2MBXA

Structure, dynamics and stability of allergen cod parvalbumin gad m 1 by solution and high-pressure nmr.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin beta
publication title Solution and high-pressure NMR studies of the structure, dynamics, and stability of the cross-reactive allergenic cod parvalbumin Gad m 1.
pubmed doi rcsb
source organism Gadus morhua
molecule tags Contractile protein
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mbxA00
2LE9B 1ALVA 1L2OB 3GOFA 5I2LA 3EKHA 1TCOB 1ZOTB 5KTYA 3AKAA 2PVBA 2K7DA 3MSEB 1RJVA 2MLEC 1KSMA 3IF7A 2WORA 4M2PA 1CFCA 2KAYA 1KCYA 1K93D 1KK7Y 5ER4X 1G33A 2M3WA 1XFZO 1TTXA 2GGZA 3JVTC 2M1KB 1SL8A 3AKBA 1CDMA 3DVJA 3NSLA 5HLVA 1KFXL 5HKYA 1HQVA 2JNFA 1KQMB 3A8RA 2BE4A 2PMYA 5GQQC 1XK4C 1BU3A 3QRXA 1RROA 1CFPA 1EG3A 2BCAA 1YUUA 2CNPA 4MZLA 5JJGA 1OMDA 1XFUO 2K7OA 4M2OA 1F70A 4PE1A 2TN4A 1OMVA 2KI4C 3OB2B 1BJFA 2JT0A 3SJSA 1YX7A 2ISDA 1UUSA 3TS5C 1SRAA 2JRFA 2NLNA 3CWGA 1CM4A 3BUNB 1QIVA 1A29A 2ZRTA 5D69A 3VRQA 1WDCB 2NZ0A 1B47A 3KEVA 1J7OA 2KBMA 5D7FA 2LVJA 1R2UA 5I2OA 3PFVA 4HRGA 5HKWA 1B1GA 2DOQA 1IH0A 4N5XA 3I5FB 3SG3A 2AMIA 3PN7C 2D8NA 2JTZA 4BY4A 1V1FA 1WRKA 2LMUA 4A4BA 4M2QA 1JFKA 1IWQA 2HQWA 2ZNEA 1XK4A 2KAXA 4ORAB 1ZFSA 3CLNA 1WY9A 2KGRA 4XJKA 3SIAA 1CMFA 1CB1A 1GGZA 5CSNA 2L0PA 3VRNA 2ZFDA 1AJ4A 2B1UA 2CT9A 2EHBA 2KDHA 1F4QA 3SG7A 3VRPA 2KAVA 4GNKB 3DVEA 4DRWA 1CNPA 4MBEA 1L2OC 1DGVA 4QJ3B 2I94A 4MSPA 3DF0A 5KSZA 2WOSA 1U5IB 1A75B 3DVKA 1J7PA 4MZJA 1CMGA 1JBAA 3FIAA 3RLZA 3KO0A 1NX2A 4I5JA 1QV0A 1LA3A 1S26D 3M0WA 1NCYA 1DMOA 1H4BA 1IQ5A 3LK1A 1DJHA 1QLSA 1S1EA 2NCPA 5CSIA 1ZMZA 4NDDA 3KHEA 4NQGA 3HX4A 2FJUB 1KQMC 4OR9B 4P2YB 1AUIB 3I5IB 1NPQA 2EGDA 1F71A 2M29A 1QXPA 3D0YA 4WRIA 1K9KA 2I7AA 3BOWA 1DF0B 1DJGA 1DT7B 2KSPA 5AERA 4I5KA 1B7TZ 2M1UA 3LLEA 1QVIZ 1QTXA 1FI6A 1AHRA 3D0YB 4GUKA 2VRGA 3OHMB 1XA5A 2O60A 4ZCVA 1PVBA 1FI5A 3EK7A 4YRUA 3ICBA 2WC8A 2WCEA 1DJIA 2F33A 1A4PA 2LANA 1SL7A 3WHUB 3PATA 2LMVA 3I5GB 2KGBC 1UHHA 1WDCC 5HLOA 2KI6D 2M0RA 1TNPA 1SR6B 4AOMA 2COLB 1BLQA 2I2RE 1UHIA 3NXAA 2L51A 1VRKA 4CIDA 1GJYA 2LNKA 2LVKA 3I5FC 3SG2A 2WNDA 1YX8A 1IKUA 1SY9A 4AQJA 1DGUA 5AFPA 2R2IA 1RTP1 4PALA 1UHJA 2V53A 4XYNA 3PLFB 4ORCB 3ZNIA 5JOLA 2ZRSA 1B4CA 1FPWA 1J1DA 1OOJA 2LLSA 2FCDA 1XFWO 3VGOA 1B7TY 1IGVA 2FOTA 1QVIY 2BE6A 1XFYO 1SK6D 1QJTA 1PSRA 2JU0A 2LP3A 1UHNA 3KF9A 1XFVO 3OX6A 4PE0A 4MVFA 2F8PA 2BBMA 1Y6WA 1S6CA 1M45A 4I5LB 1ZUZA 1KFUS 1SCVA 1AJ5A 1BODA 3IQQA 4FQOA 2BL0B 2ZKMX 2MJWB 3I5HB 3CS1A 1RECA 3NSOA 3CR2A 1JFJA 4ZCUA 4PHMA 1DJWA 1BR1B 1K90D 3LK0A 2LM5A 4GGFC 3EVVA 2Y1MA 1CLMA 1Q80A 3NSIA 3ZWHA 2OTGB 2JPTA 2ZNDA 5I2QA 4CFQA 5IBWA 2CTNA 3FS7A 5F6TA 4YBHB 4YGAA 4DIRA 4AQIA 5CPVA 2LC5A 2EC6B 3EVUA 5J3XA 3BUXB 1Y1UA 2LAPA 1EL4A 1S3PA 3CR4X 1PULA 1XVJA 1E8AA 5CSFA 1Y1AA 3I5IC 1K2HA 4WQ3A 1OZOA 1HT9A 1TN4A 3BXKA 2E30A 3BUWB 4C0LA 1V1GA 2M7NA 1IJ6A 2NXQA 5ER5A 4JPZB 4DUQA 1NYAA 2HQ8A 2LLTA 1IG5A 2ZN9A 4HRHA 2BBNA 2JC2A 4JQ0D 3HCMA 4MRXA 1L7ZA 1UWOA 2BCBA 1RK9A 1J55A 1LA0A 5KU1A 1B9AA 4JWQA 4PHJA 1LINA 1ODBA 3A4UB 2JULA 3AAJA 1QLKA 2GGMA 4GGFA 1U5IA 1A75A 3WNXB 3PALA 1OE9B 3I5GC 1DVIA 1YUTA 2L4IA 1W7IB 2MAZA 4OVNF 1QV1A 1DJXA 2NCOA 3PSRA 1G8IA 3DVMA 1SR6C 4IL1A 1XFXO 1YRTB 2I18A 1QS7A 1JWDA 4MN0A 1LKJA 2KBIA 2KYCA 1OQPA 1UP5A 2HPSA 3TUYB 4MRYA 2BCXA 2F3ZA 2AAOA 4YGDB 3EK4A 1LXFC 1B8RA 1K96A 5DKNA 1QASA 2JT3A 4ORBB 1DF0A 2SASA 1TRFA 3JTDB 1QX2A 4YI8A 4YGCB 1MR8A 2E6WA 2BKHB 2LP2A 3VROA 2F3YA 1YURA 2KOTA 1WLMA 2K7BA 1MHOA 2LVVA 1K95A 4ETOA 3H4SE 1SCMB 5HKZA 5PALA 2JXCA 2LMTA 1IJ5A 3I5HC 2F2OA 1EJ3A 3C1VA 2A4JA 1UHKA 1KFUL 4A4CA 4QJ4B 1B8LA 2OS8B 4WQ2A 4MEWA 5DKRA 1K94A 3IQOA 1SNLA 1R6PA 1EG4A 2LCPA 1SMGA 5I8NA 1OSAA 1FW4A 2K2AA 2OTGC 1KWOB 3TDIA 3E3RA 2Y5IA 4MLWA 1JUOA 3K21A 1KSOA 1PVAA 1YUSA 2L5XB 1PALA 1UURA 1SL9A 1OZSA 1KK7Z 1NX0A 1RFJA 2KFGA 2EC6C 2GV5A 1F54A 2JOJA 4GAOA 5FYXA 1MF8B 1PK0D 1FBVA 1RWYA 1S5GZ 2K2FA 4N1GA 1C7VA 2WCBA 2H2KA 4USLA 1F4OA 1N0YA 2LVIA 3BYAA 3SG4A 4QJ5B 2O5GA 3BUOB 1MXEA 1EH2A 4N1FA 1CTRA 1GQMA 1BF5A 5TNCA 1J7QA 2HF5A 1EXRA 1CM1A 2KNEA 3F45A 1BMOA 3EKJA 4P5OE 4ICBA 1S6IA 2KI6C 2OPOA 2L50A 1N65A 1DJYA 2KHNA 1J7RA 1TNWA 2LHLA 3PM8A 1SPYA 1QX5B 1NCZA 4OV2A 4PHKA 1J1EA 1TNQA 3NSKA 2L4HA 1AP4A 1WRLA 4PCWA 2L98A 1XYDA 3AAKA 4DS7A 2BECA 3O2PA 4DCKA 4F0ZB 1S5GY 2CCMA 2LUXA 4D1EA 2G2BA 1AK8A 1CFFA 2M9GA 4UPGA 3TUYC 3OX5A 1NX1A 1CLBA 4HSZA 1LVCD 1CFDA 1NX3A 2KQYA 1NSHA 2LV7A 5AANA 1NWDA 2CBLA 1BR4B 4OCIA 1D1OA 2CXJA 3JTDC 5DKQA 2FCEA 1A03A 2K0JA 3BUMB 1M31A 1Y1XA 1CDLA 1Y0VH 1SCMC 2SCPA 1BT6A 4GPLB 4R1EA 4YGEB 5AXIA 3VRRA 4C0JA 1KK8B 2JXLA 3BQ3A 3CGAA 3GK2A 3TDUA 3FWBA 1IRJA 3FWCA 1S6JA 1KQVA 2KFFA 1BOCA 2H61C 2OS8C 1K8UA 1DTLA 1BG1A 4OKHA 1M46A 1B8CA 1NIWA 2MBXA 4CLNA 1CLLA 3TDZA 3O78A 1WRZA 3O4YA 1KWOC 1SYMA 1AVSA 1G4YR 1IQ3A 1QATA 2G9BA 2KYFA 2QACA 4C0KA 1M63B 2HETA 2M97A 1KFXS 1ZACA 2KFHA 2F2PA 4GBAA 2MA2A 2PALA 3CTNA 1GGWA 3JVTB 1CDNA 2K7CA 4HREE 5K89A 2MLFC 5CSJA 2K61A 2Y1NA 2MHHA 2BKIB 3SG5A 4L9MA 5HYDA 2Q91A 4CFRA 1S36A 2K8MB 1W7JB 2AUCA 5G08A 1FF1A 4GFTA 4I5NB 4XJKB 1JSAA 1MQ1A 4PDZA 5BPJA 2JZIA 1NUBA 2H61A 1YRUB 2JT8A 1X02A 2KI4B 3EK8A 3LL8B 3TZ1A 4FTGA 2JWWA 1MUXA 3KPXA 3TS5B 1WLZA 2BL0C 3CZTX 2ZN8A 3O6BA 4E68A 1C07A 1F55A 4NDCA 1TNXA 3OP0A 4BY5A 1SKTA 4CPVA 3DF0B 3CR5X 3D10A 3LCPC 2Y4QA 1SW8A 2KQ6A 5AEQA 1CDPA 1TOPA 4TNCA 2Q4UA 3SG6A 1N2DA 2P6BB 2M8UA 3WHTB 3PN7B 2JNXA 1NP8A 1OMRA 1F8HA 2LLUA 1YVHA 2JQ6A 2PRUA 1DJZA 2MRDA 3GK4X 1K9UA 1YVLA 4PE4A 5B8IB 1ALWA 1MWNA 1QX7A 4Q04A 1TCFA 4PHNA 1JC2A 1PSBA 2M7LA 4YI9A 3WXAA 1H8BA 2M49B 2QPTA 3SIBA 4YGBB 2PSRA 1YTZC 1MXLC 2LUCA 1YR5A 3BOWB 4MZKA 3OB1B 1TIZA 3RM1A 3DD4A 4PE7A 1C7WA 1JF2A 1K9PA 1A2XA 3EVRA 1KK8C 1M39A 1SBJA 4GGNA 4NDBA 1PRWA 3GK1A 4U8DA 2PASA 1NCXA 2RGIA 2JTTA 2WCFA 1QIWA 2LHIA 2IS9A 1CKKA 1XO5A 2L2EA 1JF0A
