3AKBA

Structural basis for prokaryotic calcium-mediated regulation by a streptomyces coelicolor calcium-binding protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
EYERRIAARFTTFDQDGNGHIDRSDFSGAAKAMLAEFGVAARSDRGQALYGGAEALWQGLAGIADRDGDQRITREEFVTGAVKRLRDKPDRFAEMARPFLHAALGVADTDGDGAVTVADTARALTAFGVPEDLARQAAAALDTDGDGKVGETEIVPAFARYFTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative calcium binding protein
publication title Structural basis for prokaryotic calciummediated regulation by a Streptomyces coelicolor calcium binding protein
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Metal binding protein
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3akbA00
2ZNEA 3EVVA 1CFCA 1SNLA 4CPVA 1IGVA 2EC6B 3BUXB 2JRFA 4ORAB 1IKUA 1S6JA 3KPXA 4PHJA 2KI4B 1KK7Z 4GFTA 4PHMA 5AFPA 1RTP1 1XFYO 3DVMA 4HREE 5DKNA 4OKHA 1J55A 2Q4UA 4UPGA 3LK1A 1YUTA 2BE4A 1AUIB 1AK8A 4DRWA 3ZNIA 1DJWA 2FOTA 5AXIA 1YVHA 4YGDB 1RROA 1LVCD 1QLKA 4XJKB 4NDDA 2JQ6A 2BECA 4MZJA 3VROA 4QJ5B 2JT8A 5D69A 3PLFB 3I5FC 1IH0A 2JULA 3D10A 1B7TY 3ICBA 1KQMC 4I5NB 2QPTA 2LUXA 2R2IA 2L51A 1BODA 1UURA 1IG5A 3LK0A 3NSLA 1SCMC 4NQGA 1NP8A 1J7OA 1F4QA 2JNXA 2M97A 4YI9A 1RECA 2ZRTA 2BBMA 3I5FB 4ETOA 1NX3A 1KFXS 1KQMB 1XA5A 1S36A 2LLUA 2HETA 4OCIA 1AP4A 3TDIA 2NCPA 2LAPA 2M1UA 2ZRSA 1YTZC 2JXCA 2K2FA 1Y1XA 2CXJA 4YGEB 1HT9A 1MWNA 1SCMB 1IQ5A 3MSEB 4R1EA 1XK4C 1WRLA 1YUSA 2F3ZA 4U8DA 4CLNA 1DJGA 3RLZA 5CPVA 1K8UA 3TUYB 1AHRA 3CLNA 1ALVA 3H4SE 1S6IA 2KNEA 2ISDA 1TIZA 3CZTX 1CMGA 3K21A 1E8AA 1R2UA 2KFFA 1LXFC 3NSOA 1DJYA 1IQ3A 2L98A 2COLB 2WORA 2JU0A 2K7OA 3HX4A 3SIBA 2BCBA 3LCPC 2LV7A 2Y5IA 3IQQA 1MR8A 2JC2A 2ZN9A 1ZACA 3CS1A 3EVRA 2H2KA 4FTGA 2F2OA 2DOQA 2LLTA 1M39A 3FIAA 2KYFA 4GAOA 1S6CA 1CDLA 3FWBA 1FI6A 1KFXL 2CTNA 1EG3A 1SK6D 4YGAA 1DF0A 1PALA 3SIAA 1A03A 2BKIB 1SKTA 1K96A 1LKJA 3LLEA 2F8PA 2CT9A 2SASA 3ZWHA 4L9MA 5CSFA 1EJ3A 4GGFA 2K0JA 3EVUA 3A4UB 1JWDA 2NXQA 1OMVA 1SMGA 2MLFC 1SRAA 3EKJA 1W7JB 2JTZA 5HLOA 4JQ0D 1D1OA 1CDMA 4MSPA 1QV0A 2M9GA 1OE9B 2ZN8A 2BE6A 4N1GA 3RM1A 1RK9A 3PN7C 2KQ6A 1NCYA 1WLZA 1Y1UA 2JZIA 2E6WA 3EKHA 1QVIY 3I5HC 2M7NA 2JXLA 4D1EA 1PVAA 3I5IC 3SG3A 2G2BA 4ORCB 1F54A 3FS7A 2WC8A 3PN7B 2LMUA 1QIWA 4A4CA 1KCYA 1J7RA 4WRIA 5B8IB 4N1FA 4YI8A 1GQMA 1UP5A 3I5IB 1CFFA 1DGVA 1KK8C 1QX2A 1UHKA 1K9PA 2D8NA 2IS9A 3O6BA 2K2AA 1C07A 4XYNA 4PHNA 2NLNA 1AJ5A 4I5JA 3BUNB 1QX7A 2L2EA 5ER5A 3CR5X 1QJTA 1TRFA 3WNXB 3SG2A 5PALA 2ZFDA 1KK8B 5J3XA 1K2HA 1WY9A 1DTLA 1AVSA 1S1EA 4ZCVA 1KQVA 1U5IB 4M2QA 4DIRA 4PHKA 4WQ3A 1N2DA 3I5GC 2ZNDA 3DVKA 2M49B 1R6PA 2L50A 3VRPA 1K94A 2BBNA 2I7AA 1NX1A 1WDCC 2AMIA 2LLSA 1UHJA 3I5GB 1NYAA 2B1UA 2G9BA 1K9KA 1NCZA 1PULA 2LHIA 1UHNA 4E68A 1SR6C 3KO0A 1NX0A 1WDCB 2EHBA 3GK1A 2Y1NA 1CKKA 1JFKA 1YX7A 1NIWA 3FWCA 2KFHA 5I2OA 1FBVA 1LA0A 5GQQC 5JOLA 3BUMB 1KWOC 2M29A 3TZ1A 1M63B 1SR6B 1Y0VH 1YR5A 1QVIZ 4ORBB 1F71A 1BJFA 4F0ZB 3KHEA 1NUBA 4HSZA 2VRGA 1PVBA 4MRYA 4WQ2A 1JSAA 4AQIA 2OTGC 3EK4A 5IBWA 4JWQA 1B4CA 4P2YB 1KWOB 2FCDA 3M0WA 4MZKA 1CDPA 1IRJA 2WCBA 1FI5A 1CFDA 5G08A 1EH2A 1L2OC 2OS8C 1XFUO 2LE9B 1OMRA 3IQOA 5DKQA 2M1KB 5I2LA 2OTGB 1QATA 3BOWA 4I5LB 2KYCA 3IF7A 4PE1A 2HQWA 5CSJA 2O5GA 3QRXA 2WNDA 2MRDA 1L2OB 2CCMA 3TS5C 4C0LA 3BUOB 2OS8B 2GV5A 1CLBA 5I2QA 3WHTB 1J1DA 2LUCA 2NZ0A 1XO5A 3OX5A 1KSMA 1RJVA 2EGDA 1BF5A 1CDNA 1G8IA 1YURA 3GOFA 1CMFA 4CFQA 1CM4A 3TS5B 4MVFA 4CIDA 1OQPA 1KK7Y 2LNKA 4AQJA 4GBAA 1CM1A 3OHMB 2HF5A 1KFUL 2RGIA 1B9AA 4OR9B 4MLWA 2AAOA 1MHOA 1LA3A 4GPLB 1L7ZA 3VRNA 1SCVA 1B7TZ 4PE4A 1XFXO 1EL4A 2E30A 1TNPA 4CFRA 1PSRA 1XYDA 1DT7B 3O2PA 1DF0B 2KI6D 4QJ3B 2MBXA 3O78A 2K7CA 2L0PA 1Q80A 2LC5A 1QX5B 3AKBA 3DF0B 1J1EA 1KSOA 1YRTB 1GJYA 3AAKA 2LP3A 1UUSA 1A4PA 2LMTA 1UHHA 1SY9A 5FYXA 3VRQA 3KF9A 1IWQA 1PSBA 2MLEC 2FCEA 2MHHA 1M31A 3CR4X 3D0YB 1SL7A 2JTTA 1ZUZA 1J7PA 3CR2A 2BL0C 1C7VA 1B47A 5I8NA 3I5HB 4NDCA 1A75A 4BY5A 2H61C 2JPTA 2KI6C 2KBMA 5AANA 1MXEA 1XFVO 4DCKA 4PE7A 2O60A 5DKRA 2QACA 5CSIA 3TDUA 1K93D 1V1GA 1A2XA 2BL0B 1CLMA 1ALWA 1DMOA 2BCAA 5JJGA 1CFPA 3SG6A 4GGNA 5KTYA 4C0JA 3E3RA 1SYMA 1XFWO 3HCMA 1FW4A 1QIVA 1S3PA 2OPOA 4MZLA 1H8BA 1K9UA 1TOPA 1W7IB 2LANA 1TCFA 3GK4X 2PASA 3NSIA 4ZCUA 1WLMA 1MQ1A 1SL9A 3NSKA 3O4YA 5HLVA 5HKYA 4ICBA 2MAZA 2K7BA 1BT6A 2KAYA 5F6TA 1QXPA 2Y1MA 3A8RA 2HPSA 2LCPA 2WCEA 2GGZA 3EK8A 1Y1AA 4MEWA 4XJKA 3BQ3A 1EG4A 1DJIA 1S5GY 2LHLA 1DJZA 1K90D 1V1FA 1B8CA 2L4HA 1OZSA 1F70A 3BUWB 3PM8A 2V53A 1N0YA 5ER4X 3SG5A 1QASA 1QV1A 1MXLC 5D7FA 4YRUA 4A4BA 1A29A 4NDBA 2PMYA 1CTRA 1YRUB 3EK7A 4YBHB 3VGOA 4FQOA 3SG4A 1SPYA 2Y4QA 2PSRA 1OOJA 1KFUS 4PCWA 1XVJA 1UWOA 4HRHA 2KFGA 4OVNF 2KAXA 3DVEA 1FPWA 5CSNA 2I94A 3PFVA 1QLSA 1PRWA 3GK2A 4M2PA 1B8LA 3SG7A 1BR1B 4I5KA 2FJUB 3VRRA 1OSAA 2HQ8A 4MRXA 2KAVA 1B1GA 4OV2A 3TUYC 3DVJA 2L4IA 4YGCB 2LVIA 1ODBA 2P6BB 2F3YA 2JT0A 1VRKA 1XK4A 1TNWA 2MA2A 1X02A 1ZOTB 2KDHA 1PK0D 5KSZA 2M8UA 1S26D 2KHNA 1NPQA 1UHIA 2K8MB 1DJXA 2GGMA 2AUCA 4IL1A 2KGRA 4N5XA 2M7LA 1M45A 3JTDC 1RWYA 2KQYA 1C7WA 1OMDA 1H4BA 2KBIA 4AOMA 2L5XB 4Q04A 5KU1A 2CNPA 1MUXA 1AJ4A 1JUOA 1MF8B 1BMOA 1JC2A 3JTDB 1JFJA 3C1VA 1EXRA 1N65A 4P5OE 1YVLA 3WHUB 1YUUA 3BOWB 1G33A 2K7DA 2BCXA 2PRUA 3TDZA 1CNPA 4GGFC 1YX8A 1XFZO 1SW8A 2KGBC 2NCOA 3PALA 3SJSA 3PSRA 3PATA 1WRKA 3NXAA 4PALA 1S5GZ 4PDZA 1F8HA 3BXKA 4BY4A 2A4JA 2PALA 1WRZA 1TNQA 2PVBA 1TNXA 2M3WA 1DVIA 4MBEA 4HRGA 1JF2A 4DS7A 1TTXA 2WCFA 5BPJA 1ZMZA 2BKHB 3KEVA 3DF0A 4GUKA 5TNCA 2JT3A 1B8RA 4M2OA 2F33A 3OB1B 2TN4A 2MJWB 3OB2B 1K95A 1RFJA 2LVJA 2LVVA 5AERA 1J7QA 1FF1A 1TN4A 3LL8B 3JVTC 1QS7A 3DD4A 1BLQA 3D0YA 1M46A 2KOTA 1BR4B 3F45A 2LMVA 3AAJA 1NWDA 3BYAA 2LM5A 4QJ4B 3WXAA 1G4YR 2I18A 1ZFSA 1NSHA 1BU3A 2CBLA 3OX6A 5HKZA 4USLA 2Q91A 3OP0A 4C0KA 5HYDA 1CB1A 1NX2A 1GGWA 3JVTB 2F2PA 1OZOA 1HQVA 2LVKA 2WOSA 3CTNA 4GNKB 4TNCA 3AKAA 4MN0A 1CLLA 1SL8A 2JOJA 3CWGA 1BG1A 1GGZA 1SBJA 1IJ5A 1Y6WA 3CGAA 4YGBB 5AEQA 1NCXA 2SCPA 1A75B 2H61A 2JWWA 4PE0A 1JF0A 2JNFA 2LP2A 1F55A 4DUQA 1QTXA 2EC6C 2M0RA 1LINA 1TCOB 2KI4C 1DJHA 1U5IA 2KSPA 1BOCA 5K89A 5HKWA 1DGUA 2I2RE 1F4OA 4JPZB 2ZKMX 2K61A 1IJ6A 1JBAA
