1TWOA

Nmr structure of the pheromone binding protein from antheraea polyphemus at acidic ph
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein
publication title Structural Consequences of the pH-induced Conformational Switch in A.polyphemus Pheromone-binding Protein: Mechanisms of Ligand Release
pubmed doi rcsb
source organism Antheraea polyphemus
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1twoA00
3B7AA 3NGVA 3B88A 3NHIA 3R1OA 3S0GA 2QEBA 3OGNA 1ORGA 1XFRA 3D77A 2QEHA 1TUJA 2WCMA 3D78A 3R72A 2P70A 3L47A 3RZSA 3B87A 2ERBA 3PJIA 3Q8IA 1QWVA 4FQTA 3S0EA 1C3YA 2L2CA 3DZTA 3D76A 1OOIX 1DQEA 3D74A 3BFBA 3CZ1A 3CZ2A 2WC6A 1OOFA 3DXLA 3R1PA 1GM0A 3BJHA 2GTEA 3FE6A 3S0DA 3N7HA 5DICA 3B86A 4F7FA 1TWOA 3DY9A 1OOGA 3L4LA 3S0BA 3QMEA 2FJYA 3S0AA 4JD9A 2H8VA 3FE9A 1C3ZA 3BFAA 3B6XA 3DYEA 4OZDA 3R1VA 2WCHA 2WC5A 2PQLA 3FE8A 2WCKA 1LS8A 3NHTA 1OOHA 3CDNA 3BFHA 3K1EA 1OW4A 2KPHA 3D73A 3VB1A 3L4AA 4INWA 1T14A 3CZ0A 2WCLA 3S0FA 4PT1A 3V2LA 2QDIA 4INXA 2QEOA 5EL2A 2P71A 3CYZA 2JPOA 1P28A 2QEVA 3CABA 2WCJA 3D75A
chains in the Genus database with same CATH superfamily
1NX1A 1QV0A 1CMGA 2VRGA 2ZN9A 3B7AA 4OR9B 4PDZA 2JC2A 1K9KA 3NHIA 4C0KA 5AANA 3VRRA 1WRZA 2COLB 3OGNA 1XVJA 4DIRA 4BY5A 2EGDA 1KK7Y 3D0YB 2E6WA 3WHUB 1N2DA 1B7TY 1RFJA 1DF0B 1GJYA 3L47A 4PHMA 4USLA 1C07A 1QASA 1UUSA 2ZFDA 1JFJA 1OZSA 1SCMB 1TCOB 3CZTX 3A4UB 3HX4A 3KHEA 3PATA 3VGOA 1DC1A 1C3YA 2LMUA 3EVVA 1V1FA 3D74A 2ZNDA 1IJ6A 2BE4A 2LLTA 1K9UA 3SS5A 2Y1NA 1SK6D 4GNKB 4YGDB 2WC6A 1PVAA 3R1PA 1RROA 1GM0A 3BJHA 5KU1A 1A2XA 1DJYA 1CLLA 2L98A 3JVTC 4MVFA 4XYNA 5DICA 2M3WA 1CLMA 2JNFA 2WORA 2CT9A 1YUSA 2KI4C 2RGIA 1DGVA 3I5IB 3O4YA 3QRXA 3L4LA 1A4PA 2WC8A 5I2QA 1SCVA 1F4QA 3VRNA 4QJ5B 2CNPA 3TS5B 2F2OA 1RJVA 3KPXA 5FI7A 1NX3A 2L5XB 2MAZA 5FYXA 2M0RA 3AAJA 3TS5C 1NUBA 4CLNA 2I94A 1SR6B 2NCOA 4JD9A 3OX6A 1B8RA 2K2FA 3DVJA 4ETOA 1DT7B 1A75B 4CIDA 3PLFB 1XK4A 3WHTB 1DTLA 2I2RE 3B6XA 1RWYA 1ZACA 2LLUA 3SS4A 3SG2A 2LMVA 1QIWA 1DJIA 1HT9A 2SCPA 4ZCVA 5BPJA 2CBLA 2I18A 4R1EA 1F54A 1IIOA 1NX0A 2LP2A 2WCEA 2MHHA 3GK2A 1LS8A 1KK7Z 3NHTA 3PM8A 2HQWA 4FTGA 1N65A 3I5GC 2JT8A 1CNPA 3EVRA 4I5JA 3EG5B 4MRYA 1BMOA 2P6BB 4OCIA 2KFHA 2KPHA 3D73A 3LK0A 5HL1A 2KLDA 1NCYA 3L4AA 1MF8B 4INWA 5CSFA 4A4BA 1QLSA 4AQIA 1CFCA 3EKHA 2BCBA 3GOFA 5CSJA 1NWDA 1C7WA 3ICBA 2CXJA 5DKNA 2F33A 1W9ZA 2NCPA 3JVTB 2ISDA 3AKAA 2QDIA 4INXA 1GQMA 3LLEA 5KTYA 4HSZA 2FJUB 