2MBXA

Structure, dynamics and stability of allergen cod parvalbumin gad m 1 by solution and high-pressure nmr.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin beta
publication title Solution and high-pressure NMR studies of the structure, dynamics, and stability of the cross-reactive allergenic cod parvalbumin Gad m 1.
pubmed doi rcsb
source organism Gadus morhua
molecule tags Contractile protein
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mbxA00
1ZACA 3BOWA 1L2OB 2K7OA 1BOCA 1R6PA 1IRJA 1SYMA 1J55A 3SIAA 1RK9A 1WDCB 4A4CA 3PN7B 1AHRA 1JF0A 2KAVA 4GNKB 2EHBA 1DJWA 5BPJA 1DJYA 2D8NA 2FOTA 1J7QA 2LCPA 1RJVA 2JPTA 2ZRSA 3FS7A 2K61A 1AUIB 3I5FB 5D69A 3VGOA 1K94A 1FI6A 2DOQA 1XFUO 1TCOB 3BUXB 2AUCA 2JT8A 3OHMB 2LNKA 1BR1B 2FCEA 2HPSA 1IGVA 4PDZA 3SG4A 1XFZO 1CFPA 1OZOA 3EVVA 2BECA 1KFXS 4UPGA 2LUCA 5DKNA 1K90D 1AK8A 1AJ5A 2BBMA 3LLEA 1L7ZA 2NXQA 1UHNA 2L98A 1K95A 3CTNA 5HKWA 1J7PA 1CFFA 4JPZB 2NZ0A 3TZ1A 2E30A 4P2YB 3SG7A 1JUOA 4JQ0D 3TS5C 1Y6WA 3DF0B 4BY5A 1BU3A 1MXEA 1KFUS 2JXCA 2QPTA 2ZNDA 1IG5A 2R2IA 2Q4UA 1TRFA 1LA0A 4R1EA 3O6BA 1KWOB 1EH2A 4ZCVA 2M7LA 2M29A 4GAOA 2OS8C 1K9PA 1U5IB 4NQGA 5K89A 3PATA 1BG1A 2OTGB 2LLUA 3RLZA 3VROA 1QLSA 1SCVA 5B8IB 1OZSA 1QIVA 1GGWA 1UHIA 3PLFB 1ZUZA 3KPXA 1DT7B 4GGNA 2I2RE 2BCXA 2LM5A 1NIWA 2LP2A 1WRZA 2Y4QA 4L9MA 4WQ2A 5DKRA 4MEWA 4PCWA 1SK6D 1TNWA 3VRPA 4JWQA 1SCMC 2KGRA 2I18A 2KAXA 4OR9B 4IL1A 4YGCB 5JJGA 5DKQA 5I2OA 4NDDA 3OB1B 1XO5A 3EVUA 1A29A 3TDZA 3BUNB 3VRNA 4DUQA 1KCYA 1JC2A 1OMDA 1AJ4A 1ALVA 4NDCA 4GUKA 3BQ3A 3I5HC 3DD4A 1GJYA 4HRGA 4GFTA 4PHNA 4D1EA 3VRRA 1B1GA 1IH0A 1FW4A 1CTRA 3PALA 1XFXO 1QVIZ 1S26D 1FF1A 3SG6A 2WORA 1N2DA 1NPQA 2JOJA 2L5XB 1Y1AA 2L0PA 2JULA 1UP5A 3DVJA 5I8NA 2M8UA 1X02A 2B1UA 1C7VA 1ODBA 3BUMB 1QLKA 2O60A 5CSJA 4PE0A 2L50A 5HKYA 3PSRA 1E8AA 2E6WA 3NSLA 3LK0A 3OX6A 1DGVA 2L51A 5CSIA 1DF0A 5FYXA 1OSAA 3OX5A 3TUYB 1RFJA 2K7CA 3BYAA 2H61A 3DVMA 3EVRA 1AP4A 4PALA 5HLOA 2PRUA 1B9AA 1A75B 2LVJA 1KFXL 1S3PA 2I94A 1MQ1A 2HETA 3I5IB 2LUXA 2TN4A 1YX8A 2COLB 4GPLB 4MSPA 1QV0A 2CT9A 2Y1MA 1RTP1 2FCDA 5ER5A 3FWCA 4F0ZB 1B7TY 2LHLA 1CMFA 1S6IA 1CMGA 1B8CA 4YBHB 2QACA 2BBNA 1EG3A 2KFHA 3CZTX 1TOPA 1YUTA 1YVHA 4Q04A 5HKZA 4DRWA 1IJ6A 2JC2A 2F2PA 3C1VA 2Y5IA 1QX2A 1U5IA 2BL0B 2AAOA 1KFUL 1MR8A 1GQMA 2Q91A 3JTDB 1G8IA 1ZFSA 2GGMA 1WLZA 5AXIA 3SG5A 2G9BA 2KYCA 2JT0A 4MZKA 1EJ3A 2CTNA 2L2EA 4XJKB 4QJ4B 1LVCD 2F33A 2IS9A 3LCPC 2K7BA 1J1DA 4N5XA 1KSMA 4DCKA 2JTTA 1TNPA 4P5OE 3EK8A 1KK8C 2ZN8A 2KFFA 2ZNEA 1N0YA 1KQMB 1SY9A 1L2OC 1YVLA 1S6JA 3AAJA 3GK4X 1NX0A 2WCBA 4YGEB 1KSOA 1WDCC 4PHJA 1UWOA 4ORCB 2EC6C 1PRWA 4MVFA 2JZIA 3IF7A 2F8PA 1JBAA 3I5FC 2WNDA 2M1KB 1XK4C 1ALWA 2MHHA 5I2LA 1K93D 3I5GC 2MLEC 1M46A 1QVIY 5J3XA 1XFYO 3WNXB 3TDIA 5CSNA 2LMVA 4N1GA 2K2AA 1B47A 2KDHA 1SKTA 4MN0A 1H8BA 3TDUA 1CLMA 1DJXA 1M45A 2H2KA 4GGFA 1C7WA 2PSRA 5TNCA 1SNLA 3LK1A 2H61C 1PVAA 1XFWO 2SCPA 2KYFA 4I5LB 2F3YA 3KO0A 1SR6B 5F6TA 4PE7A 2PVBA 4E68A 4MZLA 2F2OA 1YURA 3RM1A 5I2QA 3CR4X 1DJIA 1TNXA 1NYAA 1A75A 2BE6A 3PM8A 2PALA 2ZFDA 3JVTB 2JRFA 3CR2A 1R2UA 1CFDA 2M97A 3ICBA 2PASA 2WCEA 1TCFA 2LC5A 1XYDA 1QXPA 1EG4A 1NX2A 1SL7A 3M0WA 2OTGC 4M2QA 2K2FA 3E3RA 5CSFA 2K7DA 1CDNA 4MBEA 1PSBA 1SBJA 3F45A 3EK4A 3GK1A 2GV5A 1EXRA 2K0JA 2ZRTA 4FQOA 4DIRA 2AMIA 2I7AA 2MAZA 3I5HB 1J7RA 2M3WA 2LANA 3MSEB 4OV2A 2LLTA 1D1OA 1MUXA 2HF5A 1DVIA 1IQ5A 4YI9A 1W7JB 3EKHA 4TNCA 1TN4A 4PHKA 3WHUB 1MXLC 3WHTB 2KGBC 1XK4A 4HREE 2P6BB 1K2HA 2WC8A 4FTGA 2JU0A 2KI6C 3BUOB 1DJGA 1CNPA 2NCOA 1TIZA 1F4OA 1YX7A 2JNXA 5GQQC 4U8DA 2CCMA 1SW8A 3BUWB 3KHEA 1UURA 2KNEA 2LVKA 2M7NA 1WLMA 1LXFC 1MHOA 2MJWB 5PALA 1NCXA 1MWNA 3CLNA 1CFCA 2KI4B 1CDMA 2ZKMX 1IKUA 1W7IB 5G08A 2ISDA 2F3ZA 4MRYA 1JFJA 1CLBA 1FBVA 5AFPA 4BY4A 3IQQA 3SJSA 1OMVA 1NWDA 2EGDA 1S36A 3CR5X 3DF0A 4C0JA 1CKKA 4GGFC 1NX3A 2LVIA 1JFKA 2LVVA 4ETOA 2MRDA 3PFVA 1ZOTB 1PALA 4YGDB 3GOFA 1WRLA 2MA2A 3LL8B 1QX5B 1G33A 3SIBA 2G2BA 1NSHA 3TUYC 4USLA 3VRQA 1PK0D 1A2XA 4WRIA 2JT3A 1JSAA 1SL9A 2MLFC 1XVJA 3NXAA 1NUBA 1M39A 3I5IC 1XFVO 3SG2A 1HT9A 5KTYA 1A03A 2OPOA 1CM1A 1MF8B 3EK7A 4N1FA 4ICBA 4YGAA 2JNFA 3H4SE 4CIDA 3AKBA 3CWGA 1F4QA 4NDBA 2KQ6A 3HCMA 5CPVA 1QV1A 4WQ3A 4M2OA 4AQJA 1K8UA 4C0KA 4MZJA 1C07A 2JWWA 2FJUB 1YTZC 2MBXA 2BL0C 2KI6D 3O78A 4ORAB 3PN7C 4AQIA 1F54A 2EC6B 3JTDC 1J7OA 1YUSA 5AEQA 3D10A 2KFGA 1YRTB 1IJ5A 1YR5A 1G4YR 1BLQA 4I5NB 1OOJA 1FI5A 5AANA 1UUSA 1GGZA 3I5GB 3OB2B 1WY9A 1OMRA 1DTLA 3KF9A 4HRHA 3TS5B 3ZNIA 1PULA 5D7FA 1F71A 1N65A 1BMOA 2V53A 1KK7Z 3AKAA 1KQMC 1QASA 3KEVA 3ZWHA 3AAKA 1Y1UA 4MLWA 5ER4X 2JXLA 1QIWA 4C0LA 1DF0B 1CLLA 1F70A 2OS8B 2LHIA 4I5JA 1UHJA 1V1GA 4PE4A 1S1EA 2RGIA 3D0YB 3QRXA 2KBIA 1M31A 1VRKA 4OCIA 1OE9B 1TNQA 1OQPA 1UHKA 2HQWA 1DJZA 2LV7A 2O5GA 2KSPA 1S5GZ 1CDPA 3EKJA 1B7TZ 1DJHA 1QX7A 1FPWA 1PVBA 1RWYA 1AVSA 4I5KA 1QATA 2M49B 1DGUA 1K9KA 1KWOC 1SCMB 2LMTA 3BOWB 4YRUA 3K21A 2LAPA 4YGBB 1HQVA 1YRUB 2PMYA 1JWDA 1SR6C 2KBMA 2BKIB 1BODA 2CXJA 2NCPA 1KQVA 1K9UA 4DS7A 2JQ6A 1Y0VH 4CPVA 3WXAA 1BT6A 4PHMA 4CFRA 1SRAA 3CS1A 2CBLA 5HYDA 1Y1XA 4ORBB 1NP8A 2GGZA 3JVTC 4OVNF 1S6CA 4CLNA 1TTXA 4XJKA 3OP0A 3A8RA 2NLNA 1PSRA 4XYNA 1J1EA 1IQ3A 2SASA 3NSIA 4A4BA 1F8HA 3GK2A 1SPYA 1H4BA 3NSKA 2L4IA 2LLSA 4QJ5B 2KAYA 1RECA 1BJFA 1V1FA 1BF5A 1CDLA 2LP3A 2KQYA 3IQOA 1LINA 3DVEA 1B8RA 1RROA 1WRKA 3FIAA 2BCAA 1LKJA 4YI8A 4OKHA 2M0RA 4ZCUA 5JOLA 4MRXA 3O4YA 5KU1A 1IWQA 1ZMZA 1YUUA 1LA3A 1SMGA 2ZN9A 3CGAA 3A4UB 1KK7Y 2LE9B 2M9GA 1BR4B 2K8MB 2WCFA 1NX1A 2L4HA 1QTXA 2A4JA 5HLVA 3SG3A 2BCBA 4AOMA 2Y1NA 1F55A 2M1UA 1JF2A 1QJTA 3NSOA 4M2PA 5KSZA 3HX4A 1UHHA 4HSZA 2KOTA 2KI4C 1QS7A 1NCYA 3D0YA 1CM4A 2CNPA 1M63B 5AERA 3DVKA 5IBWA 2VRGA 1CB1A 2JTZA 4GBAA 2KHNA 1SL8A 3FWBA 4QJ3B 4CFQA 1DMOA 1B8LA 1S5GY 4PE1A 1B4CA 2HQ8A 2BE4A 1A4PA 1KK8B 1NCZA 2LMUA 2WOSA 3O2PA 2BKHB 1Q80A 3BXKA 1EL4A 1XA5A 1K96A