chains in the Genus database with same CATH superfamily
3NGVA 1ORGA 2LE9B 1ALVA 1L2OB 3GOFA 5I2LA 3EKHA 4IJ7A 1TCOB 1ZOTB 3B87A 5KTYA 3AKAA 2PVBA 2K7DA 3MSEB 1RJVA 2MLEC 1KSMA 3IF7A 5D3OA 2WORA 5EL2A 4INXA 4M2PA 1CFCA 2KAYA 1KCYA 1K93D 1KK7Y 5ER4X 3DXLA 1G33A 2M3WA 1XFZO 1TTXA 2GGZA 3JVTC 2M1KB 1SL8A 3AKBA 1CDMA 3DVJA 3NSLA 5HLVA 1KFXL 5HKYA 1HQVA 2JNFA 1KQMB 2QEBA 3A8RA 2BE4A 1C3YA 2QDIA 2PMYA 5GQQC 1XK4C 1BU3A 3QRXA 1RROA 1CFPA 1EG3A 2BCAA 2BNXA 1YUUA 5I94A 2CNPA 4MZLA 5JJGA 1OMDA 1XFUO 2K7OA 4M2OA 1F70A 3D77A 4PE1A 2TN4A 1OMVA 2KI4C 3OB2B 1BJFA 2JT0A 3SJSA 1YX7A 2ISDA 1UUSA 3R72A 1SRAA 2JRFA 2NLNA 3CWGA 3TS5C 1CM4A 3BUNB 1QIVA 1A29A 2ZRTA 5D69A 3VRQA 3IVTA 1WDCB 2NZ0A 1B47A 3KEVA 3R1VA 1J7OA 2KBMA 5D7FA 2LVJA 1R2UA 3Q8IA 5I2OA 3PFVA 4HRGA 3B6XA 5HKWA 1B1GA 2DOQA 3DY9A 4N5XA 1IH0A 5FI2A 3D76A 3I5FB 3SG3A 2AMIA 1XFRA 3PN7C 3CYZA 2D8NA 2JTZA 3CABA 4BY4A 1V1FA 1WRKA 2LMUA 4A4BA 3K1EA 4M2QA 1JFKA 1IWQA 2HQWA 1DQEA 2ZNEA 1XK4A 2KAXA 4ORAB 2WC5A 3S0GA 1ZFSA 3CLNA 3FE6A 1WY9A 2KGRA 4XJKA 3SIAA 1W9ZA 1CMFA 1CB1A 1GGZA 5CSNA 3SS3A 2L0PA 3VRNA 2ZFDA 4JKTA 1AJ4A 2B1UA 2CT9A 2EHBA 2KDHA 3CZ1A 1F4QA 3SG7A 3S0EA 3VRPA 2PQLA 2KAVA 3B7AA 4GNKB 3DVEA 4DRWA 1CNPA 4MBEA 1L2OC 1DGVA 4QJ3B 2I94A 4MSPA 3DF0A 5KSZA 2WOSA 5HL1A 1U5IB 1A75B 3DVKA 1J7PA 2QEVA 4MZJA 1CMGA 1JBAA 3FIAA 3RLZA 3KO0A 1NX2A 4I5JA 1T14A 1QV0A 1LA3A 1S26D 3M0WA 1NCYA 1DMOA 1H4BA 1IQ5A 3LK1A 1DJHA 1QLSA 1S1EA 2NCPA 4PT1A 5CSIA 1ZMZA 1IIOA 4NDDA 3KHEA 4NQGA 3HX4A 2FJUB 1KQMC 4OR9B 4P2YB 1AUIB 3I5IB 1NPQA 2EGDA 1F71A 3DYEA 2M29A 1QXPA 3D0YA 4WRIA 5FI7A 1K9KA 2I7AA 3BOWA 4KYNA 1DF0B 1DJGA 3NHIA 1DT7B 3UNWA 2KSPA 5AERA 2KPHA 4I5KA 1B7TZ 2M1UA 3LLEA 1QVIZ 1QTXA 1FI6A 1AHRA 3D0YB 4GUKA 1P28A 2VRGA 3OHMB 1XA5A 2O60A 4ZCVA 1PVBA 1FI5A 3EK7A 4YRUA 3ICBA 2WC8A 2WCEA 1DJIA 2F33A 1A4PA 2LANA 1SL7A 3WHUB 3PATA 2WCHA 2LMVA 3I5GB 2KGBC 1UHHA 1WDCC 5HLOA 2KI6D 2M0RA 1TNPA 1SR6B 4AOMA 2COLB 1BLQA 2I2RE 1UHIA 3D73A 2L51A 3NXAA 1VRKA 4CIDA 1GJYA 2LNKA 2LVKA 3I5FC 3SG2A 3SS5A 2WNDA 3L4LA 1YX8A 5DICA 1IKUA 1SY9A 3S0DA 4AQJA 1DGUA 4FQTA 5AFPA 2K60A 1RTP1 2R2IA 1UHJA 2V53A 4PALA 3PLFB 4XYNA 4ORCB 3ZNIA 5JOLA 2ZRSA 1B4CA 1FPWA 1J1DA 1OOJA 2LLSA 2FCDA 1XFWO 3VGOA 1B7TY 1IGVA 2FOTA 1QVIY 2BE6A 1XFYO 1SK6D 1QJTA 1PSRA 2JU0A 2KLDA 1UHNA 2LP3A 1XFVO 3KF9A 3OX6A 4PE0A 4MVFA 2F8PA 2BBMA 1Y6WA 1S6CA 1M45A 4I5LB 1ZUZA 1KFUS 1SCVA 2JPOA 1AJ5A 1BODA 3IQQA 4FQOA 2BL0B 2ZKMX 2MJWB 3I5HB 3CS1A 1RECA 3NSOA 3D78A 3CR2A 1JFJA 3CZ0A 4ZCUA 4PHMA 1DJWA 1QWVA 1BR1B 1K90D 1TWOA 3OGNA 3LK0A 2LM5A 4GGFC 3EVVA 2Y1MA 1CLMA 1Q80A 3NSIA 3ZWHA 2OTGB 2JPTA 2ZNDA 5I2QA 4CFQA 2WCJA 5IBWA 2CTNA 3FS7A 5F6TA 4YBHB 4YGAA 4DIRA 4AQIA 2L5YA 5CPVA 2LC5A 2EC6B 3EVUA 5J3XA 3BUXB 1Y1UA 2LAPA 3SS4A 3BJHA 1EL4A 1S3PA 3CR4X 1PULA 1XVJA 1DELA 1E8AA 1Y1AA 3I5IC 5CSFA 3V2LA 1K2HA 4WQ3A 2KLEA 1OZOA 1HT9A 1TN4A 3BXKA 2E30A 3BUWB 4JD9A 4C0LA 1V1GA 2M7NA 1IJ6A 2NXQA 3NHTA 4JPZB 5ER5A 4DUQA 1NYAA 2HQ8A 2LLTA 1IG5A 2ZN9A 4HRHA 2BBNA 2JC2A 4JQ0D 3HCMA 4MRXA 1L7ZA 1UWOA 2BCBA 1RK9A 1J55A 1LA0A 5KU1A 1B9AA 4JWQA 4PHJA 1LINA 1ODBA 3A4UB 2JULA 3AAJA 1QLKA 2GGMA 4GGFA 1U5IA 1A75A 3WNXB 3PALA 1OE9B 3I5GC 1DVIA 1YUTA 2L4IA 1W7IB 2MAZA 4OVNF 3R1OA 1QV1A 1DJXA 2NCOA 3PSRA 1G8IA 3DVMA 1SR6C 4IL1A 1XFXO 1YRTB 2I18A 1QS7A 1JWDA 3N7HA 4MN0A 1LKJA 2KBIA 2YGUA 2KYCA 1OQPA 1UP5A 2HPSA 3TUYB 3QMEA 3PJIA 4MRYA 2BCXA 2F3ZA 2AAOA 3PM2A 4YGDB 3EK4A 1LXFC 1B8RA 1K96A 5DKNA 1QASA 2JT3A 4ORBB 1DF0A 2SASA 1TRFA 3JTDB 1QX2A 3FE8A 4YI8A 4YGCB 1MR8A 2E6WA 2BKHB 2LP2A 3VROA 2F3YA 1YURA 2KOTA 1WLMA 2K7BA 1MHOA 3BFAA 2LVVA 1K95A 4ETOA 3H4SE 1SCMB 5HKZA 5PALA 2PYQA 2JXCA 2LMTA 1IJ5A 3I5HC 2F2OA 1EJ3A 3CZ2A 3C1VA 2A4JA 1UHKA 1KFUL 4A4CA 4QJ4B 1B8LA 2OS8B 4WQ2A 4MEWA 5DKRA 1K94A 2L2CA 3IQOA 1SNLA 1R6PA 1EG4A 2LCPA 1SMGA 5I8NA 1OSAA 1FW4A 2K2AA 2OTGC 1KWOB 3L47A 3TDIA 3E3RA 2Y5IA 3VB1A 4MLWA 1DEKA 1JUOA 3K21A 1KSOA 1PVAA 1YUSA 2L5XB 3DZTA 3S0FA 1PALA 1UURA 2BAPA 1SL9A 1OZSA 1KK7Z 1NX0A 1RFJA 2KFGA 2EC6C 1SSEB 2GV5A 1OOFA 1F54A 2JOJA 4GAOA 5FYXA 1MF8B 1OOIX 1FBVA 1PK0D 1RWYA 1S5GZ 2K2FA 4N1GA 2WCBA 5AXIA 2H2KA 4USLA 1C7VA 1F4OA 1N0YA 2LVIA 3BYAA 3SG4A 4QJ5B 2O5GA 2QEOA 3BUOB 1MXEA 1EH2A 4N1FA 1CTRA 1GQMA 1BF5A 5TNCA 1J7QA 2HF5A 1EXRA 1CM1A 2KNEA 3F45A 2QEHA 1OW4A 2WCMA 3S0AA 1BMOA 2P70A 3EKJA 4P5OE 4ICBA 3D74A 1S6IA 2KI6C 2OPOA 2L50A 1N65A 2WCKA 1Z4HA 1DJYA 2KHNA 1J7RA 1TNWA 2LHLA 3PM8A 1SPYA 1QX5B 1NCZA 4OV2A 4PHKA 1J1EA 1TNQA 3NSKA 2L4HA 1AP4A 1WRLA 4PCWA 2L98A 1XYDA 3AAKA 4DS7A 2BECA 3O2PA 4DCKA 4F0ZB 1S5GY 2CCMA 1GM0A 2LUXA 4D1EA 2G2BA 1AK8A 1CFFA 2M9GA 4UPGA 3TUYC 3OX5A 1NX1A 1CLBA 1OOGA 4HSZA 1LVCD 1CFDA 1NX3A 2KQYA 3R1PA 1NSHA 2LV7A 5AANA 2ERBA 1NWDA 2CBLA 1BR4B 3BFHA 4OCIA 1D1OA 2CXJA 3JTDC 5DKQA 2FCEA 1A03A 3B86A 2K0JA 3BUMB 3L4AA 1M31A 1Y1XA 1CDLA 1Y0VH 1SCMC 2SCPA 1BT6A 4GPLB 3D75A 3OBVA 4R1EA 4YGEB 3VRRA 4C0JA 1KK8B 2JXLA 3BQ3A 3CGAA 3GK2A 3TDUA 3FWBA 1IRJA 3FWCA 