2QEOA 2KAVA 4M2PA 1SL7A 1OZOA 2MLEC 1WDCC 2P71A 1AJ5A 1ZUZA 1CDPA 2KHNA 4GUKA 1JWDA 1M31A 2JPOA 2PALA 1IKUA 2Y5IA 1AP4A 3EKJA 1DJZA 3FIAA 3NGVA 3EK4A 5G08A 1Y0VH 1Y1UA 2FCEA 1CM1A 2K61A 1SL9A 1U5IA 1YUTA 2GGMA 2QEBA 3F45A 3IQQA 4ORBB 3S0GA 1UHNA 2KBMA 1K95A 1QATA 2LVJA 1TUJA 3CR4X 4PCWA 1CLBA 1M46A 1G4YR 2M97A 4PHNA 2JZIA 2ZRTA 3B87A 3UO9A 3PJIA 1OQPA 2EC6C 1QX2A 2A4JA 1R6PA 1L2OC 2M9GA 3Q8IA 2PRUA 2IS9A 2LP3A 1CDMA 2JULA 4FQTA 4PE1A 1CFPA 1FI5A 2AUCA 1LVCD 4GPLB 5HLOA 3S0EA 4BY4A 2KYCA 2ZNEA 3D10A 3DZTA 1DGUA 1AVSA 1SW8A 1TUZA 3D76A 1DQEA 5HLVA 2LVVA 4HRHA 4MZLA 1B47A 2LANA 4D1EA 1BODA 1PALA 1J55A 1SRAA 3CZ2A 1YX8A 1IQ3A 3CWGA 3DXLA 4Q04A 4GGFC 1Q80A 1RK9A 1ODBA 1GGZA 3FE6A 1GGWA 2KAYA 3N7HA 5ER5A 4JKTA 1J7QA 1K93D 2L51A 1J7OA 1K2HA 1NIWA 1FF1A 4KYNA 3C1VA 2FOTA 1XA5A 2BNXA 1ZFSA 1SY9A 1UHKA 4U8DA 1BR1B 4M2QA 1JF2A 2JNXA 1U5IB 1BU3A 2BE6A 2KI6D 3NXAA 1IQ5A 3OBVA 2M1KB 3QMEA 3SIAA 4PE4A 2JPTA 3O2PA 3VRQA 1LINA 4GGNA 1OOJA 2KOTA 4GGFA 2DOQA 1A75A 1WDCB 1EL4A 2I7AA 1C7VA 1WRLA 2LVKA 1F4OA 3BUMB 3IF7A 2V53A 1BR4B 2KBIA 1PSBA 2H8VA 3DVMA 3KEVA 4YGCB 2F8PA 2F3YA 2JTTA 3GK4X 2KAXA 1EH2A 3CGAA 4YBHB 5HYDA 1S6CA 1MUXA 2WCHA 3NSIA 2KI6C 4CFRA 1K9PA 3OB1B 4DS7A 4ORCB 4JQ0D 1B1GA 2KFGA 4N1GA 1W7JB 1TNPA 1AJ4A 2EC6B 1J1EA 3K1EA 1L2OB 1OW4A 1J1DA 1W7IB 2JWWA 3VB1A 1NP8A 4YRUA 4PALA 2M1UA 1T14A 3CZ0A 4PHJA 5J3XA 1XFZO 2AAOA 1F8HA 1ALVA 3I5FC 2K2AA 3SJSA 2WOSA 4GBAA 2YGUA 2EHBA 1MR8A 3CTNA 1FBVA 1MQ1A 2HETA 5FI2A 3S0FA 3BYAA 2LUXA 2OS8C 2JXLA 4I5KA 2KSPA 2OPOA 3RM1A 1NPQA 2BKIB 2L50A 4I5NB 3BUWB 2BECA 3CR2A 1D1OA 3NSKA 2MRDA 5HKWA 1B7TZ 1G33A 4N5XA 1IG5A 3TZ1A 5AERA 5D7FA 5K89A 2D8NA 4TNCA 2L2EA 1BLQA 2QEVA 3CABA 1DVIA 1FW4A 5AXIA 1KK8C 2NXQA 3AKBA 1BOCA 3B88A 5ER4X 3A8RA 3R1OA 5CPVA 4YGEB 1B9AA 3DD4A 1ORGA 2QACA 1OMDA 2K7DA 1HQVA 1QS7A 3D77A 2G9BA 3GK1A 4GAOA 2ZRSA 5AEQA 2M7LA 1KSMA 2KNEA 1VRKA 3D78A 1L7ZA 1S26D 1UHJA 3H4SE 3R72A 2MBXA 4CPVA 2P70A 3RZSA 1XFYO 2ERBA 4NDBA 1NCZA 1V1GA 2KI4B 2GGZA 2M49B 1OE9B 2L4HA 1KSOA 1UURA 3JTDC 4ORAB 4ZCUA 1AHRA 1DJWA 1PK0D 3EVUA 1H8BA 3I5HC 1SBJA 4CFQA 2FCDA 3DF0B 1NSHA 1YRUB 3BFBA 1CM4A 1TRFA 3CZ1A 3BUXB 3RLZA 2PYQA 3ZWHA 2BCAA 2Y1MA 3SG7A 2SASA 1NX2A 1WY9A 5GQQC 2BBNA 3AAKA 3TUYC 1KFUS 1SPYA 2LM5A 2OTGC 3TDIA 2GTEA 1B8CA 1Y1AA 3S0DA 1E8AA 4FQOA 3TDUA 3ZNIA 1LKJA 1ZMZA 1XFVO 3B86A 1WRKA 3I5FB 3OX5A 5PALA 4F7FA 2M29A 3FS7A 1S6IA 2F3ZA 2F2PA 4MLWA 1SNLA 