1TWOA

Nmr structure of the pheromone binding protein from antheraea polyphemus at acidic ph
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Structural Consequences of the pH-induced Conformational Switch in A.polyphemus Pheromone-binding Protein: Mechanisms of Ligand Release
pubmed doi rcsb
source organism Antheraea polyphemus
molecule tags Pheromone binding protein
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1twoA00
3CZ0A 2WC6A 2ERBA 5EL2A 3R1OA 3V2LA 2FJYA 1GM0A 2WCKA 3D78A 3N7HA 1OOGA 2WCJA 3S0AA 3FE8A 2L2CA 3CABA 2QEBA 3L47A 3BFHA 3VB1A 1TWOA 1OOIX 3S0DA 1C3ZA 3CZ2A 3D74A 1QWVA 3B87A 3CDNA 3DY9A 2QEHA 3BFBA 4JD9A 3D77A 3FE9A 3B7AA 3BFAA 3DYEA 4INWA 3B88A 5DICA 1P28A 3OGNA 3PJIA 1LS8A 3DXLA 3NHIA 2P70A 3RZSA 1TUJA 3S0FA 1OOHA 2KPHA 3R1VA 3L4LA 2PQLA 1C3YA 3QMEA 1OW4A 2JPOA 3NGVA 2WCHA 3FE6A 3B6XA 2P71A 4F7FA 3CYZA 2GTEA 2QEVA 1ORGA 3NHTA 3R1PA 3D76A 2WCLA 1XFRA 1T14A 3K1EA 3S0EA 3D75A 3D73A 2QEOA 3B86A 3S0GA 3S0BA 4FQTA 3Q8IA 4INXA 1OOFA 2WC5A 3DZTA 3BJHA 2QDIA 2WCMA 1DQEA 4PT1A 2H8VA 3CZ1A 3L4AA 3R72A 4OZDA
chains in the Genus database with same CATH superfamily
1SKTA 1YUTA 5HLVA 3O78A 1KWOB 1K94A 2CT9A 5G08A 2MRDA 2KBIA 1DJYA 1DTLA 2LUXA 3PSRA 2WC6A 4FTGA 3D0YB 2JC2A 2ERBA 2KSPA 2SCPA 4R1EA 2LP2A 2LUCA 3KF9A 2G9BA 3OHMB 3R1OA 5HKYA 2OTGB 3D10A 1B7TY 2LLUA 3V2LA 2HPSA 2FJYA 4C0KA 3OB1B 1DJIA 1AP4A 2Y5IA 3I5IC 2KNEA 1SR6C 1QLSA 3UNWA 5BPJA 2E30A 1GQMA 5CSJA 1OOGA 2MLFC 2HQWA 1GGWA 1Z4HA 3SS5A 3DF0A 3BUNB 4PE0A 1CDNA 3RM1A 2JWWA 3AKAA 4DRWA 1TWOA 3TDZA 1F8HA 1JFKA 2K7CA 5HYDA 3LLEA 1CM4A 5I94A 2BAPA 3D74A 4HRGA 5CSFA 3EG5B 3B87A 1X02A 2YGUA 3IQOA 2CBLA 3CLNA 3CDNA 5D3OA 3DY9A 1DEKA 4MZJA 1J7PA 1Y1AA 1MF8B 1QX5B 2LVJA 5ER5A 3I5FB 1OOJA 2LHIA 2I94A 2JU0A 4GGFC 2ZRSA 3CR5X 2BE6A 5DKRA 4A4CA 2KQ6A 1KCYA 4KYNA 4USLA 1CLLA 1NPQA 4ZCUA 1L2OB 2PALA 3BUMB 3TS5C 4CPVA 1N0YA 2FCEA 1Y1XA 2JT0A 4YGBB 3JVTC 4TNCA 1CLMA 1DF0B 4OR9B 2WCFA 3DVEA 3JTDC 5AXIA 3VRQA 1W7IB 1BF5A 1TRFA 2LP3A 3RZSA 1IQ3A 1M46A 2IS9A 3PN7B 4CIDA 2M97A 1SCVA 2BCAA 2HF5A 2Y4QA 4I5NB 2KPHA 5HL1A 5ER4X 2L51A 2PQLA 1F71A 1XFWO 1IQ5A 1KFXS 1NX2A 3TS5B 1JC2A 1OW4A 3BOWA 3EVRA 2K0JA 3NGVA 1UURA 4N1GA 1Y0VH 1L7ZA 4N1FA 4QJ3B 2L5XB 4WRIA 4F7FA 4CLNA 2M0RA 1ZFSA 4P2YB 3CYZA 1QASA 1WDCB 2L5YA 1XVJA 2BECA 2Q4UA 1Y1UA 2QEVA 1A2XA 4PHJA 5KU1A 3M0WA 1EXRA 1CM1A 1OMDA 4NDCA 1DVIA 1J7RA 1KK8C 1KK7Z 1RROA 2LVKA 3LK0A 4PE4A 