chains in the Genus database with same CATH superfamily
2ZNEA 3D74A 1P28A 5FI6A 5I94A 3EVVA 1CFCA 1SNLA 4CPVA 1IGVA 2EC6B 3BUXB 2JRFA 4ORAB 2QEOA 1IKUA 1S6JA 3KPXA 4PHJA 2KI4B 1KK7Z 4GFTA 4PHMA 5AFPA 1RTP1 1XFYO 3DVMA 4HREE 5DKNA 4OKHA 1J55A 2Q4UA 4UPGA 3CYZA 1YUTA 2BE4A 1AUIB 3LK1A 4DRWA 3ZNIA 1AK8A 1DJWA 2FOTA 5AXIA 1YVHA 4YGDB 1RROA 1LVCD 1QLKA 4XJKB 4NDDA 2JQ6A 2BECA 4MZJA 3VROA 4QJ5B 2JT8A 5D69A 3PLFB 3I5FC 1IH0A 2JULA 3D10A 1B7TY 3ICBA 1KQMC 4I5NB 2QPTA 2LUXA 2R2IA 3BJHA 2L51A 3FE9A 1BODA 1UURA 1IG5A 3LK0A 3NSLA 1SCMC 4NQGA 1NP8A 1J7OA 2H8VA 1F4QA 2JNXA 2M97A 4YI9A 1RECA 2ZRTA 2BBMA 3I5FB 4ETOA 1NX3A 1KFXS 1KQMB 1XA5A 1S36A 2LLUA 2HETA 4OCIA 1AP4A 3TDIA 2NCPA 2LAPA 1TUJA 2M1UA 2ZRSA 1YTZC 2JXCA 2K2FA 1Y1XA 2CXJA 4YGEB 1HT9A 1MWNA 1SCMB 1IQ5A 3MSEB 4R1EA 1XK4C 1WRLA 1YUSA 3EG5B 2F3ZA 4U8DA 3R72A 4CLNA 1DJGA 4IJ7A 5CPVA 1K8UA 3RLZA 3TUYB 1AHRA 3CLNA 1ALVA 3H4SE 1S6IA 2KNEA 2ISDA 1TIZA 3CZTX 1CMGA 3K21A 1E8AA 2YGUA 1R2UA 2KFFA 1LXFC 3NSOA 1DC1A 1DJYA 3PJIA 2L98A 1IQ3A 2COLB 2WORA 2JU0A 2K7OA 3HX4A 3S0AA 3SIBA 2BCBA 3LCPC 2LV7A 3L4LA 2Y5IA 3IQQA 1MR8A 2JC2A 2ZN9A 1ZACA 3CDNA 3CS1A 3EVRA 3FE8A 2H2KA 4FTGA 3RZSA 2F2OA 3FE6A 2DOQA 2LLTA 1M39A 3FIAA 2KYFA 4GAOA 1C3ZA 1S6CA 1CDLA 3L4AA 3FWBA 3S0DA 1FI6A 3O4XA 1KFXL 2CTNA 1EG3A 3D76A 1SK6D 4YGAA 1DF0A 1PALA 2QEVA 3SIAA 1A03A 3SS4A 2BKIB 1SKTA 3D75A 3UO9A 1K96A 1LKJA 3BFAA 2F8PA 2CT9A 2SASA 3LLEA 4L9MA 5CSFA 1EJ3A 3ZWHA 4GGFA 2K0JA 3EVUA 3A4UB 1JWDA 2NXQA 2BAPA 3CZ1A 1OMVA 1SMGA 2MLFC 1SRAA 3B7AA 1W7JB 3EKJA 2JTZA 5HLOA 4JQ0D 1D1OA 1CDMA 4MSPA 1QV0A 2M9GA 1OE9B 2ZN8A 2BE6A 4N1GA 3RM1A 1RK9A 3PN7C 2KQ6A 3OGNA 1NCYA 1WLZA 1Y1UA 1DQEA 2JZIA 2E6WA 3EKHA 1QVIY 3I5HC 2M7NA 2JXLA 4D1EA 1PVAA 3I5IC 3SG3A 2G2BA 4ORCB 1F54A 3FS7A 2WC8A 3PN7B 2LMUA 4OZDA 1QIWA 4A4CA 1KCYA 1J7RA 4WRIA 5B8IB 4N1FA 3Q8IA 4YI8A 1GQMA 3B88A 1UP5A 3I5IB 1CFFA 5DICA 1DGVA 1KK8C 1QX2A 1UHKA 1K9PA 2D8NA 2IS9A 3O6BA 2K2AA 2PYQA 4XYNA 4PHNA 2NLNA 1C07A 1AJ5A 4I5JA 3BUNB 4PT1A 1QX7A 2L2EA 5ER5A 1DELA 3CR5X 1QJTA 3NHTA 1TRFA 3WNXB 3B86A 3SG2A 5PALA 2ZFDA 3NGVA 3QMEA 1KK8B 5J3XA 3UNWA 1K2HA 1WY9A 1DTLA 1AVSA 1S1EA 4ZCVA 1KQVA 1U5IB 4M2QA 4DIRA 4PHKA 4WQ3A 1N2DA 3I5GC 2ZNDA 3CZ0A 3DVKA 4INXA 2M49B 1R6PA 2L50A 3R1OA 3VRPA 1K94A 2BBNA 2WCJA 2I7AA 1NX1A 1WDCC 2L5YA 2AMIA 2LLSA 1UHJA 3I5GB 1NYAA 2B1UA 1OOIX 2G9BA 1K9KA 1NCZA 1PULA 3B87A 2LHIA 5EL2A 1UHNA 4E68A 1SR6C 3KO0A 1NX0A 1WDCB 2EHBA 3GK1A 1IIOA 2Y1NA 3BFBA 1CKKA 1JFKA 1YX7A 1NIWA 3FWCA 2KFHA 5I2OA 3DXLA 1FBVA 1LA0A 5FI2A 5GQQC 5JOLA 2GTEA 3BUMB 1KWOC 2M29A 3TZ1A 1M63B 1SR6B 1DEKA 1Y0VH 5D3OA 1YR5A 1QVIZ 3N7HA 4ORBB 1F71A 1BJFA 2P70A 4F0ZB 3CZ2A 3KHEA 1NUBA 4HSZA 2VRGA 1PVBA 4MRYA 4WQ2A 1JSAA 3V2LA 4AQIA 2OTGC 3EK4A 5IBWA 4JWQA 1B4CA 4P2YB 1KWOB 2BNXA 2FCDA 3M0WA 4MZKA 1CDPA 1IRJA 2QDIA 2WCBA 1FI5A 1CFDA 5G08A 1EH2A 1L2OC 2OS8C 1XFUO 2LE9B 3SS3A 1OMRA 3IQOA 5DKQA 2M1KB 5I2LA 2OTGB 1QATA 3BOWA 4I5LB 2KYCA 3IF7A 2WC6A 4PE1A 2HQWA 2WCMA 3D78A 2O5GA 3QRXA 2WNDA 5CSJA 3S0FA 2MRDA 1L2OB 2CCMA 3TS5C 4C0LA 3BUOB 2OS8B 2GV5A 1CLBA 4JKTA 5I2QA 3WHTB 1J1DA 2LUCA 2FJYA 2NZ0A 1XO5A 3OX5A 1KSMA 1RJVA 2EGDA 3DY9A 1BF5A 1CDNA 2PQLA 1G8IA 1YURA 3GOFA 1QWVA 1CMFA 4CFQA 1CM4A 3OBVA 3TS5B 4MVFA 4CIDA 1OQPA 1KK7Y 2LNKA 4AQJA 4GBAA 1CM1A 3OHMB 2HF5A 1KFUL 2RGIA 1B9AA 4OR9B 3PM2A 4MLWA 2AAOA 1MHOA 1LA3A 4GPLB 1L7ZA 3VRNA 1SCVA 1B7TZ 4PE4A 1XFXO 1EL4A 2E30A 1TNPA 4CFRA 1PSRA 1TWOA 1XYDA 1DT7B 3O2PA 1DF0B 2KI6D 4QJ3B 2MBXA 3O78A 2K7CA 1Z4HA 2L0PA 1Q80A 2LC5A 1QX5B 3AKBA 3DF0B 1J1EA 1KSOA 1YRTB 1GJYA 3AAKA 2LP3A 1UUSA 1A4PA 2LMTA 2QEHA 1UHHA 1SY9A 5FYXA 3VRQA 3KF9A 1IWQA 1PSBA 2MLEC 3L47A 2FCEA 2KPHA 1M31A 2MHHA 3CR4X 3D0YB 1SL7A 2JTTA 2WCLA 1ZUZA 1J7PA 3CR2A 2BL0C 1C7VA 1B47A 5I8NA 3I5HB 4NDCA 1A75A 3B6XA 2H61C 1OW4A 2JPTA 2KI6C 4BY5A 2KBMA 5AANA 3SS5A 1C3YA 1MXEA 1XFVO 4DCKA 4PE7A 2O60A 5DKRA 2QACA 5CSIA 3TDUA 1K93D 1V1GA 1A2XA 2KLDA 2BL0B 4F7FA 1CLMA 1ALWA 3DYEA 1DMOA 2BCAA 5JJGA 1CFPA 3SG6A 4GGNA 5KTYA 1GM0A 4C0JA 3E3RA 1SYMA 1XFWO 3HCMA 1FW4A 1QIVA 1S3PA 2OPOA 4MZLA 1H8BA 1K9UA 1TOPA 1W7IB 2LANA 1TCFA 2KLEA 3GK4X 2PASA 3NSIA 4ZCUA 1WLMA 1MQ1A 1SL9A 3NSKA 3O4YA 5HLVA 5HKYA 4ICBA 3S0EA 2MAZA 2K7BA 3IVTA 1BT6A 2KAYA 3K1EA 1QXPA 2Y1MA 3A8RA 5F6TA 2HPSA 2LCPA 4JD9A 2WCEA 2GGZA 2WCKA 1Y1AA 3EK8A 4MEWA 4XJKA 3BQ3A 3S0GA 2L2CA 1EG4A 2WC5A 1DJIA 1S5GY 2LHLA 1DJZA 1K90D 1V1FA 1B8CA 2L4HA 1OZSA 1F70A 3BUWB 3PM8A 2V53A 1OOFA 1N0YA 5ER4X 3SG5A 1QASA 1QV1A 1MXLC 1TUZA 5D7FA 1W9ZA 4YRUA 4A4BA 1A29A 4NDBA 2PMYA 1CTRA 1YRUB 3EK7A 4YBHB 3VGOA 4FQOA 3SG4A 1SPYA 2Y4QA 1OOHA 2PSRA 1OOJA 1KFUS 4PCWA 1XVJA 1SSEB 1UWOA 4HRHA 2KFGA 4OVNF 2KAXA 3DVEA 1FPWA 5CSNA 2I94A 3PFVA 1QLSA 1PRWA 3GK2A 4M2PA 2QEBA 1B8LA 3SG7A 1BR1B 4I5KA 2FJUB 3VRRA 1OSAA 