1TWOA 5F6TA 1EJ3A 1OOGA 4MBEA 2OS8B 2JOJA 4WQ2A 5JOLA 2MA2A 2M7NA 3CLNA 1DJXA 2WCBA 2KQYA 3OP0A 1UHIA 3BUOB 3I5GB 3PN7C 2L5YA 4MEWA 2LVIA 3NSLA 1OSAA 2FJYA 1JBAA 1A03A 4YGAA 1Y1XA 3KF9A 1CMFA 2QPTA 1B8LA 3S0AA 3BXKA 1TNXA 1KK8B 5DKQA 1FPWA 1EG3A 1C3ZA 2CTNA 1TTXA 1F71A 1Y6WA 1PSRA 3DYEA 4OZDA 1JFKA 3I5IC 3R1VA 4MN0A 1CKKA 2NZ0A 2Y4QA 1UP5A 2BL0C 1R2UA 4AQJA 3OHMB 2KLEA 4YGBB 1OOHA 3CDNA 3EK8A 2HF5A 3CS1A 2BKHB 2G2BA 4OV2A 4IL1A 1IRJA 3I5HB 3SG5A 3PFVA 2WNDA 5CSNA 2BBMA 1UWOA 4C0JA 1LXFC 1CTRA 2KGBC 2B1UA 2K8MB 2E30A 2M8UA 4MZKA 1CFDA 1YURA 1YR5A 2PMYA 4C0LA 1SYMA 1CB1A 1LA3A 4XJKB 3EK7A 3TUYB 1N0YA 1M45A 3IVTA 2OTGB 5TNCA 2KYFA 4PT1A 3V2LA 2MJWB 2LAPA 1TNWA 4YI8A 5CSIA 1KFXS 2H2KA 1NYAA 3SS3A 1LA0A 4AOMA 3TDZA 4OVNF 1M63B 2O60A 5KSZA 1MWNA 1SSEB 2PVBA 4DUQA 3NSOA 4IJ7A 4NDCA 2JT0A 1F70A 2TN4A 2K60A 3CYZA 1BT6A 4F0ZB 2ZN8A 1KFUL 1PRWA 1WLZA 2H61C 1YX7A 1P28A 5HKYA 2BAPA 2NLNA 2WCJA 1IGVA 3D75A 3PN7B 1MHOA 2JXCA 4NDDA 4WRIA 1H4BA 2Q4UA 4ICBA 2LCPA 2LHIA 3M0WA 3O4XA 3SG6A 2JU0A 2MLFC 3BOWA 5FI6A 3WXAA 3O6BA 1RECA 3PM2A 1M39A 1XFRA 2GV5A 2K7OA 1SMGA 1A29A 2L0PA 2QEHA 1QX5B 3DVKA 2JQ6A 1JC2A 1ZOTB 1EXRA 2WCMA 3LK1A 5D3OA 5IBWA 1TCFA 3DF0A 1XK4C 2HPSA 2K7BA 2Q91A 2O5GA 2ZKMX 1AUIB 2H61A 4WQ3A 1QWVA 4MZJA 2BL0B 1XYDA 1TOPA 1K96A 1MXLC 1QTXA 3FWCA 2L2CA 4QJ3B 1KQVA 2AMIA 1OOIX 1YRTB 2CCMA 3SG4A 4A4CA 5I94A 5D69A 3PALA 1JSAA 2KDHA 1TN4A 1NCXA 1OOFA 1QIVA 1F55A 4PHKA 1YVLA 1CDNA 3HCMA 4UPGA 5JJGA 1IJ5A 4DCKA 5AFPA 1K94A 3KO0A 1S3PA 4DRWA 3BQ3A 1QVIY 1BF5A 4L9MA 4OKHA 1AK8A 1X02A 4MRXA 5I2OA 1S5GY 2KQ6A 2LUCA 3DY9A 1KQMC 3IQOA 3BOWB 4JPZB 4E68A 1B4CA 1KWOC 1QXPA 3S0BA 1ALWA 1J7PA 1IWQA 1JF0A 3WNXB 3E3RA 1Z4HA 2JTZA 1DMOA 1XFXO 4I5LB 1Z2CB 2L4IA 4MSPA 2LMTA 1BJFA 1DJHA 1J7RA 3SG3A 3PSRA 4HRGA 1K90D 1DELA 4QJ4B 1YVHA 4PE0A 1OMVA 4GFTA 1DJGA 3FE9A 3VROA 3BFAA 1SKTA 4PE7A 1KFXL 1TIZA 2KGRA 1QX7A 4JWQA 4HREE 1CDLA 3CR5X 1IH0A 2LNKA 2WC5A 2PQLA 3FE8A 3SIBA 2WCKA 1YUUA 2LE9B 5I8NA 1FI6A 1SCMC 3K21A 2LHLA 3BFHA 1PULA 1YTZC 1WLMA 1XFUO 1XFWO 2K7CA 4XJKA 2K0JA 2LC5A 2KFFA 3D0YA 4P2YB 5HKZA 2JT3A 1S36A 3FWBA 1S1EA 1TNQA 1G8IA 4N1FA 1DF0A 1RTP1 2PSRA 1MXEA 2WCFA 4YI9A 1QV1A 3LL8B 3OB2B 2WCLA 2BCXA 2JRFA 3UNWA 1CFFA 1UHHA 3BUNB 3DVEA 2LLSA 1DEKA 3O78A 4P5OE 5I2LA 1QVIZ 1OMRA 1PVBA 3LCPC 3MSEB 4NQGA 5DKRA 2PASA 5EL2A 1SL8A 1S6JA 1S5GZ 1KQMB 1QLKA 2HQ8A 4M2OA 2R2IA 1KWOB 1KCYA 5B8IB 1EG4A 3JTDB 1JUOA 1XO5A 1SR6C 1QJTA 1BG1A 2LV7A 1K8UA 3VRPA