chains in the Genus database with same CATH superfamily
1ZACA 3BOWA 1L2OB 2K7OA 1BOCA 1R6PA 1IRJA 1SYMA 1J55A 3SIAA 3L4LA 1RK9A 1WDCB 4A4CA 3PN7B 1AHRA 1JF0A 2KAVA 1OOFA 4GNKB 5HL1A 2EHBA 1DJWA 4OZDA 4F7FA 1DJYA 2D8NA 2FOTA 3V2LA 5BPJA 2LCPA 1J7QA 1RJVA 2JPTA 2ZRSA 3FS7A 2K61A 1AUIB 3I5FB 5D69A 3VGOA 1K94A 3B6XA 1FI6A 2DOQA 1XFUO 1TCOB 3BUXB 2AUCA 2JT8A 3OHMB 2LNKA 1BR1B 2FCEA 2HPSA 1IGVA 4PDZA 3SG4A 1XFZO 1CFPA 1OZOA 3EVVA 2BECA 1KFXS 4UPGA 2KLDA 3B7AA 2LUCA 5DKNA 1K90D 4INXA 1AJ5A 2BBMA 1AK8A 3LLEA 1L7ZA 2NXQA 1UHNA 3B88A 3Q8IA 2L98A 1K95A 3CTNA 5HKWA 1J7PA 1CFFA 4JPZB 2NZ0A 3TZ1A 2E30A 4P2YB 3SG7A 1JUOA 4JQ0D 3TS5C 1Y6WA 3DF0B 4BY5A 1BU3A 2QEOA 1MXEA 1KFUS 2JXCA 2QPTA 2KLEA 1IG5A 2R2IA 2ZNDA 2Q4UA 1TRFA 1LA0A 4R1EA 3O6BA 1KWOB 1EH2A 4ZCVA 2QEHA 2M7LA 2M29A 4GAOA 2OS8C 1K9PA 1U5IB 4NQGA 5K89A 3PATA 1BG1A 2OTGB 2LLUA 3RLZA 3VROA 1QLSA 1SCVA 5B8IB 1OZSA 1QIVA 1GGWA 1UHIA 3PLFB 1ZUZA 3KPXA 1DT7B 4GGNA 2I2RE 2BCXA 2LM5A 1NIWA 2LP2A 1WRZA 2Y4QA 4L9MA 4WQ2A 3K1EA 5EL2A 5DKRA 4MEWA 2P71A 4PCWA 1SK6D 1TNWA 3S0AA 3VRPA 4JWQA 1SCMC 2KGRA 2I18A 2KAXA 4OR9B 3IVTA 4IL1A 4YGCB 5JJGA 5DKQA 5I2OA 4NDDA 3OB1B 1XO5A 3EVUA 1A29A 1OOIX 3BUNB 3TDZA 3VRNA 4DUQA 1KCYA 1JC2A 1OMDA 1AJ4A 1ALVA 4NDCA 4GUKA 3BQ3A 3I5HC 3DD4A 1GJYA 2BNXA 4HRGA 4GFTA 4PHNA 4D1EA 3VRRA 1B1GA 1IH0A 1FW4A 1CTRA 1OW4A 3PALA 1XFXO 1QVIZ 1S26D 2WCMA 1FF1A 3SG6A 1IIOA 2WORA 2QDIA 1N2DA 1NPQA 2JOJA 2L5XB 1Y1AA 2L0PA 2JULA 1UP5A 2WC5A 3DVJA 5I8NA 2M8UA 1X02A 2B1UA 1C7VA 1ODBA 3BUMB 1QLKA 2O60A 5CSJA 4PE0A 3BFAA 2L50A 3CDNA 4PT1A 5HKYA 3PSRA 1E8AA 2E6WA 3NSLA 3LK0A 3OX6A 1DGVA 2L51A 5CSIA 1DF0A 5FYXA 1OSAA 3OX5A 3TUYB 1RFJA 2K7CA 3BYAA 2H61A 3DVMA 3EVRA 1AP4A 4PALA 5HLOA 2PRUA 1B9AA 1TUZA 1A75B 2LVJA 1KFXL 1S3PA 2I94A 1MQ1A 2HETA 3I5IB 2LUXA 2TN4A 1YX8A 2COLB 4GPLB 4MSPA 1QV0A 2CT9A 1OOHA 2Y1MA 1RTP1 2FCDA 5ER5A 3FWCA 2QEVA 4F0ZB 1B7TY 2LHLA 1CMFA 1S6IA 1CMGA 1B8CA 2K60A 3BFBA 4KYNA 4YBHB 2QACA 2BBNA 4IJ7A 1EG3A 2KFHA 3CZTX 1TOPA 1YUTA 1YVHA 4Q04A 5HKZA 4DRWA 1IJ6A 2JC2A 3CZ2A 2F2PA 3C1VA 2Y5IA 1QX2A 1U5IA 2BL0B 2AAOA 1SSEB 1KFUL 1MR8A 1GQMA 2Q91A 2WCLA 3JTDB 1G8IA 1ZFSA 2GGMA 1WLZA 5AXIA 3VB1A 3SG5A 2G9BA 2KYCA 2JT0A 4MZKA 1EJ3A 2CTNA 2L2EA 4XJKB 4QJ4B 1LVCD 2F33A 2IS9A 3LCPC 2K7BA 1J1DA 4N5XA 1KSMA 4DCKA 2JTTA 1TNPA 4P5OE 3EK8A 1KK8C 2ZN8A 2KFFA 2ZNEA 1N0YA 1KQMB 1SY9A 1L2OC 1YVLA 1S6JA 3AAJA 3GK4X 1NX0A 2WCBA 2L2CA 4YGEB 1KSOA 1WDCC 1OOGA 1UWOA 4PHJA 4ORCB 2EC6C 1PRWA 4MVFA 2JZIA 3IF7A 1XFRA 2F8PA 2WC6A 2GTEA 1JBAA 3I5FC 2WNDA 2M1KB 1XK4C 3DYEA 1ALWA 2P70A 2MHHA 5I2LA 1K93D 3I5GC 2MLEC 1M46A 1QVIY 5J3XA 1XFYO 1DC1A 3WNXB 3TDIA 5CSNA 2LMVA 4N1GA 2K2AA 1B47A 2KDHA 1SKTA 4MN0A 1H8BA 3TDUA 1CLMA 1DJXA 1QWVA 1M45A 2H2KA 4GGFA 1C7WA 2ERBA 2PSRA 5TNCA 1SNLA 3LK1A 2H61C 1PVAA 1XFWO 2SCPA 2KYFA 4I5LB 2F3YA 3KO0A 1SR6B 2KPHA 5F6TA 4PE7A 3R72A 1W9ZA 5FI7A 2PVBA 4E68A 4MZLA 2F2OA 1YURA 3RM1A 5I2QA 3CR4X 1DJIA 3EG5B 1TNXA 1NYAA 1A75A 2BE6A 3PM8A 2PALA 3SS4A 2ZFDA 3JVTB 2JRFA 1Z2CB 3CR2A 1R2UA 1CFDA 2M97A 3ICBA 2PASA 2WCKA 3D76A 3NHIA 2WCEA 3R1PA 1TCFA 2LC5A 1XYDA 1QXPA 1EG4A 1NX2A 1SL7A 3M0WA 2OTGC 4M2QA 3D75A 2K2FA 2WCJA 3E3RA 1DELA 5CSFA 2K7DA 1CDNA 4MBEA 1PSBA 1SBJA 3F45A 3EK4A 3GK1A 2GV5A 1EXRA 2K0JA 2ZRTA 1Z4HA 3CYZA 4FQOA 4DIRA 2AMIA 2I7AA 2MAZA 3I5HB 1J7RA 2M3WA 2LANA 3CZ0A 3MSEB 4OV2A 2LLTA 1GM0A 1D1OA 1MUXA 2HF5A 1DVIA 1IQ5A 4YI9A 1W7JB 3EKHA 4TNCA 1TN4A 4PHKA 3WHUB 1MXLC 3WHTB 2KGBC 4INWA 1XK4A 2WCHA 3PM2A 1P28A 4HREE 2P6BB 1K2HA 1DQEA 2WC8A 4FTGA 2JU0A 2KI6C 3BUOB 1DJGA 1CNPA 2NCOA 1C3ZA 1TIZA 1F4OA 1YX7A 2JNXA 5GQQC 4U8DA 2CCMA 3OGNA 1SW8A 3BUWB 3KHEA 1UURA 2KNEA 2LVKA 2M7NA 1WLMA 1LXFC 1MHOA 2MJWB 3N7HA 3DY9A 1NCXA 5PALA 1ORGA 1MWNA 3CLNA 1CFCA 2KI4B 1CDMA 2ZKMX 1IKUA 1W7IB 5G08A 2ISDA 2F3ZA 4MRYA 1JFJA 1CLBA 1FBVA 5AFPA 4BY4A 3IQQA 3UO9A 3SJSA 1OMVA 1NWDA 2EGDA 1S36A 3CR5X 3DF0A 4C0JA 1CKKA 4GGFC 1NX3A 2LVIA 1JFKA 2LVVA 3UNWA 4ETOA 2MRDA 3PFVA 1DEKA 1ZOTB 1PALA 3QMEA 3RZSA 4YGDB 3GOFA 1T14A 1WRLA 2MA2A 1QX5B 1G33A 3LL8B 3S0EA 3SIBA 2G2BA 1NSHA 3TUYC 4USLA 3DZTA 3VRQA 1PK0D 1A2XA 4WRIA 2JT3A 1JSAA 1SL9A 3NGVA 2MLFC 1XVJA 3NXAA 1NUBA 3FE9A 1M39A 3I5IC 1XFVO 3SG2A 1HT9A 5KTYA 1A03A 2OPOA 1CM1A 1MF8B 3EK7A 3SS5A 4N1FA 5I94A 4ICBA 4YGAA 2JNFA 3H4SE 4CIDA 3AKBA 3CWGA 1F4QA 4NDBA 2KQ6A 3HCMA 5CPVA 1QV1A 4WQ3A 4M2OA 4AQJA 1K8UA 3SS3A 4C0KA 4MZJA 3B86A 1C07A 2JWWA 2FJUB 1YTZC 2MBXA 2BL0C 2KI6D 3O78A 4ORAB 3D73A 3PN7C 4AQIA 1F54A 2EC6B 3JTDC 1J7OA 2YGUA 1YUSA 5AEQA 3D10A 2KFGA 1YRTB 1IJ5A 1YR5A 1G4YR 1BLQA 4I5NB 1OOJA 1FI5A 5AANA 1UUSA 1GGZA 3I5GB 3OB2B 1WY9A 1OMRA 1DTLA 3KF9A 2PYQA 4HRHA 3TS5B 3ZNIA 1PULA 5D7FA 1F71A 1N65A 1BMOA 3BFHA 2V53A 1KK7Z 3AKAA 3PJIA 1KQMC 1QASA 3KEVA 3ZWHA 3AAKA 1Y1UA 4MLWA 5ER4X 2JXLA 5FI2A 1QIWA 4C0LA 1DF0B 1CLLA 1F70A 2OS8B 1LS8A 2LHIA 4I5JA 1UHJA 1V1GA 3NHTA 4PE4A 1S1EA 3B87A 2RGIA 3D0YB 3QRXA 2KBIA 1M31A 1VRKA 4OCIA 1OE9B 1TNQA 1OQPA 1UHKA 