2HQ8A 4MRXA 2KAVA 1B1GA 3D77A 4OV2A 3TUYC 3DVJA 2L4IA 4YGCB 2LVIA 1ODBA 2P6BB 2F3YA 2JT0A 1VRKA 1XK4A 1TNWA 2MA2A 2WCHA 1X02A 1ZOTB 2KDHA 1PK0D 5KSZA 2M8UA 1S26D 2KHNA 1NPQA 1UHIA 2K8MB 1DJXA 2GGMA 2AUCA 4IL1A 2KGRA 4N5XA 2M7LA 3R1VA 1M45A 3JTDC 1RWYA 3S0BA 2KQYA 4KYNA 1C7WA 1OMDA 1H4BA 2KBIA 4AOMA 2L5XB 4Q04A 5KU1A 2CNPA 1XFRA 1MUXA 1AJ4A 1JUOA 1OOGA 1T14A 3D73A 1MF8B 1BMOA 2P71A 1JC2A 3JTDB 1JFJA 3VB1A 3C1VA 1EXRA 1N65A 4P5OE 1YVLA 3WHUB 1YUUA 3BOWB 1G33A 2K7DA 2ERBA 2BCXA 2PRUA 3TDZA 1CNPA 4GGFC 1ORGA 1XFZO 1SW8A 1YX8A 2KGBC 2NCOA 3PALA 3PSRA 3PATA 3SJSA 1WRKA 3NXAA 4PALA 3DZTA 1S5GZ 4PDZA 1F8HA 5HL1A 3BXKA 4BY4A 2A4JA 2PALA 1WRZA 1TNQA 2PVBA 1TNXA 2M3WA 1DVIA 4MBEA 4HRGA 1JF2A 4DS7A 1TTXA 2WCFA 5BPJA 1ZMZA 2BKHB 3KEVA 3DF0A 4GUKA 5TNCA 2JT3A 1B8RA 3BFHA 4M2OA 2F33A 3R1PA 3OB1B 2TN4A 3NHIA 2MJWB 5FI7A 3OB2B 1K95A 1RFJA 2LVJA 2LVVA 5AERA 1J7QA 1FF1A 1TN4A 3LL8B 2K60A 3JVTC 1Z2CB 1QS7A 3DD4A 1BLQA 3D0YA 1M46A 2KOTA 1BR4B 3F45A 2LMVA 3AAJA 1NWDA 3CABA 3BYAA 2LM5A 1LS8A 4QJ4B 3WXAA 1G4YR 2I18A 1ZFSA 1NSHA 1BU3A 2CBLA 3OX6A 5HKZA 4USLA 2Q91A 3OP0A 4C0KA 5HYDA 1CB1A 1NX2A 2JPOA 1GGWA 3JVTB 2F2PA 1OZOA 1HQVA 2LVKA 2WOSA 3CTNA 4GNKB 4TNCA 3AKAA 4MN0A 1CLLA 1SL8A 2JOJA 3CWGA 1BG1A 1GGZA 1SBJA 1IJ5A 1Y6WA 3CGAA 4YGBB 5AEQA 1NCXA 2SCPA 1A75B 2H61A 2JWWA 4PE0A 1JF0A 2JNFA 2LP2A 1F55A 4DUQA 1QTXA 2EC6C 2M0RA 1LINA 1TCOB 2KI4C 1DJHA 1U5IA 2KSPA 1BOCA 5K89A 5HKWA 1DGUA 4FQTA 2I2RE 4INWA 1F4OA 4JPZB 2ZKMX 2K61A 1IJ6A 1JBAA
chains in the Genus database with same CATH topology
2ZNEA 3EVVA 1CFCA 1SNLA 4CPVA 1IGVA 2EC6B 3BUXB 2JRFA 4ORAB 1IKUA 1S6JA 3KPXA 4PHJA 2KI4B 1KK7Z 4GFTA 4PHMA 5AFPA 1RTP1 1XFYO 3DVMA 4HREE 5DKNA 4OKHA 1J55A 2Q4UA 4UPGA 3LK1A 1YUTA 2BE4A 1AUIB 1AK8A 4DRWA 3ZNIA 1DJWA 2FOTA 5AXIA 1YVHA 4YGDB 1RROA 1LVCD 1QLKA 4XJKB 4NDDA 2JQ6A 2BECA 4MZJA 3VROA 4QJ5B 2JT8A 5D69A 3PLFB 3I5FC 1IH0A 2JULA 3D10A 1B7TY 3ICBA 1KQMC 4I5NB 2QPTA 2LUXA 2R2IA 2L51A 1BODA 1UURA 1IG5A 3LK0A 3NSLA 1SCMC 4NQGA 1NP8A 1J7OA 1F4QA 2JNXA 2M97A 4YI9A 1RECA 2ZRTA 2BBMA 3I5FB 4ETOA 1NX3A 1KFXS 1KQMB 1XA5A 1S36A 2LLUA 2HETA 4OCIA 1AP4A 3TDIA 2NCPA 2LAPA 2M1UA 2ZRSA 1YTZC 2JXCA 2K2FA 1Y1XA 2CXJA 4YGEB 1HT9A 1MWNA 1SCMB 1IQ5A 3MSEB 4R1EA 1XK4C 1WRLA 1YUSA 2F3ZA 4U8DA 4CLNA 1DJGA 3RLZA 5CPVA 1K8UA 3TUYB 1AHRA 3CLNA 1ALVA 3H4SE 1S6IA 2KNEA 2ISDA 1TIZA 3CZTX 1CMGA 3K21A 1E8AA 1R2UA 2KFFA 1LXFC 3NSOA 1DJYA 1IQ3A 2L98A 2COLB 2WORA 2JU0A 2K7OA 3HX4A 3SIBA 2BCBA 3LCPC 2LV7A 2Y5IA 3IQQA 1MR8A 2JC2A 2ZN9A 1ZACA 3CS1A 3EVRA 2H2KA 4FTGA 2F2OA 2DOQA 2LLTA 1M39A 3FIAA 2KYFA 4GAOA 1S6CA 1CDLA 3FWBA 1FI6A 1KFXL 2CTNA 1EG3A 1SK6D 4YGAA 1DF0A 1PALA 3SIAA 1A03A 2BKIB 1SKTA 1K96A 1LKJA 3LLEA 2F8PA 2CT9A 2SASA 3ZWHA 4L9MA 5CSFA 1EJ3A 4GGFA 2K0JA 3EVUA 3A4UB 1JWDA 2NXQA 1OMVA 1SMGA 2MLFC 1SRAA 3EKJA 1W7JB 2JTZA 5HLOA 4JQ0D 1D1OA 1CDMA 4MSPA 1QV0A 2M9GA 1OE9B 2ZN8A 2BE6A 4N1GA 3RM1A 1RK9A 3PN7C 2KQ6A 1NCYA 1WLZA 1Y1UA 2JZIA 2E6WA 3EKHA 1QVIY 3I5HC 2M7NA 2JXLA 4D1EA 1PVAA 3I5IC 3SG3A 2G2BA 4ORCB 1F54A 3FS7A 2WC8A 3PN7B 2LMUA 1QIWA 4A4CA 1KCYA 1J7RA 4WRIA 5B8IB 4N1FA 4YI8A 1GQMA 1UP5A 3I5IB 1CFFA 1DGVA 1KK8C 1QX2A 1UHKA 1K9PA 2D8NA 2IS9A 3O6BA 2K2AA 1C07A 4XYNA 4PHNA 2NLNA 1AJ5A 4I5JA 3BUNB 1QX7A 2L2EA 5ER5A 3CR5X 1QJTA 1TRFA 3WNXB 3SG2A 5PALA 2ZFDA 1KK8B 5J3XA 1K2HA 1WY9A 1DTLA 1AVSA 1S1EA 4ZCVA 1KQVA 1U5IB 4M2QA 4DIRA 4PHKA 4WQ3A 1N2DA 3I5GC 2ZNDA 3DVKA 2M49B 1R6PA 2L50A 3VRPA 1K94A 2BBNA 2I7AA 1NX1A 1WDCC 2AMIA 2LLSA 1UHJA 3I5GB 1NYAA 2B1UA 2G9BA 1K9KA 1NCZA 1PULA 2LHIA 1UHNA 4E68A 1SR6C 3KO0A 1NX0A 1WDCB 2EHBA 3GK1A 2Y1NA 1CKKA 1JFKA 1YX7A 1NIWA 3FWCA 2KFHA 5I2OA 1FBVA 1LA0A 5GQQC 5JOLA 3BUMB 1KWOC 2M29A 3TZ1A 1M63B 1SR6B 1Y0VH 1YR5A 1QVIZ 4ORBB 1F71A 1BJFA 4F0ZB 3KHEA 1NUBA 4HSZA 2VRGA 1PVBA 4MRYA 4WQ2A 1JSAA 4AQIA 2OTGC 3EK4A 5IBWA 4JWQA 1B4CA 4P2YB 1KWOB 2FCDA 3M0WA 4MZKA 1CDPA 1IRJA 2WCBA 1FI5A 1CFDA 5G08A 1EH2A 1L2OC 2OS8C 1XFUO 2LE9B 1OMRA 3IQOA 5DKQA 2M1KB 5I2LA 2OTGB 1QATA 3BOWA 4I5LB 2KYCA 3IF7A 4PE1A 2HQWA 5CSJA 2O5GA 3QRXA 2WNDA 2MRDA 1L2OB 2CCMA 3TS5C 4C0LA 3BUOB 2OS8B 2GV5A 1CLBA 5I2QA 3WHTB 1J1DA 2LUCA 2NZ0A 1XO5A 3OX5A 1KSMA 1RJVA 2EGDA 1BF5A 1CDNA 1G8IA 1YURA 3GOFA 1CMFA 4CFQA 1CM4A 3TS5B 4MVFA 4CIDA 1OQPA 1KK7Y 2LNKA 4AQJA 4GBAA 1CM1A 3OHMB 2HF5A 1KFUL 2RGIA 1B9AA 4OR9B 4MLWA 2AAOA 1MHOA 1LA3A 4GPLB 1L7ZA 3VRNA 1SCVA 1B7TZ 4PE4A 1XFXO 1EL4A 2E30A 1TNPA 4CFRA 1PSRA 1XYDA 1DT7B 3O2PA 1DF0B 2KI6D 4QJ3B 2MBXA 3O78A 2K7CA 2L0PA 1Q80A 2LC5A 1QX5B 3AKBA 3DF0B 1J1EA 1KSOA 1YRTB 1GJYA 3AAKA 2LP3A 1UUSA 1A4PA 2LMTA 1UHHA 1SY9A 5FYXA 3VRQA 3KF9A 1IWQA 1PSBA 2MLEC 2FCEA 2MHHA 1M31A 3CR4X 3D0YB 1SL7A 2JTTA 1ZUZA 1J7PA 3CR2A 2BL0C 1C7VA 1B47A 5I8NA 3I5HB 4NDCA 1A75A 4BY5A 2H61C 2JPTA 2KI6C 2KBMA 5AANA 1MXEA 1XFVO 4DCKA 4PE7A 2O60A 5DKRA 2QACA 5CSIA 3TDUA 1K93D 1V1GA 1A2XA 2BL0B 1CLMA 1ALWA 1DMOA 2BCAA 5JJGA 1CFPA 3SG6A 4GGNA 5KTYA 4C0JA 3E3RA 1SYMA 1XFWO 3HCMA 1FW4A 1QIVA 1S3PA 2OPOA 4MZLA 1H8BA 1K9UA 1TOPA 1W7IB 2LANA 1TCFA 3GK4X 2PASA 3NSIA 4ZCUA 1WLMA 1MQ1A 1SL9A 3NSKA 3O4YA 5HLVA 5HKYA 4ICBA 2MAZA 2K7BA 1BT6A 2KAYA 5F6TA 1QXPA 2Y1MA 3A8RA 2HPSA 2LCPA 2WCEA 2GGZA 3EK8A 1Y1AA 4MEWA 4XJKA 3BQ3A 1EG4A 1DJIA 1S5GY 2LHLA 1DJZA 1K90D 1V1FA 1B8CA 2L4HA 1OZSA 1F70A 3BUWB 3PM8A 2V53A 1N0YA 5ER4X 3SG5A 1QASA 1QV1A 1MXLC 5D7FA 4YRUA 4A4BA 1A29A 4NDBA 2PMYA 1CTRA 1YRUB 3EK7A 4YBHB 3VGOA 4FQOA 3SG4A 1SPYA 2Y4QA 2PSRA 1OOJA 