chains in the Genus database with same CATH topology
3B7AA 3NGVA 3B88A 3NHIA 3R1OA 3S0GA 2QEBA 3OGNA 1ORGA 1XFRA 3D77A 2QEHA 1TUJA 2WCMA 3D78A 3R72A 2P70A 3L47A 3RZSA 3B87A 2ERBA 3PJIA 3Q8IA 1QWVA 4FQTA 3S0EA 1C3YA 2L2CA 3DZTA 3D76A 1OOIX 1DQEA 3D74A 3BFBA 3CZ1A 3CZ2A 2WC6A 1OOFA 3DXLA 3R1PA 1GM0A 3BJHA 2GTEA 3FE6A 3S0DA 3N7HA 5DICA 3B86A 4F7FA 1TWOA 3DY9A 1OOGA 3L4LA 3S0BA 3QMEA 2FJYA 3S0AA 4JD9A 2H8VA 3FE9A 1C3ZA 3BFAA 3B6XA 3DYEA 4OZDA 3R1VA 2WCHA 2WC5A 2PQLA 3FE8A 2WCKA 1LS8A 3NHTA 1OOHA 3CDNA 3BFHA 3K1EA 1OW4A 2KPHA 3D73A 3VB1A 3L4AA 4INWA 1T14A 3CZ0A 2WCLA 3S0FA 4PT1A 3V2LA 2QDIA 4INXA 2QEOA 5EL2A 2P71A 3CYZA 2JPOA 1P28A 2QEVA 3CABA 2WCJA 3D75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7A A;  3NGV A;  3B88 A;  3NHI A;  3R1O A;  3S0G A;  2QEB A;  3OGN A;  1ORG A;  1XFR A;  3D77 A;  2QEH A;  1TUJ A;  2WCM A;  3D78 A;  3R72 A;  2P70 A;  3L47 A;  3RZS A;  3B87 A;  2ERB A;  3PJI A;  3Q8I A;  1QWV A;  4FQT A;  3S0E A;  1C3Y A;  2L2C A;  3DZT A;  3D76 A;  1OOI X;  1DQE A;  3D74 A;  3BFB A;  3CZ1 A;  3CZ2 A;  2WC6 A;  1OOF A;  3DXL A;  3R1P A;  1GM0 A;  3BJH A;  2GTE A;  3FE6 A;  3S0D A;  3N7H A;  5DIC A;  3B86 A;  4F7F A;  1TWO A;  3DY9 A;  1OOG A;  3L4L A;  3S0B A;  3QME A;  2FJY A;  3S0A A;  4JD9 A;  2H8V A;  3FE9 A;  1C3Z A;  3BFA A;  3B6X A;  3DYE A;  4OZD A;  3R1V A;  2WCH A;  2WC5 A;  2PQL A;  3FE8 A;  2WCK A;  1LS8 A;  3NHT A;  1OOH A;  3CDN A;  3BFH A;  3K1E A;  1OW4 A;  2KPH A;  3D73 A;  3VB1 A;  3L4A A;  4INW A;  1T14 A;  3CZ0 A;  2WCL A;  3S0F A;  4PT1 A;  3V2L A;  2QDI A;  4INX A;  2QEO A;  5EL2 A;  2P71 A;  3CYZ A;  2JPO A;  1P28 A;  2QEV A;  3CAB A;  2WCJ A;  3D75 A; 
#chains in the Genus database with same CATH topology
 1NX1 A;  1QV0 A;  1CMG A;  2VRG A;  2ZN9 A;  3B7A A;  4OR9 B;  4PDZ A;  2JC2 A;  1K9K A;  3NHI A;  4C0K A;  5AAN A;  3VRR A;  1WRZ A;  2COL B;  3OGN A;  1XVJ A;  4DIR A;  4BY5 A;  2EGD A;  1KK7 Y;  3D0Y B;  2E6W A;  3WHU B;  1N2D A;  1B7T Y;  1RFJ A;  1DF0 B;  1GJY A;  3L47 A;  4PHM A;  4USL A;  1C07 A;  1QAS A;  1UUS A;  2ZFD A;  1JFJ A;  1OZS A;  1SCM B;  1TCO B;  3CZT X;  3A4U B;  3HX4 A;  3KHE A;  3PAT A;  3VGO A;  1DC1 A;  1C3Y A;  2LMU A;  3EVV A;  1V1F A;  3D74 A;  2ZND A;  1IJ6 A;  2BE4 A;  2LLT A;  1K9U A;  3SS5 A;  2Y1N A;  1SK6 D;  4GNK B;  4YGD B;  2WC6 A;  1PVA A;  3R1P A;  1RRO A;  1GM0 A;  