1A75B 2LCPA 5D69A 1AJ4A 1YUUA 3O6BA 2HQ8A 3HX4A 3KEVA 4U8DA 2G2BA 3LL8B 5KTYA 1DMOA 3S0BA 4FQTA 2MHHA 1SW8A 2WOSA 5HKWA 3FS7A 1DJWA 3OBVA 2AAOA 2WC5A 4OKHA 1BR1B 1SMGA 3FWCA 1QVIY 2L50A 2QDIA 2WCMA 3VRNA 3FWBA 3NSLA 2KLDA 4PT1A 2I2RE 1YTZC 3R72A 1S6IA 1YRTB 3CR4X 1PRWA 3VRPA 3E3RA 1AHRA 1ODBA 2ZFDA 1KSOA 3A4UB 4PE1A 4WQ3A 1JF2A 2H61C 1C7WA 1TNWA 1WLMA 1K9KA 2A4JA 2CNPA 3SG6A 2H2KA 2CCMA 3BUWB 1CB1A 2JNFA 3EK8A 3KHEA 2ZKMX 2MBXA 1BLQA 1SL8A 2AUCA 2Y1MA 4XJKB 5AANA 1J1DA 2MA2A 3SG5A 1M45A 1RK9A 5EL2A 1JSAA 1S5GZ 4OVNF 1OMVA 2K8MB 2WORA 1K96A 4P5OE 4YGCB 4MZLA 1CLBA 3ZNIA 3I5HB 1GM0A 3DVJA 4JPZB 2L98A 2WCKA 3D78A 1CTRA 3N7HA 1CDMA 2WCJA 2KOTA 3CABA 2QEBA 3TUYC 2M1KB 5AEQA 1UHNA 3CTNA 2OTGC 1HQVA 2NLNA 3PLFB 4XYNA 4C0JA 1KFUL 3TZ1A 1M39A 2K60A 1TNQA 3SS3A 1QWVA 1NCXA 2KI4B 3NSOA 2QEHA 3TUYB 2FOTA 1Y6WA 1RECA 5TNCA 2KHNA 3CWGA 1NUBA 1QS7A 1S26D 2JPTA 1AUIB 2KBMA 2KDHA 2O5GA 1K9PA 3BFAA 3F45A 3H4SE 3O4XA 4GBAA 4GGFA 4INWA 3B88A 2LLTA 5DICA 3LK1A 3OGNA 3PJIA 4PDZA 2LAPA 1A03A 3DXLA 3SIAA 1LVCD 1TCFA 3NHIA 2M1UA 3NXAA 4HRHA 2K7BA 3I5FC 1LA3A 1CFCA 1KQVA 1M63B 3CR2A 2JOJA 1IIOA 1IRJA 2PASA 2BBNA 1OOHA 1GJYA 1DJZA 4I5JA 4ICBA 1L2OC 2LC5A 1RWYA 2F3YA 3GK4X 4ZCVA 3SG4A 1BG1A 1IKUA 2F33A 2WC8A 3VROA 3AAJA 1QJTA 2K7DA 4L9MA 1VRKA 2KI6D 3WHUB 1YR5A 1TIZA 3PN7C 1PULA 1G33A 2GGZA 4OV2A 1B8LA 2OS8B 5AFPA 2LMTA 5HKZA 1ALWA 2GTEA 3DD4A 2KFGA 1PVBA 1SCMB 2KYCA 4MSPA 5DKQA 1CMFA 1KSMA 1S3PA 4GFTA 5I2OA 2PRUA 1G4YR 1NSHA 1PALA 1RFJA 1XFRA 3S0EA 1G8IA 4YI8A 3EVUA 3ZWHA 2JZIA 2QEOA 2JTZA 1FI6A 3S0GA 1W9ZA 1A29A 1WDCC 1RJVA 3PFVA 1S6CA 4IL1A 4YRUA 2BCBA 2O60A 3DVMA 2PVBA 3Q8IA 1PVAA 1QV0A 4F0ZB 1W7JB 1WLZA 1B1GA 4AOMA 4ETOA 1S1EA 1F4OA 2KGRA 3DZTA 3BJHA 5CPVA 4UPGA 3EKHA 5B8IB 1MUXA 4MLWA 1U5IA 1Q80A 2L2EA 4MRXA 3WNXB 2VRGA 1N65A 3EKJA 2H8VA 3L4AA 1OQPA 1XO5A 1XYDA 4M2QA 4M2OA 3FIAA 1B8RA 1NX0A 2BCXA 4GNKB 4XJKA 1R6PA 1QLKA 1SL7A 1CFFA 1GGZA 3PM8A 1CDLA 1IGVA 2MAZA 5FI6A 4CFRA 1TCOB 2EC6B 2H61A 1IWQA 3EVVA 1TN4A 3DF0B 3IQQA 1YRUB 2BL0B 3BYAA 3TDUA 2FCDA 1NCYA 2CTNA 2M29A 4MBEA 1KK7Y 3VGOA 1SYMA 1QIVA 5CSNA 5KSZA 1UP5A 4HSZA 4AQIA 5JJGA 4PHNA 1B4CA 4MN0A 1SSEB 4MVFA 3O2PA 1S36A 2BNXA 5DKNA 3UO9A 1FF1A 1DJXA 3ICBA 4DUQA 2AMIA 2WCEA 2L0PA 3S0AA 3FE8A 2NZ0A 3L47A 1C7VA 2LANA 3D0YA 2M9GA 3BFHA 1JFJA 1IH0A 4YGDB 3VB1A 1OZOA 5I2LA 1OOIX 2JULA 1FPWA 1NIWA 1XK4C 3NSIA 3I5HC 3BQ3A 4GAOA 3S0DA 1BT6A 3CZ2A 5K89A 