1KFUS 4PCWA 1XVJA 1UWOA 4HRHA 2KFGA 4OVNF 2KAXA 3DVEA 1FPWA 5CSNA 2I94A 3PFVA 1QLSA 1PRWA 3GK2A 4M2PA 1B8LA 3SG7A 1BR1B 4I5KA 2FJUB 3VRRA 1OSAA 2HQ8A 4MRXA 2KAVA 1B1GA 4OV2A 3TUYC 3DVJA 2L4IA 4YGCB 2LVIA 1ODBA 2P6BB 2F3YA 2JT0A 1VRKA 1XK4A 1TNWA 2MA2A 1X02A 1ZOTB 2KDHA 1PK0D 5KSZA 2M8UA 1S26D 2KHNA 1NPQA 1UHIA 2K8MB 1DJXA 2GGMA 2AUCA 4IL1A 2KGRA 4N5XA 2M7LA 1M45A 3JTDC 1RWYA 2KQYA 1C7WA 1OMDA 1H4BA 2KBIA 4AOMA 2L5XB 4Q04A 5KU1A 2CNPA 1MUXA 1AJ4A 1JUOA 1MF8B 1BMOA 1JC2A 3JTDB 1JFJA 3C1VA 1EXRA 1N65A 4P5OE 1YVLA 3WHUB 1YUUA 3BOWB 1G33A 2K7DA 2BCXA 2PRUA 3TDZA 1CNPA 4GGFC 1YX8A 1XFZO 1SW8A 2KGBC 2NCOA 3PALA 3SJSA 3PSRA 3PATA 1WRKA 3NXAA 4PALA 1S5GZ 4PDZA 1F8HA 3BXKA 4BY4A 2A4JA 2PALA 1WRZA 1TNQA 2PVBA 1TNXA 2M3WA 1DVIA 4MBEA 4HRGA 1JF2A 4DS7A 1TTXA 2WCFA 5BPJA 1ZMZA 2BKHB 3KEVA 3DF0A 4GUKA 5TNCA 2JT3A 1B8RA 4M2OA 2F33A 3OB1B 2TN4A 2MJWB 3OB2B 1K95A 1RFJA 2LVJA 2LVVA 5AERA 1J7QA 1FF1A 1TN4A 3LL8B 3JVTC 1QS7A 3DD4A 1BLQA 3D0YA 1M46A 2KOTA 1BR4B 3F45A 2LMVA 3AAJA 1NWDA 3BYAA 2LM5A 4QJ4B 3WXAA 1G4YR 2I18A 1ZFSA 1NSHA 1BU3A 2CBLA 3OX6A 5HKZA 4USLA 2Q91A 3OP0A 4C0KA 5HYDA 1CB1A 1NX2A 1GGWA 3JVTB 2F2PA 1OZOA 1HQVA 2LVKA 2WOSA 3CTNA 4GNKB 4TNCA 3AKAA 4MN0A 1CLLA 1SL8A 2JOJA 3CWGA 1BG1A 1GGZA 1SBJA 1IJ5A 1Y6WA 3CGAA 4YGBB 5AEQA 1NCXA 2SCPA 1A75B 2H61A 2JWWA 4PE0A 1JF0A 2JNFA 2LP2A 1F55A 4DUQA 1QTXA 2EC6C 2M0RA 1LINA 1TCOB 2KI4C 1DJHA 1U5IA 2KSPA 1BOCA 5K89A 5HKWA 1DGUA 2I2RE 1F4OA 4JPZB 2ZKMX 2K61A 1IJ6A 1JBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNE A;  3EVV A;  1CFC A;  1SNL A;  4CPV A;  1IGV A;  2EC6 B;  3BUX B;  2JRF A;  4ORA B;  1IKU A;  1S6J A;  3KPX A;  4PHJ A;  2KI4 B;  1KK7 Z;  4GFT A;  4PHM A;  5AFP A;  1RTP 1;  1XFY O;  3DVM A;  4HRE E;  5DKN A;  4OKH A;  1J55 A;  2Q4U A;  4UPG A;  3LK1 A;  1YUT A;  2BE4 A;  1AUI B;  1AK8 A;  4DRW A;  3ZNI A;  1DJW A;  2FOT A;  5AXI A;  1YVH A;  4YGD B;  1RRO A;  1LVC D;  1QLK A;  4XJK B;  4NDD A;  2JQ6 A;  2BEC A;  4MZJ A;  3VRO A;  4QJ5 B;  2JT8 A;  5D69 A;  3PLF B;  3I5F C;  1IH0 A;  2JUL A;  3D10 A;  1B7T Y;  3ICB A;  1KQM C;  4I5N B;  2QPT A;  2LUX A;  2R2I A;  2L51 A;  1BOD A;  1UUR A;  1IG5 A;  3LK0 A;  3NSL A;  1SCM C;  4NQG A;  1NP8 A;  1J7O A;  1F4Q A;  2JNX A;  2M97 A;  4YI9 A;  1REC A;  2ZRT A;  2BBM A;  3I5F B;  4ETO A;  1NX3 A;  1KFX S;  1KQM B;  1XA5 A;  1S36 A;  2LLU A;  2HET A;  4OCI A;  1AP4 A;  3TDI A;  2NCP A;  2LAP A;  2M1U A;  2ZRS A;  1YTZ C;  2JXC A;  2K2F A;  1Y1X A;  2CXJ A;  4YGE B;  1HT9 A;  1MWN A;  1SCM B;  1IQ5 A;  3MSE B;  4R1E A;  1XK4 C;  1WRL A;  1YUS A;  2F3Z A;  4U8D A;  4CLN A;  1DJG A;  3RLZ A;  5CPV A;  1K8U A;  3TUY B;  1AHR A;  3CLN A;  1ALV A;  3H4S E;  1S6I A;  2KNE A;  2ISD A;  1TIZ A;  3CZT X;  1CMG A;  3K21 A;  1E8A A;  1R2U A;  2KFF A;  1LXF C;  3NSO A;  1DJY A;  1IQ3 A;  2L98 A;  2COL B;  2WOR A;  2JU0 A;  2K7O A;  3HX4 A;  3SIB A;  2BCB A;  3LCP C;  2LV7 A;  2Y5I A;  3IQQ A;  1MR8 A;  2JC2 A;  2ZN9 A;  1ZAC A;  3CS1 A;  3EVR A;  2H2K A;  4FTG A;  2F2O A;  2DOQ A;  2LLT A;  1M39 A;  3FIA A;  2KYF A;  4GAO A;  1S6C A;  1CDL A;  3FWB A;  1FI6 A;  1KFX L;  2CTN A;  1EG3 A;  1SK6 D;  4YGA A;  1DF0 A;  1PAL A;  3SIA A;  1A03 A;  2BKI B;  1SKT A;  1K96 A;  1LKJ A;  3LLE A;  2F8P A;  2CT9 A;  2SAS A;  3ZWH A;  4L9M A;  5CSF A;  1EJ3 A;  4GGF A;  2K0J A;  3EVU A;  3A4U B;  1JWD A;  2NXQ A;  1OMV A;  1SMG A;  2MLF C;  1SRA A;  3EKJ A;  1W7J B;  2JTZ A;  5HLO A;  4JQ0 D;  1D1O A;  1CDM A;  4MSP A;  1QV0 A;  2M9G A;  1OE9 B;  2ZN8 A;  2BE6 A;  4N1G A;  3RM1 A;  1RK9 A;  3PN7 C;  2KQ6 A;  1NCY A;  1WLZ A;  1Y1U A;  2JZI A;  2E6W A;  3EKH A;  1QVI Y;  3I5H C;  2M7N A;  2JXL A;  4D1E A;  1PVA A;  3I5I C;  3SG3 A;  2G2B A;  4ORC B;  1F54 A;  3FS7 A;  2WC8 A;  3PN7 B;  2LMU A;  1QIW A;  4A4C A;  1KCY A;  1J7R A;  4WRI A;  5B8I B;  4N1F A;  4YI8 A;  1GQM A;  1UP5 A;  3I5I B;  1CFF A;  1DGV A;  1KK8 C;  1QX2 A;  1UHK A;  1K9P A;  2D8N A;  2IS9 A;  3O6B A;  2K2A A;  1C07 A;  4XYN A;  4PHN A;  2NLN A;  1AJ5 A;  4I5J A;  3BUN B;  1QX7 A;  2L2E A;  5ER5 A;  3CR5 X;  1QJT A;  1TRF A;  3WNX B;  3SG2 A;  5PAL A;  2ZFD A;  1KK8 B;  5J3X A;  1K2H A;  1WY9 A;  1DTL A;  1AVS A;  1S1E A;  4ZCV A;  1KQV A;  1U5I B;  4M2Q A;  4DIR A;  4PHK A;  4WQ3 A;  1N2D A;  3I5G C;  2ZND A;  3DVK A;  2M49 B;  1R6P A;  2L50 A;  3VRP A;  1K94 A;  2BBN A;  2I7A A;  1NX1 A;  1WDC C;  2AMI A;  2LLS A;  1UHJ A;  3I5G B;  1NYA A;  2B1U A;  2G9B A;  1K9K A;  1NCZ A;  1PUL A;  2LHI A;  1UHN A;  4E68 A;  1SR6 C;  3KO0 A;  1NX0 A;  1WDC B;  2EHB A;  3GK1 A;  2Y1N A;  1CKK A;  1JFK A;  1YX7 A;  1NIW A;  3FWC A;  2KFH A;  5I2O A;  1FBV A;  1LA0 A;  5GQQ C;  5JOL A;  3BUM B;  1KWO C;  2M29 A;  3TZ1 A;  1M63 B;  1SR6 B;  1Y0V H;  1YR5 A;  1QVI Z;  4ORB B;  1F71 A;  1BJF A;  4F0Z B;  3KHE A;  1NUB A;  4HSZ A;  2VRG A;  1PVB A;  4MRY A;  4WQ2 A;  1JSA A;  4AQI A;  2OTG C;  3EK4 A;  5IBW A;  4JWQ A;  1B4C A;  4P2Y B;  1KWO B;  2FCD A;  3M0W A;  4MZK A;  1CDP A;  1IRJ A;  2WCB A;  1FI5 A;  1CFD A;  5G08 A;  1EH2 A;  1L2O C;  2OS8 C;  1XFU O;  2LE9 B;  1OMR A;  3IQO A;  5DKQ A;  2M1K B;  5I2L A;  2OTG B;  1QAT A;  3BOW A;  4I5L B;  2KYC A;  3IF7 A;  4PE1 A;  2HQW A;  5CSJ A;  2O5G A;  3QRX A;  2WND A;  2MRD A;  1L2O B;  2CCM A;  3TS5 C;  4C0L A;  3BUO B;  2OS8 B;  2GV5 A;  1CLB A;  5I2Q A;  3WHT B;  1J1D A;  2LUC A;  2NZ0 A;  1XO5 