2HQWA 3R1OA 1DJZA 2LV7A 2O5GA 2KSPA 3D77A 1S5GZ 1CDPA 3EKJA 1B7TZ 1DJHA 1QX7A 1FPWA 1PVBA 1RWYA 1AVSA 3S0FA 4I5KA 1QATA 2M49B 1DGUA 3S0BA 1K9KA 1KWOC 1SCMB 2LMTA 3BOWB 4YRUA 3K21A 2LAPA 4YGBB 1HQVA 1YRUB 3S0GA 2PMYA 1JWDA 1SR6C 2KBMA 2BKIB 1BODA 2CXJA 2NCPA 1KQVA 2BAPA 4JD9A 1K9UA 1TUJA 4DS7A 3FE8A 2JQ6A 4JKTA 1Y0VH 4CPVA 3WXAA 1BT6A 4PHMA 4CFRA 1SRAA 3CS1A 2CBLA 5HYDA 5DICA 1Y1XA 4ORBB 1NP8A 2GGZA 3JVTC 4OVNF 1S6CA 4CLNA 1TTXA 4XJKA 3OP0A 3A8RA 2NLNA 1PSRA 4XYNA 1J1EA 1IQ3A 2SASA 3NSIA 4A4BA 1F8HA 3O4XA 3GK2A 1SPYA 3D78A 1H4BA 3NSKA 2L4IA 2LLSA 4QJ5B 2KAYA 1RECA 1BJFA 1TWOA 1V1FA 1BF5A 1CDLA 2LP3A 3OBVA 2QEBA 2KQYA 3IQOA 1LINA 3DVEA 5FI6A 1B8RA 1RROA 1WRKA 3FIAA 2BCAA 1LKJA 4YI8A 3CZ1A 1C3YA 4OKHA 3D74A 2M0RA 3R1VA 4ZCUA 5JOLA 4MRXA 3O4YA 2H8VA 3DXLA 5KU1A 1IWQA 1ZMZA 1YUUA 1LA3A 1SMGA 2ZN9A 3CGAA 3A4UB 1KK7Y 2LE9B 2M9GA 1BR4B 2K8MB 2JPOA 2WCFA 5D3OA 2L5YA 1NX1A 2L4HA 1QTXA 2A4JA 5HLVA 3SG3A 2BCBA 4AOMA 2Y1NA 1F55A 2M1UA 1JF2A 1QJTA 3NSOA 3L4AA 4M2PA 5KSZA 3HX4A 4FQTA 1UHHA 4HSZA 2KOTA 2KI4C 1QS7A 1NCYA 3D0YA 1CM4A 2CNPA 3FE6A 1M63B 5AERA 3DVKA 5IBWA 2VRGA 1CB1A 2JTZA 4GBAA 2KHNA 1SL8A 3FWBA 4QJ3B 4CFQA 1DMOA 1B8LA 1S5GY 4PE1A 1B4CA 3BJHA 2HQ8A 2BE4A 1A4PA 1KK8B 1NCZA 2LMUA 2WOSA 2PQLA 3L47A 2BKHB 3O2PA 1Q80A 3BXKA 2FJYA 3S0DA 1EL4A 3CABA 1XA5A 1K96A
chains in the Genus database with same CATH topology
1ZACA 3BOWA 1L2OB 2K7OA 1BOCA 1R6PA 1IRJA 1SYMA 1J55A 3SIAA 1RK9A 1WDCB 4A4CA 3PN7B 1AHRA 1JF0A 2KAVA 4GNKB 2EHBA 1DJWA 5BPJA 1DJYA 2D8NA 2FOTA 1J7QA 2LCPA 1RJVA 2JPTA 2ZRSA 3FS7A 2K61A 1AUIB 3I5FB 5D69A 3VGOA 1K94A 1FI6A 2DOQA 1XFUO 1TCOB 3BUXB 2AUCA 2JT8A 3OHMB 2LNKA 1BR1B 2FCEA 2HPSA 1IGVA 4PDZA 3SG4A 1XFZO 1CFPA 1OZOA 3EVVA 2BECA 1KFXS 4UPGA 2LUCA 5DKNA 1K90D 1AK8A 1AJ5A 2BBMA 3LLEA 1L7ZA 2NXQA 1UHNA 2L98A 1K95A 3CTNA 5HKWA 1J7PA 1CFFA 4JPZB 2NZ0A 3TZ1A 2E30A 4P2YB 3SG7A 1JUOA 4JQ0D 3TS5C 1Y6WA 3DF0B 4BY5A 1BU3A 1MXEA 1KFUS 2JXCA 2QPTA 2ZNDA 1IG5A 2R2IA 2Q4UA 1TRFA 1LA0A 4R1EA 3O6BA 1KWOB 1EH2A 4ZCVA 2M7LA 2M29A 4GAOA 2OS8C 1K9PA 1U5IB 4NQGA 5K89A 3PATA 1BG1A 2OTGB 2LLUA 3RLZA 3VROA 1QLSA 1SCVA 5B8IB 1OZSA 1QIVA 1GGWA 1UHIA 3PLFB 1ZUZA 3KPXA 1DT7B 4GGNA 2I2RE 2BCXA 2LM5A 1NIWA 2LP2A 1WRZA 2Y4QA 4L9MA 4WQ2A 5DKRA 4MEWA 4PCWA 1SK6D 1TNWA 3VRPA 4JWQA 1SCMC 2KGRA 2I18A 2KAXA 4OR9B 4IL1A 4YGCB 5JJGA 5DKQA 5I2OA 4NDDA 3OB1B 1XO5A 3EVUA 1A29A 3TDZA 3BUNB 3VRNA 4DUQA 1KCYA 1JC2A 1OMDA 1AJ4A 1ALVA 4NDCA 4GUKA 3BQ3A 3I5HC 3DD4A 1GJYA 4HRGA 4GFTA 4PHNA 4D1EA 3VRRA 1B1GA 1IH0A 1FW4A 1CTRA 3PALA 1XFXO 1QVIZ 1S26D 1FF1A 3SG6A 2WORA 1N2DA 1NPQA 2JOJA 2L5XB 1Y1AA 2L0PA 2JULA 1UP5A 3DVJA 5I8NA 2M8UA 1X02A 2B1UA 1C7VA 1ODBA 3BUMB 1QLKA 2O60A 5CSJA 4PE0A 2L50A 5HKYA 3PSRA 1E8AA 2E6WA 3NSLA 3LK0A 3OX6A 1DGVA 2L51A 5CSIA 1DF0A 5FYXA 1OSAA 3OX5A 3TUYB 1RFJA 2K7CA 3BYAA 2H61A 3DVMA 3EVRA 1AP4A 4PALA 5HLOA 2PRUA 1B9AA 1A75B 2LVJA 1KFXL 1S3PA 2I94A 1MQ1A 2HETA 3I5IB 2LUXA 2TN4A 1YX8A 2COLB 4GPLB 4MSPA 1QV0A 2CT9A 2Y1MA 1RTP1 2FCDA 5ER5A 3FWCA 4F0ZB 1B7TY 2LHLA 1CMFA 1S6IA 1CMGA 1B8CA 4YBHB 2QACA 2BBNA 1EG3A 2KFHA 3CZTX 1TOPA 1YUTA 1YVHA 4Q04A 5HKZA 4DRWA 1IJ6A 2JC2A 2F2PA 3C1VA 2Y5IA 1QX2A 1U5IA 2BL0B 2AAOA 1KFUL 1MR8A 1GQMA 2Q91A 3JTDB 1G8IA 1ZFSA 2GGMA 1WLZA 5AXIA 3SG5A 2G9BA 2KYCA 2JT0A 4MZKA 1EJ3A 2CTNA 2L2EA 4XJKB 4QJ4B 1LVCD 2F33A 2IS9A 3LCPC 2K7BA 1J1DA 4N5XA 1KSMA 4DCKA 2JTTA 1TNPA 4P5OE 3EK8A 1KK8C 2ZN8A 2KFFA 2ZNEA 1N0YA 1KQMB 1SY9A 1L2OC 1YVLA 1S6JA 3AAJA 3GK4X 1NX0A 2WCBA 4YGEB 1KSOA 1WDCC 4PHJA 1UWOA 4ORCB 2EC6C 1PRWA 4MVFA 2JZIA 3IF7A 2F8PA 1JBAA 3I5FC 2WNDA 2M1KB 1XK4C 1ALWA 2MHHA 5I2LA 1K93D 3I5GC 2MLEC 1M46A 1QVIY 5J3XA 1XFYO 3WNXB 3TDIA 5CSNA 2LMVA 4N1GA 2K2AA 1B47A 2KDHA 1SKTA 4MN0A 1H8BA 3TDUA 1CLMA 1DJXA 1M45A 2H2KA 4GGFA 1C7WA 2PSRA 5TNCA 1SNLA 3LK1A 2H61C 1PVAA 1XFWO 2SCPA 2KYFA 4I5LB 2F3YA 3KO0A 1SR6B 5F6TA 4PE7A 2PVBA 4E68A 4MZLA 2F2OA 1YURA 3RM1A 5I2QA 3CR4X 1DJIA 1TNXA 1NYAA 1A75A 2BE6A 3PM8A 2PALA 2ZFDA 3JVTB 2JRFA 3CR2A 1R2UA 1CFDA 2M97A 3ICBA 2PASA 2WCEA 1TCFA 2LC5A 1XYDA 1QXPA 1EG4A 1NX2A 1SL7A 3M0WA 2OTGC 4M2QA 2K2FA 3E3RA 5CSFA 2K7DA 1CDNA 4MBEA 1PSBA 1SBJA 3F45A 3EK4A 3GK1A 2GV5A 1EXRA 2K0JA 2ZRTA 4FQOA 4DIRA 2AMIA 2I7AA 2MAZA 3I5HB 1J7RA 2M3WA 2LANA 3MSEB 4OV2A 2LLTA 1D1OA 1MUXA 2HF5A 1DVIA 1IQ5A 4YI9A 1W7JB 3EKHA 4TNCA 1TN4A 4PHKA 3WHUB 1MXLC 3WHTB 2KGBC 1XK4A 4HREE 2P6BB 1K2HA 2WC8A 4FTGA 2JU0A 2KI6C 3BUOB 1DJGA 1CNPA 2NCOA 1TIZA 1F4OA 1YX7A 2JNXA 5GQQC 4U8DA 2CCMA 1SW8A 3BUWB 3KHEA 1UURA 2KNEA 2LVKA 2M7NA 1WLMA 1LXFC 1MHOA 2MJWB 5PALA 1NCXA 1MWNA 3CLNA 1CFCA 2KI4B 1CDMA 2ZKMX 1IKUA 1W7IB 5G08A 2ISDA 2F3ZA 4MRYA 1JFJA 1CLBA 1FBVA 5AFPA 4BY4A 3IQQA 3SJSA 1OMVA 1NWDA 2EGDA 1S36A 3CR5X 3DF0A 4C0JA 1CKKA 4GGFC 1NX3A 2LVIA 1JFKA 2LVVA 4ETOA 2MRDA 3PFVA 1ZOTB 1PALA 4YGDB 3GOFA 1WRLA 2MA2A 3LL8B 1QX5B 1G33A 3SIBA 2G2BA 1NSHA 3TUYC 4USLA 3VRQA 1PK0D 1A2XA 4WRIA 2JT3A 1JSAA 1SL9A 2MLFC 1XVJA 3NXAA 1NUBA 1M39A 3I5IC 1XFVO 3SG2A 1HT9A 5KTYA 1A03A 2OPOA 1CM1A 1MF8B 3EK7A 4N1FA 4ICBA 4YGAA 2JNFA 3H4SE 4CIDA 3AKBA 3CWGA 1F4QA 4NDBA 2KQ6A 3HCMA 5CPVA 1QV1A 4WQ3A 4M2OA 4AQJA 1K8UA 4C0KA 4MZJA 1C07A 2JWWA 2FJUB 1YTZC 2MBXA 2BL0C 2KI6D 3O78A 4ORAB 3PN7C 4AQIA 1F54A 2EC6B 3JTDC 1J7OA 1YUSA 5AEQA 3D10A 2KFGA 1YRTB 1IJ5A 1YR5A 1G4YR 1BLQA 4I5NB 1OOJA 1FI5A 5AANA 1UUSA 1GGZA 3I5GB 3OB2B 1WY9A 1OMRA 1DTLA 3KF9A 4HRHA 3TS5B 3ZNIA 1PULA 5D7FA 