OVN F;  3I5F B;  1F4O A;  3AAJ A;  1G4Y R;  1N2D A;  2O5G A;  1BG1 A;  2M49 B;  2LMT A;  4JPZ B;  1BOC A;  1K9P A;  2I94 A;  4YI8 A;  2OTG B;  2E6W A;  1CM4 A;  1CMF A;  2HET A;  1NX0 A;  4NQG A;  2KYC A;  1MXE A;  1DTL A;  2K61 A;  2LM5 A;  1BU3 A;  5CSF A;  1U5I B;  3KHE A;  1YUS A;  4YGB B;  1TTX A;  1EL4 A;  1DJH A;  1J1E A;  3TS5 B;  2LUC A;  3KO0 A;  2LC5 A;  4FQO A;  1DVI A;  3JVT C;  1BF5 A;  2JT8 A;  4DIR A;  2I2R E;  3CTN A;  2FOT A;  1OSA A;  3PAL A;  4P5O E;  1SBJ A;  2HQ8 A;  1QAT A;  2KYF A;  2QAC A;  3WNX B;  4OKH A;  3I5H B;  1WY9 A;  3SJS A;  2BCX A;  2QPT A;  2JRF A;  1DJZ A;  2WCF A;  4BY5 A;  1KK7 Y;  1S5G Z;  1QTX A;  1IQ5 A;  2WC8 A;  3TDI A;  2OTG C;  2K8M B;  3AKA A;  1FI6 A;  4PDZ A;  1OOJ A;  4GBA A;  5I8N A;  2K7B A;  4CID A;  1IGV A;  1A75 B;  1E8A A;  1WRK A;  4DS7 A;  1F55 A;  2SCP A;  1B7T Y;  1QV1 A;  2I18 A;  4N5X A;  2M9G A;  1FBV A;  3TS5 C;  5G08 A;  4NDB A;  3BYA A;  2Q91 A;  3ICB A;  5TNC A;  1TCF A;  4WRI A;  2L4H A;  4PAL A;  1L7Z A;  4MBE A;  1J55 A;  2KBM A;  2FCD A;  2BCA A;  1JWD A;  3CR2 A;  1G8I A;  2LCP A;  3O4Y A;  1GQM A;  1DF0 A;  1NX2 A;  1DJX A;  5I2L A;  3EVU A;  1CFP A;  1Y6W A;  2BKI B;  1TIZ A;  4MEW A;  1OZS A;  1UHK A;  2F3Z A;  1KQM C;  2M97 A;  1N65 A;  1EG4 A;  3GOF A;  3RM1 A;  1XFW O;  1IKU A;  1JC2 A;  1OMV A;  1S26 D;  1UWO A;  5HLV A;  1QV0 A;  1SK6 D;  2BE4 A;  2EC6 C;  3EK8 A;  4ETO A;  3ZNI A;  2MAZ A;  2CBL A;  4USL A;  2FCE A;  4GNK B;  4IL1 A;  3IQQ A;  1RTP 1;  1FW4 A;  1RJV A;  1CM1 A;  2O60 A;  1NP8 A;  2JNX A;  3A8R A;  3CR5 X;  1F8H A;  1YRT B;  2I7A A;  3DF0 B;  2K7D A;  4PCW A;  2F33 A;  1B8C A;  1HQV A;  1RWY A;  2JC2 A;  1IG5 A;  3CR4 X;  3D0Y A;  5HKW A;  4QJ5 B;  4MZL A;  1GGZ A;  2MLE C;  1Y1X A;  3O6B A;  5AFP A;  1YUU A;  1BR1 B;  1SCV A;  2E30 A;  4XJK A;  1YRU B;  5GQQ C;  1LVC D;  3ZWH A;  1NPQ A;  2Y1N A;  1BLQ A;  1UHI A;  1B47 A;  1SCM B;  2MHH A;  3M0W A;  4HSZ A;  2PSR A;  1CDN A;  1NCZ A;  1WDC B;  1BT6 A;  1F4Q A;  1MUX A;  2RGI A;  2HF5 A;  1KSM A;  4MVF A;  2KAV A;  1DJI A;  1MHO A;  1NCY A;  2CNP A;  4E68 A;  3F45 A;  3CWG A;  2KQ6 A;  3JTD B;  3OB2 B;  4ZCV A;  2L0P A;  3WHU B;  2KFG A;  3FWB A;  4MZJ A;  4MN0 A;  1XFV O;  1YUT A;  1CNP A;  2JTT A;  2LP2 A;  1TNX A;  4F0Z B;  1DMO A;  1H4B A;  2JZI A;  2ZND A;  1MWN A;  3DVJ A;  3BUN B;  3O2P A;  4C0L A;  2H2K A;  5HKY A;  3CGA A;  3DVM A;  1V1F A;  2NZ0 A;  4YGD B;  3JVT B;  5CSN A;  1JFK A;  5CPV A;  1Q80 A;  3SG7 A;  1CLB A;  4GGF C;  3EK7 