1S6JA 1KQVA 2KFFA 1BOCA 2H61C 2OS8C 1K8UA 1DTLA 1BG1A 4OKHA 1M46A 1B8CA 1NIWA 2MBXA 4CLNA 1CLLA 3TDZA 3O78A 1LS8A 4F7FA 1WRZA 3O4YA 1KWOC 1SYMA 1AVSA 1G4YR 1IQ3A 1QATA 2G9BA 2KYFA 2QACA 4C0KA 1M63B 2HETA 3S0BA 2M97A 1KFXS 1ZACA 2KFHA 3BFBA 2F2PA 4GBAA 3FE9A 2MA2A 2PALA 3CTNA 1GGWA 3JVTB 1CDNA 2K7CA 4HREE 5K89A 2MLFC 5CSJA 2K61A 2Y1NA 2MHHA 2BKIB 3SG5A 5FI6A 4L9MA 5HYDA 2Q91A 3CDNA 1S36A 4CFRA 2K8MB 1W7JB 2AUCA 5G08A 3UO9A 4GFTA 4I5NB 4XJKB 1FF1A 1MQ1A 1JSAA 4PDZA 5BPJA 2JZIA 1NUBA 2H61A 1YRUB 2JT8A 1X02A 2KI4B 1TUJA 3EK8A 2H8VA 3LL8B 4FTGA 2JWWA 1MUXA 2P71A 3KPXA 3TS5B 1TUZA 1WLZA 1DC1A 2BL0C 3CZTX 3O4XA 2ZN8A 3O6BA 4E68A 1C07A 1F55A 4NDCA 1TNXA 3OP0A 4BY5A 1SKTA 4CPVA 3DF0B 1C3ZA 3CR5X 3EG5B 3D10A 3LCPC 2Y4QA 1SW8A 2KQ6A 4INWA 5AEQA 1CDPA 1TOPA 4TNCA 2Q4UA 3SG6A 1N2DA 2P6BB 1OOHA 2M8UA 3WHTB 3PN7B 2JNXA 1NP8A 1OMRA 1F8HA 2LLUA 1YVHA 2JQ6A 2PRUA 1DJZA 2MRDA 3GK4X 1K9UA 1YVLA 4PE4A 5B8IB 2FJYA 1ALWA 1MWNA 1QX7A 4Q04A 1TCFA 4OZDA 4PHNA 1JC2A 1PSBA 2WCLA 4YI9A 2M7LA 3WXAA 1H8BA 2M49B 2QPTA 3SIBA 3TZ1A 4YGBB 1Z2CB 2PSRA 3RZSA 1YTZC 1MXLC 2LUCA 1YR5A 3BOWB 4MZKA 3OB1B 1TIZA 3RM1A 3DD4A 4PE7A 1C7WA 1JF2A 1K9PA 1A2XA 3EVRA 1KK8C 1M39A 1SBJA 4GGNA 4NDBA 1PRWA 3GK1A 4U8DA 2PASA 1NCXA 2GTEA 2RGIA 2JTTA 2WC6A 2WCFA 1QIWA 3B88A 2LHIA 2IS9A 1CKKA 1XO5A 2L2EA 1JF0A
chains in the Genus database with same CATH topology
2LE9B 1ALVA 1L2OB 3GOFA 5I2LA 3EKHA 1TCOB 1ZOTB 5KTYA 3AKAA 2PVBA 2K7DA 3MSEB 1RJVA 2MLEC 1KSMA 3IF7A 2WORA 4M2PA 1CFCA 2KAYA 1KCYA 1K93D 1KK7Y 5ER4X 1G33A 2M3WA 1XFZO 1TTXA 2GGZA 3JVTC 2M1KB 1SL8A 3AKBA 1CDMA 3DVJA 3NSLA 5HLVA 1KFXL 5HKYA 1HQVA 2JNFA 1KQMB 3A8RA 2BE4A 2PMYA 5GQQC 1XK4C 1BU3A 3QRXA 1RROA 1CFPA 1EG3A 2BCAA 1YUUA 2CNPA 4MZLA 5JJGA 1OMDA 1XFUO 2K7OA 4M2OA 1F70A 4PE1A 2TN4A 1OMVA 2KI4C 3OB2B 1BJFA 2JT0A 3SJSA 1YX7A 2ISDA 1UUSA 3TS5C 1SRAA 2JRFA 2NLNA 3CWGA 1CM4A 3BUNB 1QIVA 1A29A 2ZRTA 5D69A 3VRQA 1WDCB 2NZ0A 1B47A 3KEVA 1J7OA 2KBMA 5D7FA 2LVJA 1R2UA 5I2OA 3PFVA 4HRGA 5HKWA 1B1GA 2DOQA 1IH0A 4N5XA 3I5FB 3SG3A 2AMIA 3PN7C 2D8NA 2JTZA 4BY4A 1V1FA 1WRKA 2LMUA 4A4BA 4M2QA 1JFKA 1IWQA 2HQWA 2ZNEA 1XK4A 2KAXA 4ORAB 1ZFSA 3CLNA 1WY9A 2KGRA 4XJKA 3SIAA 1CMFA 1CB1A 1GGZA 5CSNA 2L0PA 3VRNA 2ZFDA 1AJ4A 2B1UA 2CT9A 2EHBA 2KDHA 1F4QA 3SG7A 3VRPA 2KAVA 4GNKB 3DVEA 4DRWA 1CNPA 4MBEA 1L2OC 1DGVA 4QJ3B 2I94A 4MSPA 3DF0A 5KSZA 2WOSA 1U5IB 1A75B 3DVKA 1J7PA 4MZJA 1CMGA 1JBAA 3FIAA 3RLZA 3KO0A 1NX2A 4I5JA 1QV0A 1LA3A 1S26D 3M0WA 1NCYA 1DMOA 1H4BA 1IQ5A 3LK1A 1DJHA 1QLSA 1S1EA 2NCPA 5CSIA 1ZMZA 4NDDA 3KHEA 4NQGA 3HX4A 2FJUB 1KQMC 4OR9B 4P2YB 1AUIB 3I5IB 1NPQA 2EGDA 1F71A 2M29A 1QXPA 3D0YA 4WRIA 1K9KA 2I7AA 3BOWA 1DF0B 1DJGA 1DT7B 2KSPA 5AERA 4I5KA 1B7TZ 2M1UA 3LLEA 1QVIZ 1QTXA 1FI6A 1AHRA 3D0YB 4GUKA 2VRGA 3OHMB 1XA5A 2O60A 4ZCVA 1PVBA 1FI5A 3EK7A 4YRUA 3ICBA 2WC8A 2WCEA 1DJIA 2F33A 1A4PA 2LANA 1SL7A 3WHUB 3PATA 2LMVA 3I5GB 2KGBC 1UHHA 1WDCC 5HLOA 2KI6D 2M0RA 1TNPA 1SR6B 4AOMA 2COLB 1BLQA 2I2RE 1UHIA 3NXAA 2L51A 1VRKA 4CIDA 1GJYA 2LNKA 2LVKA 3I5FC 3SG2A 2WNDA 1YX8A 1IKUA 1SY9A 4AQJA 1DGUA 5AFPA 2R2IA 1RTP1 4PALA 1UHJA 2V53A 4XYNA 3PLFB 4ORCB 3ZNIA 5JOLA 2ZRSA 1B4CA 1FPWA 1J1DA 1OOJA 2LLSA 2FCDA 1XFWO 3VGOA 1B7TY 1IGVA 2FOTA 1QVIY 2BE6A 1XFYO 1SK6D 1QJTA 1PSRA 2JU0A 2LP3A 1UHNA 3KF9A 1XFVO 3OX6A 4PE0A 4MVFA 2F8PA 2BBMA 1Y6WA 1S6CA 1M45A 4I5LB 1ZUZA 1KFUS 1SCVA 1AJ5A 1BODA 3IQQA 4FQOA 2BL0B 2ZKMX 2MJWB 3I5HB 3CS1A 1RECA 3NSOA 3CR2A 1JFJA 4ZCUA 4PHMA 1DJWA 1BR1B 1K90D 3LK0A 2LM5A 4GGFC 3EVVA 2Y1MA 1CLMA 1Q80A 3NSIA 3ZWHA 2OTGB 2JPTA 2ZNDA 5I2QA 4CFQA 5IBWA 2CTNA 3FS7A 5F6TA 4YBHB 4YGAA 4DIRA 4AQIA 5CPVA 2LC5A 2EC6B 3EVUA 5J3XA 3BUXB 1Y1UA 2LAPA 1EL4A 1S3PA 3CR4X 1PULA 1XVJA 1E8AA 5CSFA 1Y1AA 3I5IC 1K2HA 4WQ3A 1OZOA 1HT9A 1TN4A 3BXKA 2E30A 3BUWB 4C0LA 1V1GA 2M7NA 1IJ6A 2NXQA 5ER5A 4JPZB 4DUQA 1NYAA 2HQ8A 2LLTA 1IG5A 2ZN9A 4HRHA 2BBNA 2JC2A 4JQ0D 3HCMA 4MRXA 1L7ZA 1UWOA 2BCBA 1RK9A 1J55A 1LA0A 5KU1A 1B9AA 4JWQA 4PHJA 1LINA 1ODBA 3A4UB 2JULA 3AAJA 1QLKA 2GGMA 4GGFA 1U5IA 1A75A 3WNXB 3PALA 1OE9B 3I5GC 1DVIA 1YUTA 2L4IA 1W7IB 2MAZA 4OVNF 1QV1A 1DJXA 2NCOA 3PSRA 1G8IA 3DVMA 1SR6C 4IL1A 1XFXO 1YRTB 2I18A 1QS7A 1JWDA 4MN0A 1LKJA 2KBIA 2KYCA 1OQPA 1UP5A 2HPSA 3TUYB 4MRYA 2BCXA 2F3ZA 2AAOA 4YGDB 3EK4A 1LXFC 1B8RA 1K96A 5DKNA 1QASA 2JT3A 4ORBB 1DF0A 2SASA 1TRFA 3JTDB 1QX2A 4YI8A 4YGCB 1MR8A 2E6WA 2BKHB 2LP2A 3VROA 2F3YA 1YURA 2KOTA 1WLMA 2K7BA 1MHOA 2LVVA 1K95A 4ETOA 3H4SE 1SCMB 5HKZA 5PALA 2JXCA 2LMTA 1IJ5A 3I5HC 2F2OA 1EJ3A 3C1VA 2A4JA 1UHKA 1KFUL 4A4CA 4QJ4B 1B8LA 2OS8B 4WQ2A 4MEWA 5DKRA 1K94A 3IQOA 1SNLA 1R6PA 1EG4A 2LCPA 1SMGA 5I8NA 1OSAA 1FW4A 2K2AA 2OTGC 1KWOB 3TDIA 3E3RA 2Y5IA 4MLWA 1JUOA 3K21A 1KSOA 1PVAA 1YUSA 2L5XB 1PALA 1UURA 1SL9A 1OZSA 1KK7Z 1NX0A 1RFJA 2KFGA 2EC6C 2GV5A 1F54A 2JOJA 4GAOA 5FYXA 1MF8B 1PK0D 1FBVA 1RWYA 1S5GZ 2K2FA 4N1GA 1C7VA 2WCBA 2H2KA 4USLA 1F4OA 1N0YA 2LVIA 3BYAA 3SG4A 4QJ5B 2O5GA 3BUOB 1MXEA 1EH2A 4N1FA 1CTRA 1GQMA 1BF5A 5TNCA 1J7QA 2HF5A 1EXRA 1CM1A 2KNEA 3F45A 1BMOA 3EKJA 4P5OE 4ICBA 1S6IA 2KI6C 2OPOA 2L50A 1N65A 1DJYA 2KHNA 1J7RA 1TNWA 2LHLA 3PM8A 1SPYA 1QX5B 1NCZA 4OV2A 4PHKA 1J1EA 1TNQA 3NSKA 2L4HA 1AP4A 1WRLA 4PCWA 2L98A 1XYDA 3AAKA 4DS7A 2BECA 3O2PA 4DCKA 4F0ZB 1S5GY 2CCMA 2LUXA 4D1EA 2G2BA 1AK8A 1CFFA 2M9GA 4UPGA 3TUYC 3OX5A 1NX1A 1CLBA 4HSZA 1LVCD 1CFDA 1NX3A 2KQYA 1NSHA 2LV7A 5AANA 1NWDA 2CBLA 1BR4B 4OCIA 1D1OA 