1F71A 1N65A 1BMOA 2V53A 1KK7Z 3AKAA 1KQMC 1QASA 3KEVA 3ZWHA 3AAKA 1Y1UA 4MLWA 5ER4X 2JXLA 1QIWA 4C0LA 1DF0B 1CLLA 1F70A 2OS8B 2LHIA 4I5JA 1UHJA 1V1GA 4PE4A 1S1EA 2RGIA 3D0YB 3QRXA 2KBIA 1M31A 1VRKA 4OCIA 1OE9B 1TNQA 1OQPA 1UHKA 2HQWA 1DJZA 2LV7A 2O5GA 2KSPA 1S5GZ 1CDPA 3EKJA 1B7TZ 1DJHA 1QX7A 1FPWA 1PVBA 1RWYA 1AVSA 4I5KA 1QATA 2M49B 1DGUA 1K9KA 1KWOC 1SCMB 2LMTA 3BOWB 4YRUA 3K21A 2LAPA 4YGBB 1HQVA 1YRUB 2PMYA 1JWDA 1SR6C 2KBMA 2BKIB 1BODA 2CXJA 2NCPA 1KQVA 1K9UA 4DS7A 2JQ6A 1Y0VH 4CPVA 3WXAA 1BT6A 4PHMA 4CFRA 1SRAA 3CS1A 2CBLA 5HYDA 1Y1XA 4ORBB 1NP8A 2GGZA 3JVTC 4OVNF 1S6CA 4CLNA 1TTXA 4XJKA 3OP0A 3A8RA 2NLNA 1PSRA 4XYNA 1J1EA 1IQ3A 2SASA 3NSIA 4A4BA 1F8HA 3GK2A 1SPYA 1H4BA 3NSKA 2L4IA 2LLSA 4QJ5B 2KAYA 1RECA 1BJFA 1V1FA 1BF5A 1CDLA 2LP3A 2KQYA 3IQOA 1LINA 3DVEA 1B8RA 1RROA 1WRKA 3FIAA 2BCAA 1LKJA 4YI8A 4OKHA 2M0RA 4ZCUA 5JOLA 4MRXA 3O4YA 5KU1A 1IWQA 1ZMZA 1YUUA 1LA3A 1SMGA 2ZN9A 3CGAA 3A4UB 1KK7Y 2LE9B 2M9GA 1BR4B 2K8MB 2WCFA 1NX1A 2L4HA 1QTXA 2A4JA 5HLVA 3SG3A 2BCBA 4AOMA 2Y1NA 1F55A 2M1UA 1JF2A 1QJTA 3NSOA 4M2PA 5KSZA 3HX4A 1UHHA 4HSZA 2KOTA 2KI4C 1QS7A 1NCYA 3D0YA 1CM4A 2CNPA 1M63B 5AERA 3DVKA 5IBWA 2VRGA 1CB1A 2JTZA 4GBAA 2KHNA 1SL8A 3FWBA 4QJ3B 4CFQA 1DMOA 1B8LA 1S5GY 4PE1A 1B4CA 2HQ8A 2BE4A 1A4PA 1KK8B 1NCZA 2LMUA 2WOSA 3O2PA 2BKHB 1Q80A 3BXKA 1EL4A 1XA5A 1K96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAC A;  3BOW A;  1L2O B;  2K7O A;  1BOC A;  1R6P A;  1IRJ A;  1SYM A;  1J55 A;  3SIA A;  1RK9 A;  1WDC B;  4A4C A;  3PN7 B;  1AHR A;  1JF0 A;  2KAV A;  4GNK B;  2EHB A;  1DJW A;  5BPJ A;  1DJY A;  2D8N A;  2FOT A;  1J7Q A;  2LCP A;  1RJV A;  2JPT A;  2ZRS A;  3FS7 A;  2K61 A;  1AUI B;  3I5F B;  5D69 A;  3VGO A;  1K94 A;  1FI6 A;  2DOQ A;  1XFU O;  1TCO B;  3BUX B;  2AUC A;  2JT8 A;  3OHM B;  2LNK A;  1BR1 B;  2FCE A;  2HPS A;  1IGV A;  4PDZ A;  3SG4 A;  1XFZ O;  1CFP A;  1OZO A;  3EVV A;  2BEC A;  1KFX S;  4UPG A;  2LUC A;  5DKN A;  1K90 D;  1AK8 A;  1AJ5 A;  2BBM A;  3LLE A;  1L7Z A;  2NXQ A;  1UHN A;  2L98 A;  1K95 A;  3CTN A;  5HKW A;  1J7P A;  1CFF A;  4JPZ B;  2NZ0 A;  3TZ1 A;  2E30 A;  4P2Y B;  3SG7 A;  1JUO A;  4JQ0 D;  3TS5 C;  1Y6W A;  3DF0 B;  4BY5 A;  1BU3 A;  1MXE A;  1KFU S;  2JXC A;  2QPT A;  2ZND A;  1IG5 A;  2R2I A;  2Q4U A;  1TRF A;  1LA0 A;  4R1E A;  3O6B A;  1KWO B;  1EH2 A;  4ZCV A;  2M7L A;  2M29 A;  4GAO A;  2OS8 C;  1K9P A;  1U5I B;  4NQG A;  5K89 A;  3PAT A;  1BG1 A;  2OTG B;  2LLU A;  3RLZ A;  3VRO A;  1QLS A;  1SCV A;  5B8I B;  1OZS A;  1QIV A;  1GGW A;  1UHI A;  3PLF B;  1ZUZ A;  3KPX A;  1DT7 B;  4GGN A;  2I2R E;  2BCX A;  2LM5 A;  1NIW A;  2LP2 A;  1WRZ A;  2Y4Q A;  4L9M A;  4WQ2 A;  5DKR A;  4MEW A;  4PCW A;  1SK6 D;  1TNW A;  3VRP A;  4JWQ A;  1SCM C;  2KGR A;  2I18 A;  2KAX A;  4OR9 B;  4IL1 A;  4YGC B;  5JJG A;  5DKQ A;  5I2O A;  4NDD A;  3OB1 B;  1XO5 A;  3EVU A;  1A29 A;  3TDZ A;  3BUN B;  3VRN A;  4DUQ A;  1KCY A;  1JC2 A;  1OMD A;  1AJ4 A;  1ALV A;  4NDC A;  4GUK A;  3BQ3 A;  3I5H C;  3DD4 A;  1GJY A;  4HRG A;  4GFT A;  4PHN A;  4D1E A;  3VRR A;  1B1G A;  1IH0 A;  1FW4 A;  1CTR A;  3PAL A;  1XFX O;  1QVI Z;  1S26 D;  1FF1 A;  3SG6 A;  2WOR A;  1N2D A;  1NPQ A;  2JOJ A;  2L5X B;  1Y1A A;  2L0P A;  2JUL A;  1UP5 A;  3DVJ A;  5I8N A;  2M8U A;  1X02 A;  2B1U A;  1C7V A;  1ODB A;  3BUM B;  1QLK A;  2O60 A;  5CSJ A;  4PE0 A;  2L50 A;  5HKY A;  3PSR A;  1E8A A;  2E6W A;  3NSL A;  3LK0 A;  3OX6 A;  1DGV A;  2L51 A;  5CSI A;  1DF0 A;  5FYX A;  1OSA A;  3OX5 A;  3TUY B;  1RFJ A;  2K7C A;  3BYA A;  2H61 A;  3DVM A;  3EVR A;  1AP4 A;  4PAL A;  5HLO A;  2PRU A;  1B9A A;  1A75 B;  2LVJ A;  1KFX L;  1S3P A;  2I94 A;  1MQ1 A;  2HET A;  3I5I B;  2LUX A;  2TN4 A;  1YX8 A;  2COL B;  4GPL B;  4MSP A;  1QV0 A;  2CT9 A;  2Y1M A;  1RTP 1;  2FCD A;  5ER5 A;  3FWC A;  4F0Z B;  1B7T Y;  2LHL A;  1CMF A;  1S6I A;  1CMG A;  1B8C A;  4YBH B;  2QAC A;  2BBN A;  1EG3 A;  2KFH A;  3CZT X;  1TOP A;  1YUT A;  1YVH A;  4Q04 A;  5HKZ A;  4DRW A;  1IJ6 A;  2JC2 A;  2F2P A;  3C1V A;  2Y5I A;  1QX2 A;  1U5I A;  2BL0 B;  2AAO A;  1KFU L;  1MR8 A;  1GQM A;  2Q91 A;  3JTD B;  1G8I A;  1ZFS A;  2GGM A;  1WLZ A;  5AXI A;  3SG5 A;  2G9B A;  2KYC A;  2JT0 A;  4MZK A;  1EJ3 A;  2CTN A;  2L2E A;  4XJK B;  4QJ4 B;  1LVC D;  2F33 A;  2IS9 A;  3LCP C;  2K7B A;  1J1D A;  4N5X A;  1KSM A;  4DCK A;  2JTT A;  1TNP A;  4P5O E;  3EK8 A;  1KK8 C;  2ZN8 A;  2KFF A;  2ZNE A;  1N0Y A;  1KQM B;  1SY9 A;  1L2O C;  1YVL A;  1S6J A;  3AAJ A;  3GK4 X;  1NX0 A;  2WCB A;  4YGE B;  1KSO A;  1WDC C;  4PHJ A;  1UWO A;  4ORC B;  2EC6 C;  1PRW A;  4MVF A;  2JZI A;  3IF7 A;  2F8P A;  1JBA A;  3I5F C;  2WND A;  2M1K B;  1XK4 C;  1ALW A;  2MHH A;  5I2L A;  1K93 D;  3I5G C;  2MLE C;  1M46 A;  1QVI Y;  5J3X A;  1XFY O;  3WNX B;  3TDI A;  5CSN A;  2LMV A;  4N1G A;  2K2A A;  1B47 A;  2KDH A;  1SKT A;  4MN0 A;  1H8B A;  3TDU A;  1CLM A;  1DJX A;  1M45 A;  2H2K A;  4GGF A;  1C7W A;  2PSR A;  5TNC A;  1SNL A;  3LK1 A;  2H61 C;  1PVA A;  1XFW O;  2SCP A;  2KYF A;  4I5L B;  2F3Y A;  3KO0 A;  1SR6 B;  5F6T A;  4PE7 A;  2PVB A;  4E68 A;  4MZL A;  2F2O A;  1YUR A;  3RM1 A;  5I2Q A;  3CR4 X;  1DJI A;  1TNX A;  1NYA A;  1A75 A;  2BE6 A;  3PM8 A;  2PAL A;  2ZFD A;  3JVT B;  2JRF A;  3CR2 A;  1R2U A;  1CFD A;  2M97 A;  3ICB A;  2PAS A;  2WCE A;  1TCF A;  2LC5 A;  1XYD A;  1QXP