A;  1WDC C;  2AUC A;  1FF1 A;  4M2Q A;  1KFX S;  1CFD A;  1TRF A;  3KPX A;  1TN4 A;  2BE6 A;  2M1K B;  4CFQ A;  2H61 A;  2L51 A;  5AER A;  5KU1 A;  2VRG A;  2F2O A;  1RRO A;  1MR8 A;  3O78 A;  3JTD C;  2JUL A;  1S6J A;  2ZKM X;  1VRK A;  2DOQ A;  3C1V A;  1KK8 C;  1K8U A;  2JQ6 A;  2M3W A;  3QRX A;  3PSR A;  5IBW A;  2MA2 A;  1NSH A;  2WOR A;  3GK4 X;  1F71 A;  1H8B A;  2LHL A;  2NLN A;  1YX7 A;  1FPW A;  1SR6 C;  1LA0 A;  5CSI A;  4MLW A;  1JF2 A;  1S36 A;  1B9A A;  2KBI A;  2P6B B;  2BBM A;  2AMI A;  1KWO C;  1LKJ A;  1DT7 B;  2OPO A;  5I2O A;  1TNQ A;  1OZO A;  1AP4 A;  1EG3 A;  1QX2 A;  2M7L A;  4ZCU A;  3SG3 A;  3OX5 A;  2LVI A;  4QJ3 B;  1KQM B;  1NIW A;  5DKN A;  4AOM A;  1R6P A;  3CS1 A;  2KFH A;  3TDZ A;  2JOJ A;  3DVE A;  4U8D A;  1B8R A;  1QX7 A;  3NSK A;  1C7W A;  2EC6 B;  1D1O A;  2JT0 A;  1AVS A;  3SIA A;  1JSA A;  2NCP A;  1A03 A;  3SG4 A;  1BR4 B;  1ALV A;  4YGC B;  3PN7 C;  3BQ3 A;  1HT9 A;  1NX1 A;  4YBH B;  3SIB A;  1Y0V H;  3WXA A;  1S5G Y;  2SAS A;  1PVB A;  4AQJ A;  3VGO A;  1KFU L;  1M39 A;  5KTY A;  2L4I A;  1FI5 A;  2G2B A;  2L2E A;  1S3P A;  2MJW B;  1U5I A;  3VRO A;  1B4C A;  1DGU A;  1DJW A;  1UHN A;  1YX8 A;  3FS7 A;  4DUQ A;  2EHB A;  5HYD A;  1J7O A;  1KQV A;  1XFZ O;  2F2P A;  2COL B;  4GAO A;  3RLZ A;  1CDM A;  1A4P A;  1Y1U A;  3OHM B;  1R2U A;  2GGZ A;  2K2F A;  1K96 A;  2LMU A;  4GGN A;  1QS7 A;  1PRW A;  1S6C A;  4N1F A;  1EH2 A;  2LAN A;  3LLE A;  2NCO A;  4I5L B;  4L9M A;  2KI4 B;  3LK1 A;  2CCM A;  1SW8 A;  1CFF A;  4UPG A;  3E3R A;  5PAL A;  1ZFS A;  1KCY A;  1G33 A;  2G9B A;  2KI6 D;  3TZ1 A;  3BUX B;  5HKZ A;  1A75 A;  3BUM B;  5HLO A;  1JF0 A;  1JUO A;  1UHJ A;  1XK4 C;  1K9K A;  2JXL A;  4JWQ A;  3BOW B;  1XVJ A;  4FTG A;  4YRU A;  2L50 A;  1N0Y A;  3BUO B;  2NXQ A;  3I5G B;  2LLS A;  2LVJ A;  1SMG A;  1DJG A;  3MSE B;  1AJ5 A;  3OP0 A;  2BKH B;  1QVI Z;  1NX3 A;  2ZN9 A;  1DGV A;  1TCO B;  2LP3 A;  2MLF C;  4MZK A;  3IF7 A;  1GGW A;  1DJY A;  2KI4 C;  4M2P A;  4CFR A;  4PHK A;  2GV5 A;  1XA5 A;  1KK8 B;  2KI6 C;  2WOS A;  3SG5 A;  4ORC B;  1CLL A;  1C07 A;  2K7O A;  2PRU A;  1J7P A;  4N1G A;  2BEC A;  4NDC A;  4P2Y B;  2WND A;  3CZT X;  2ZFD A;  4R1E A;  1J7Q A;  1SR6 B;  2FJU B;  3NSL A;  1K2H A;  2Q4U A;  2ZN8 A;  3EKH A;  4PHJ A;  5D7F A;  2OS8 C;  4PE1 A;  5JOL A;  2LUX A;  4ORA B;  1BJF A;  1WRZ A;  2JU0 A;  1KWO B;  1MXL C;  2BCB A;  3I5G C;  4BY4 A;  2KQY A;  3DF0 A;  4HRH A;  4DRW A;  3VRQ A;  2ZRT A;  4D1E A;  2H61 C;  3DVK A;  3NXA A;  