3BJH A;  5KU1 A;  1A2X A;  1DJY A;  1CLL A;  2L98 A;  3JVT C;  4MVF A;  4XYN A;  5DIC A;  2M3W A;  1CLM A;  2JNF A;  2WOR A;  2CT9 A;  1YUS A;  2KI4 C;  2RGI A;  1DGV A;  3I5I B;  3O4Y A;  3QRX A;  3L4L A;  1A4P A;  2WC8 A;  5I2Q A;  1SCV A;  1F4Q A;  3VRN A;  4QJ5 B;  2CNP A;  3TS5 B;  2F2O A;  1RJV A;  3KPX A;  5FI7 A;  1NX3 A;  2L5X B;  2MAZ A;  5FYX A;  2M0R A;  3AAJ A;  3TS5 C;  1NUB A;  4CLN A;  2I94 A;  1SR6 B;  2NCO A;  4JD9 A;  3OX6 A;  1B8R A;  2K2F A;  3DVJ A;  4ETO A;  1DT7 B;  1A75 B;  4CID A;  3PLF B;  1XK4 A;  3WHT B;  1DTL A;  2I2R E;  3B6X A;  1RWY A;  1ZAC A;  2LLU A;  3SS4 A;  3SG2 A;  2LMV A;  1QIW A;  1DJI A;  1HT9 A;  2SCP A;  4ZCV A;  5BPJ A;  2CBL A;  2I18 A;  4R1E A;  1F54 A;  1IIO A;  1NX0 A;  2LP2 A;  2WCE A;  2MHH A;  3GK2 A;  1LS8 A;  1KK7 Z;  3NHT A;  3PM8 A;  2HQW A;  4FTG A;  1N65 A;  3I5G C;  2JT8 A;  1CNP A;  3EVR A;  4I5J A;  3EG5 B;  4MRY A;  1BMO A;  2P6B B;  4OCI A;  2KFH A;  2KPH A;  3D73 A;  3LK0 A;  5HL1 A;  2KLD A;  1NCY A;  3L4A A;  1MF8 B;  4INW A;  5CSF A;  4A4B A;  1QLS A;  4AQI A;  1CFC A;  3EKH A;  2BCB A;  3GOF A;  5CSJ A;  1NWD A;  1C7W A;  3ICB A;  2CXJ A;  5DKN A;  2F33 A;  1W9Z A;  2NCP A;  3JVT B;  2ISD A;  3AKA A;  2QDI A;  4INX A;  1GQM A;  3LLE A;  5KTY A;  4HSZ A;  2FJU B;  2QEO A;  2KAV A;  4M2P A;  1SL7 A;  1OZO A;  2MLE C;  1WDC C;  2P71 A;  1AJ5 A;  1ZUZ A;  1CDP A;  2KHN A;  4GUK A;  1JWD A;  1M31 A;  2JPO A;  2PAL A;  1IKU A;  2Y5I A;  1AP4 A;  3EKJ A;  1DJZ A;  3FIA A;  3NGV A;  3EK4 A;  5G08 A;  1Y0V H;  1Y1U A;  2FCE A;  1CM1 A;  2K61 A;  1SL9 A;  1U5I A;  1YUT A;  2GGM A;  2QEB A;  3F45 A;  3IQQ A;  4ORB B;  3S0G A;  1UHN A;  2KBM A;  1K95 A;  1QAT A;  2LVJ A;  1TUJ A;  3CR4 X;  4PCW A;  1CLB A;  1M46 A;  1G4Y R;  2M97 A;  4PHN A;  2JZI A;  2ZRT A;  3B87 A;  3UO9 A;  3PJI A;  1OQP A;  2EC6 C;  1QX2 A;  2A4J A;  1R6P A;  1L2O C;  2M9G A;  3Q8I A;  2PRU A;  2IS9 A;  2LP3 A;  1CDM A;  2JUL A;  4FQT A;  4PE1 A;  1CFP A;  1FI5 A;  2AUC A;  1LVC D;  4GPL B;  5HLO A;  3S0E A;  4BY4 A;  2KYC A;  2ZNE A;  3D10 A;  3DZT A;  1DGU A;  1AVS A;  1SW8 A;  1TUZ A;  3D76 A;  1DQE A;  5HLV A;  2LVV A;  4HRH A;  4MZL A;  1B47 A;  2LAN A;  4D1E A;  1BOD A;  1PAL A;  1J55 A;  1SRA A;  3CZ2 A;  1YX8 A;  1IQ3 A;  3CWG A;  3DXL A;  4Q04 A;  4GGF C;  1Q80 A;  1RK9 A;  1ODB A;  1GGZ A;  3FE6 A;  1GGW A;  2KAY A;  3N7H A;  5ER5 A;  4JKT