3SS4A 1FI5A 1IG5A 1OE9B 1WY9A 4NDBA 1EL4A 2LE9B 2M3WA 3WHTB 1NX1A 1LXFC 4JD9A 1DT7B 1ZMZA 3FE9A 3B7AA 1MQ1A 3GK2A 3SJSA 1QX2A 2D8NA 1N2DA 1B47A 1YX7A 2RGIA 1TOPA 2GV5A 1BODA 1FBVA 3BOWB 3KO0A 1S6JA 2NCOA 2ZRTA 2CXJA 2KI4C 3VRRA 1NWDA 1KFUS 1OMRA 4MRYA 4PHKA 1XFYO 5F6TA 4D1EA 1S5GY 1SY9A 1JBAA 1MXEA 2ISDA 5I2QA 1TUJA 1OSAA 2PMYA 3OX6A 3S0FA 2R2IA 4GPLB 1CMGA 1K9UA 3I5GC 2JQ6A 1E8AA 3AAKA 2KFHA 3L4LA 4PCWA 1YURA 2PYQA 1C3YA 1UHKA 3CGAA 3QMEA 2FJUB 2F2OA 2MJWB 4PALA 2JPOA 1IJ5A 1K93D 1TUZA 4NDDA 3BXKA 2WCHA 1QX7A 1DF0A 1K95A 1A4PA 2P71A 5PALA 1FW4A 2QACA 1UHJA 1YUSA 3I5GB 1KQMB 2KYFA 1SNLA 3CS1A 4PHMA 2BBMA 2JTTA 3SIBA 1XFXO 2LV7A 2JNXA 4DIRA 1ORGA 3BUOB 3RLZA 2K61A 1CKKA 1F55A 1B7TZ 3EK4A 2I18A 2L4HA 2ZN9A 2QPTA 3OX5A 1J7OA 2WCLA 2I7AA 2L4IA 2M49B 1BJFA 3EK7A 1EG3A 1CFPA 2OS8C 3B86A 1CFDA 3OB2B 4MZKA 4YGAA 1EJ3A 4NQGA 1ZUZA 5J3XA 4QJ4B 2ZN8A 1SCMC 5IBWA 4OCIA 2P6BB 1XA5A 2JRFA 2KFFA 1V1GA 2Y1NA 1WRKA 4E68A 2KAXA 2JXLA 4GUKA 1BMOA 1UHHA 1HT9A 3IVTA 1AK8A 1NYAA 1A75A 1DQEA 1SK6D 2EGDA 4FQOA 2COLB 2WCBA 1JUOA 3MSEB 4BY5A 3SG7A 4OZDA 1QXPA 1MXLC 4DCKA 1UUSA 1DJGA 1BOCA 3PATA 2E6WA 1AJ5A 2JT3A 4JKTA 3CZ0A 3I5IB 1SR6B 2JT8A 4Q04A 1CDPA 1LINA 4A4BA 1AVSA 1MR8A 4AQJA 2MLEC 4PE7A 3GOFA 2NCPA 1NCZA 2DOQA 1LA0A 2F2PA 2EC6C 1BU3A 1NP8A 1ALVA 1BR4B 5FI7A 3K21A 4I5KA 1QATA 2BL0C 3O4YA 4MEWA 2L2CA 1C07A 3A8RA 1EH2A 3PALA 1V1FA 3C1VA 1TNPA 5I8NA 1K2HA 1SL9A 3CZTX 3IF7A 2LNKA 1C3ZA 2LMVA 4N5XA 1XK4A 1CNPA 5HLOA 2JXCA 2LHLA 4BY4A 1XFUO 3JVTB 3BFBA 1KFXL 3JTDB 2BKIB 3D77A 4ORAB 2K2AA 1TTXA 3GK1A 2LVIA 1JWDA 2M7LA 1J1EA 4DS7A 1F4QA 3DYEA 3WXAA 3SG2A 1WRLA 1P28A 1QV1A 1ZACA 2M8UA 3OP0A 1LS8A 2OPOA 4CFQA 1DGVA 1RTP1 2KLEA 2P70A 2M7NA 2PSRA 1SBJA 1QIWA 1J7QA 2NXQA 1PK0D 1QVIZ 1XFZO 4M2PA 4QJ5B 4ORBB 2HETA 4ORCB 1SPYA 3R1VA 1UHIA 4JQ0D 2BE4A 5GQQC 5JOLA 1XFVO 1MHOA 3HCMA 1F70A 1UWOA 1YX8A 1KK8B 3LCPC 3QRXA 2F8PA 1DELA 3AKBA 3FE6A 2BKHB 3B6XA 4GGNA 1TNXA 2LMUA 2EHBA 4HREE 1H4BA 2ZNDA 2TN4A 1QTXA 5AERA 4C0LA 2LLSA 3NSKA 1D1OA 2V53A 1OZSA 1WRZA 5CSIA 1YVLA 1PSBA 1YVHA 2K2FA 4WQ2A 4YBHB 3NHTA 3SG3A 2KGBC 2ZNEA 1U5IB 1J55A 2B1UA 3R1PA 3D76A 2SASA 1MWNA 2KAYA 1T14A 3DVKA 3K1EA 3KPXA 1B8CA 1M31A 3D73A 1SRAA 3D75A 4YGEB 2WNDA 1KQMC 1ZOTB 1DC1A 3TDIA 4YI9A 1NX3A 1K8UA 1H8BA 1PSRA 2LVVA 1DGUA 4INXA 1OOFA 1DJHA 2KI6C 1KWOC 4IJ7A 1R2UA 2Q91A 2KQYA 1B9AA 2F3ZA 3PM2A 1EG4A 2LM5A 5FI2A 4I5LB 1IJ6A 4JWQA 1K90D 1F54A 3CZ1A 2GGMA 2K7OA 1JF0A 5FYXA 1Z2CB 5D7FA 1LKJA 2KAVA 3BUXB