2CXJA 3JTDC 5DKQA 2FCEA 1A03A 2K0JA 3BUMB 1M31A 1Y1XA 1CDLA 1Y0VH 1SCMC 2SCPA 1BT6A 4GPLB 4R1EA 4YGEB 5AXIA 3VRRA 4C0JA 1KK8B 2JXLA 3BQ3A 3CGAA 3GK2A 3TDUA 3FWBA 1IRJA 3FWCA 1S6JA 1KQVA 2KFFA 1BOCA 2H61C 2OS8C 1K8UA 1DTLA 1BG1A 4OKHA 1M46A 1B8CA 1NIWA 2MBXA 4CLNA 1CLLA 3TDZA 3O78A 1WRZA 3O4YA 1KWOC 1SYMA 1AVSA 1G4YR 1IQ3A 1QATA 2G9BA 2KYFA 2QACA 4C0KA 1M63B 2HETA 2M97A 1KFXS 1ZACA 2KFHA 2F2PA 4GBAA 2MA2A 2PALA 3CTNA 1GGWA 3JVTB 1CDNA 2K7CA 4HREE 5K89A 2MLFC 5CSJA 2K61A 2Y1NA 2MHHA 2BKIB 3SG5A 4L9MA 5HYDA 2Q91A 4CFRA 1S36A 2K8MB 1W7JB 2AUCA 5G08A 1FF1A 4GFTA 4I5NB 4XJKB 1JSAA 1MQ1A 4PDZA 5BPJA 2JZIA 1NUBA 2H61A 1YRUB 2JT8A 1X02A 2KI4B 3EK8A 3LL8B 3TZ1A 4FTGA 2JWWA 1MUXA 3KPXA 3TS5B 1WLZA 2BL0C 3CZTX 2ZN8A 3O6BA 4E68A 1C07A 1F55A 4NDCA 1TNXA 3OP0A 4BY5A 1SKTA 4CPVA 3DF0B 3CR5X 3D10A 3LCPC 2Y4QA 1SW8A 2KQ6A 5AEQA 1CDPA 1TOPA 4TNCA 2Q4UA 3SG6A 1N2DA 2P6BB 2M8UA 3WHTB 3PN7B 2JNXA 1NP8A 1OMRA 1F8HA 2LLUA 1YVHA 2JQ6A 2PRUA 1DJZA 2MRDA 3GK4X 1K9UA 1YVLA 4PE4A 5B8IB 1ALWA 1MWNA 1QX7A 4Q04A 1TCFA 4PHNA 1JC2A 1PSBA 2M7LA 4YI9A 3WXAA 1H8BA 2M49B 2QPTA 3SIBA 4YGBB 2PSRA 1YTZC 1MXLC 2LUCA 1YR5A 3BOWB 4MZKA 3OB1B 1TIZA 3RM1A 3DD4A 4PE7A 1C7WA 1JF2A 1K9PA 1A2XA 3EVRA 1KK8C 1M39A 1SBJA 4GGNA 4NDBA 1PRWA 3GK1A 4U8DA 2PASA 1NCXA 2RGIA 2JTTA 2WCFA 1QIWA 2LHIA 2IS9A 1CKKA 1XO5A 2L2EA 1JF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE9 B;  1ALV A;  1L2O B;  3GOF A;  5I2L A;  3EKH A;  1TCO B;  1ZOT B;  5KTY A;  3AKA A;  2PVB A;  2K7D A;  3MSE B;  1RJV A;  2MLE C;  1KSM A;  3IF7 A;  2WOR A;  4M2P A;  1CFC A;  2KAY A;  1KCY A;  1K93 D;  1KK7 Y;  5ER4 X;  1G33 A;  2M3W A;  1XFZ O;  1TTX A;  2GGZ A;  3JVT C;  2M1K B;  1SL8 A;  3AKB A;  1CDM A;  3DVJ A;  3NSL A;  5HLV A;  1KFX L;  5HKY A;  1HQV A;  2JNF A;  1KQM B;  3A8R A;  2BE4 A;  2PMY A;  5GQQ C;  1XK4 C;  1BU3 A;  3QRX A;  1RRO A;  1CFP A;  1EG3 A;  2BCA A;  1YUU A;  2CNP A;  4MZL A;  5JJG A;  1OMD A;  1XFU O;  2K7O A;  4M2O A;  1F70 A;  4PE1 A;  2TN4 A;  1OMV A;  2KI4 C;  3OB2 B;  1BJF A;  2JT0 A;  3SJS A;  1YX7 A;  2ISD A;  1UUS A;  3TS5 C;  1SRA A;  2JRF A;  2NLN A;  3CWG A;  1CM4 A;  3BUN B;  1QIV A;  1A29 A;  2ZRT A;  5D69 A;  3VRQ A;  1WDC B;  2NZ0 A;  1B47 A;  3KEV A;  1J7O A;  2KBM A;  5D7F A;  2LVJ A;  1R2U A;  5I2O A;  3PFV A;  4HRG A;  5HKW A;  1B1G A;  2DOQ A;  1IH0 A;  4N5X A;  3I5F B;  3SG3 A;  2AMI A;  3PN7 C;  2D8N A;  2JTZ A;  4BY4 A;  1V1F A;  1WRK A;  2LMU A;  4A4B A;  4M2Q A;  1JFK A;  1IWQ A;  2HQW A;  2ZNE A;  1XK4 A;  2KAX A;  4ORA B;  1ZFS A;  3CLN A;  1WY9 A;  2KGR A;  4XJK A;  3SIA A;  1CMF A;  1CB1 A;  1GGZ A;  5CSN A;  2L0P A;  3VRN A;  2ZFD A;  1AJ4 A;  2B1U A;  2CT9 A;  2EHB A;  2KDH A;  1F4Q A;  3SG7 A;  3VRP A;  2KAV A;  4GNK B;  3DVE A;  4DRW A;  1CNP A;  4MBE A;  1L2O C;  1DGV A;  4QJ3 B;  2I94 A;  4MSP A;  3DF0 A;  5KSZ A;  2WOS A;  1U5I B;  1A75 B;  3DVK A;  1J7P A;  4MZJ A;  1CMG A;  1JBA A;  3FIA A;  3RLZ A;  3KO0 A;  1NX2 A;  4I5J A;  1QV0 A;  1LA3 A;  1S26 D;  3M0W A;  1NCY A;  1DMO A;  1H4B A;  1IQ5 A;  3LK1 A;  1DJH A;  1QLS A;  1S1E A;  2NCP A;  5CSI A;  1ZMZ A;  4NDD A;  3KHE A;  4NQG A;  3HX4 A;  2FJU B;  1KQM C;  4OR9 B;  4P2Y B;  1AUI B;  3I5I B;  1NPQ A;  2EGD A;  1F71 A;  2M29 A;  1QXP A;  3D0Y A;  4WRI A;  1K9K A;  2I7A A;  3BOW A;  1DF0 B;  1DJG A;  1DT7 B;  2KSP A;  5AER A;  4I5K A;  1B7T Z;  2M1U A;  3LLE A;  1QVI Z;  1QTX A;  1FI6 A;  1AHR A;  3D0Y B;  4GUK A;  2VRG A;  3OHM B;  1XA5 A;  2O60 A;  4ZCV A;  1PVB A;  1FI5 A;  3EK7 A;  4YRU A;  3ICB A;  2WC8 A;  2WCE A;  1DJI A;  2F33 A;  1A4P A;  2LAN A;  1SL7 A;  3WHU B;  3PAT A;  2LMV A;  3I5G B;  2KGB C;  1UHH A;  1WDC C;  5HLO A;  2KI6 D;  2M0R A;  1TNP A;  1SR6 B;  4AOM A;  2COL B;  1BLQ A;  2I2R E;  1UHI A;  3NXA A;  2L51 A;  1VRK A;  4CID A;  1GJY A;  2LNK A;  2LVK A;  3I5F C;  3SG2 A;  2WND A;  1YX8 A;  1IKU A;  1SY9 A;  4AQJ A;  1DGU A;  5AFP A;  2R2I A;  1RTP 1;  4PAL A;  1UHJ A;  2V53 A;  4XYN A;  3PLF B;  4ORC B;  3ZNI A;  5JOL A;  2ZRS A;  1B4C A;  1FPW A;  1J1D A;  1OOJ A;  2LLS A;  2FCD A;  1XFW O;  3VGO A;  1B7T Y;  1IGV A;  2FOT A;  1QVI Y;  2BE6 A;  1XFY O;  1SK6 D;  1QJT A;  1PSR A;  2JU0 A;  2LP3 A;  1UHN A;  3KF9 A;  1XFV O;  3OX6 A;  4PE0 A;  4MVF A;  2F8P A;  2BBM A;  1Y6W A;  1S6C A;  1M45 A;  4I5L B;  1ZUZ A;  1KFU S;  1SCV A;  1AJ5 A;  1BOD A;  3IQQ A;  4FQO A;  2BL0 B;  2ZKM X;  2MJW B;  3I5H B;  3CS1 A;  1REC A;  3NSO A;  3CR2 A;  1JFJ A;  4ZCU A;  4PHM A;  1DJW A;  1BR1 B;  1K90 D;  3LK0 A;  2LM5 A;  4GGF C;  3EVV A;  2Y1M A;  1CLM A;  1Q80 A;  3NSI A;  3ZWH A;  2OTG B;  2JPT A;  2ZND A;  5I2Q A;  4CFQ A;  5IBW A;  2CTN A;  3FS7 A;  5F6T A;  4YBH B;  4YGA A;  4DIR A;  4AQI A;  5CPV A;  2LC5 A;  2EC6 B;  3EVU A;  5J3X A;  3BUX B;  1Y1U A;  2LAP A;  1EL4 A;  1S3P A;  3CR4 X;  1PUL A;  1XVJ A;  1E8A A;  5CSF A;  1Y1A A;  3I5I C;  1K2H A;  4WQ3 A;  1OZO A;  1HT9 A;  1TN4 A;  3BXK A;  2E30 A;  3BUW B;  4C0L A;  1V1G A;  2M7N A;  1IJ6 A;  2NXQ A;  5ER5 A;  4JPZ B;  4DUQ A;  1NYA A;  2HQ8 A;  2LLT A;  1IG5 A;  2ZN9 A;  4HRH A;  2BBN A;  2JC2 A;  4JQ0 D;  3HCM A;  4MRX A;  1L7Z A;  1UWO A;  2BCB A;  1RK9 A;  1J55 A;  1LA0 A;  5KU1 A;  1B9A A;  4JWQ A;  4PHJ A;  1LIN A;  1ODB A;  3A4U B;  2JUL A;  3AAJ A;  1QLK A;  2GGM A;  4GGF A;  1U5I A;  1A75 A;  3WNX B;  3PAL A;  1OE9 B;  3I5G