A;  1J7Q A;  1K93 D;  2L51 A;  1J7O A;  1K2H A;  1NIW A;  1FF1 A;  4KYN A;  3C1V A;  2FOT A;  1XA5 A;  2BNX A;  1ZFS A;  1SY9 A;  1UHK A;  4U8D A;  1BR1 B;  4M2Q A;  1JF2 A;  2JNX A;  1U5I B;  1BU3 A;  2BE6 A;  2KI6 D;  3NXA A;  1IQ5 A;  3OBV A;  2M1K B;  3QME A;  3SIA A;  4PE4 A;  2JPT A;  3O2P A;  3VRQ A;  1LIN A;  4GGN A;  1OOJ A;  2KOT A;  4GGF A;  2DOQ A;  1A75 A;  1WDC B;  1EL4 A;  2I7A A;  1C7V A;  1WRL A;  2LVK A;  1F4O A;  3BUM B;  3IF7 A;  2V53 A;  1BR4 B;  2KBI A;  1PSB A;  2H8V A;  3DVM A;  3KEV A;  4YGC B;  2F8P A;  2F3Y A;  2JTT A;  3GK4 X;  2KAX A;  1EH2 A;  3CGA A;  4YBH B;  5HYD A;  1S6C A;  1MUX A;  2WCH A;  3NSI A;  2KI6 C;  4CFR A;  1K9P A;  3OB1 B;  4DS7 A;  4ORC B;  4JQ0 D;  1B1G A;  2KFG A;  4N1G A;  1W7J B;  1TNP A;  1AJ4 A;  2EC6 B;  1J1E A;  3K1E A;  1L2O B;  1OW4 A;  1J1D A;  1W7I B;  2JWW A;  3VB1 A;  1NP8 A;  4YRU A;  4PAL A;  2M1U A;  1T14 A;  3CZ0 A;  4PHJ A;  5J3X A;  1XFZ O;  2AAO A;  1F8H A;  1ALV A;  3I5F C;  2K2A A;  3SJS A;  2WOS A;  4GBA A;  2YGU A;  2EHB A;  1MR8 A;  3CTN A;  1FBV A;  1MQ1 A;  2HET A;  5FI2 A;  3S0F A;  3BYA A;  2LUX A;  2OS8 C;  2JXL A;  4I5K A;  2KSP A;  2OPO A;  3RM1 A;  1NPQ A;  2BKI B;  2L50 A;  4I5N B;  3BUW B;  2BEC A;  3CR2 A;  1D1O A;  3NSK A;  2MRD A;  5HKW A;  1B7T Z;  1G33 A;  4N5X A;  1IG5 A;  3TZ1 A;  5AER A;  5D7F A;  5K89 A;  2D8N A;  4TNC A;  2L2E A;  1BLQ A;  2QEV A;  3CAB A;  1DVI A;  1FW4 A;  5AXI A;  1KK8 C;  2NXQ A;  3AKB A;  1BOC A;  3B88 A;  5ER4 X;  3A8R A;  3R1O A;  5CPV A;  4YGE B;  1B9A A;  3DD4 A;  1ORG A;  2QAC A;  1OMD A;  2K7D A;  1HQV A;  1QS7 A;  3D77 A;  2G9B A;  3GK1 A;  4GAO A;  2ZRS A;  5AEQ A;  2M7L A;  1KSM A;  2KNE A;  1VRK A;  3D78 A;  1L7Z A;  1S26 D;  1UHJ A;  3H4S E;  3R72 A;  2MBX A;  4CPV A;  2P70 A;  3RZS A;  1XFY O;  2ERB A;  4NDB A;  1NCZ A;  1V1G A;  2KI4 B;  2GGZ A;  2M49 B;  1OE9 B;  2L4H A;  1KSO A;  1UUR A;  3JTD C;  4ORA B;  4ZCU A;  1AHR A;  1DJW A;  1PK0 D;  3EVU A;  1H8B A;  3I5H C;  1SBJ A;  4CFQ A;  2FCD A;  3DF0 B;  1NSH A;  1YRU B;  3BFB A;  1CM4 A;  1TRF A;  3CZ1 A;  3BUX B;  3RLZ A;  2PYQ A;  3ZWH A;  2BCA A;  2Y1M A;  3SG7 A;  2SAS A;  1NX2 A;  1WY9 A;  5GQQ C;  2BBN A;  3AAK A;  3TUY C;  1KFU S;  1SPY A;  2LM5 A;  2OTG C;  3TDI A;  2GTE A;  1B8C A;  1Y1A A;  3S0D A;  1E8A A;  4FQO A;  3TDU A;  3ZNI A;  1LKJ A;  1ZMZ A;  1XFV O;  3B86 A;  1WRK A;  3I5F B;  3OX5 