A;  3OX5 A;  1KSM A;  1RJV A;  2EGD A;  1BF5 A;  1CDN A;  1G8I A;  1YUR A;  3GOF A;  1CMF A;  4CFQ A;  1CM4 A;  3TS5 B;  4MVF A;  4CID A;  1OQP A;  1KK7 Y;  2LNK A;  4AQJ A;  4GBA A;  1CM1 A;  3OHM B;  2HF5 A;  1KFU L;  2RGI A;  1B9A A;  4OR9 B;  4MLW A;  2AAO A;  1MHO A;  1LA3 A;  4GPL B;  1L7Z A;  3VRN A;  1SCV A;  1B7T Z;  4PE4 A;  1XFX O;  1EL4 A;  2E30 A;  1TNP A;  4CFR A;  1PSR A;  1XYD A;  1DT7 B;  3O2P A;  1DF0 B;  2KI6 D;  4QJ3 B;  2MBX A;  3O78 A;  2K7C A;  2L0P A;  1Q80 A;  2LC5 A;  1QX5 B;  3AKB A;  3DF0 B;  1J1E A;  1KSO A;  1YRT B;  1GJY A;  3AAK A;  2LP3 A;  1UUS A;  1A4P A;  2LMT A;  1UHH A;  1SY9 A;  5FYX A;  3VRQ A;  3KF9 A;  1IWQ A;  1PSB A;  2MLE C;  2FCE A;  2MHH A;  1M31 A;  3CR4 X;  3D0Y B;  1SL7 A;  2JTT A;  1ZUZ A;  1J7P A;  3CR2 A;  2BL0 C;  1C7V A;  1B47 A;  5I8N A;  3I5H B;  4NDC A;  1A75 A;  4BY5 A;  2H61 C;  2JPT A;  2KI6 C;  2KBM A;  5AAN A;  1MXE A;  1XFV O;  4DCK A;  4PE7 A;  2O60 A;  5DKR A;  2QAC A;  5CSI A;  3TDU A;  1K93 D;  1V1G A;  1A2X A;  2BL0 B;  1CLM A;  1ALW A;  1DMO A;  2BCA A;  5JJG A;  1CFP A;  3SG6 A;  4GGN A;  5KTY A;  4C0J A;  3E3R A;  1SYM A;  1XFW O;  3HCM A;  1FW4 A;  1QIV A;  1S3P A;  2OPO A;  4MZL A;  1H8B A;  1K9U A;  1TOP A;  1W7I B;  2LAN A;  1TCF A;  3GK4 X;  2PAS A;  3NSI A;  4ZCU A;  1WLM A;  1MQ1 A;  1SL9 A;  3NSK A;  3O4Y A;  5HLV A;  5HKY A;  4ICB A;  2MAZ A;  2K7B A;  1BT6 A;  2KAY A;  5F6T A;  1QXP A;  2Y1M A;  3A8R A;  2HPS A;  2LCP A;  2WCE A;  2GGZ A;  3EK8 A;  1Y1A A;  4MEW A;  4XJK A;  3BQ3 A;  1EG4 A;  1DJI A;  1S5G Y;  2LHL A;  1DJZ A;  1K90 D;  1V1F A;  1B8C A;  2L4H A;  1OZS A;  1F70 A;  3BUW B;  3PM8 A;  2V53 A;  1N0Y A;  5ER4 X;  3SG5 A;  1QAS A;  1QV1 A;  1MXL C;  5D7F A;  4YRU A;  4A4B A;  1A29 A;  4NDB A;  2PMY A;  1CTR A;  1YRU B;  3EK7 A;  4YBH B;  3VGO A;  4FQO A;  3SG4 A;  1SPY A;  2Y4Q A;  2PSR A;  1OOJ A;  1KFU S;  4PCW A;  1XVJ A;  1UWO A;  4HRH A;  2KFG A;  4OVN F;  2KAX A;  3DVE A;  1FPW A;  5CSN A;  2I94 A;  3PFV A;  1QLS A;  1PRW A;  3GK2 A;  4M2P A;  1B8L A;  3SG7 A;  1BR1 B;  4I5K A;  2FJU B;  3VRR A;  1OSA A;  2HQ8 A;  4MRX A;  2KAV A;  1B1G A;  4OV2 A;  3TUY C;  3DVJ A;  2L4I A;  4YGC B;  2LVI A;  1ODB A;  2P6B B;  2F3Y A;  2JT0 A;  1VRK A;  1XK4 A;  1TNW A;  2MA2 A;  1X02 A;  1ZOT B;  2KDH A;  1PK0 D;  5KSZ A;  2M8U A;  1S26 D;  2KHN A;  1NPQ A;  1UHI A;  2K8M B;  1DJX A;  2GGM A;  2AUC A;  4IL1 A;  2KGR A;  4N5X A;  2M7L A;  1M45 A;  3JTD C;  1RWY A;  2KQY A;  1C7W A;  1OMD A;  1H4B A;  2KBI A;  4AOM A;  2L5X B;  4Q04 A;  5KU1 A;  2CNP A;  1MUX A;  1AJ4 A;  1JUO A;  1MF8 B;  1BMO A;  1JC2 A;  3JTD B;  1JFJ A;  3C1V A;  1EXR A;  1N65 A;  4P5O E;  1YVL A;  3WHU B;  1YUU A;  3BOW B;  1G33 A;  2K7D A;  2BCX A;  2PRU A;  3TDZ A;  1CNP A;  4GGF C;  1YX8 A;  1XFZ O;  1SW8 A;  2KGB C;  2NCO A;  3PAL A;  3SJS A;  3PSR A;  3PAT A;  1WRK A;  3NXA A;  4PAL A;  1S5G Z;  4PDZ A;  1F8H A;  3BXK A;  4BY4 A;  2A4J A;  2PAL A;  1WRZ A;  1TNQ A;  2PVB A;  1TNX A;  2M3W A;  1DVI A;  4MBE A;  4HRG A;  1JF2 A;  4DS7 A;  1TTX A;  2WCF A;  5BPJ A;  1ZMZ A;  2BKH B;  3KEV A;  3DF0 A;  4GUK A;  5TNC A;  2JT3 A;  1B8R A;  4M2O A;  2F33 A;  3OB1 B;  2TN4 A;  2MJW B;  3OB2 B;  1K95 A;  1RFJ A;  2LVJ A;  2LVV A;  5AER A;  1J7Q A;  1FF1 A;  1TN4 A;  3LL8 B;  3JVT C;  1QS7 A;  3DD4 A;  1BLQ A;  3D0Y A;  1M46 A;  2KOT A;  1BR4 B;  3F45 A;  2LMV A;  3AAJ A;  1NWD A;  3BYA A;  2LM5 A;  4QJ4 B;  3WXA A;  1G4Y R;  2I18 A;  1ZFS A;  1NSH A;  1BU3 A;  2CBL A;  3OX6 A;  5HKZ A;  4USL A;  2Q91 A;  3OP0 A;  4C0K A;  5HYD A;  1CB1 A;  1NX2 A;  1GGW A;  3JVT B;  2F2P A;  1OZO A;  1HQV A;  2LVK A;  2WOS A;  3CTN A;  4GNK B;  4TNC A;  3AKA A;  4MN0 A;  1CLL A;  1SL8 A;  2JOJ A;  3CWG A;  1BG1 A;  1GGZ A;  1SBJ A;  1IJ5 A;  1Y6W A;  3CGA A;  4YGB B;  5AEQ A;  1NCX A;  2SCP A;  1A75 B;  2H61 A;  2JWW A;  4PE0 A;  1JF0 A;  2JNF A;  2LP2 A;  1F55 A;  4DUQ A;  1QTX A;  2EC6 C;  2M0R A;  1LIN A;  1TCO B;  2KI4 C;  1DJH A;  1U5I A;  2KSP A;  1BOC A;  5K89 A;  5HKW A;  1DGU A;  2I2R E;  1F4O A;  4JPZ B;  2ZKM X;  2K61 A;  1IJ6 A;  1JBA A; 
#chains in the Genus database with same CATH topology
 2ZNE A;  3D74 A;  1P28 A;  5FI6 A;  5I94 A;  3EVV A;  1CFC A;  1SNL A;  4CPV A;  1IGV A;  2EC6 B;  3BUX B;  2JRF A;  4ORA B;  2QEO A;  1IKU A;  1S6J A;  3KPX A;  4PHJ A;  2KI4 B;  1KK7 Z;  4GFT A;  4PHM A;  5AFP A;  1RTP 1;  1XFY O;  3DVM A;  4HRE E;  5DKN A;  4OKH A;  1J55 A;  2Q4U A;  4UPG A;  3CYZ A;  1YUT A;  2BE4 A;  1AUI B;  3LK1 A;  4DRW A;  3ZNI A;  1AK8 A;  1DJW A;  2FOT A;  5AXI A;  1YVH A;  4YGD B;  1RRO A;  1LVC D;  1QLK A;  4XJK B;  4NDD A;  2JQ6 A;  2BEC A;  4MZJ A;  3VRO A;  4QJ5 B;  2JT8 A;  5D69 A;  3PLF B;  3I5F C;  1IH0 A;  2JUL A;  3D10 A;  1B7T Y;  3ICB A;  1KQM C;  4I5N B;  2QPT A;  2LUX A;  2R2I A;  3BJH A;  2L51 A;  3FE9 A;  1BOD A;  1UUR A;  1IG5 A;  3LK0 A;  3NSL A;  1SCM C;  4NQG A;  1NP8 A;  1J7O A;  2H8V A;  1F4Q A;  2JNX A;  2M97 A;  4YI9 A;  1REC A;  2ZRT A;  2BBM A;  3I5F B;  4ETO A;  1NX3 A;  1KFX S;  1KQM B;  1XA5 A;  1S36 A;  2LLU A;  2HET A;  4OCI A;  1AP4 A;  3TDI A;  2NCP A;  2LAP A;  1TUJ A;  2M1U A;  2ZRS A;  1YTZ C;  2JXC A;  2K2F A;  1Y1X A;  2CXJ A;  4YGE B;  1HT9 A;  1MWN A;  1SCM B;  1IQ5 A;  3MSE B;  4R1E A;  1XK4 C;  1WRL A;  1YUS A;  3EG5 B;  2F3Z A;  4U8D A;  3R72 A;  4CLN A;  1DJG