C;  1DVI A;  1YUT A;  2L4I A;  1W7I B;  2MAZ A;  4OVN F;  1QV1 A;  1DJX A;  2NCO A;  3PSR A;  1G8I A;  3DVM A;  1SR6 C;  4IL1 A;  1XFX O;  1YRT B;  2I18 A;  1QS7 A;  1JWD A;  4MN0 A;  1LKJ A;  2KBI A;  2KYC A;  1OQP A;  1UP5 A;  2HPS A;  3TUY B;  4MRY A;  2BCX A;  2F3Z A;  2AAO A;  4YGD B;  3EK4 A;  1LXF C;  1B8R A;  1K96 A;  5DKN A;  1QAS A;  2JT3 A;  4ORB B;  1DF0 A;  2SAS A;  1TRF A;  3JTD B;  1QX2 A;  4YI8 A;  4YGC B;  1MR8 A;  2E6W A;  2BKH B;  2LP2 A;  3VRO A;  2F3Y A;  1YUR A;  2KOT A;  1WLM A;  2K7B A;  1MHO A;  2LVV A;  1K95 A;  4ETO A;  3H4S E;  1SCM B;  5HKZ A;  5PAL A;  2JXC A;  2LMT A;  1IJ5 A;  3I5H C;  2F2O A;  1EJ3 A;  3C1V A;  2A4J A;  1UHK A;  1KFU L;  4A4C A;  4QJ4 B;  1B8L A;  2OS8 B;  4WQ2 A;  4MEW A;  5DKR A;  1K94 A;  3IQO A;  1SNL A;  1R6P A;  1EG4 A;  2LCP A;  1SMG A;  5I8N A;  1OSA A;  1FW4 A;  2K2A A;  2OTG C;  1KWO B;  3TDI A;  3E3R A;  2Y5I A;  4MLW A;  1JUO A;  3K21 A;  1KSO A;  1PVA A;  1YUS A;  2L5X B;  1PAL A;  1UUR A;  1SL9 A;  1OZS A;  1KK7 Z;  1NX0 A;  1RFJ A;  2KFG A;  2EC6 C;  2GV5 A;  1F54 A;  2JOJ A;  4GAO A;  5FYX A;  1MF8 B;  1PK0 D;  1FBV A;  1RWY A;  1S5G Z;  2K2F A;  4N1G A;  1C7V A;  2WCB A;  2H2K A;  4USL A;  1F4O A;  1N0Y A;  2LVI A;  3BYA A;  3SG4 A;  4QJ5 B;  2O5G A;  3BUO B;  1MXE A;  1EH2 A;  4N1F A;  1CTR A;  1GQM A;  1BF5 A;  5TNC A;  1J7Q A;  2HF5 A;  1EXR A;  1CM1 A;  2KNE A;  3F45 A;  1BMO A;  3EKJ A;  4P5O E;  4ICB A;  1S6I A;  2KI6 C;  2OPO A;  2L50 A;  1N65 A;  1DJY A;  2KHN A;  1J7R A;  1TNW A;  2LHL A;  3PM8 A;  1SPY A;  1QX5 B;  1NCZ A;  4OV2 A;  4PHK A;  1J1E A;  1TNQ A;  3NSK A;  2L4H A;  1AP4 A;  1WRL A;  4PCW A;  2L98 A;  1XYD A;  3AAK A;  4DS7 A;  2BEC A;  3O2P A;  4DCK A;  4F0Z B;  1S5G Y;  2CCM A;  2LUX A;  4D1E A;  2G2B A;  1AK8 A;  1CFF A;  2M9G A;  4UPG A;  3TUY C;  3OX5 A;  1NX1 A;  1CLB A;  4HSZ A;  1LVC D;  1CFD A;  1NX3 A;  2KQY A;  1NSH A;  2LV7 A;  5AAN A;  1NWD A;  2CBL A;  1BR4 B;  4OCI A;  1D1O A;  2CXJ A;  3JTD C;  5DKQ A;  2FCE A;  1A03 A;  2K0J A;  3BUM B;  1M31 A;  1Y1X A;  1CDL A;  1Y0V H;  1SCM C;  2SCP A;  1BT6 A;  4GPL B;  4R1E A;  4YGE B;  5AXI A;  3VRR A;  4C0J A;  1KK8 B;  2JXL A;  3BQ3 A;  3CGA A;  3GK2 A;  3TDU A;  3FWB A;  1IRJ A;  3FWC A;  1S6J A;  1KQV A;  2KFF A;  1BOC A;  2H61 C;  2OS8 C;  1K8U A;  1DTL A;  1BG1 A;  4OKH A;  1M46 A;  1B8C A;  1NIW A;  2MBX A;  4CLN A;  1CLL A;  3TDZ A;  3O78 A;  1WRZ A;  3O4Y A;  1KWO C;  1SYM A;  1AVS A;  1G4Y R;  1IQ3 A;  1QAT A;  2G9B A;  2KYF A;  2QAC A;  4C0K A;  1M63 B;  2HET A;  2M97 A;  1KFX S;  1ZAC A;  2KFH A;  2F2P A;  4GBA A;  2MA2 A;  2PAL A;  3CTN A;  1GGW A;  3JVT B;  1CDN A;  2K7C A;  4HRE E;  5K89 A;  2MLF C;  5CSJ A;  2K61 A;  2Y1N A;  2MHH A;  2BKI B;  3SG5 A;  4L9M A;  5HYD A;  2Q91 A;  4CFR A;  1S36 A;  2K8M B;  1W7J B;  2AUC A;  5G08 A;  1FF1 A;  4GFT A;  4I5N B;  4XJK B;  1JSA A;  1MQ1 A;  4PDZ A;  5BPJ A;  2JZI A;  1NUB A;  2H61 A;  1YRU B;  2JT8 A;  1X02 A;  2KI4 B;  3EK8 A;  3LL8 B;  3TZ1 A;  4FTG A;  2JWW A;  1MUX A;  3KPX A;  3TS5 B;  1WLZ A;  2BL0 C;  3CZT X;  2ZN8 A;  3O6B A;  4E68 A;  1C07 A;  1F55 A;  4NDC A;  1TNX A;  3OP0 A;  4BY5 A;  1SKT A;  4CPV A;  3DF0 B;  3CR5 X;  3D10 A;  3LCP C;  2Y4Q A;  1SW8 A;  2KQ6 A;  5AEQ A;  1CDP A;  1TOP A;  4TNC A;  2Q4U A;  3SG6 A;  1N2D A;  2P6B B;  2M8U A;  3WHT B;  3PN7 B;  2JNX A;  1NP8 A;  1OMR A;  1F8H A;  2LLU A;  1YVH A;  2JQ6 A;  2PRU A;  1DJZ A;  2MRD A;  3GK4 X;  1K9U A;  1YVL A;  4PE4 A;  5B8I B;  1ALW A;  1MWN A;  1QX7 A;  4Q04 A;  1TCF A;  4PHN A;  1JC2 A;  1PSB A;  2M7L A;  4YI9 A;  3WXA A;  1H8B A;  2M49 B;  2QPT A;  3SIB A;  4YGB B;  2PSR A;  1YTZ C;  1MXL C;  2LUC A;  1YR5 A;  3BOW B;  4MZK A;  3OB1 B;  1TIZ A;  3RM1 A;  3DD4 A;  4PE7 A;  1C7W A;  1JF2 A;  1K9P A;  1A2X A;  3EVR A;  1KK8 C;  1M39 A;  1SBJ A;  4GGN A;  4NDB A;  1PRW A;  3GK1 A;  4U8D A;  2PAS A;  1NCX A;  2RGI A;  2JTT A;  2WCF A;  1QIW A;  2LHI A;  2IS9 A;  1CKK A;  1XO5 A;  2L2E A;  1JF0 A; 
#chains in the Genus database with same CATH topology
 3NGV A;  1ORG A;  2LE9 B;  1ALV A;  1L2O B;  3GOF A;  5I2L A;  3EKH A;  4IJ7 A;  1TCO B;  1ZOT B;  3B87 A;  5KTY A;  3AKA A;  2PVB A;  2K7D A;  3MSE B;  1RJV A;  2MLE C;  1KSM A;  3IF7 A;  5D3O A;  2WOR A;  5EL2 A;  4INX A;  4M2P A;  1CFC A;  2KAY A;  1KCY A;  1K93 D;  1KK7 Y;  5ER4 X;  3DXL A;  1G33 A;  2M3W A;  1XFZ O;  1TTX A;  2GGZ A;  3JVT C;  2M1K B;  1SL8 A;  3AKB A;  1CDM A;  3DVJ A;  3NSL A;  5HLV A;  1KFX L;  5HKY A;  1HQV A;  2JNF A;  1KQM B;  2QEB A;  3A8R A;  2BE4 A;  1C3Y A;  2QDI A;  2PMY A;  5GQQ C;  1XK4 C;  1BU3 A;  3QRX A;  1RRO A;  1CFP A;  1EG3 A;  2BCA A;  2BNX A;  1YUU A;  5I94 A;  2CNP A;  4MZL A;  5JJG A;  1OMD A;  1XFU O;  2K7O A;  4M2O A;  1F70 A;  3D77 A;  4PE1 A;  2TN4 A;  1OMV A;  2KI4 C;  3OB2 B;  1BJF A;  2JT0 A;  3SJS A;  1YX7 A;  2ISD A;  1UUS A;  3R72 A;  1SRA A;  2JRF A;  2NLN A;  3CWG A;  3TS5 C;  1CM4 A;  3BUN B;  1QIV A;  1A29 A;  2ZRT A;  5D69 A;  3VRQ A;  3IVT A;  1WDC B;  2NZ0 A;  1B47 A;  3KEV A;  3R1V A;  1J7O A;  2KBM A;  5D7F A;  2LVJ A;  1R2U A;  3Q8I A;  5I2O A;  3PFV A;  4HRG A;  3B6X A;  5HKW A;  1B1G A;  2DOQ A;  3DY9 A;  4N5X A;  1IH0 A;  5FI2 A;  3D76 A;  3I5F B;  3SG3 A;  2AMI A;  1XFR A;  3PN7 C;  3CYZ A;  2D8N A;  2JTZ A;  3CAB A;  4BY4 A;  1V1F A;  1WRK