A;  1EG4 A;  1NX2 A;  1SL7 A;  3M0W A;  2OTG C;  4M2Q A;  2K2F A;  3E3R A;  5CSF A;  2K7D A;  1CDN A;  4MBE A;  1PSB A;  1SBJ A;  3F45 A;  3EK4 A;  3GK1 A;  2GV5 A;  1EXR A;  2K0J A;  2ZRT A;  4FQO A;  4DIR A;  2AMI A;  2I7A A;  2MAZ A;  3I5H B;  1J7R A;  2M3W A;  2LAN A;  3MSE B;  4OV2 A;  2LLT A;  1D1O A;  1MUX A;  2HF5 A;  1DVI A;  1IQ5 A;  4YI9 A;  1W7J B;  3EKH A;  4TNC A;  1TN4 A;  4PHK A;  3WHU B;  1MXL C;  3WHT B;  2KGB C;  1XK4 A;  4HRE E;  2P6B B;  1K2H A;  2WC8 A;  4FTG A;  2JU0 A;  2KI6 C;  3BUO B;  1DJG A;  1CNP A;  2NCO A;  1TIZ A;  1F4O A;  1YX7 A;  2JNX A;  5GQQ C;  4U8D A;  2CCM A;  1SW8 A;  3BUW B;  3KHE A;  1UUR A;  2KNE A;  2LVK A;  2M7N A;  1WLM A;  1LXF C;  1MHO A;  2MJW B;  5PAL A;  1NCX A;  1MWN A;  3CLN A;  1CFC A;  2KI4 B;  1CDM A;  2ZKM X;  1IKU A;  1W7I B;  5G08 A;  2ISD A;  2F3Z A;  4MRY A;  1JFJ A;  1CLB A;  1FBV A;  5AFP A;  4BY4 A;  3IQQ A;  3SJS A;  1OMV A;  1NWD A;  2EGD A;  1S36 A;  3CR5 X;  3DF0 A;  4C0J A;  1CKK A;  4GGF C;  1NX3 A;  2LVI A;  1JFK A;  2LVV A;  4ETO A;  2MRD A;  3PFV A;  1ZOT B;  1PAL A;  4YGD B;  3GOF A;  1WRL A;  2MA2 A;  3LL8 B;  1QX5 B;  1G33 A;  3SIB A;  2G2B A;  1NSH A;  3TUY C;  4USL A;  3VRQ A;  1PK0 D;  1A2X A;  4WRI A;  2JT3 A;  1JSA A;  1SL9 A;  2MLF C;  1XVJ A;  3NXA A;  1NUB A;  1M39 A;  3I5I C;  1XFV O;  3SG2 A;  1HT9 A;  5KTY A;  1A03 A;  2OPO A;  1CM1 A;  1MF8 B;  3EK7 A;  4N1F A;  4ICB A;  4YGA A;  2JNF A;  3H4S E;  4CID A;  3AKB A;  3CWG A;  1F4Q A;  4NDB A;  2KQ6 A;  3HCM A;  5CPV A;  1QV1 A;  4WQ3 A;  4M2O A;  4AQJ A;  1K8U A;  4C0K A;  4MZJ A;  1C07 A;  2JWW A;  2FJU B;  1YTZ C;  2MBX A;  2BL0 C;  2KI6 D;  3O78 A;  4ORA B;  3PN7 C;  4AQI A;  1F54 A;  2EC6 B;  3JTD C;  1J7O A;  1YUS A;  5AEQ A;  3D10 A;  2KFG A;  1YRT B;  1IJ5 A;  1YR5 A;  1G4Y R;  1BLQ A;  4I5N B;  1OOJ A;  1FI5 A;  5AAN A;  1UUS A;  1GGZ A;  3I5G B;  3OB2 B;  1WY9 A;  1OMR A;  1DTL A;  3KF9 A;  4HRH A;  3TS5 B;  3ZNI A;  1PUL A;  5D7F A;  1F71 A;  1N65 A;  1BMO A;  2V53 A;  1KK7 Z;  3AKA A;  1KQM C;  1QAS A;  3KEV A;  3ZWH A;  3AAK A;  1Y1U A;  4MLW A;  5ER4 X;  2JXL A;  1QIW A;  4C0L A;  1DF0 B;  1CLL A;  1F70 A;  2OS8 B;  2LHI A;  4I5J A;  1UHJ A;  1V1G A;  4PE4 A;  1S1E A;  2RGI A;  3D0Y B;  3QRX A;  2KBI A;  1M31 A;  1VRK A;  4OCI A;  1OE9 B;  1TNQ A;  1OQP A;  1UHK A;  2HQW A;  1DJZ A;  2LV7 A;  2O5G A;  2KSP A;  1S5G Z;  1CDP A;  3EKJ A;  1B7T Z;  1DJH A;  1QX7 A;  1FPW A;  1PVB A;  1RWY A;  1AVS A;  4I5K A;  1QAT A;  2M49 B;  1DGU A;  1K9K A;  1KWO C;  1SCM B;  2LMT A;  3BOW B;  4YRU A;  3K21 A;  2LAP A;  4YGB B;  1HQV A;  1YRU B;  2PMY A;  1JWD A;  1SR6 C;  2KBM A;  2BKI B;  1BOD A;  2CXJ A;  2NCP A;  1KQV A;  1K9U A;  4DS7 A;  2JQ6 A;  1Y0V H;  4CPV A;  3WXA A;  1BT6 A;  4PHM A;  4CFR A;  1SRA A;  3CS1 A;  2CBL A;  5HYD A;  1Y1X A;  4ORB B;  1NP8 A;  2GGZ A;  3JVT C;  4OVN F;  1S6C A;  4CLN A;  1TTX A;  4XJK A;  3OP0 A;  3A8R A;  2NLN A;  1PSR A;  4XYN A;  1J1E A;  1IQ3 A;  2SAS A;  3NSI A;  4A4B A;  1F8H A;  3GK2 A;  1SPY A;  1H4B A;  3NSK A;  2L4I A;  2LLS A;  4QJ5 B;  2KAY A;  1REC A;  1BJF A;  1V1F A;  1BF5 A;  1CDL A;  2LP3 A;  2KQY A;  3IQO A;  1LIN A;  3DVE A;  1B8R A;  1RRO A;  1WRK A;  3FIA A;  2BCA A;  1LKJ A;  4YI8 A;  4OKH A;  2M0R A;  4ZCU A;  5JOL A;  4MRX A;  3O4Y A;  5KU1 A;  1IWQ A;  1ZMZ A;  1YUU A;  1LA3 A;  1SMG A;  2ZN9 A;  3CGA A;  3A4U B;  1KK7 Y;  2LE9 B;  2M9G A;  1BR4 B;  2K8M B;  2WCF A;  1NX1 A;  2L4H A;  1QTX A;  2A4J A;  5HLV A;  3SG3 A;  2BCB A;  4AOM A;  2Y1N A;  1F55 A;  2M1U A;  1JF2 A;  1QJT A;  3NSO A;  4M2P A;  5KSZ A;  3HX4 A;  1UHH A;  4HSZ A;  2KOT A;  2KI4 C;  1QS7 A;  1NCY A;  3D0Y A;  1CM4 A;  2CNP A;  1M63 B;  5AER A;  3DVK A;  5IBW A;  2VRG A;  1CB1 A;  2JTZ A;  4GBA A;  2KHN A;  1SL8 A;  3FWB A;  4QJ3 B;  4CFQ A;  1DMO A;  1B8L A;  1S5G Y;  4PE1 A;  1B4C A;  2HQ8 A;  2BE4 A;  1A4P A;  1KK8 B;  1NCZ A;  2LMU A;  2WOS A;  3O2P A;  2BKH B;  1Q80 A;  3BXK A;  1EL4 A;  1XA5 A;  1K96 A; 
#chains in the Genus database with same CATH topology
 1ZAC A;  3BOW A;  1L2O B;  2K7O A;  1BOC A;  1R6P A;  1IRJ A;  1SYM A;  1J55 A;  3SIA A;  3L4L A;  1RK9 A;  1WDC B;  4A4C A;  3PN7 B;  1AHR A;  1JF0 A;  2KAV A;  1OOF A;  4GNK B;  5HL1 A;  2EHB A;  1DJW A;  4OZD A;  4F7F A;  1DJY A;  2D8N A;  2FOT A;  3V2L A;  5BPJ A;  2LCP A;  1J7Q A;  1RJV A;  2JPT A;  2ZRS A;  3FS7 A;  2K61 A;  1AUI B;  3I5F B;  5D69 A;  3VGO A;  1K94 A;  3B6X A;  1FI6 A;  2DOQ A;  1XFU O;  1TCO B;  3BUX B;  2AUC A;  2JT8 A;  3OHM B;  2LNK A;  1BR1 B;  2FCE A;  2HPS A;  1IGV A;  4PDZ A;  3SG4 A;  1XFZ O;  1CFP A;  1OZO A;  3EVV A;  2BEC A;  1KFX S;  4UPG A;  2KLD A;  3B7A A;  2LUC A;  5DKN A;  1K90 D;  4INX A;  1AJ5 A;  2BBM A;  1AK8 A;  3LLE A;  1L7Z A;  2NXQ A;  1UHN A;  3B88 A;  3Q8I A;  2L98 A;  1K95 A;  3CTN A;  5HKW A;  1J7P A;  1CFF A;  4JPZ B;  2NZ0 A;  3TZ1 A;  2E30 A;  4P2Y B;  3SG7 A;  1JUO A;  4JQ0 D;  3TS5 C;  1Y6W A;  3DF0 B;  4BY5 A;  1BU3 A;  2QEO A;  1MXE A;  1KFU S;  2JXC A;  2QPT A;  2KLE A;  1IG5 A;  2R2I A;  2ZND A;  2Q4U A;  1TRF A;  1LA0 A;  4R1E A;  3O6B A;  1KWO B;  1EH2 A;  4ZCV A;  2QEH A;  2M7L A;  2M29 A;  4GAO A;  2OS8 C;  1K9P A;  1U5I B;  4NQG A;  5K89 A;  3PAT A;  1BG1 A;  2OTG B;  2LLU A;  3RLZ A;  3VRO A;  1QLS A;  1SCV A;  5B8I B;  1OZS A;  1QIV A;  1GGW