A;  4IJ7 A;  5CPV A;  1K8U A;  3RLZ A;  3TUY B;  1AHR A;  3CLN A;  1ALV A;  3H4S E;  1S6I A;  2KNE A;  2ISD A;  1TIZ A;  3CZT X;  1CMG A;  3K21 A;  1E8A A;  2YGU A;  1R2U A;  2KFF A;  1LXF C;  3NSO A;  1DC1 A;  1DJY A;  3PJI A;  2L98 A;  1IQ3 A;  2COL B;  2WOR A;  2JU0 A;  2K7O A;  3HX4 A;  3S0A A;  3SIB A;  2BCB A;  3LCP C;  2LV7 A;  3L4L A;  2Y5I A;  3IQQ A;  1MR8 A;  2JC2 A;  2ZN9 A;  1ZAC A;  3CDN A;  3CS1 A;  3EVR A;  3FE8 A;  2H2K A;  4FTG A;  3RZS A;  2F2O A;  3FE6 A;  2DOQ A;  2LLT A;  1M39 A;  3FIA A;  2KYF A;  4GAO A;  1C3Z A;  1S6C A;  1CDL A;  3L4A A;  3FWB A;  3S0D A;  1FI6 A;  3O4X A;  1KFX L;  2CTN A;  1EG3 A;  3D76 A;  1SK6 D;  4YGA A;  1DF0 A;  1PAL A;  2QEV A;  3SIA A;  1A03 A;  3SS4 A;  2BKI B;  1SKT A;  3D75 A;  3UO9 A;  1K96 A;  1LKJ A;  3BFA A;  2F8P A;  2CT9 A;  2SAS A;  3LLE A;  4L9M A;  5CSF A;  1EJ3 A;  3ZWH A;  4GGF A;  2K0J A;  3EVU A;  3A4U B;  1JWD A;  2NXQ A;  2BAP A;  3CZ1 A;  1OMV A;  1SMG A;  2MLF C;  1SRA A;  3B7A A;  1W7J B;  3EKJ A;  2JTZ A;  5HLO A;  4JQ0 D;  1D1O A;  1CDM A;  4MSP A;  1QV0 A;  2M9G A;  1OE9 B;  2ZN8 A;  2BE6 A;  4N1G A;  3RM1 A;  1RK9 A;  3PN7 C;  2KQ6 A;  3OGN A;  1NCY A;  1WLZ A;  1Y1U A;  1DQE A;  2JZI A;  2E6W A;  3EKH A;  1QVI Y;  3I5H C;  2M7N A;  2JXL A;  4D1E A;  1PVA A;  3I5I C;  3SG3 A;  2G2B A;  4ORC B;  1F54 A;  3FS7 A;  2WC8 A;  3PN7 B;  2LMU A;  4OZD A;  1QIW A;  4A4C A;  1KCY A;  1J7R A;  4WRI A;  5B8I B;  4N1F A;  3Q8I A;  4YI8 A;  1GQM A;  3B88 A;  1UP5 A;  3I5I B;  1CFF A;  5DIC A;  1DGV A;  1KK8 C;  1QX2 A;  1UHK A;  1K9P A;  2D8N A;  2IS9 A;  3O6B A;  2K2A A;  2PYQ A;  4XYN A;  4PHN A;  2NLN A;  1C07 A;  1AJ5 A;  4I5J A;  3BUN B;  4PT1 A;  1QX7 A;  2L2E A;  5ER5 A;  1DEL A;  3CR5 X;  1QJT A;  3NHT A;  1TRF A;  3WNX B;  3B86 A;  3SG2 A;  5PAL A;  2ZFD A;  3NGV A;  3QME A;  1KK8 B;  5J3X A;  3UNW A;  1K2H A;  1WY9 A;  1DTL A;  1AVS A;  1S1E A;  4ZCV A;  1KQV A;  1U5I B;  4M2Q A;  4DIR A;  4PHK A;  4WQ3 A;  1N2D A;  3I5G C;  2ZND A;  3CZ0 A;  3DVK A;  4INX A;  2M49 B;  1R6P A;  2L50 A;  3R1O A;  3VRP A;  1K94 A;  2BBN A;  2WCJ A;  2I7A A;  1NX1 A;  1WDC C;  2L5Y A;  2AMI A;  2LLS A;  1UHJ A;  3I5G B;  1NYA A;  2B1U A;  1OOI X;  2G9B A;  1K9K A;  1NCZ A;  1PUL A;  3B87 A;  2LHI A;  5EL2 A;  1UHN A;  4E68 A;  1SR6 C;  3KO0 A;  1NX0 A;  1WDC B;  2EHB A;  3GK1 A;  1IIO A;  2Y1N A;  3BFB A;  1CKK A;  1JFK A;  1YX7 A;  1NIW A;  3FWC A;  2KFH A;  5I2O A;  3DXL A;  1FBV A;  1LA0 A;  5FI2 A;  5GQQ C;  5JOL A;  2GTE A;  3BUM B;  1KWO C;  2M29 A;  3TZ1 A;  1M63 B;  1SR6 B;  1DEK A;  1Y0V H;  5D3O A;  1YR5 A;  1QVI Z;  3N7H A;  4ORB B;  1F71 A;  1BJF A;  2P70 A;  4F0Z B;  3CZ2 A;  3KHE A;  1NUB A;  4HSZ A;  2VRG A;  1PVB A;  4MRY A;  4WQ2 A;  1JSA A;  3V2L A;  4AQI A;  2OTG C;  3EK4 A;  5IBW A;  4JWQ A;  1B4C A;  4P2Y B;  1KWO B;  2BNX A;  2FCD A;  3M0W A;  4MZK A;  1CDP A;  1IRJ A;  2QDI A;  2WCB A;  1FI5 A;  1CFD A;  5G08 A;  1EH2 A;  1L2O C;  2OS8 C;  1XFU O;  2LE9 B;  3SS3 A;  1OMR A;  3IQO A;  5DKQ A;  2M1K B;  5I2L A;  2OTG B;  1QAT A;  3BOW A;  4I5L B;  2KYC A;  3IF7 A;  2WC6 A;  4PE1 A;  2HQW A;  2WCM A;  3D78 A;  2O5G A;  3QRX A;  2WND A;  5CSJ A;  3S0F A;  2MRD A;  1L2O B;  2CCM A;  3TS5 C;  4C0L A;  3BUO B;  2OS8 B;  2GV5 A;  1CLB A;  4JKT A;  5I2Q A;  3WHT B;  1J1D A;  2LUC A;  2FJY A;  2NZ0 A;  1XO5 A;  3OX5 A;  1KSM A;  1RJV A;  2EGD A;  3DY9 A;  1BF5 A;  1CDN A;  2PQL A;  1G8I A;  1YUR A;  3GOF A;  1QWV A;  1CMF A;  4CFQ A;  1CM4 A;  3OBV A;  3TS5 B;  4MVF A;  4CID A;  1OQP A;  1KK7 Y;  2LNK A;  4AQJ A;  4GBA A;  1CM1 A;  3OHM B;  2HF5 A;  1KFU L;  2RGI A;  1B9A A;  4OR9 B;  3PM2 A;  4MLW A;  2AAO A;  1MHO A;  1LA3 A;  4GPL B;  1L7Z A;  3VRN A;  1SCV A;  1B7T Z;  4PE4 A;  1XFX O;  1EL4 A;  2E30 A;  1TNP A;  4CFR A;  1PSR A;  1TWO A;  1XYD A;  1DT7 B;  3O2P A;  1DF0 B;  2KI6 D;  4QJ3 B;  2MBX A;  3O78 A;  2K7C A;  1Z4H A;  2L0P A;  1Q80 A;  2LC5 A;  1QX5 B;  3AKB A;  3DF0 B;  1J1E A;  1KSO A;  1YRT B;  1GJY A;  3AAK A;  2LP3 A;  1UUS A;  1A4P A;  2LMT A;  2QEH A;  1UHH A;  1SY9 A;  5FYX A;  3VRQ A;  3KF9 A;  1IWQ A;  1PSB A;  2MLE C;  3L47 A;  2FCE A;  2KPH A;  1M31 A;  2MHH A;  3CR4 X;  3D0Y B;  1SL7 A;  2JTT A;  2WCL A;  1ZUZ A;  1J7P A;  3CR2 A;  2BL0 C;  1C7V A;  1B47 A;  5I8N A;  3I5H B;  4NDC A;  1A75 A;  3B6X A;  2H61 C;  1OW4 A;  2JPT A;  2KI6 C;  4BY5 A;  2KBM A;  5AAN A;  3SS5 A;  1C3Y A;  1MXE A;  1XFV O;  4DCK A;  4PE7 A;  2O60 A;  5DKR A;  2QAC A;  5CSI A;  3TDU A;  1K93 D;  1V1G A;  1A2X A;  2KLD A;  2BL0 B;  4F7F A;  1CLM A;  1ALW A;  3DYE A;  1DMO A;  2BCA A;  5JJG A;  1CFP A;  3SG6 A;  4GGN A;  5KTY A;  1GM0 A;  4C0J A;  3E3R A;  1SYM A;  1XFW O;  3HCM A;  1FW4 A;  1QIV A;  1S3P A;  2OPO A;  4MZL A;  1H8B A;  1K9U A;  1TOP A;  1W7I B;  2LAN A;  1TCF A;  2KLE A;  3GK4 X;  2PAS A;  3NSI A;  4ZCU A;  1WLM A;  1MQ1 A;  1SL9 A;  3NSK A;  3O4Y A;  5HLV A;  5HKY A;  4ICB A;  3S0E A;  2MAZ A;  2K7B A;  3IVT A;  1BT6 A;  2KAY A;  3K1E A;  1QXP A;  2Y1M A;  3A8R A;  5F6T A;  2HPS A;  2LCP A;  4JD9 A;  2WCE A;  2GGZ A;  2WCK A;  1Y1A A;  3EK8 A;  4MEW A;  4XJK A;  3BQ3 A;  3S0G A;  2L2C A;  1EG4 A;  2WC5 A;  1DJI A;  1S5G Y;  2LHL A;  1DJZ A;  1K90 D;  1V1F A;  1B8C A;  2L4H A;  1OZS A;  1F70 A;  3BUW B;  3PM8 A;  2V53 A;  1OOF A;  1N0Y A;  5ER4 X;  3SG5 A;  1QAS A;  1QV1 A;  1MXL