A;  2LMU A;  4A4B A;  3K1E A;  4M2Q A;  1JFK A;  1IWQ A;  2HQW A;  1DQE A;  2ZNE A;  1XK4 A;  2KAX A;  4ORA B;  2WC5 A;  3S0G A;  1ZFS A;  3CLN A;  3FE6 A;  1WY9 A;  2KGR A;  4XJK A;  3SIA A;  1W9Z A;  1CMF A;  1CB1 A;  1GGZ A;  5CSN A;  3SS3 A;  2L0P A;  3VRN A;  2ZFD A;  4JKT A;  1AJ4 A;  2B1U A;  2CT9 A;  2EHB A;  2KDH A;  3CZ1 A;  1F4Q A;  3SG7 A;  3S0E A;  3VRP A;  2PQL A;  2KAV A;  3B7A A;  4GNK B;  3DVE A;  4DRW A;  1CNP A;  4MBE A;  1L2O C;  1DGV A;  4QJ3 B;  2I94 A;  4MSP A;  3DF0 A;  5KSZ A;  2WOS A;  5HL1 A;  1U5I B;  1A75 B;  3DVK A;  1J7P A;  2QEV A;  4MZJ A;  1CMG A;  1JBA A;  3FIA A;  3RLZ A;  3KO0 A;  1NX2 A;  4I5J A;  1T14 A;  1QV0 A;  1LA3 A;  1S26 D;  3M0W A;  1NCY A;  1DMO A;  1H4B A;  1IQ5 A;  3LK1 A;  1DJH A;  1QLS A;  1S1E A;  2NCP A;  4PT1 A;  5CSI A;  1ZMZ A;  1IIO A;  4NDD A;  3KHE A;  4NQG A;  3HX4 A;  2FJU B;  1KQM C;  4OR9 B;  4P2Y B;  1AUI B;  3I5I B;  1NPQ A;  2EGD A;  1F71 A;  3DYE A;  2M29 A;  1QXP A;  3D0Y A;  4WRI A;  5FI7 A;  1K9K A;  2I7A A;  3BOW A;  4KYN A;  1DF0 B;  1DJG A;  3NHI A;  1DT7 B;  3UNW A;  2KSP A;  5AER A;  2KPH A;  4I5K A;  1B7T Z;  2M1U A;  3LLE A;  1QVI Z;  1QTX A;  1FI6 A;  1AHR A;  3D0Y B;  4GUK A;  1P28 A;  2VRG A;  3OHM B;  1XA5 A;  2O60 A;  4ZCV A;  1PVB A;  1FI5 A;  3EK7 A;  4YRU A;  3ICB A;  2WC8 A;  2WCE A;  1DJI A;  2F33 A;  1A4P A;  2LAN A;  1SL7 A;  3WHU B;  3PAT A;  2WCH A;  2LMV A;  3I5G B;  2KGB C;  1UHH A;  1WDC C;  5HLO A;  2KI6 D;  2M0R A;  1TNP A;  1SR6 B;  4AOM A;  2COL B;  1BLQ A;  2I2R E;  1UHI A;  3D73 A;  2L51 A;  3NXA A;  1VRK A;  4CID A;  1GJY A;  2LNK A;  2LVK A;  3I5F C;  3SG2 A;  3SS5 A;  2WND A;  3L4L A;  1YX8 A;  5DIC A;  1IKU A;  1SY9 A;  3S0D A;  4AQJ A;  1DGU A;  4FQT A;  5AFP A;  2K60 A;  1RTP 1;  2R2I A;  1UHJ A;  2V53 A;  4PAL A;  3PLF B;  4XYN A;  4ORC B;  3ZNI A;  5JOL A;  2ZRS A;  1B4C A;  1FPW A;  1J1D A;  1OOJ A;  2LLS A;  2FCD A;  1XFW O;  3VGO A;  1B7T Y;  1IGV A;  2FOT A;  1QVI Y;  2BE6 A;  1XFY O;  1SK6 D;  1QJT A;  1PSR A;  2JU0 A;  2KLD A;  1UHN A;  2LP3 A;  1XFV O;  3KF9 A;  3OX6 A;  4PE0 A;  4MVF A;  2F8P A;  2BBM A;  1Y6W A;  1S6C A;  1M45 A;  4I5L B;  1ZUZ A;  1KFU S;  1SCV A;  2JPO A;  1AJ5 A;  1BOD A;  3IQQ A;  4FQO A;  2BL0 B;  2ZKM X;  2MJW B;  3I5H B;  3CS1 A;  1REC A;  3NSO A;  3D78 A;  3CR2 A;  1JFJ A;  3CZ0 A;  4ZCU A;  4PHM A;  1DJW A;  1QWV A;  1BR1 B;  1K90 D;  1TWO A;  3OGN A;  3LK0 A;  2LM5 A;  4GGF C;  3EVV A;  2Y1M A;  1CLM A;  1Q80 A;  3NSI A;  3ZWH A;  2OTG B;  2JPT A;  2ZND A;  5I2Q A;  4CFQ A;  2WCJ A;  5IBW A;  2CTN A;  3FS7 A;  5F6T A;  4YBH B;  4YGA A;  4DIR A;  4AQI A;  2L5Y A;  5CPV A;  2LC5 A;  2EC6 B;  3EVU A;  5J3X A;  3BUX B;  1Y1U A;  2LAP A;  3SS4 A;  3BJH A;  1EL4 A;  1S3P A;  3CR4 X;  1PUL A;  1XVJ A;  1DEL A;  1E8A A;  1Y1A A;  3I5I C;  5CSF A;  3V2L A;  1K2H A;  4WQ3 A;  2KLE A;  1OZO A;  1HT9 A;  1TN4 A;  3BXK A;  2E30 A;  3BUW B;  4JD9 A;  4C0L A;  1V1G A;  2M7N A;  1IJ6 A;  2NXQ A;  3NHT A;  4JPZ B;  5ER5 A;  4DUQ A;  1NYA A;  2HQ8 A;  2LLT A;  1IG5 A;  2ZN9 A;  4HRH A;  2BBN A;  2JC2 A;  4JQ0 D;  3HCM A;  4MRX A;  1L7Z A;  1UWO A;  2BCB A;  1RK9 A;  1J55 A;  1LA0 A;  5KU1 A;  1B9A A;  4JWQ A;  4PHJ A;  1LIN A;  1ODB A;  3A4U B;  2JUL A;  3AAJ A;  1QLK A;  2GGM A;  4GGF A;  1U5I A;  1A75 A;  3WNX B;  3PAL A;  1OE9 B;  3I5G C;  1DVI A;  1YUT A;  2L4I A;  1W7I B;  2MAZ A;  4OVN F;  3R1O A;  1QV1 A;  1DJX A;  2NCO A;  3PSR A;  1G8I A;  3DVM A;  1SR6 C;  4IL1 A;  1XFX O;  1YRT B;  2I18 A;  1QS7 A;  1JWD A;  3N7H A;  4MN0 A;  1LKJ A;  2KBI A;  2YGU A;  2KYC A;  1OQP A;  1UP5 A;  2HPS A;  3TUY B;  3QME A;  3PJI A;  4MRY A;  2BCX A;  2F3Z A;  2AAO A;  3PM2 A;  4YGD B;  3EK4 A;  1LXF C;  1B8R A;  1K96 A;  5DKN A;  1QAS A;  2JT3 A;  4ORB B;  1DF0 A;  2SAS A;  1TRF A;  3JTD B;  1QX2 A;  3FE8 A;  4YI8 A;  4YGC B;  1MR8 A;  2E6W A;  2BKH B;  2LP2 A;  3VRO A;  2F3Y A;  1YUR A;  2KOT A;  1WLM A;  2K7B A;  1MHO A;  3BFA A;  2LVV A;  1K95 A;  4ETO A;  3H4S E;  1SCM B;  5HKZ A;  5PAL A;  2PYQ A;  2JXC A;  2LMT A;  1IJ5 A;  3I5H C;  2F2O A;  1EJ3 A;  3CZ2 A;  3C1V A;  2A4J A;  1UHK A;  1KFU L;  4A4C A;  4QJ4 B;  1B8L A;  2OS8 B;  4WQ2 A;  4MEW A;  5DKR A;  1K94 A;  2L2C A;  3IQO A;  1SNL A;  1R6P A;  1EG4 A;  2LCP A;  1SMG A;  5I8N A;  1OSA A;  1FW4 A;  2K2A A;  2OTG C;  1KWO B;  3L47 A;  3TDI A;  3E3R A;  2Y5I A;  3VB1 A;  4MLW A;  1DEK A;  1JUO A;  3K21 A;  1KSO A;  1PVA A;  1YUS A;  2L5X B;  3DZT A;  3S0F A;  1PAL A;  1UUR A;  2BAP A;  1SL9 A;  1OZS A;  1KK7 Z;  1NX0 A;  1RFJ A;  2KFG A;  2EC6 C;  1SSE B;  2GV5 A;  1OOF A;  1F54 A;  2JOJ A;  4GAO A;  5FYX A;  1MF8 B;  1OOI X;  1FBV A;  1PK0 D;  1RWY A;  1S5G Z;  2K2F A;  4N1G A;  2WCB A;  5AXI A;  2H2K A;  4USL A;  1C7V A;  1F4O A;  1N0Y A;  2LVI A;  3BYA A;  3SG4 A;  4QJ5 B;  2O5G A;  2QEO A;  3BUO B;  1MXE A;  1EH2 A;  4N1F A;  1CTR A;  1GQM A;  1BF5 A;  5TNC A;  1J7Q A;  2HF5 A;  1EXR A;  1CM1 A;  2KNE A;  3F45 A;  2QEH A;  1OW4 A;  2WCM A;  3S0A A;  1BMO A;  2P70 A;  3EKJ A;  4P5O E;  4ICB A;  3D74 A;  1S6I A;  2KI6 C;  2OPO A;  2L50 A;  1N65 A;  2WCK A;  1Z4H A;  1DJY A;  2KHN A;  1J7R A;  1TNW A;  2LHL A;  3PM8 A;  1SPY A;  1QX5 B;  1NCZ A;  4OV2 A;  4PHK A;  1J1E A;  1TNQ A;  3NSK A;  2L4H A;  1AP4 A;  1WRL A;  4PCW A;  2L98 A;  1XYD A;  3AAK A;  4DS7 