chains in the Genus database with same CATH topology
3CZ0A 2WC6A 2ERBA 5EL2A 3R1OA 3V2LA 2FJYA 1GM0A 2WCKA 3D78A 3N7HA 1OOGA 2WCJA 3S0AA 3FE8A 2L2CA 3CABA 2QEBA 3L47A 3BFHA 3VB1A 1TWOA 1OOIX 3S0DA 1C3ZA 3CZ2A 3D74A 1QWVA 3B87A 3CDNA 3DY9A 2QEHA 3BFBA 4JD9A 3D77A 3FE9A 3B7AA 3BFAA 3DYEA 4INWA 3B88A 5DICA 1P28A 3OGNA 3PJIA 1LS8A 3DXLA 3NHIA 2P70A 3RZSA 1TUJA 3S0FA 1OOHA 2KPHA 3R1VA 3L4LA 2PQLA 1C3YA 3QMEA 1OW4A 2JPOA 3NGVA 2WCHA 3FE6A 3B6XA 2P71A 4F7FA 3CYZA 2GTEA 2QEVA 1ORGA 3NHTA 3R1PA 3D76A 2WCLA 1XFRA 1T14A 3K1EA 3S0EA 3D75A 3D73A 2QEOA 3B86A 3S0GA 3S0BA 4FQTA 3Q8IA 4INXA 1OOFA 2WC5A 3DZTA 3BJHA 2QDIA 2WCMA 1DQEA 4PT1A 2H8VA 3CZ1A 3L4AA 3R72A 4OZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  2WC6 A;  2ERB A;  5EL2 A;  3R1O A;  3V2L A;  2FJY A;  1GM0 A;  2WCK A;  3D78 A;  3N7H A;  1OOG A;  2WCJ A;  3S0A A;  3FE8 A;  2L2C A;  3CAB A;  2QEB A;  3L47 A;  3BFH A;  3VB1 A;  1TWO A;  1OOI X;  3S0D A;  1C3Z A;  3CZ2 A;  3D74 A;  1QWV A;  3B87 A;  3CDN A;  3DY9 A;  2QEH A;  3BFB A;  4JD9 A;  3D77 A;  3FE9 A;  3B7A A;  3BFA A;  3DYE A;  4INW A;  3B88 A;  5DIC A;  1P28 A;  3OGN A;  3PJI A;  1LS8 A;  3DXL A;  3NHI A;  2P70 A;  3RZS A;  1TUJ A;  3S0F A;  1OOH A;  2KPH A;  3R1V A;  3L4L A;  2PQL A;  1C3Y A;  3QME A;  1OW4 A;  2JPO A;  3NGV A;  2WCH A;  3FE6 A;  3B6X A;  2P71 A;  4F7F A;  3CYZ A;  2GTE A;  2QEV A;  1ORG A;  3NHT A;  3R1P A;  3D76 A;  2WCL A;  1XFR A;  1T14 A;  3K1E A;  3S0E A;  3D75 A;  3D73 A;  2QEO A;  3B86 A;  3S0G A;  3S0B A;  4FQT A;  3Q8I A;  4INX A;  1OOF A;  2WC5 A;  3DZT A;  3BJH A;  2QDI A;  2WCM A;  1DQE A;  4PT1 A;  2H8V A;  3CZ1 A;  3L4A A;  3R72 A;  4OZD A; 
#chains in the Genus database with same CATH topology
 1SKT A;  1YUT A;  5HLV A;  3O78 A;  1KWO B;  1K94 A;  2CT9 A;  5G08 A;  2MRD A;  2KBI A;  1DJY A;  1DTL A;  2LUX A;  3PSR A;  2WC6 A;  4FTG A;  3D0Y B;  2JC2 A;  2ERB A;  2KSP A;  2SCP A;  4R1E A;  2LP2 A;  2LUC A;  3KF9 A;  2G9B A;  3OHM B;  3R1O A;  5HKY A;  2OTG B;  3D10 A;  1B7T Y;  2LLU A;  3V2L A;  2HPS A;  2FJY A;  4C0K A;  3OB1 B;  1DJI A;  1AP4 A;  2Y5I A;  3I5I C;  2KNE A;  1SR6 C;  1QLS A;  3UNW A;  5BPJ A;  2E30 A;  1GQM A;  5CSJ A;  1OOG A;  2MLF C;  2HQW A;  1GGW A;  1Z4H A;  3SS5 A;  3DF0 A;  3BUN B;  4PE0 A;  1CDN A;  3RM1 A;  2JWW A;  3AKA A;  4DRW A;  1TWO A;  3TDZ A;  1F8H