C;  1TUZ A;  5D7F A;  1W9Z A;  4YRU A;  4A4B A;  1A29 A;  4NDB A;  2PMY A;  1CTR A;  1YRU B;  3EK7 A;  4YBH B;  3VGO A;  4FQO A;  3SG4 A;  1SPY A;  2Y4Q A;  1OOH A;  2PSR A;  1OOJ A;  1KFU S;  4PCW A;  1XVJ A;  1SSE B;  1UWO A;  4HRH A;  2KFG A;  4OVN F;  2KAX A;  3DVE A;  1FPW A;  5CSN A;  2I94 A;  3PFV A;  1QLS A;  1PRW A;  3GK2 A;  4M2P A;  2QEB A;  1B8L A;  3SG7 A;  1BR1 B;  4I5K A;  2FJU B;  3VRR A;  1OSA A;  2HQ8 A;  4MRX A;  2KAV A;  1B1G A;  3D77 A;  4OV2 A;  3TUY C;  3DVJ A;  2L4I A;  4YGC B;  2LVI A;  1ODB A;  2P6B B;  2F3Y A;  2JT0 A;  1VRK A;  1XK4 A;  1TNW A;  2MA2 A;  2WCH A;  1X02 A;  1ZOT B;  2KDH A;  1PK0 D;  5KSZ A;  2M8U A;  1S26 D;  2KHN A;  1NPQ A;  1UHI A;  2K8M B;  1DJX A;  2GGM A;  2AUC A;  4IL1 A;  2KGR A;  4N5X A;  2M7L A;  3R1V A;  1M45 A;  3JTD C;  1RWY A;  3S0B A;  2KQY A;  4KYN A;  1C7W A;  1OMD A;  1H4B A;  2KBI A;  4AOM A;  2L5X B;  4Q04 A;  5KU1 A;  2CNP A;  1XFR A;  1MUX A;  1AJ4 A;  1JUO A;  1OOG A;  1T14 A;  3D73 A;  1MF8 B;  1BMO A;  2P71 A;  1JC2 A;  3JTD B;  1JFJ A;  3VB1 A;  3C1V A;  1EXR A;  1N65 A;  4P5O E;  1YVL A;  3WHU B;  1YUU A;  3BOW B;  1G33 A;  2K7D A;  2ERB A;  2BCX A;  2PRU A;  3TDZ A;  1CNP A;  4GGF C;  1ORG A;  1XFZ O;  1SW8 A;  1YX8 A;  2KGB C;  2NCO A;  3PAL A;  3PSR A;  3PAT A;  3SJS A;  1WRK A;  3NXA A;  4PAL A;  3DZT A;  1S5G Z;  4PDZ A;  1F8H A;  5HL1 A;  3BXK A;  4BY4 A;  2A4J A;  2PAL A;  1WRZ A;  1TNQ A;  2PVB A;  1TNX A;  2M3W A;  1DVI A;  4MBE A;  4HRG A;  1JF2 A;  4DS7 A;  1TTX A;  2WCF A;  5BPJ A;  1ZMZ A;  2BKH B;  3KEV A;  3DF0 A;  4GUK A;  5TNC A;  2JT3 A;  1B8R A;  3BFH A;  4M2O A;  2F33 A;  3R1P A;  3OB1 B;  2TN4 A;  3NHI A;  2MJW B;  5FI7 A;  3OB2 B;  1K95 A;  1RFJ A;  2LVJ A;  2LVV A;  5AER A;  1J7Q A;  1FF1 A;  1TN4 A;  3LL8 B;  2K60 A;  3JVT C;  1Z2C B;  1QS7 A;  3DD4 A;  1BLQ A;  3D0Y A;  1M46 A;  2KOT A;  1BR4 B;  3F45 A;  2LMV A;  3AAJ A;  1NWD A;  3CAB A;  3BYA A;  2LM5 A;  1LS8 A;  4QJ4 B;  3WXA A;  1G4Y R;  2I18 A;  1ZFS A;  1NSH A;  1BU3 A;  2CBL A;  3OX6 A;  5HKZ A;  4USL A;  2Q91 A;  3OP0 A;  4C0K A;  5HYD A;  1CB1 A;  1NX2 A;  2JPO A;  1GGW A;  3JVT B;  2F2P A;  1OZO A;  1HQV A;  2LVK A;  2WOS A;  3CTN A;  4GNK B;  4TNC A;  3AKA A;  4MN0 A;  1CLL A;  1SL8 A;  2JOJ A;  3CWG A;  1BG1 A;  1GGZ A;  1SBJ A;  1IJ5 A;  1Y6W A;  3CGA A;  4YGB B;  5AEQ A;  1NCX A;  2SCP A;  1A75 B;  2H61 A;  2JWW A;  4PE0 A;  1JF0 A;  2JNF A;  2LP2 A;  1F55 A;  4DUQ A;  1QTX A;  2EC6 C;  2M0R A;  1LIN A;  1TCO B;  2KI4 C;  1DJH A;  1U5I A;  2KSP A;  1BOC A;  5K89 A;  5HKW A;  1DGU A;  4FQT A;  2I2R E;  4INW A;  1F4O A;  4JPZ B;  2ZKM X;  2K61 A;  1IJ6 A;  1JBA A; 
#chains in the Genus database with same CATH homology
 2ZNE A;  3EVV A;  1CFC A;  1SNL A;  4CPV A;  1IGV A;  2EC6 B;  3BUX B;  2JRF A;  4ORA B;  1IKU A;  1S6J A;  3KPX A;  4PHJ A;  2KI4 B;  1KK7 Z;  4GFT A;  4PHM A;  5AFP A;  1RTP 1;  1XFY O;  3DVM A;  4HRE E;  5DKN A;  4OKH A;  1J55 A;  2Q4U A;  4UPG A;  3LK1 A;  1YUT A;  2BE4 A;  1AUI B;  1AK8 A;  4DRW A;  3ZNI A;  1DJW A;  2FOT A;  5AXI A;  1YVH A;  4YGD B;  1RRO A;  1LVC D;  1QLK A;  4XJK B;  4NDD A;  2JQ6 A;  2BEC A;  4MZJ A;  3VRO A;  4QJ5 B;  2JT8 A;  5D69 A;  3PLF B;  3I5F C;  1IH0 A;  2JUL A;  3D10 A;  1B7T Y;  3ICB A;  1KQM C;  4I5N B;  2QPT A;  2LUX A;  2R2I A;  2L51 A;  1BOD A;  1UUR A;  1IG5 A;  3LK0 A;  3NSL A;  1SCM C;  4NQG A;  1NP8 A;  1J7O A;  1F4Q A;  2JNX A;  2M97 A;  4YI9 A;  1REC A;  2ZRT A;  2BBM A;  3I5F B;  4ETO A;  1NX3 A;  1KFX S;  1KQM B;  1XA5 A;  1S36 A;  2LLU A;  2HET A;  4OCI A;  1AP4 A;  3TDI A;  2NCP A;  2LAP A;  2M1U A;  2ZRS A;  1YTZ C;  2JXC A;  2K2F A;  1Y1X A;  2CXJ A;  4YGE B;  1HT9 A;  1MWN A;  1SCM B;  1IQ5 A;  3MSE B;  4R1E A;  1XK4 C;  1WRL A;  1YUS A;  2F3Z A;  4U8D A;  4CLN A;  1DJG A;  3RLZ A;  5CPV A;  1K8U A;  3TUY B;  1AHR A;  3CLN A;  1ALV A;  3H4S E;  1S6I A;  2KNE A;  2ISD A;  1TIZ A;  3CZT X;  1CMG A;  3K21 A;  1E8A A;  1R2U A;  2KFF A;  1LXF C;  3NSO A;  1DJY A;  1IQ3 A;  2L98 A;  2COL B;  2WOR A;  2JU0 A;  2K7O A;  3HX4 A;  3SIB A;  2BCB A;  3LCP C;  2LV7 A;  2Y5I A;  3IQQ A;  1MR8 A;  2JC2 A;  2ZN9 A;  1ZAC A;  3CS1 A;  3EVR A;  2H2K A;  4FTG A;  2F2O A;  2DOQ A;  2LLT A;  1M39 A;  3FIA A;  2KYF A;  4GAO A;  1S6C A;  1CDL A;  3FWB A;  1FI6 A;  1KFX L;  2CTN A;  1EG3 A;  1SK6 D;  4YGA A;  1DF0 A;  1PAL A;  3SIA A;  1A03 A;  2BKI B;  1SKT A;  1K96 A;  1LKJ A;  3LLE A;  2F8P A;  2CT9 A;  2SAS A;  3ZWH A;  4L9M A;  5CSF A;  1EJ3 A;  4GGF A;  2K0J A;  3EVU A;  3A4U B;  1JWD A;  2NXQ A;  1OMV A;  1SMG A;  2MLF C;  1SRA A;  3EKJ A;  1W7J B;  2JTZ A;  5HLO A;  4JQ0 D;  1D1O A;  1CDM A;  4MSP A;  1QV0 A;  2M9G A;  1OE9 B;  2ZN8 A;  2BE6 A;  4N1G A;  3RM1 A;  1RK9 A;  3PN7 C;  2KQ6 A;  1NCY A;  1WLZ A;  1Y1U A;  2JZI A;  2E6W A;  3EKH A;  1QVI Y;  3I5H C;  2M7N A;  2JXL A;  4D1E A;  1PVA A;  3I5I C;  3SG3 A;  2G2B A;  4ORC B;  1F54 A;  3FS7 A;  2WC8 A;  3PN7 B;  2LMU A;  1QIW A;  4A4C A;  1KCY A;  1J7R A;  4WRI A;  5B8I B;  4N1F A;  4YI8 A;  1GQM A;  1UP5 A;  3I5I B;  1CFF A;  1DGV A;  1KK8 C;  1QX2 A;  1UHK A;  1K9P A;  2D8N A;  2IS9 A;  3O6B A;  2K2A A;  1C07 A;  4XYN A;  4PHN A;  2NLN A;  1AJ5 A;  4I5J A;  3BUN B;  1QX7 A;  2L2E A;  5ER5 A;  3CR5 X;  1QJT A;  1TRF A;  3WNX B;  3SG2 A;  5PAL A;  2ZFD A;  1KK8 B;  5J3X A;  1K2H A;  1WY9 A;  1DTL