A;  2BEC A;  3O2P A;  4DCK A;  4F0Z B;  1S5G Y;  2CCM A;  1GM0 A;  2LUX A;  4D1E A;  2G2B A;  1AK8 A;  1CFF A;  2M9G A;  4UPG A;  3TUY C;  3OX5 A;  1NX1 A;  1CLB A;  1OOG A;  4HSZ A;  1LVC D;  1CFD A;  1NX3 A;  2KQY A;  3R1P A;  1NSH A;  2LV7 A;  5AAN A;  2ERB A;  1NWD A;  2CBL A;  1BR4 B;  3BFH A;  4OCI A;  1D1O A;  2CXJ A;  3JTD C;  5DKQ A;  2FCE A;  1A03 A;  3B86 A;  2K0J A;  3BUM B;  3L4A A;  1M31 A;  1Y1X A;  1CDL A;  1Y0V H;  1SCM C;  2SCP A;  1BT6 A;  4GPL B;  3D75 A;  3OBV A;  4R1E A;  4YGE B;  3VRR A;  4C0J A;  1KK8 B;  2JXL A;  3BQ3 A;  3CGA A;  3GK2 A;  3TDU A;  3FWB A;  1IRJ A;  3FWC A;  1S6J A;  1KQV A;  2KFF A;  1BOC A;  2H61 C;  2OS8 C;  1K8U A;  1DTL A;  1BG1 A;  4OKH A;  1M46 A;  1B8C A;  1NIW A;  2MBX A;  4CLN A;  1CLL A;  3TDZ A;  3O78 A;  1LS8 A;  4F7F A;  1WRZ A;  3O4Y A;  1KWO C;  1SYM A;  1AVS A;  1G4Y R;  1IQ3 A;  1QAT A;  2G9B A;  2KYF A;  2QAC A;  4C0K A;  1M63 B;  2HET A;  3S0B A;  2M97 A;  1KFX S;  1ZAC A;  2KFH A;  3BFB A;  2F2P A;  4GBA A;  3FE9 A;  2MA2 A;  2PAL A;  3CTN A;  1GGW A;  3JVT B;  1CDN A;  2K7C A;  4HRE E;  5K89 A;  2MLF C;  5CSJ A;  2K61 A;  2Y1N A;  2MHH A;  2BKI B;  3SG5 A;  5FI6 A;  4L9M A;  5HYD A;  2Q91 A;  3CDN A;  1S36 A;  4CFR A;  2K8M B;  1W7J B;  2AUC A;  5G08 A;  3UO9 A;  4GFT A;  4I5N B;  4XJK B;  1FF1 A;  1MQ1 A;  1JSA A;  4PDZ A;  5BPJ A;  2JZI A;  1NUB A;  2H61 A;  1YRU B;  2JT8 A;  1X02 A;  2KI4 B;  1TUJ A;  3EK8 A;  2H8V A;  3LL8 B;  4FTG A;  2JWW A;  1MUX A;  2P71 A;  3KPX A;  3TS5 B;  1TUZ A;  1WLZ A;  1DC1 A;  2BL0 C;  3CZT X;  3O4X A;  2ZN8 A;  3O6B A;  4E68 A;  1C07 A;  1F55 A;  4NDC A;  1TNX A;  3OP0 A;  4BY5 A;  1SKT A;  4CPV A;  3DF0 B;  1C3Z A;  3CR5 X;  3EG5 B;  3D10 A;  3LCP C;  2Y4Q A;  1SW8 A;  2KQ6 A;  4INW A;  5AEQ A;  1CDP A;  1TOP A;  4TNC A;  2Q4U A;  3SG6 A;  1N2D A;  2P6B B;  1OOH A;  2M8U A;  3WHT B;  3PN7 B;  2JNX A;  1NP8 A;  1OMR A;  1F8H A;  2LLU A;  1YVH A;  2JQ6 A;  2PRU A;  1DJZ A;  2MRD A;  3GK4 X;  1K9U A;  1YVL A;  4PE4 A;  5B8I B;  2FJY A;  1ALW A;  1MWN A;  1QX7 A;  4Q04 A;  1TCF A;  4OZD A;  4PHN A;  1JC2 A;  1PSB A;  2WCL A;  4YI9 A;  2M7L A;  3WXA A;  1H8B A;  2M49 B;  2QPT A;  3SIB A;  3TZ1 A;  4YGB B;  1Z2C B;  2PSR A;  3RZS A;  1YTZ C;  1MXL C;  2LUC A;  1YR5 A;  3BOW B;  4MZK A;  3OB1 B;  1TIZ A;  3RM1 A;  3DD4 A;  4PE7 A;  1C7W A;  1JF2 A;  1K9P A;  1A2X A;  3EVR A;  1KK8 C;  1M39 A;  1SBJ A;  4GGN A;  4NDB A;  1PRW A;  3GK1 A;  4U8D A;  2PAS A;  1NCX A;  2GTE A;  2RGI A;  2JTT A;  2WC6 A;  2WCF A;  1QIW A;  3B88 A;  2LHI A;  2IS9 A;  1CKK A;  1XO5 A;  2L2E A;  1JF0 A; 
#chains in the Genus database with same CATH homology
 2LE9 B;  1ALV A;  1L2O B;  3GOF A;  5I2L A;  3EKH A;  1TCO B;  1ZOT B;  5KTY A;  3AKA A;  2PVB A;  2K7D A;  3MSE B;  1RJV A;  2MLE C;  1KSM A;  3IF7 A;  2WOR A;  4M2P A;  1CFC A;  2KAY A;  1KCY A;  1K93 D;  1KK7 Y;  5ER4 X;  1G33 A;  2M3W A;  1XFZ O;  1TTX A;  2GGZ A;  3JVT C;  2M1K B;  1SL8 A;  3AKB A;  1CDM A;  3DVJ A;  3NSL A;  5HLV A;  1KFX L;  5HKY A;  1HQV A;  2JNF A;  1KQM B;  3A8R A;  2BE4 A;  2PMY A;  5GQQ C;  1XK4 C;  1BU3 A;  3QRX A;  1RRO A;  1CFP A;  1EG3 A;  2BCA A;  1YUU A;  2CNP A;  4MZL A;  5JJG A;  1OMD A;  1XFU O;  2K7O A;  4M2O A;  1F70 A;  4PE1 A;  2TN4 A;  1OMV A;  2KI4 C;  3OB2 B;  1BJF A;  2JT0 A;  3SJS A;  1YX7 A;  2ISD A;  1UUS A;  3TS5 C;  1SRA A;  2JRF A;  2NLN A;  3CWG A;  1CM4 A;  3BUN B;  1QIV A;  1A29 A;  2ZRT A;  5D69 A;  3VRQ A;  1WDC B;  2NZ0 A;  1B47 A;  3KEV A;  1J7O A;  2KBM A;  5D7F A;  2LVJ A;  1R2U A;  5I2O A;  3PFV A;  4HRG A;  5HKW A;  1B1G A;  2DOQ A;  1IH0 A;  4N5X A;  3I5F B;  3SG3 A;  2AMI A;  3PN7 C;  2D8N A;  2JTZ A;  4BY4 A;  1V1F A;  1WRK A;  2LMU A;  4A4B A;  4M2Q A;  1JFK A;  1IWQ A;  2HQW A;  2ZNE A;  1XK4 A;  2KAX A;  4ORA B;  1ZFS A;  3CLN A;  1WY9 A;  2KGR A;  4XJK A;  3SIA A;  1CMF A;  1CB1 A;  1GGZ A;  5CSN A;  2L0P A;  3VRN A;  2ZFD A;  1AJ4 A;  2B1U A;  2CT9 A;  2EHB A;  2KDH A;  1F4Q A;  3SG7 A;  3VRP A;  2KAV A;  4GNK B;  3DVE A;  4DRW A;  1CNP A;  4MBE A;  1L2O C;  1DGV A;  4QJ3 B;  2I94 A;  4MSP A;  3DF0 A;  5KSZ A;  2WOS A;  1U5I B;  1A75 B;  3DVK A;  1J7P A;  4MZJ A;  1CMG A;  1JBA A;  3FIA A;  3RLZ A;  3KO0 A;  1NX2 A;  4I5J A;  1QV0 A;  1LA3 A;  1S26 D;  3M0W A;  1NCY A;  1DMO A;  1H4B A;  1IQ5 A;  3LK1 A;  1DJH A;  1QLS A;  1S1E A;  2NCP A;  5CSI A;  1ZMZ A;  4NDD A;  3KHE A;  4NQG A;  3HX4 A;  2FJU B;  1KQM C;  4OR9 B;  4P2Y B;  1AUI B;  3I5I B;  1NPQ A;  2EGD A;  1F71 A;  2M29 A;  1QXP A;  3D0Y A;  4WRI A;  1K9K A;  2I7A A;  3BOW A;  1DF0 B;  1DJG A;  1DT7 B;  2KSP A;  5AER A;  4I5K A;  1B7T Z;  2M1U A;  3LLE A;  1QVI Z;  1QTX A;  1FI6 A;  1AHR A;  3D0Y B;  4GUK A;  2VRG A;  3OHM B;  1XA5 A;  2O60 A;  4ZCV A;  1PVB A;  1FI5 A;  3EK7 A;  4YRU A;  3ICB A;  2WC8 A;  2WCE A;  1DJI A;  2F33 A;  1A4P A;  2LAN A;  1SL7 A;  3WHU B;  3PAT A;  2LMV A;  3I5G B;  2KGB C;  1UHH A;  1WDC C;  5HLO A;  2KI6 D;  2M0R A;  1TNP A;  1SR6 B;  4AOM A;  2COL B;  1BLQ A;  2I2R E;  1UHI A;  3NXA A;  2L51 A;  1VRK A;  4CID A;  1GJY A;  2LNK A;  2LVK A;  3I5F C;  3SG2 A;  2WND A;  1YX8 A;  1IKU A;  1SY9 A;  4AQJ A;  1DGU A;  5AFP A;  2R2I A;  1RTP 1;  4PAL A;  1UHJ A;  2V53 A;  4XYN A;  3PLF B;  4ORC B;  3ZNI A;  5JOL A;  2ZRS A;  1B4C A;  1FPW A;  1J1D A;  1OOJ A;  2LLS