A;  1JFK A;  2K7C A;  5HYD A;  3LLE A;  1CM4 A;  5I94 A;  2BAP A;  3D74 A;  4HRG A;  5CSF A;  3EG5 B;  3B87 A;  1X02 A;  2YGU A;  3IQO A;  2CBL A;  3CLN A;  3CDN A;  5D3O A;  3DY9 A;  1DEK A;  4MZJ A;  1J7P A;  1Y1A A;  1MF8 B;  1QX5 B;  2LVJ A;  5ER5 A;  3I5F B;  1OOJ A;  2LHI A;  2I94 A;  2JU0 A;  4GGF C;  2ZRS A;  3CR5 X;  2BE6 A;  5DKR A;  4A4C A;  2KQ6 A;  1KCY A;  4KYN A;  4USL A;  1CLL A;  1NPQ A;  4ZCU A;  1L2O B;  2PAL A;  3BUM B;  3TS5 C;  4CPV A;  1N0Y A;  2FCE A;  1Y1X A;  2JT0 A;  4YGB B;  3JVT C;  4TNC A;  1CLM A;  1DF0 B;  4OR9 B;  2WCF A;  3DVE A;  3JTD C;  5AXI A;  3VRQ A;  1W7I B;  1BF5 A;  1TRF A;  2LP3 A;  3RZS A;  1IQ3 A;  1M46 A;  2IS9 A;  3PN7 B;  4CID A;  2M97 A;  1SCV A;  2BCA A;  2HF5 A;  2Y4Q A;  4I5N B;  2KPH A;  5HL1 A;  5ER4 X;  2L51 A;  2PQL A;  1F71 A;  1XFW O;  1IQ5 A;  1KFX S;  1NX2 A;  3TS5 B;  1JC2 A;  1OW4 A;  3BOW A;  3EVR A;  2K0J A;  3NGV A;  1UUR A;  4N1G A;  1Y0V H;  1L7Z A;  4N1F A;  4QJ3 B;  2L5X B;  4WRI A;  4F7F A;  4CLN A;  2M0R A;  1ZFS A;  4P2Y B;  3CYZ A;  1QAS A;  1WDC B;  2L5Y A;  1XVJ A;  2BEC A;  2Q4U A;  1Y1U A;  2QEV A;  1A2X A;  4PHJ A;  5KU1 A;  3M0W A;  1EXR A;  1CM1 A;  1OMD A;  4NDC A;  1DVI A;  1J7R A;  1KK8 C;  1KK7 Z;  1RRO A;  2LVK A;  3LK0 A;  4PE4 A;  1A75 B;  2LCP A;  5D69 A;  1AJ4 A;  1YUU A;  3O6B A;  2HQ8 A;  3HX4 A;  3KEV A;  4U8D A;  2G2B A;  3LL8 B;  5KTY A;  1DMO A;  3S0B A;  4FQT A;  2MHH A;  1SW8 A;  2WOS A;  5HKW A;  3FS7 A;  1DJW A;  3OBV A;  2AAO A;  2WC5 A;  4OKH A;  1BR1 B;  1SMG A;  3FWC A;  1QVI Y;  2L50 A;  2QDI A;  2WCM A;  3VRN A;  3FWB A;  3NSL A;  2KLD A;  4PT1 A;  2I2R E;  1YTZ C;  3R72 A;  1S6I A;  1YRT B;  3CR4 X;  1PRW A;  3VRP A;  3E3R A;  1AHR A;  1ODB A;  2ZFD A;  1KSO A;  3A4U B;  4PE1 A;  4WQ3 A;  1JF2 A;  2H61 C;  1C7W A;  1TNW A;  1WLM A;  1K9K A;  2A4J A;  2CNP A;  3SG6 A;  2H2K A;  2CCM A;  3BUW B;  1CB1 A;  2JNF A;  3EK8 A;  3KHE A;  2ZKM X;  2MBX A;  1BLQ A;  1SL8 A;  2AUC A;  2Y1M A;  4XJK B;  5AAN A;  1J1D A;  2MA2 A;  3SG5 A;  1M45 A;  1RK9 A;  5EL2 A;  1JSA A;  1S5G Z;  4OVN F;  1OMV A;  2K8M B;  2WOR A;  1K96 A;  4P5O E;  4YGC B;  4MZL A;  1CLB A;  3ZNI A;  3I5H B;  1GM0 A;  3DVJ A;  4JPZ B;  2L98 A;  2WCK A;  3D78 A;  1CTR A;  3N7H A;  1CDM A;  2WCJ A;  2KOT A;  3CAB A;  2QEB A;  3TUY C;  2M1K B;  5AEQ A;  1UHN A;  3CTN A;  2OTG C;  1HQV A;  2NLN A;  3PLF B;  4XYN A;  