A;  5PAL A;  4F7F A;  2M29 A;  3FS7 A;  1S6I A;  2F3Z A;  2F2P A;  4MLW A;  1SNL A;  1TWO A;  5F6T A;  1EJ3 A;  1OOG A;  4MBE A;  2OS8 B;  2JOJ A;  4WQ2 A;  5JOL A;  2MA2 A;  2M7N A;  3CLN A;  1DJX A;  2WCB A;  2KQY A;  3OP0 A;  1UHI A;  3BUO B;  3I5G B;  3PN7 C;  2L5Y A;  4MEW A;  2LVI A;  3NSL A;  1OSA A;  2FJY A;  1JBA A;  1A03 A;  4YGA A;  1Y1X A;  3KF9 A;  1CMF A;  2QPT A;  1B8L A;  3S0A A;  3BXK A;  1TNX A;  1KK8 B;  5DKQ A;  1FPW A;  1EG3 A;  1C3Z A;  2CTN A;  1TTX A;  1F71 A;  1Y6W A;  1PSR A;  3DYE A;  4OZD A;  1JFK A;  3I5I C;  3R1V A;  4MN0 A;  1CKK A;  2NZ0 A;  2Y4Q A;  1UP5 A;  2BL0 C;  1R2U A;  4AQJ A;  3OHM B;  2KLE A;  4YGB B;  1OOH A;  3CDN A;  3EK8 A;  2HF5 A;  3CS1 A;  2BKH B;  2G2B A;  4OV2 A;  4IL1 A;  1IRJ A;  3I5H B;  3SG5 A;  3PFV A;  2WND A;  5CSN A;  2BBM A;  1UWO A;  4C0J A;  1LXF C;  1CTR A;  2KGB C;  2B1U A;  2K8M B;  2E30 A;  2M8U A;  4MZK A;  1CFD A;  1YUR A;  1YR5 A;  2PMY A;  4C0L A;  1SYM A;  1CB1 A;  1LA3 A;  4XJK B;  3EK7 A;  3TUY B;  1N0Y A;  1M45 A;  3IVT A;  2OTG B;  5TNC A;  2KYF A;  4PT1 A;  3V2L A;  2MJW B;  2LAP A;  1TNW A;  4YI8 A;  5CSI A;  1KFX S;  2H2K A;  1NYA A;  3SS3 A;  1LA0 A;  4AOM A;  3TDZ A;  4OVN F;  1M63 B;  2O60 A;  5KSZ A;  1MWN A;  1SSE B;  2PVB A;  4DUQ A;  3NSO A;  4IJ7 A;  4NDC A;  2JT0 A;  1F70 A;  2TN4 A;  2K60 A;  3CYZ A;  1BT6 A;  4F0Z B;  2ZN8 A;  1KFU L;  1PRW A;  1WLZ A;  2H61 C;  1YX7 A;  1P28 A;  5HKY A;  2BAP A;  2NLN A;  2WCJ A;  1IGV A;  3D75 A;  3PN7 B;  1MHO A;  2JXC A;  4NDD A;  4WRI A;  1H4B A;  2Q4U A;  4ICB A;  2LCP A;  2LHI A;  3M0W A;  3O4X A;  3SG6 A;  2JU0 A;  2MLF C;  3BOW A;  5FI6 A;  3WXA A;  3O6B A;  1REC A;  3PM2 A;  1M39 A;  1XFR A;  2GV5 A;  2K7O A;  1SMG A;  1A29 A;  2L0P A;  2QEH A;  1QX5 B;  3DVK A;  2JQ6 A;  1JC2 A;  1ZOT B;  1EXR A;  2WCM A;  3LK1 A;  5D3O A;  5IBW A;  1TCF A;  3DF0 A;  1XK4 C;  2HPS A;  2K7B A;  2Q91 A;  2O5G A;  2ZKM X;  1AUI B;  2H61 A;  4WQ3 A;  1QWV A;  4MZJ A;  2BL0 B;  1XYD A;  1TOP A;  1K96 A;  1MXL C;  1QTX A;  3FWC A;  2L2C A;  4QJ3 B;  1KQV A;  2AMI A;  1OOI X;  1YRT B;  2CCM A;  3SG4 A;  4A4C A;  5I94 A;  5D69 A;  3PAL A;  1JSA A;  2KDH A;  1TN4 A;  1NCX A;  1OOF A;  1QIV A;  1F55 A;  4PHK A;  1YVL A;  1CDN A;  3HCM A;  4UPG A;  5JJG A;  1IJ5 A;  4DCK A;  5AFP A;  1K94 A;  3KO0 A;  1S3P A;  4DRW A;  3BQ3 A;  1QVI Y;  1BF5 A;  4L9M A;  4OKH A;  1AK8 A;  