A;  1UHI A;  3PLF B;  1ZUZ A;  3KPX A;  1DT7 B;  4GGN A;  2I2R E;  2BCX A;  2LM5 A;  1NIW A;  2LP2 A;  1WRZ A;  2Y4Q A;  4L9M A;  4WQ2 A;  3K1E A;  5EL2 A;  5DKR A;  4MEW A;  2P71 A;  4PCW A;  1SK6 D;  1TNW A;  3S0A A;  3VRP A;  4JWQ A;  1SCM C;  2KGR A;  2I18 A;  2KAX A;  4OR9 B;  3IVT A;  4IL1 A;  4YGC B;  5JJG A;  5DKQ A;  5I2O A;  4NDD A;  3OB1 B;  1XO5 A;  3EVU A;  1A29 A;  1OOI X;  3BUN B;  3TDZ A;  3VRN A;  4DUQ A;  1KCY A;  1JC2 A;  1OMD A;  1AJ4 A;  1ALV A;  4NDC A;  4GUK A;  3BQ3 A;  3I5H C;  3DD4 A;  1GJY A;  2BNX A;  4HRG A;  4GFT A;  4PHN A;  4D1E A;  3VRR A;  1B1G A;  1IH0 A;  1FW4 A;  1CTR A;  1OW4 A;  3PAL A;  1XFX O;  1QVI Z;  1S26 D;  2WCM A;  1FF1 A;  3SG6 A;  1IIO A;  2WOR A;  2QDI A;  1N2D A;  1NPQ A;  2JOJ A;  2L5X B;  1Y1A A;  2L0P A;  2JUL A;  1UP5 A;  2WC5 A;  3DVJ A;  5I8N A;  2M8U A;  1X02 A;  2B1U A;  1C7V A;  1ODB A;  3BUM B;  1QLK A;  2O60 A;  5CSJ A;  4PE0 A;  3BFA A;  2L50 A;  3CDN A;  4PT1 A;  5HKY A;  3PSR A;  1E8A A;  2E6W A;  3NSL A;  3LK0 A;  3OX6 A;  1DGV A;  2L51 A;  5CSI A;  1DF0 A;  5FYX A;  1OSA A;  3OX5 A;  3TUY B;  1RFJ A;  2K7C A;  3BYA A;  2H61 A;  3DVM A;  3EVR A;  1AP4 A;  4PAL A;  5HLO A;  2PRU A;  1B9A A;  1TUZ A;  1A75 B;  2LVJ A;  1KFX L;  1S3P A;  2I94 A;  1MQ1 A;  2HET A;  3I5I B;  2LUX A;  2TN4 A;  1YX8 A;  2COL B;  4GPL B;  4MSP A;  1QV0 A;  2CT9 A;  1OOH A;  2Y1M A;  1RTP 1;  2FCD A;  5ER5 A;  3FWC A;  2QEV A;  4F0Z B;  1B7T Y;  2LHL A;  1CMF A;  1S6I A;  1CMG A;  1B8C A;  2K60 A;  3BFB A;  4KYN A;  4YBH B;  2QAC A;  2BBN A;  4IJ7 A;  1EG3 A;  2KFH A;  3CZT X;  1TOP A;  1YUT A;  1YVH A;  4Q04 A;  5HKZ A;  4DRW A;  1IJ6 A;  2JC2 A;  3CZ2 A;  2F2P A;  3C1V A;  2Y5I A;  1QX2 A;  1U5I A;  2BL0 B;  2AAO A;  1SSE B;  1KFU L;  1MR8 A;  1GQM A;  2Q91 A;  2WCL A;  3JTD B;  1G8I A;  1ZFS A;  2GGM A;  1WLZ A;  5AXI A;  3VB1 A;  3SG5 A;  2G9B A;  2KYC A;  2JT0 A;  4MZK A;  1EJ3 A;  2CTN A;  2L2E A;  4XJK B;  4QJ4 B;  1LVC D;  2F33 A;  2IS9 A;  3LCP C;  2K7B A;  1J1D A;  4N5X A;  1KSM A;  4DCK A;  2JTT A;  1TNP A;  4P5O E;  3EK8 A;  1KK8 C;  2ZN8 A;  2KFF A;  2ZNE A;  1N0Y A;  1KQM B;  1SY9 A;  1L2O C;  1YVL A;  1S6J A;  3AAJ A;  3GK4 X;  1NX0 A;  2WCB A;  2L2C A;  4YGE B;  1KSO A;  1WDC C;  1OOG A;  1UWO A;  4PHJ A;  4ORC B;  2EC6 C;  1PRW A;  4MVF A;  2JZI A;  3IF7 A;  1XFR A;  2F8P A;  2WC6 A;  2GTE A;  1JBA A;  3I5F C;  2WND A;  2M1K B;  1XK4 C;  3DYE A;  1ALW A;  2P70 A;  2MHH A;  5I2L A;  1K93 D;  3I5G C;  2MLE C;  1M46 A;  1QVI Y;  5J3X A;  1XFY O;  1DC1 A;  3WNX B;  3TDI A;  5CSN A;  2LMV A;  4N1G A;  2K2A A;  1B47 A;  2KDH A;  1SKT A;  4MN0 A;  1H8B A;  3TDU A;  1CLM A;  1DJX A;  1QWV A;  1M45 A;  2H2K A;  4GGF A;  1C7W A;  2ERB A;  2PSR A;  5TNC A;  1SNL A;  3LK1 A;  2H61 C;  1PVA A;  1XFW O;  2SCP A;  2KYF A;  4I5L B;  2F3Y A;  3KO0 A;  1SR6 B;  2KPH A;  5F6T A;  4PE7 A;  3R72 A;  1W9Z A;  5FI7 A;  2PVB A;  4E68 A;  4MZL A;  2F2O A;  1YUR A;  3RM1 A;  5I2Q A;  3CR4 X;  1DJI A;  3EG5 B;  1TNX A;  1NYA A;  1A75 A;  2BE6 A;  3PM8 A;  2PAL A;  3SS4 A;  2ZFD A;  3JVT B;  2JRF A;  1Z2C B;  3CR2 A;  1R2U A;  1CFD A;  2M97 A;  3ICB A;  2PAS A;  2WCK A;  3D76 A;  3NHI A;  2WCE A;  3R1P A;  1TCF A;  2LC5 A;  1XYD A;  1QXP A;  1EG4 A;  1NX2 A;  1SL7 A;  3M0W A;  2OTG C;  4M2Q A;  3D75 A;  2K2F A;  2WCJ A;  3E3R A;  1DEL A;  5CSF A;  2K7D A;  1CDN A;  4MBE A;  1PSB A;  1SBJ A;  3F45 A;  3EK4 A;  3GK1 A;  2GV5 A;  1EXR A;  2K0J A;  2ZRT A;  1Z4H A;  3CYZ A;  4FQO A;  4DIR A;  2AMI A;  2I7A A;  2MAZ A;  3I5H B;  1J7R A;  2M3W A;  2LAN A;  3CZ0 A;  3MSE B;  4OV2 A;  2LLT A;  1GM0 A;  1D1O A;  1MUX A;  2HF5 A;  1DVI A;  1IQ5 A;  4YI9 A;  1W7J B;  3EKH A;  4TNC A;  1TN4 A;  4PHK A;  3WHU B;  1MXL C;  3WHT B;  2KGB C;  4INW A;  1XK4 A;  2WCH A;  3PM2 A;  1P28 A;  4HRE E;  2P6B B;  1K2H A;  1DQE A;  2WC8 A;  4FTG A;  2JU0 A;  2KI6 C;  3BUO B;  1DJG A;  1CNP A;  2NCO A;  1C3Z A;  1TIZ A;  1F4O A;  1YX7 A;  2JNX A;  5GQQ C;  4U8D A;  2CCM A;  3OGN A;  1SW8 A;  3BUW B;  3KHE A;  1UUR A;  2KNE A;  2LVK A;  2M7N A;  1WLM A;  1LXF C;  1MHO A;  2MJW B;  3N7H A;  3DY9 A;  1NCX A;  5PAL A;  1ORG A;  1MWN A;  3CLN A;  1CFC A;  2KI4 B;  1CDM A;  2ZKM X;  1IKU A;  1W7I B;  5G08 A;  2ISD A;  2F3Z A;  4MRY A;  1JFJ A;  1CLB A;  1FBV A;  5AFP A;  4BY4 A;  3IQQ A;  3UO9 A;  3SJS A;  1OMV A;  1NWD A;  2EGD A;  1S36 A;  3CR5 X;  3DF0 A;  4C0J A;  1CKK A;  4GGF C;  1NX3 A;  2LVI A;  1JFK A;  2LVV A;  3UNW A;  4ETO A;  2MRD A;  3PFV A;  1DEK A;  1ZOT B;  1PAL A;  3QME A;  3RZS A;  4YGD B;  3GOF A;  1T14 A;  1WRL A;  2MA2 A;  1QX5 B;  1G33 A;  3LL8 B;  3S0E A;  3SIB A;  2G2B A;  1NSH A;  3TUY C;  4USL A;  3DZT A;  3VRQ A;  1PK0 D;  1A2X A;  4WRI A;  2JT3 A;  1JSA A;  1SL9 A;  3NGV A;  2MLF C;  1XVJ A;  3NXA A;  1NUB A;  3FE9 A;  1M39 A;  3I5I C;  1XFV O;  3SG2 A;  1HT9 A;  5KTY A;  1A03 A;  2OPO A;  1CM1 A;  1MF8 B;  3EK7 A;  3SS5 A;  4N1F A;  5I94 A;  4ICB A;  4YGA A;  2JNF A;  3H4S E;  4CID A;  3AKB A;  3CWG A;  1F4Q A;  4NDB A;  2KQ6 A;  3HCM A;  5CPV A;  1QV1 A;  4WQ3 A;  4M2O A;  4AQJ A;  1K8U A;  3SS3 A;  4C0K A;  4MZJ A;  3B86 A;  1C07 A;  2JWW A;  2FJU B;  1YTZ C;  2MBX A;  2BL0 C;  2KI6 D;  3O78 A;  4ORA B;  3D73 A;  3PN7 C;  4AQI A;  1F54 A;  2EC6 B;  3JTD C;  1J7O A;  2YGU A;  1YUS A;  5AEQ A;  3D10 A;  2KFG