4C0J A;  1KFU L;  3TZ1 A;  1M39 A;  2K60 A;  1TNQ A;  3SS3 A;  1QWV A;  1NCX A;  2KI4 B;  3NSO A;  2QEH A;  3TUY B;  2FOT A;  1Y6W A;  1REC A;  5TNC A;  2KHN A;  3CWG A;  1NUB A;  1QS7 A;  1S26 D;  2JPT A;  1AUI B;  2KBM A;  2KDH A;  2O5G A;  1K9P A;  3BFA A;  3F45 A;  3H4S E;  3O4X A;  4GBA A;  4GGF A;  4INW A;  3B88 A;  2LLT A;  5DIC A;  3LK1 A;  3OGN A;  3PJI A;  4PDZ A;  2LAP A;  1A03 A;  3DXL A;  3SIA A;  1LVC D;  1TCF A;  3NHI A;  2M1U A;  3NXA A;  4HRH A;  2K7B A;  3I5F C;  1LA3 A;  1CFC A;  1KQV A;  1M63 B;  3CR2 A;  2JOJ A;  1IIO A;  1IRJ A;  2PAS A;  2BBN A;  1OOH A;  1GJY A;  1DJZ A;  4I5J A;  4ICB A;  1L2O C;  2LC5 A;  1RWY A;  2F3Y A;  3GK4 X;  4ZCV A;  3SG4 A;  1BG1 A;  1IKU A;  2F33 A;  2WC8 A;  3VRO A;  3AAJ A;  1QJT A;  2K7D A;  4L9M A;  1VRK A;  2KI6 D;  3WHU B;  1YR5 A;  1TIZ A;  3PN7 C;  1PUL A;  1G33 A;  2GGZ A;  4OV2 A;  1B8L A;  2OS8 B;  5AFP A;  2LMT A;  5HKZ A;  1ALW A;  2GTE A;  3DD4 A;  2KFG A;  1PVB A;  1SCM B;  2KYC A;  4MSP A;  5DKQ A;  1CMF A;  1KSM A;  1S3P A;  4GFT A;  5I2O A;  2PRU A;  1G4Y R;  1NSH A;  1PAL A;  1RFJ A;  1XFR A;  3S0E A;  1G8I A;  4YI8 A;  3EVU A;  3ZWH A;  2JZI A;  2QEO A;  2JTZ A;  1FI6 A;  3S0G A;  1W9Z A;  1A29 A;  1WDC C;  1RJV A;  3PFV A;  1S6C A;  4IL1 A;  4YRU A;  2BCB A;  2O60 A;  3DVM A;  2PVB A;  3Q8I A;  1PVA A;  1QV0 A;  4F0Z B;  1W7J B;  1WLZ A;  1B1G A;  4AOM A;  4ETO A;  1S1E A;  1F4O A;  2KGR A;  3DZT A;  3BJH A;  5CPV A;  4UPG A;  3EKH A;  5B8I B;  1MUX A;  4MLW A;  1U5I A;  1Q80 A;  2L2E A;  4MRX A;  3WNX B;  2VRG A;  1N65 A;  3EKJ A;  2H8V A;  3L4A A;  1OQP A;  1XO5 A;  1XYD A;  4M2Q A;  4M2O A;  3FIA A;  1B8R A;  1NX0 A;  2BCX A;  4GNK B;  4XJK A;  1R6P A;  1QLK A;  1SL7 A;  1CFF A;  1GGZ A;  3PM8 A;  1CDL A;  1IGV A;  2MAZ A;  5FI6 A;  4CFR A;  1TCO B;  2EC6 B;  2H61 A;  1IWQ A;  3EVV A;  1TN4 A;  3DF0 B;  3IQQ A;  1YRU B;  2BL0 B;  3BYA A;  3TDU A;  2FCD A;  1NCY A;  2CTN A;  2M29 A;  4MBE A;  1KK7 Y;  3VGO A;  1SYM A;  1QIV A;  5CSN A;  5KSZ A;  1UP5 A;  4HSZ A;  4AQI A;  5JJG A;  4PHN A;  1B4C A;  4MN0 A;  1SSE B;  4MVF A;  3O2P A;  1S36 A;  2BNX A;  5DKN A;  3UO9 A;  1FF1 A;  1DJX A;  3ICB A;  4DUQ A;  2AMI A;  2WCE A;  2L0P A;  3S0A A;  3FE8 A;  2NZ0 A;  3L47 A;  1C7V A;  2LAN A;  3D0Y A;  2M9G A;  3BFH A;  1JFJ A;  1IH0 A;  4YGD B;  3VB1 A;  1OZO A;  5I2L A;  1OOI X;  2JUL A;  1FPW A;  1NIW A;  1XK4 C;  