1X02 A;  4MRX A;  5I2O A;  1S5G Y;  2KQ6 A;  2LUC A;  3DY9 A;  1KQM C;  3IQO A;  3BOW B;  4JPZ B;  4E68 A;  1B4C A;  1KWO C;  1QXP A;  3S0B A;  1ALW A;  1J7P A;  1IWQ A;  1JF0 A;  3WNX B;  3E3R A;  1Z4H A;  2JTZ A;  1DMO A;  1XFX O;  4I5L B;  1Z2C B;  2L4I A;  4MSP A;  2LMT A;  1BJF A;  1DJH A;  1J7R A;  3SG3 A;  3PSR A;  4HRG A;  1K90 D;  1DEL A;  4QJ4 B;  1YVH A;  4PE0 A;  1OMV A;  4GFT A;  1DJG A;  3FE9 A;  3VRO A;  3BFA A;  1SKT A;  4PE7 A;  1KFX L;  1TIZ A;  2KGR A;  1QX7 A;  4JWQ A;  4HRE E;  1CDL A;  3CR5 X;  1IH0 A;  2LNK A;  2WC5 A;  2PQL A;  3FE8 A;  3SIB A;  2WCK A;  1YUU A;  2LE9 B;  5I8N A;  1FI6 A;  1SCM C;  3K21 A;  2LHL A;  3BFH A;  1PUL A;  1YTZ C;  1WLM A;  1XFU O;  1XFW O;  2K7C A;  4XJK A;  2K0J A;  2LC5 A;  2KFF A;  3D0Y A;  4P2Y B;  5HKZ A;  2JT3 A;  1S36 A;  3FWB A;  1S1E A;  1TNQ A;  1G8I A;  4N1F A;  1DF0 A;  1RTP 1;  2PSR A;  1MXE A;  2WCF A;  4YI9 A;  1QV1 A;  3LL8 B;  3OB2 B;  2WCL A;  2BCX A;  2JRF A;  3UNW A;  1CFF A;  1UHH A;  3BUN B;  3DVE A;  2LLS A;  1DEK A;  3O78 A;  4P5O E;  5I2L A;  1QVI Z;  1OMR A;  1PVB A;  3LCP C;  3MSE B;  4NQG A;  5DKR A;  2PAS A;  5EL2 A;  1SL8 A;  1S6J A;  1S5G Z;  1KQM B;  1QLK A;  2HQ8 A;  4M2O A;  2R2I A;  1KWO B;  1KCY A;  5B8I B;  1EG4 A;  3JTD B;  1JUO A;  1XO5 A;  1SR6 C;  1QJT A;  1BG1 A;  2LV7 A;  1K8U A;  3VRP A; 
#chains in the Genus database with same CATH homology
 3B7A A;  3NGV A;  3B88 A;  3NHI A;  3R1O A;  3S0G A;  2QEB A;  3OGN A;  1ORG A;  1XFR A;  3D77 A;  2QEH A;  1TUJ A;  2WCM A;  3D78 A;  3R72 A;  2P70 A;  3L47 A;  3RZS A;  3B87 A;  2ERB A;  3PJI A;  3Q8I A;  1QWV A;  4FQT A;  3S0E A;  1C3Y A;  2L2C A;  3DZT A;  3D76 A;  1OOI X;  1DQE A;  3D74 A;  3BFB A;  3CZ1 A;  3CZ2 A;  2WC6 A;  1OOF A;  3DXL A;  3R1P A;  1GM0 A;  3BJH A;  2GTE A;  3FE6 A;  3S0D A;  3N7H A;  5DIC A;  3B86 A;  4F7F A;  1TWO A;  3DY9 A;  1OOG A;  3L4L A;  3S0B A;  3QME A;  2FJY A;  3S0A A;  4JD9 A;  2H8V A;  3FE9 A;  1C3Z A;  3BFA A;  3B6X A;  3DYE A;  4OZD A;  3R1V A;  2WCH A;  2WC5 A;  2PQL A;  3FE8 A;  2WCK A;  1LS8 A;  3NHT A;  1OOH A;  3CDN A;  3BFH A;  3K1E A;  1OW4 A;  2KPH A;  3D73 A;  3VB1 A;  3L4A A;  4INW A;  1T14 A;  3CZ0 A;  2WCL A;  3S0F A;  4PT1 A;  3V2L A;  2QDI A;  4INX A;  2QEO A;  5EL2 A;  2P71 A;  3CYZ A;  2JPO A;  1P28 A;  2QEV A;  3CAB A;  2WCJ A;  3D75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...