A;  1YRT B;  1IJ5 A;  1YR5 A;  1G4Y R;  1BLQ A;  4I5N B;  1OOJ A;  1FI5 A;  5AAN A;  1UUS A;  1GGZ A;  3I5G B;  3OB2 B;  1WY9 A;  1OMR A;  1DTL A;  3KF9 A;  2PYQ A;  4HRH A;  3TS5 B;  3ZNI A;  1PUL A;  5D7F A;  1F71 A;  1N65 A;  1BMO A;  3BFH A;  2V53 A;  1KK7 Z;  3AKA A;  3PJI A;  1KQM C;  1QAS A;  3KEV A;  3ZWH A;  3AAK A;  1Y1U A;  4MLW A;  5ER4 X;  2JXL A;  5FI2 A;  1QIW A;  4C0L A;  1DF0 B;  1CLL A;  1F70 A;  2OS8 B;  1LS8 A;  2LHI A;  4I5J A;  1UHJ A;  1V1G A;  3NHT A;  4PE4 A;  1S1E A;  3B87 A;  2RGI A;  3D0Y B;  3QRX A;  2KBI A;  1M31 A;  1VRK A;  4OCI A;  1OE9 B;  1TNQ A;  1OQP A;  1UHK A;  2HQW A;  3R1O A;  1DJZ A;  2LV7 A;  2O5G A;  2KSP A;  3D77 A;  1S5G Z;  1CDP A;  3EKJ A;  1B7T Z;  1DJH A;  1QX7 A;  1FPW A;  1PVB A;  1RWY A;  1AVS A;  3S0F A;  4I5K A;  1QAT A;  2M49 B;  1DGU A;  3S0B A;  1K9K A;  1KWO C;  1SCM B;  2LMT A;  3BOW B;  4YRU A;  3K21 A;  2LAP A;  4YGB B;  1HQV A;  1YRU B;  3S0G A;  2PMY A;  1JWD A;  1SR6 C;  2KBM A;  2BKI B;  1BOD A;  2CXJ A;  2NCP A;  1KQV A;  2BAP A;  4JD9 A;  1K9U A;  1TUJ A;  4DS7 A;  3FE8 A;  2JQ6 A;  4JKT A;  1Y0V H;  4CPV A;  3WXA A;  1BT6 A;  4PHM A;  4CFR A;  1SRA A;  3CS1 A;  2CBL A;  5HYD A;  5DIC A;  1Y1X A;  4ORB B;  1NP8 A;  2GGZ A;  3JVT C;  4OVN F;  1S6C A;  4CLN A;  1TTX A;  4XJK A;  3OP0 A;  3A8R A;  2NLN A;  1PSR A;  4XYN A;  1J1E A;  1IQ3 A;  2SAS A;  3NSI A;  4A4B A;  1F8H A;  3O4X A;  3GK2 A;  1SPY A;  3D78 A;  1H4B A;  3NSK A;  2L4I A;  2LLS A;  4QJ5 B;  2KAY A;  1REC A;  1BJF A;  1TWO A;  1V1F A;  1BF5 A;  1CDL A;  2LP3 A;  3OBV A;  2QEB A;  2KQY A;  3IQO A;  1LIN A;  3DVE A;  5FI6 A;  1B8R A;  1RRO A;  1WRK A;  3FIA A;  2BCA A;  1LKJ A;  4YI8 A;  3CZ1 A;  1C3Y A;  4OKH A;  3D74 A;  2M0R A;  3R1V A;  4ZCU A;  5JOL A;  4MRX A;  3O4Y A;  2H8V A;  3DXL A;  5KU1 A;  1IWQ A;  1ZMZ A;  1YUU A;  1LA3 A;  1SMG A;  2ZN9 A;  3CGA A;  3A4U B;  1KK7 Y;  2LE9 B;  2M9G A;  1BR4 B;  2K8M B;  2JPO A;  2WCF A;  5D3O A;  2L5Y A;  1NX1 A;  2L4H A;  1QTX A;  2A4J A;  5HLV A;  3SG3 A;  2BCB A;  4AOM A;  2Y1N A;  1F55 A;  2M1U A;  1JF2 A;  1QJT A;  3NSO A;  3L4A A;  4M2P A;  5KSZ A;  3HX4 A;  4FQT A;  1UHH A;  4HSZ A;  2KOT A;  2KI4 C;  1QS7 A;  1NCY A;  3D0Y A;  1CM4 A;  2CNP A;  3FE6 A;  1M63 B;  5AER A;  3DVK A;  5IBW A;  2VRG A;  1CB1 A;  2JTZ A;  4GBA A;  2KHN A;  1SL8 A;  3FWB A;  4QJ3 B;  4CFQ A;  1DMO A;  1B8L A;  1S5G Y;  4PE1 A;  1B4C A;  3BJH A;  2HQ8 A;  2BE4 A;  1A4P A;  1KK8 B;  1NCZ A;  2LMU A;  2WOS A;  2PQL A;  3L47 A;  2BKH B;  3O2P A;  1Q80 A;  3BXK A;  2FJY A;  3S0D A;  1EL4 A;  3CAB A;  1XA5 A;  1K96 A; 
#chains in the Genus database with same CATH homology
 1ZAC A;  3BOW A;  1L2O B;  2K7O A;  1BOC A;  1R6P A;  1IRJ A;  1SYM A;  1J55 A;  3SIA A;  1RK9 A;  1WDC B;  4A4C A;  3PN7 B;  1AHR A;  1JF0 A;  2KAV A;  4GNK B;  2EHB A;  1DJW A;  5BPJ A;  1DJY A;  2D8N A;  2FOT A;  1J7Q A;  2LCP A;  1RJV A;  2JPT A;  2ZRS A;  3FS7 A;  2K61 A;  1AUI B;  3I5F B;  5D69 A;  3VGO A;  1K94 A;  1FI6 A;  2DOQ A;  1XFU O;  1TCO B;  3BUX B;  2AUC A;  2JT8 A;  3OHM B;  2LNK A;  1BR1 B;  2FCE A;  2HPS A;  1IGV A;  4PDZ A;  3SG4 A;  1XFZ O;  1CFP A;  1OZO A;  3EVV A;  2BEC A;  1KFX S;  4UPG A;  2LUC A;  5DKN A;  1K90 D;  1AK8 A;  1AJ5 A;  2BBM A;  3LLE A;  1L7Z A;  2NXQ A;  1UHN A;  2L98 A;  1K95 A;  3CTN A;  5HKW A;  1J7P A;  1CFF A;  4JPZ B;  2NZ0 A;  3TZ1 A;  2E30 A;  4P2Y B;  3SG7 A;  1JUO A;  4JQ0 D;  3TS5 C;  1Y6W A;  3DF0 B;  4BY5 A;  1BU3 A;  1MXE A;  1KFU S;  2JXC A;  2QPT A;  2ZND A;  1IG5 A;  2R2I A;  2Q4U A;  1TRF A;  1LA0 A;  4R1E A;  3O6B A;  1KWO B;  1EH2 A;  4ZCV A;  2M7L A;  2M29 A;  4GAO A;  2OS8 C;  1K9P A;  1U5I B;  4NQG A;  5K89 A;  3PAT A;  1BG1 A;  2OTG B;  2LLU A;  3RLZ A;  3VRO A;  1QLS A;  1SCV A;  5B8I B;  1OZS A;  1QIV A;  1GGW A;  1UHI A;  3PLF B;  1ZUZ A;  3KPX A;  1DT7 B;  4GGN A;  2I2R E;  2BCX A;  2LM5 A;  1NIW A;  2LP2 A;  1WRZ A;  2Y4Q A;  4L9M A;  4WQ2 A;  5DKR A;  4MEW A;  4PCW A;  1SK6 D;  1TNW A;  3VRP A;  4JWQ A;  1SCM C;  2KGR A;  2I18 A;  2KAX A;  4OR9 B;  4IL1 A;  4YGC B;  5JJG A;  5DKQ A;  5I2O A;  4NDD A;  3OB1 B;  1XO5 A;  3EVU A;  1A29 A;  3TDZ A;  3BUN B;  3VRN A;  4DUQ A;  1KCY A;  1JC2 A;  1OMD A;  1AJ4 A;  1ALV A;  4NDC A;  4GUK A;  3BQ3 A;  3I5H C;  3DD4 A;  1GJY A;  4HRG A;  4GFT A;  4PHN A;  4D1E A;  3VRR A;  1B1G A;  1IH0 A;  1FW4 A;  1CTR A;  3PAL A;  1XFX O;  1QVI Z;  1S26 D;  1FF1 A;  3SG6 A;  2WOR A;  1N2D A;  1NPQ A;  2JOJ A;  2L5X B;  1Y1A A;  2L0P A;  2JUL A;  1UP5 A;  3DVJ A;  5I8N A;  2M8U A;  1X02 A;  2B1U A;  1C7V A;  1ODB A;  3BUM B;  1QLK A;  2O60 A;  5CSJ A;  4PE0 A;  2L50 A;  5HKY A;  3PSR A;  1E8A A;  2E6W A;  3NSL A;  3LK0 A;  3OX6 A;  1DGV A;  2L51 A;  5CSI A;  1DF0 A;  5FYX A;  1OSA A;  3OX5 A;  3TUY B;  1RFJ A;  2K7C A;  3BYA A;  2H61 A;  3DVM A;  3EVR A;  1AP4 A;  4PAL A;  5HLO A;  2PRU A;  1B9A A;  1A75 B;  2LVJ A;  1KFX L;  1S3P A;  2I94 A;  1MQ1 A;  2HET A;  3I5I B;  2LUX A;  2TN4 A;  1YX8 A;  2COL B;  4GPL B;  4MSP A;  1QV0 A;  2CT9 A;  2Y1M A;  1RTP 1;  2FCD A;  5ER5 A;  3FWC A;  4F0Z B;  1B7T Y;  2LHL A;  1CMF A;  1S6I A;  1CMG A;  1B8C A;  4YBH B;  2QAC A;  2BBN A;  1EG3 A;  2KFH A;  3CZT X;  1TOP A;  1YUT A;  1YVH A;  4Q04 A;  5HKZ A;  4DRW A;  1IJ6 A;  2JC2 A;  2F2P A;  3C1V A;  2Y5I A;  1QX2 A;  1U5I A;  2BL0 