3NSI A;  3I5H C;  3BQ3 A;  4GAO A;  3S0D A;  1BT6 A;  3CZ2 A;  5K89 A;  3SS4 A;  1FI5 A;  1IG5 A;  1OE9 B;  1WY9 A;  4NDB A;  1EL4 A;  2LE9 B;  2M3W A;  3WHT B;  1NX1 A;  1LXF C;  4JD9 A;  1DT7 B;  1ZMZ A;  3FE9 A;  3B7A A;  1MQ1 A;  3GK2 A;  3SJS A;  1QX2 A;  2D8N A;  1N2D A;  1B47 A;  1YX7 A;  2RGI A;  1TOP A;  2GV5 A;  1BOD A;  1FBV A;  3BOW B;  3KO0 A;  1S6J A;  2NCO A;  2ZRT A;  2CXJ A;  2KI4 C;  3VRR A;  1NWD A;  1KFU S;  1OMR A;  4MRY A;  4PHK A;  1XFY O;  5F6T A;  4D1E A;  1S5G Y;  1SY9 A;  1JBA A;  1MXE A;  2ISD A;  5I2Q A;  1TUJ A;  1OSA A;  2PMY A;  3OX6 A;  3S0F A;  2R2I A;  4GPL B;  1CMG A;  1K9U A;  3I5G C;  2JQ6 A;  1E8A A;  3AAK A;  2KFH A;  3L4L A;  4PCW A;  1YUR A;  2PYQ A;  1C3Y A;  1UHK A;  3CGA A;  3QME A;  2FJU B;  2F2O A;  2MJW B;  4PAL A;  2JPO A;  1IJ5 A;  1K93 D;  1TUZ A;  4NDD A;  3BXK A;  2WCH A;  1QX7 A;  1DF0 A;  1K95 A;  1A4P A;  2P71 A;  5PAL A;  1FW4 A;  2QAC A;  1UHJ A;  1YUS A;  3I5G B;  1KQM B;  2KYF A;  1SNL A;  3CS1 A;  4PHM A;  2BBM A;  2JTT A;  3SIB A;  1XFX O;  2LV7 A;  2JNX A;  4DIR A;  1ORG A;  3BUO B;  3RLZ A;  2K61 A;  1CKK A;  1F55 A;  1B7T Z;  3EK4 A;  2I18 A;  2L4H A;  2ZN9 A;  2QPT A;  3OX5 A;  1J7O A;  2WCL A;  2I7A A;  2L4I A;  2M49 B;  1BJF A;  3EK7 A;  1EG3 A;  1CFP A;  2OS8 C;  3B86 A;  1CFD A;  3OB2 B;  4MZK A;  4YGA A;  1EJ3 A;  4NQG A;  1ZUZ A;  5J3X A;  4QJ4 B;  2ZN8 A;  1SCM C;  5IBW A;  4OCI A;  2P6B B;  1XA5 A;  2JRF A;  2KFF A;  1V1G A;  2Y1N A;  1WRK A;  4E68 A;  2KAX A;  2JXL A;  4GUK A;  1BMO A;  1UHH A;  1HT9 A;  3IVT A;  1AK8 A;  1NYA A;  1A75 A;  1DQE A;  1SK6 D;  2EGD A;  4FQO A;  2COL B;  2WCB A;  1JUO A;  3MSE B;  4BY5 A;  3SG7 A;  4OZD A;  1QXP A;  1MXL C;  4DCK A;  1UUS A;  1DJG A;  1BOC A;  3PAT A;  2E6W A;  1AJ5 A;  2JT3 A;  4JKT A;  3CZ0 A;  3I5I B;  1SR6 B;  2JT8 A;  4Q04 A;  1CDP A;  1LIN A;  4A4B A;  1AVS A;  1MR8 A;  4AQJ A;  2MLE C;  4PE7 A;  3GOF A;  2NCP A;  1NCZ A;  2DOQ A;  1LA0 A;  2F2P A;  2EC6 C;  1BU3 A;  1NP8 A;  1ALV A;  1BR4 B;  5FI7 A;  3K21 A;  4I5K A;  1QAT A;  2BL0 C;  3O4Y A;  4MEW A;  2L2C A;  1C07 A;  3A8R A;  1EH2 A;  3PAL A;  1V1F A;  3C1V A;  1TNP A;  5I8N A;  1K2H A;  1SL9 A;  3CZT X;  3IF7 A;  2LNK A;  1C3Z A;  2LMV A;  4N5X A;  1XK4 A;  1CNP A;  5HLO A;  2JXC A;  2LHL A;  4BY4 A;  1XFU O;  3JVT B;  3BFB A;  1KFX L;  3JTD B;  2BKI B;  3D77 A;  4ORA B;  2K2A A;  1TTX A;  3GK1 