1Y1A A;  2LMV A;  5D69 A;  3LK0 A;  3EKJ A;  1UUR A;  1K9U A;  2F8P A;  2LAP A;  5AEQ A;  3PM8 A;  1QXP A;  4GFT A;  2HPS A;  1BMO A;  4OCI A;  3D10 A;  1RK9 A;  3PLF B;  2AAO A;  5I2Q A;  2LVV A;  1IWQ A;  4CPV A;  1ODB A;  4XYN A;  1LA3 A;  1WRL A;  4AQI A;  1SKT A;  4ORB B;  1MQ1 A;  2TN4 A;  1LIN A;  2Y1M A;  2HQW A;  1CDL A;  2WCB A;  5BPJ A;  1F54 A;  1W7J B;  1SPY A;  1IJ5 A;  2ZRS A;  4GGF A;  1SL9 A;  4OR9 B;  4PE4 A;  1M63 B;  1RFJ A;  5ER4 X;  1CMG A;  2GGM A;  1K95 A;  3PN7 B;  3TUY B;  3EVR A;  1QX5 B;  5DKR A;  1SNL A;  1QIV A;  3GK2 A;  1DF0 B;  3KF9 A;  4MRX A;  1L2O B;  2CTN A;  1S6I A;  1YTZ C;  2JXC A;  1JBA A;  1AJ4 A;  1EJ3 A;  2BL0 B;  1KK7 Z;  2K7C A;  1QLK A;  2LLT A;  1OMR A;  1PUL A;  3TDU A;  3I5I B;  4WQ3 A;  2BBN A;  3VRN A;  3DD4 A;  4M2O A;  3A4U B;  2KNE A;  2CXJ A;  2EGD A;  4DCK A;  4PHM A;  2LLU A;  1YR5 A;  3GK1 A;  1A29 A;  1B7T Z;  3AKB A;  2F3Y A;  2LVK A;  4PE7 A;  1OE9 B;  1F70 A;  2ISD A;  1ALW A;  4C0K A;  1XYD A;  2PMY A;  1WLM A;  3I5F C;  3TUY C;  1C7V A;  1QIW A;  2CT9 A;  2MRD A;  3FIA A;  4OV2 A;  1EXR A;  2LHI A;  1PSB A;  3BUW B;  1L2O C;  5KSZ A;  1XFU O;  1YVL A;  3K21 A;  4CLN A;  3AAK A;  3D0Y B;  3IQO A;  2PAS A;  2BL0 C;  3LCP C;  2JWW A;  3EVV A;  1J7R A;  2Y4Q A;  1KFX L;  1PVA A;  4XJK B;  3I5I C;  4A4C A;  2LE9 B;  1IH0 A;  5AAN A;  1QLS A;  4C0J A;  1NYA A;  3OB1 B;  4HRE E;  1IQ3 A;  4YGA A;  2KFF A;  1TNP A;  5F6T A;  1SL8 A;  4PHN A;  1UP5 A;  1AK8 A;  3I5H C;  2A4J A;  1YUR A;  2L5X B;  1CTR A;  1GJY A;  2KGB C;  1K93 D;  1ZOT B;  1NWD A;  1ZMZ A;  5ER5 A;  1CB1 A;  2KDH A;  1A2X A;  4PE0 A;  4QJ4 B;  3VRP A;  1KSO A;  1QAS A;  3OX6 A;  4ICB A;  1ZAC A;  1B1G A;  1BOD A;  1UUS A;  2KOT A;  1V1G A;  1M45 A;  4MSP A;  3H4S E;  2D8N A;  3PFV A;  4JQ0 D;  1NUB A;  1IJ6 A;  2KAX A;  2JTZ A;  2M29 A;  2OS8 B;  4I5J A;  5J3X A;  1NCX A;  4NDD A;  3BXK A;  5CSJ A;  2ZNE A;  3FWC A;  4HRG A;  4I5N B;  1IRJ A;  1K90 D;  1XFX O;  1SL7 A;  1B8L A;  4A4B A;  4YI9 A;  4MRY A;  1SRA A;  2LNK A;  5K89 A;  1MF8 B;  1AUI B;  1X02 A;  1K94 A;  3LL8 B;  3NSO A;  5AXI A;  1M46 A;  2KSP A;  2B1U A;  1XK4 A;  1W7I B;  1REC A;  1XO5 A;  1PK0 D;  3HX4 A;  4Q04 A;  2Y5I A;  1PAL A;  1PSR A;  1TOP A;  2V53 A;  5DKQ A;  5FYX A;  3SG2 A;  1QJT A;  3NSI A;  2K0J A;  3WHT B;  4YGE B;  1SY9 A;  2M8U A;  1JFJ A;  4GPL B;  1CLM A;  2KGR A;  1QVI Y;  4TNC A;  2MBX A;  2JPT A;  2IS9 A;  2L98 A;  1CDP A;  1S1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...