B;  2AAO A;  1KFU L;  1MR8 A;  1GQM A;  2Q91 A;  3JTD B;  1G8I A;  1ZFS A;  2GGM A;  1WLZ A;  5AXI A;  3SG5 A;  2G9B A;  2KYC A;  2JT0 A;  4MZK A;  1EJ3 A;  2CTN A;  2L2E A;  4XJK B;  4QJ4 B;  1LVC D;  2F33 A;  2IS9 A;  3LCP C;  2K7B A;  1J1D A;  4N5X A;  1KSM A;  4DCK A;  2JTT A;  1TNP A;  4P5O E;  3EK8 A;  1KK8 C;  2ZN8 A;  2KFF A;  2ZNE A;  1N0Y A;  1KQM B;  1SY9 A;  1L2O C;  1YVL A;  1S6J A;  3AAJ A;  3GK4 X;  1NX0 A;  2WCB A;  4YGE B;  1KSO A;  1WDC C;  4PHJ A;  1UWO A;  4ORC B;  2EC6 C;  1PRW A;  4MVF A;  2JZI A;  3IF7 A;  2F8P A;  1JBA A;  3I5F C;  2WND A;  2M1K B;  1XK4 C;  1ALW A;  2MHH A;  5I2L A;  1K93 D;  3I5G C;  2MLE C;  1M46 A;  1QVI Y;  5J3X A;  1XFY O;  3WNX B;  3TDI A;  5CSN A;  2LMV A;  4N1G A;  2K2A A;  1B47 A;  2KDH A;  1SKT A;  4MN0 A;  1H8B A;  3TDU A;  1CLM A;  1DJX A;  1M45 A;  2H2K A;  4GGF A;  1C7W A;  2PSR A;  5TNC A;  1SNL A;  3LK1 A;  2H61 C;  1PVA A;  1XFW O;  2SCP A;  2KYF A;  4I5L B;  2F3Y A;  3KO0 A;  1SR6 B;  5F6T A;  4PE7 A;  2PVB A;  4E68 A;  4MZL A;  2F2O A;  1YUR A;  3RM1 A;  5I2Q A;  3CR4 X;  1DJI A;  1TNX A;  1NYA A;  1A75 A;  2BE6 A;  3PM8 A;  2PAL A;  2ZFD A;  3JVT B;  2JRF A;  3CR2 A;  1R2U A;  1CFD A;  2M97 A;  3ICB A;  2PAS A;  2WCE A;  1TCF A;  2LC5 A;  1XYD A;  1QXP A;  1EG4 A;  1NX2 A;  1SL7 A;  3M0W A;  2OTG C;  4M2Q A;  2K2F A;  3E3R A;  5CSF A;  2K7D A;  1CDN A;  4MBE A;  1PSB A;  1SBJ A;  3F45 A;  3EK4 A;  3GK1 A;  2GV5 A;  1EXR A;  2K0J A;  2ZRT A;  4FQO A;  4DIR A;  2AMI A;  2I7A A;  2MAZ A;  3I5H B;  1J7R A;  2M3W A;  2LAN A;  3MSE B;  4OV2 A;  2LLT A;  1D1O A;  1MUX A;  2HF5 A;  1DVI A;  1IQ5 A;  4YI9 A;  1W7J B;  3EKH A;  4TNC A;  1TN4 A;  4PHK A;  3WHU B;  1MXL C;  3WHT B;  2KGB C;  1XK4 A;  4HRE E;  2P6B B;  1K2H A;  2WC8 A;  4FTG A;  2JU0 A;  2KI6 C;  3BUO B;  1DJG A;  1CNP A;  2NCO A;  1TIZ A;  1F4O A;  1YX7 A;  2JNX A;  5GQQ C;  4U8D A;  2CCM A;  1SW8 A;  3BUW B;  3KHE A;  1UUR A;  2KNE A;  2LVK A;  2M7N A;  1WLM A;  1LXF C;  1MHO A;  2MJW B;  5PAL A;  1NCX A;  1MWN A;  3CLN A;  1CFC A;  2KI4 B;  1CDM A;  2ZKM X;  1IKU A;  1W7I B;  5G08 A;  2ISD A;  2F3Z A;  4MRY A;  1JFJ A;  1CLB A;  1FBV A;  5AFP A;  4BY4 A;  3IQQ A;  3SJS A;  1OMV A;  1NWD A;  2EGD A;  1S36 A;  3CR5 X;  3DF0 A;  4C0J A;  1CKK A;  4GGF C;  1NX3 A;  2LVI A;  1JFK A;  2LVV A;  4ETO A;  2MRD A;  3PFV A;  1ZOT B;  1PAL A;  4YGD B;  3GOF A;  1WRL A;  2MA2 A;  3LL8 B;  1QX5 B;  1G33 A;  3SIB A;  2G2B A;  1NSH A;  3TUY C;  4USL A;  3VRQ A;  1PK0 D;  1A2X A;  4WRI A;  2JT3 A;  1JSA A;  1SL9 A;  2MLF C;  1XVJ A;  3NXA A;  1NUB A;  1M39 A;  3I5I C;  1XFV O;  3SG2 A;  1HT9 A;  5KTY A;  1A03 A;  2OPO A;  1CM1 A;  1MF8 B;  3EK7 A;  4N1F A;  4ICB A;  4YGA A;  2JNF A;  3H4S E;  4CID A;  3AKB A;  3CWG A;  1F4Q A;  4NDB A;  2KQ6 A;  3HCM A;  5CPV A;  1QV1 A;  4WQ3 A;  4M2O A;  4AQJ A;  1K8U A;  4C0K A;  4MZJ A;  1C07 A;  2JWW A;  2FJU B;  1YTZ C;  2MBX A;  2BL0 C;  2KI6 D;  3O78 A;  4ORA B;  3PN7 C;  4AQI A;  1F54 A;  2EC6 B;  3JTD C;  1J7O A;  1YUS A;  5AEQ A;  3D10 A;  2KFG A;  1YRT B;  1IJ5 A;  1YR5 A;  1G4Y R;  1BLQ A;  4I5N B;  1OOJ A;  1FI5 A;  5AAN A;  1UUS A;  1GGZ A;  3I5G B;  3OB2 B;  1WY9 A;  1OMR A;  1DTL A;  3KF9 A;  4HRH A;  3TS5 B;  3ZNI A;  1PUL A;  5D7F A;  1F71 A;  1N65 A;  1BMO A;  2V53 A;  1KK7 Z;  3AKA A;  1KQM C;  1QAS A;  3KEV A;  3ZWH A;  3AAK A;  1Y1U A;  4MLW A;  5ER4 X;  2JXL A;  1QIW A;  4C0L A;  1DF0 B;  1CLL A;  1F70 A;  2OS8 B;  2LHI A;  4I5J A;  1UHJ A;  1V1G A;  4PE4 A;  1S1E A;  2RGI A;  3D0Y B;  3QRX A;  2KBI A;  1M31 A;  1VRK A;  4OCI A;  1OE9 B;  1TNQ A;  1OQP A;  1UHK A;  2HQW A;  1DJZ A;  2LV7 A;  2O5G A;  2KSP A;  1S5G Z;  1CDP A;  3EKJ A;  1B7T Z;  1DJH A;  1QX7 A;  1FPW A;  1PVB A;  1RWY A;  1AVS A;  4I5K A;  1QAT A;  2M49 B;  1DGU A;  1K9K A;  1KWO C;  1SCM B;  2LMT A;  3BOW B;  4YRU A;  3K21 A;  2LAP A;  4YGB B;  1HQV A;  1YRU B;  2PMY A;  1JWD A;  1SR6 C;  2KBM A;  2BKI B;  1BOD A;  2CXJ A;  2NCP A;  1KQV A;  1K9U A;  4DS7 A;  2JQ6 A;  1Y0V H;  4CPV A;  3WXA A;  1BT6 A;  4PHM A;  4CFR A;  1SRA A;  3CS1 A;  2CBL A;  5HYD A;  1Y1X A;  4ORB B;  1NP8 A;  2GGZ A;  3JVT C;  4OVN F;  1S6C A;  4CLN A;  1TTX A;  4XJK A;  3OP0 A;  3A8R A;  2NLN A;  1PSR A;  4XYN A;  1J1E A;  1IQ3 A;  2SAS A;  3NSI A;  4A4B A;  1F8H A;  3GK2 A;  1SPY A;  1H4B A;  3NSK A;  2L4I A;  2LLS A;  4QJ5 B;  2KAY A;  1REC A;  1BJF A;  1V1F A;  1BF5 A;  1CDL A;  2LP3 A;  2KQY A;  3IQO A;  1LIN A;  3DVE A;  1B8R A;  1RRO A;  1WRK A;  3FIA A;  2BCA A;  1LKJ A;  4YI8 A;  4OKH A;  2M0R A;  4ZCU A;  5JOL A;  4MRX A;  3O4Y A;  5KU1 A;  1IWQ A;  1ZMZ A;  1YUU A;  1LA3 A;  1SMG A;  2ZN9 A;  3CGA A;  3A4U B;  1KK7 Y;  2LE9 B;  2M9G A;  1BR4 B;  2K8M B;  2WCF A;  1NX1 A;  2L4H A;  1QTX A;  2A4J A;  5HLV A;  3SG3 A;  2BCB A;  4AOM A;  2Y1N A;  1F55 A;  2M1U A;  1JF2 A;  1QJT A;  3NSO A;  4M2P A;  5KSZ A;  3HX4 A;  1UHH A;  4HSZ A;  2KOT A;  2KI4 C;  1QS7 A;  1NCY A;  3D0Y A;  1CM4 A;  2CNP A;  1M63 B;  5AER A;  3DVK A;  5IBW A;  2VRG A;  1CB1 A;  2JTZ A;  4GBA A;  2KHN A;  1SL8 A;  3FWB A;  4QJ3 B;  4CFQ A;  1DMO A;  1B8L A;  1S5G Y;  4PE1 A;  1B4C A;  2HQ8 A;  2BE4 A;  1A4P A;  1KK8 B;  1NCZ A;  2LMU A;  2WOS A;  3O2P A;  2BKH B;  1Q80 A;  3BXK A;  1EL4 A;  1XA5 A;  1K96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...