A;  2FCD A;  1XFW O;  3VGO A;  1B7T Y;  1IGV A;  2FOT A;  1QVI Y;  2BE6 A;  1XFY O;  1SK6 D;  1QJT A;  1PSR A;  2JU0 A;  2LP3 A;  1UHN A;  3KF9 A;  1XFV O;  3OX6 A;  4PE0 A;  4MVF A;  2F8P A;  2BBM A;  1Y6W A;  1S6C A;  1M45 A;  4I5L B;  1ZUZ A;  1KFU S;  1SCV A;  1AJ5 A;  1BOD A;  3IQQ A;  4FQO A;  2BL0 B;  2ZKM X;  2MJW B;  3I5H B;  3CS1 A;  1REC A;  3NSO A;  3CR2 A;  1JFJ A;  4ZCU A;  4PHM A;  1DJW A;  1BR1 B;  1K90 D;  3LK0 A;  2LM5 A;  4GGF C;  3EVV A;  2Y1M A;  1CLM A;  1Q80 A;  3NSI A;  3ZWH A;  2OTG B;  2JPT A;  2ZND A;  5I2Q A;  4CFQ A;  5IBW A;  2CTN A;  3FS7 A;  5F6T A;  4YBH B;  4YGA A;  4DIR A;  4AQI A;  5CPV A;  2LC5 A;  2EC6 B;  3EVU A;  5J3X A;  3BUX B;  1Y1U A;  2LAP A;  1EL4 A;  1S3P A;  3CR4 X;  1PUL A;  1XVJ A;  1E8A A;  5CSF A;  1Y1A A;  3I5I C;  1K2H A;  4WQ3 A;  1OZO A;  1HT9 A;  1TN4 A;  3BXK A;  2E30 A;  3BUW B;  4C0L A;  1V1G A;  2M7N A;  1IJ6 A;  2NXQ A;  5ER5 A;  4JPZ B;  4DUQ A;  1NYA A;  2HQ8 A;  2LLT A;  1IG5 A;  2ZN9 A;  4HRH A;  2BBN A;  2JC2 A;  4JQ0 D;  3HCM A;  4MRX A;  1L7Z A;  1UWO A;  2BCB A;  1RK9 A;  1J55 A;  1LA0 A;  5KU1 A;  1B9A A;  4JWQ A;  4PHJ A;  1LIN A;  1ODB A;  3A4U B;  2JUL A;  3AAJ A;  1QLK A;  2GGM A;  4GGF A;  1U5I A;  1A75 A;  3WNX B;  3PAL A;  1OE9 B;  3I5G C;  1DVI A;  1YUT A;  2L4I A;  1W7I B;  2MAZ A;  4OVN F;  1QV1 A;  1DJX A;  2NCO A;  3PSR A;  1G8I A;  3DVM A;  1SR6 C;  4IL1 A;  1XFX O;  1YRT B;  2I18 A;  1QS7 A;  1JWD A;  4MN0 A;  1LKJ A;  2KBI A;  2KYC A;  1OQP A;  1UP5 A;  2HPS A;  3TUY B;  4MRY A;  2BCX A;  2F3Z A;  2AAO A;  4YGD B;  3EK4 A;  1LXF C;  1B8R A;  1K96 A;  5DKN A;  1QAS A;  2JT3 A;  4ORB B;  1DF0 A;  2SAS A;  1TRF A;  3JTD B;  1QX2 A;  4YI8 A;  4YGC B;  1MR8 A;  2E6W A;  2BKH B;  2LP2 A;  3VRO A;  2F3Y A;  1YUR A;  2KOT A;  1WLM A;  2K7B A;  1MHO A;  2LVV A;  1K95 A;  4ETO A;  3H4S E;  1SCM B;  5HKZ A;  5PAL A;  2JXC A;  2LMT A;  1IJ5 A;  3I5H C;  2F2O A;  1EJ3 A;  3C1V A;  2A4J A;  1UHK A;  1KFU L;  4A4C A;  4QJ4 B;  1B8L A;  2OS8 B;  4WQ2 A;  4MEW A;  5DKR A;  1K94 A;  3IQO A;  1SNL A;  1R6P A;  1EG4 A;  2LCP A;  1SMG A;  5I8N A;  1OSA A;  1FW4 A;  2K2A A;  2OTG C;  1KWO B;  3TDI A;  3E3R A;  2Y5I A;  4MLW A;  1JUO A;  3K21 A;  1KSO A;  1PVA A;  1YUS A;  2L5X B;  1PAL A;  1UUR A;  1SL9 A;  1OZS A;  1KK7 Z;  1NX0 A;  1RFJ A;  2KFG A;  2EC6 C;  2GV5 A;  1F54 A;  2JOJ A;  4GAO A;  5FYX A;  1MF8 B;  1PK0 D;  1FBV A;  1RWY A;  1S5G Z;  2K2F A;  4N1G A;  1C7V A;  2WCB A;  2H2K A;  4USL A;  1F4O A;  1N0Y A;  2LVI A;  3BYA A;  3SG4 A;  4QJ5 B;  2O5G A;  3BUO B;  1MXE A;  1EH2 A;  4N1F A;  1CTR A;  1GQM A;  1BF5 A;  5TNC A;  1J7Q A;  2HF5 A;  1EXR A;  1CM1 A;  2KNE A;  3F45 A;  1BMO A;  3EKJ A;  4P5O E;  4ICB A;  1S6I A;  2KI6 C;  2OPO A;  2L50 A;  1N65 A;  1DJY A;  2KHN A;  1J7R A;  1TNW A;  2LHL A;  3PM8 A;  1SPY A;  1QX5 B;  1NCZ A;  4OV2 A;  4PHK A;  1J1E A;  1TNQ A;  3NSK A;  2L4H A;  1AP4 A;  1WRL A;  4PCW A;  2L98 A;  1XYD A;  3AAK A;  4DS7 A;  2BEC A;  3O2P A;  4DCK A;  4F0Z B;  1S5G Y;  2CCM A;  2LUX A;  4D1E A;  2G2B A;  1AK8 A;  1CFF A;  2M9G A;  4UPG A;  3TUY C;  3OX5 A;  1NX1 A;  1CLB A;  4HSZ A;  1LVC D;  1CFD A;  1NX3 A;  2KQY A;  1NSH A;  2LV7 A;  5AAN A;  1NWD A;  2CBL A;  1BR4 B;  4OCI A;  1D1O A;  2CXJ A;  3JTD C;  5DKQ A;  2FCE A;  1A03 A;  2K0J A;  3BUM B;  1M31 A;  1Y1X A;  1CDL A;  1Y0V H;  1SCM C;  2SCP A;  1BT6 A;  4GPL B;  4R1E A;  4YGE B;  5AXI A;  3VRR A;  4C0J A;  1KK8 B;  2JXL A;  3BQ3 A;  3CGA A;  3GK2 A;  3TDU A;  3FWB A;  1IRJ A;  3FWC A;  1S6J A;  1KQV A;  2KFF A;  1BOC A;  2H61 C;  2OS8 C;  1K8U A;  1DTL A;  1BG1 A;  4OKH A;  1M46 A;  1B8C A;  1NIW A;  2MBX A;  4CLN A;  1CLL A;  3TDZ A;  3O78 A;  1WRZ A;  3O4Y A;  1KWO C;  1SYM A;  1AVS A;  1G4Y R;  1IQ3 A;  1QAT A;  2G9B A;  2KYF A;  2QAC A;  4C0K A;  1M63 B;  2HET A;  2M97 A;  1KFX S;  1ZAC A;  2KFH A;  2F2P A;  4GBA A;  2MA2 A;  2PAL A;  3CTN A;  1GGW A;  3JVT B;  1CDN A;  2K7C A;  4HRE E;  5K89 A;  2MLF C;  5CSJ A;  2K61 A;  2Y1N A;  2MHH A;  2BKI B;  3SG5 A;  4L9M A;  5HYD A;  2Q91 A;  4CFR A;  1S36 A;  2K8M B;  1W7J B;  2AUC A;  5G08 A;  1FF1 A;  4GFT A;  4I5N B;  4XJK B;  1JSA A;  1MQ1 A;  4PDZ A;  5BPJ A;  2JZI A;  1NUB A;  2H61 A;  1YRU B;  2JT8 A;  1X02 A;  2KI4 B;  3EK8 A;  3LL8 B;  3TZ1 A;  4FTG A;  2JWW A;  1MUX A;  3KPX A;  3TS5 B;  1WLZ A;  2BL0 C;  3CZT X;  2ZN8 A;  3O6B A;  4E68 A;  1C07 A;  1F55 A;  4NDC A;  1TNX A;  3OP0 A;  4BY5 A;  1SKT A;  4CPV A;  3DF0 B;  3CR5 X;  3D10 A;  3LCP C;  2Y4Q A;  1SW8 A;  2KQ6 A;  5AEQ A;  1CDP A;  1TOP A;  4TNC A;  2Q4U A;  3SG6 A;  1N2D A;  2P6B B;  2M8U A;  3WHT B;  3PN7 B;  2JNX A;  1NP8 A;  1OMR A;  1F8H A;  2LLU A;  1YVH A;  2JQ6 A;  2PRU A;  1DJZ A;  2MRD A;  3GK4 X;  1K9U A;  1YVL A;  4PE4 A;  5B8I B;  1ALW A;  1MWN A;  1QX7 A;  4Q04 A;  1TCF A;  4PHN A;  1JC2 A;  1PSB A;  2M7L A;  4YI9 A;  3WXA A;  1H8B A;  2M49 B;  2QPT A;  3SIB A;  4YGB B;  2PSR A;  1YTZ C;  1MXL C;  2LUC A;  1YR5 A;  3BOW B;  4MZK A;  3OB1 B;  1TIZ A;  3RM1 A;  3DD4 A;  4PE7 A;  1C7W A;  1JF2 A;  1K9P A;  1A2X A;  3EVR A;  1KK8 C;  1M39 A;  1SBJ A;  4GGN A;  4NDB A;  1PRW A;  3GK1 A;  4U8D A;  2PAS A;  1NCX A;  2RGI A;  2JTT A;  2WCF A;  1QIW A;  2LHI A;  2IS9 A;  1CKK A;  1XO5 A;  2L2E A;  1JF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...