A;  2LVI A;  1JWD A;  2M7L A;  1J1E A;  4DS7 A;  1F4Q A;  3DYE A;  3WXA A;  3SG2 A;  1WRL A;  1P28 A;  1QV1 A;  1ZAC A;  2M8U A;  3OP0 A;  1LS8 A;  2OPO A;  4CFQ A;  1DGV A;  1RTP 1;  2KLE A;  2P70 A;  2M7N A;  2PSR A;  1SBJ A;  1QIW A;  1J7Q A;  2NXQ A;  1PK0 D;  1QVI Z;  1XFZ O;  4M2P A;  4QJ5 B;  4ORB B;  2HET A;  4ORC B;  1SPY A;  3R1V A;  1UHI A;  4JQ0 D;  2BE4 A;  5GQQ C;  5JOL A;  1XFV O;  1MHO A;  3HCM A;  1F70 A;  1UWO A;  1YX8 A;  1KK8 B;  3LCP C;  3QRX A;  2F8P A;  1DEL A;  3AKB A;  3FE6 A;  2BKH B;  3B6X A;  4GGN A;  1TNX A;  2LMU A;  2EHB A;  4HRE E;  1H4B A;  2ZND A;  2TN4 A;  1QTX A;  5AER A;  4C0L A;  2LLS A;  3NSK A;  1D1O A;  2V53 A;  1OZS A;  1WRZ A;  5CSI A;  1YVL A;  1PSB A;  1YVH A;  2K2F A;  4WQ2 A;  4YBH B;  3NHT A;  3SG3 A;  2KGB C;  2ZNE A;  1U5I B;  1J55 A;  2B1U A;  3R1P A;  3D76 A;  2SAS A;  1MWN A;  2KAY A;  1T14 A;  3DVK A;  3K1E A;  3KPX A;  1B8C A;  1M31 A;  3D73 A;  1SRA A;  3D75 A;  4YGE B;  2WND A;  1KQM C;  1ZOT B;  1DC1 A;  3TDI A;  4YI9 A;  1NX3 A;  1K8U A;  1H8B A;  1PSR A;  2LVV A;  1DGU A;  4INX A;  1OOF A;  1DJH A;  2KI6 C;  1KWO C;  4IJ7 A;  1R2U A;  2Q91 A;  2KQY A;  1B9A A;  2F3Z A;  3PM2 A;  1EG4 A;  2LM5 A;  5FI2 A;  4I5L B;  1IJ6 A;  4JWQ A;  1K90 D;  1F54 A;  3CZ1 A;  2GGM A;  2K7O A;  1JF0 A;  5FYX A;  1Z2C B;  5D7F A;  1LKJ A;  2KAV A;  3BUX B; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  2WC6 A;  2ERB A;  5EL2 A;  3R1O A;  3V2L A;  2FJY A;  1GM0 A;  2WCK A;  3D78 A;  3N7H A;  1OOG A;  2WCJ A;  3S0A A;  3FE8 A;  2L2C A;  3CAB A;  2QEB A;  3L47 A;  3BFH A;  3VB1 A;  1TWO A;  1OOI X;  3S0D A;  1C3Z A;  3CZ2 A;  3D74 A;  1QWV A;  3B87 A;  3CDN A;  3DY9 A;  2QEH A;  3BFB A;  4JD9 A;  3D77 A;  3FE9 A;  3B7A A;  3BFA A;  3DYE A;  4INW A;  3B88 A;  5DIC A;  1P28 A;  3OGN A;  3PJI A;  1LS8 A;  3DXL A;  3NHI A;  2P70 A;  3RZS A;  1TUJ A;  3S0F A;  1OOH A;  2KPH A;  3R1V A;  3L4L A;  2PQL A;  1C3Y A;  3QME A;  1OW4 A;  2JPO A;  3NGV A;  2WCH A;  3FE6 A;  3B6X A;  2P71 A;  4F7F A;  3CYZ A;  2GTE A;  2QEV A;  1ORG A;  3NHT A;  3R1P A;  3D76 A;  2WCL A;  1XFR A;  1T14 A;  3K1E A;  3S0E A;  3D75 A;  3D73 A;  2QEO A;  3B86 A;  3S0G A;  3S0B A;  4FQT A;  3Q8I A;  4INX A;  1OOF A;  2WC5 A;  3DZT A;  3BJH A;  2QDI A;  2WCM A;  1DQE A;  4PT1 A;  2H8V A;  3CZ1 A;  3L4A A;  3R72 A;  4OZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...