A;  1AVS A;  1S1E A;  4ZCV A;  1KQV A;  1U5I B;  4M2Q A;  4DIR A;  4PHK A;  4WQ3 A;  1N2D A;  3I5G C;  2ZND A;  3DVK A;  2M49 B;  1R6P A;  2L50 A;  3VRP A;  1K94 A;  2BBN A;  2I7A A;  1NX1 A;  1WDC C;  2AMI A;  2LLS A;  1UHJ A;  3I5G B;  1NYA A;  2B1U A;  2G9B A;  1K9K A;  1NCZ A;  1PUL A;  2LHI A;  1UHN A;  4E68 A;  1SR6 C;  3KO0 A;  1NX0 A;  1WDC B;  2EHB A;  3GK1 A;  2Y1N A;  1CKK A;  1JFK A;  1YX7 A;  1NIW A;  3FWC A;  2KFH A;  5I2O A;  1FBV A;  1LA0 A;  5GQQ C;  5JOL A;  3BUM B;  1KWO C;  2M29 A;  3TZ1 A;  1M63 B;  1SR6 B;  1Y0V H;  1YR5 A;  1QVI Z;  4ORB B;  1F71 A;  1BJF A;  4F0Z B;  3KHE A;  1NUB A;  4HSZ A;  2VRG A;  1PVB A;  4MRY A;  4WQ2 A;  1JSA A;  4AQI A;  2OTG C;  3EK4 A;  5IBW A;  4JWQ A;  1B4C A;  4P2Y B;  1KWO B;  2FCD A;  3M0W A;  4MZK A;  1CDP A;  1IRJ A;  2WCB A;  1FI5 A;  1CFD A;  5G08 A;  1EH2 A;  1L2O C;  2OS8 C;  1XFU O;  2LE9 B;  1OMR A;  3IQO A;  5DKQ A;  2M1K B;  5I2L A;  2OTG B;  1QAT A;  3BOW A;  4I5L B;  2KYC A;  3IF7 A;  4PE1 A;  2HQW A;  5CSJ A;  2O5G A;  3QRX A;  2WND A;  2MRD A;  1L2O B;  2CCM A;  3TS5 C;  4C0L A;  3BUO B;  2OS8 B;  2GV5 A;  1CLB A;  5I2Q A;  3WHT B;  1J1D A;  2LUC A;  2NZ0 A;  1XO5 A;  3OX5 A;  1KSM A;  1RJV A;  2EGD A;  1BF5 A;  1CDN A;  1G8I A;  1YUR A;  3GOF A;  1CMF A;  4CFQ A;  1CM4 A;  3TS5 B;  4MVF A;  4CID A;  1OQP A;  1KK7 Y;  2LNK A;  4AQJ A;  4GBA A;  1CM1 A;  3OHM B;  2HF5 A;  1KFU L;  2RGI A;  1B9A A;  4OR9 B;  4MLW A;  2AAO A;  1MHO A;  1LA3 A;  4GPL B;  1L7Z A;  3VRN A;  1SCV A;  1B7T Z;  4PE4 A;  1XFX O;  1EL4 A;  2E30 A;  1TNP A;  4CFR A;  1PSR A;  1XYD A;  1DT7 B;  3O2P A;  1DF0 B;  2KI6 D;  4QJ3 B;  2MBX A;  3O78 A;  2K7C A;  2L0P A;  1Q80 A;  2LC5 A;  1QX5 B;  3AKB A;  3DF0 B;  1J1E A;  1KSO A;  1YRT B;  1GJY A;  3AAK A;  2LP3 A;  1UUS A;  1A4P A;  2LMT A;  1UHH A;  1SY9 A;  5FYX A;  3VRQ A;  3KF9 A;  1IWQ A;  1PSB A;  2MLE C;  2FCE A;  2MHH A;  1M31 A;  3CR4 X;  3D0Y B;  1SL7 A;  2JTT A;  1ZUZ A;  1J7P A;  3CR2 A;  2BL0 C;  1C7V A;  1B47 A;  5I8N A;  3I5H B;  4NDC A;  1A75 A;  4BY5 A;  2H61 C;  2JPT A;  2KI6 C;  2KBM A;  5AAN A;  1MXE A;  1XFV O;  4DCK A;  4PE7 A;  2O60 A;  5DKR A;  2QAC A;  5CSI A;  3TDU A;  1K93 D;  1V1G A;  1A2X A;  2BL0 B;  1CLM A;  1ALW A;  1DMO A;  2BCA A;  5JJG A;  1CFP A;  3SG6 A;  4GGN A;  5KTY A;  4C0J A;  3E3R A;  1SYM A;  1XFW O;  3HCM A;  1FW4 A;  1QIV A;  1S3P A;  2OPO A;  4MZL A;  1H8B A;  1K9U A;  1TOP A;  1W7I B;  2LAN A;  1TCF A;  3GK4 X;  2PAS A;  3NSI A;  4ZCU A;  1WLM A;  1MQ1 A;  1SL9 A;  3NSK A;  3O4Y A;  5HLV A;  5HKY A;  4ICB A;  2MAZ A;  2K7B A;  1BT6 A;  2KAY A;  5F6T A;  1QXP A;  2Y1M A;  3A8R A;  2HPS A;  2LCP A;  2WCE A;  2GGZ A;  3EK8 A;  1Y1A A;  4MEW A;  4XJK A;  3BQ3 A;  1EG4 A;  1DJI A;  1S5G Y;  2LHL A;  1DJZ A;  1K90 D;  1V1F A;  1B8C A;  2L4H A;  1OZS A;  1F70 A;  3BUW B;  3PM8 A;  2V53 A;  1N0Y A;  5ER4 X;  3SG5 A;  1QAS A;  1QV1 A;  1MXL C;  5D7F A;  4YRU A;  4A4B A;  1A29 A;  4NDB A;  2PMY A;  1CTR A;  1YRU B;  3EK7 A;  4YBH B;  3VGO A;  4FQO A;  3SG4 A;  1SPY A;  2Y4Q A;  2PSR A;  1OOJ A;  1KFU S;  4PCW A;  1XVJ A;  1UWO A;  4HRH A;  2KFG A;  4OVN F;  2KAX A;  3DVE A;  1FPW A;  5CSN A;  2I94 A;  3PFV A;  1QLS A;  1PRW A;  3GK2 A;  4M2P A;  1B8L A;  3SG7 A;  1BR1 B;  4I5K A;  2FJU B;  3VRR A;  1OSA A;  2HQ8 A;  4MRX A;  2KAV A;  1B1G A;  4OV2 A;  3TUY C;  3DVJ A;  2L4I A;  4YGC B;  2LVI A;  1ODB A;  2P6B B;  2F3Y A;  2JT0 A;  1VRK A;  1XK4 A;  1TNW A;  2MA2 A;  1X02 A;  1ZOT B;  2KDH A;  1PK0 D;  5KSZ A;  2M8U A;  1S26 D;  2KHN A;  1NPQ A;  1UHI A;  2K8M B;  1DJX A;  2GGM A;  2AUC A;  4IL1 A;  2KGR A;  4N5X A;  2M7L A;  1M45 A;  3JTD C;  1RWY A;  2KQY A;  1C7W A;  1OMD A;  1H4B A;  2KBI A;  4AOM A;  2L5X B;  4Q04 A;  5KU1 A;  2CNP A;  1MUX A;  1AJ4 A;  1JUO A;  1MF8 B;  1BMO A;  1JC2 A;  3JTD B;  1JFJ A;  3C1V A;  1EXR A;  1N65 A;  4P5O E;  1YVL A;  3WHU B;  1YUU A;  3BOW B;  1G33 A;  2K7D A;  2BCX A;  2PRU A;  3TDZ A;  1CNP A;  4GGF C;  1YX8 A;  1XFZ O;  1SW8 A;  2KGB C;  2NCO A;  3PAL A;  3SJS A;  3PSR A;  3PAT A;  1WRK A;  3NXA A;  4PAL A;  1S5G Z;  4PDZ A;  1F8H A;  3BXK A;  4BY4 A;  2A4J A;  2PAL A;  1WRZ A;  1TNQ A;  2PVB A;  1TNX A;  2M3W A;  1DVI A;  4MBE A;  4HRG A;  1JF2 A;  4DS7 A;  1TTX A;  2WCF A;  5BPJ A;  1ZMZ A;  2BKH B;  3KEV A;  3DF0 A;  4GUK A;  5TNC A;  2JT3 A;  1B8R A;  4M2O A;  2F33 A;  3OB1 B;  2TN4 A;  2MJW B;  3OB2 B;  1K95 A;  1RFJ A;  2LVJ A;  2LVV A;  5AER A;  1J7Q A;  1FF1 A;  1TN4 A;  3LL8 B;  3JVT C;  1QS7 A;  3DD4 A;  1BLQ A;  3D0Y A;  1M46 A;  2KOT A;  1BR4 B;  3F45 A;  2LMV A;  3AAJ A;  1NWD A;  3BYA A;  2LM5 A;  4QJ4 B;  3WXA A;  1G4Y R;  2I18 A;  1ZFS A;  1NSH A;  1BU3 A;  2CBL A;  3OX6 A;  5HKZ A;  4USL A;  2Q91 A;  3OP0 A;  4C0K A;  5HYD A;  1CB1 A;  1NX2 A;  1GGW A;  3JVT B;  2F2P A;  1OZO A;  1HQV A;  2LVK A;  2WOS A;  3CTN A;  4GNK B;  4TNC A;  3AKA A;  4MN0 A;  1CLL A;  1SL8 A;  2JOJ A;  3CWG A;  1BG1 A;  1GGZ A;  1SBJ A;  1IJ5 A;  1Y6W A;  3CGA A;  4YGB B;  5AEQ A;  1NCX A;  2SCP A;  1A75 B;  2H61 A;  2JWW A;  4PE0 A;  1JF0 A;  2JNF A;  2LP2 A;  1F55 A;  4DUQ A;  1QTX A;  2EC6 C;  2M0R A;  1LIN A;  1TCO B;  2KI4 C;  1DJH A;  1U5I A;  2KSP A;  1BOC A;  5K89 A;  5HKW A;  1DGU A;  2I2R E;  1F4O A;  4JPZ B;  2ZKM X;  2K61 A;  1IJ6 A;  1JBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...