1GJYA

The x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
MDPLYGYFASVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLNPQTVNSIAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSAQQGMVNFSYDDFIQCVMTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title The Crystal Structure of the Sorcin Calcium Binding Domain Provides a Model of Ca(2+)-Dependent Processes in the Full-Length Protein
pubmed doi rcsb
molecule tags Calcium binding
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gjyA00
4PE4A 2ZNEA 2EGDA 1YX8A 1YVLA 2Q91A 3GOFA 5F6TA 3CR5X 4GBAA 2KYFA 1CLMA 1RJVA 2LLUA 3LK1A 4MLWA 1YUSA 4HSZA 2SCPA 2D8NA 1KK7Y 4L9MA 1B9AA 4PE0A 2F2OA 1SL7A 3VRNA 1DJIA 2I18A 4OR9B 3CS1A 3IF7A 1IQ3A 3QRXA 1YRTB 1MWNA 1TIZA 2FCEA 1DVIA 1XK4C 2BCBA 2I7AA 2M7NA 2KFHA 4MRYA 5HLVA 1WLMA 2LMUA 4I5KA 1LINA 2L98A 5I2LA 1WRZA 2EC6C 2RGIA 1E8AA 1SCMC 2KHNA 3PSRA 1XVJA 1S3PA 4N5XA 4GGFA 4DCKA 1TCFA 1ZMZA 1MUXA 2JWWA 2O60A 2ZRTA 5GQQC 1NX0A 2PMYA 1JWDA 2F8PA 3FIAA 5AFPA 2E6WA 1GJYA 2EHBA 1BODA 3SG5A 1CLBA 4USLA 1B4CA 1HQVA 1QASA 1ZACA 2KSPA 1AJ4A 1C7WA 3NSLA 1PALA 2PALA 1QV0A 3BUWB 5J3XA 1QV1A 3BUNB 1AJ5A 4CFRA 2R2IA 4QJ3B 1NX3A 2LVJA 1TOPA 2JPTA 3SG6A 1CDMA 3BUOB 1GGWA 1KQVA 1SR6C 1QJTA 5HLOA 3FWCA 2BL0C 3RLZA 3TDUA 2GV5A 1NCYA 2WOSA 3JVTB 4CFQA 1C07A 1J7RA 4ORBB 1D1OA 2K61A 1UHKA 2BKHB 5BPJA 1QTXA 1S1EA 4Q04A 1OE9B 1R2UA 2I94A 2NLNA 5DKNA 1MXEA 2JQ6A 5KU1A 4YGAA 3RM1A 5D69A 1BJFA 3D0YB 4FQOA 4FTGA 1J7OA 1IQ5A 1CM4A 1SNLA 1WDCC 1EJ3A 3OB2B 5DKRA 4PE7A 1A75A 2LCPA 1M46A 4MZKA 2L51A 3TUYB 4BY5A 2B1UA 3I5FB 1NYAA 1W7IB 1B7TZ 1NUBA 2Y4QA 1BMOA 3TDIA 1SRAA 4PDZA 2AUCA 3NXAA 5AXIA 5TNCA 3TDZA 3PFVA 1B8CA 2LP3A 2Q4UA 1QVIZ 1NX1A 5FYXA 3ZWHA 1CDPA 1F55A 4XJKB 1M39A 1KQMC 1M63B 1IJ6A 1RECA 2KAVA 5KSZA 1H4BA 1JBAA 2ISDA 2MJWB 3VRRA 2MLFC 3VROA 1QX2A 1FF1A 1K2HA 2M29A 1CFCA 1CKKA 2ZN8A 2LAPA 1IG5A 4NDBA 1YR5A 4R1EA 1R6PA 2JZIA 2K7DA 1G33A 4YGBB 3SG2A 2A4JA 2WCBA 1AVSA 4JQ0D 2LV7A 2HETA 4AQIA 4ZCUA 1XFUO 4ORAB 1XFWO 4DUQA 1K94A 2G9BA 4PALA 4BY4A 1M31A 2NXQA 2H61A 2ZN9A 1OOJA 1FBVA 2HQ8A 1YX7A 3A4UB 4M2OA 2M9GA 4YGEB 2L5XB 1J55A 2ZFDA 1C7VA 1Q80A 1B47A 2KI6D 3EK8A 5AEQA 1K9UA 5HKYA 1CMFA 1FI6A 1JF0A 1K95A 3PATA 1AK8A 1UHHA 1K8UA 1L2OC 4DRWA 1YTZC 1G8IA 5ER5A 1QATA 4CPVA 1ALVA 1DT7B 2OTGB 4E68A 2WORA 2AMIA 3DVMA 4I5NB 1TNQA 5HYDA 1DGUA 1OQPA 1KK8B 1ZUZA 1K9KA 1OZOA 2CXJA 3IQOA 1XFXO 1EL4A 1MR8A 2KDHA 1CDLA 2WC8A 3F45A 2JXLA 1PSBA 1SL8A 2M97A 4I5JA 1WRKA 1B1GA 4WQ3A 1GGZA 3FS7A 4GGFC 1EH2A 2K7BA 2M0RA 1NSHA 3HCMA 1KSOA 1EG4A 1KWOB 2NZ0A 3EKJA 2BCXA 2M49B 1BR4B 1KFXS 2M3WA 5ER4X 5K89A 3OHMB 2LLSA 1DJWA 1PVAA 2OS8B 4MZLA 1YUTA 2JNFA 2KI4C 3SG7A 2M7LA 3BXKA 4N1FA 1LA3A 1WRLA 2VRGA 1JFKA 1SBJA 1QIVA 2WCEA 2LP2A 3NSOA 4A4BA 2HF5A 1J7PA 1KFUS 1PULA 1K90D 4AOMA 5G08A 2LUCA 2FCDA 3M0WA 4PE1A 3SG4A 3KO0A 3KHEA 1F70A 2K0JA 3EVUA 3ZNIA 2CTNA 2LVVA 2H2KA 3OX5A 3SJSA 1CFDA 1NIWA 1A29A 1UP5A 2SASA 1BLQA 2K2AA 3HX4A 4DS7A 4C0LA 2Y5IA 5HKWA 1PSRA 1SCMB 1NPQA 2M1KB 4IL1A 4NQGA 3WXAA 4MBEA 1KFXL 3D0YA 2Y1MA 4NDDA 1TRFA 2BBMA 3JTDB 1AUIB 1ZFSA 3TUYC 2JRFA 4YI9A 2KQ6A 3EK7A 1XA5A 2TN4A 1JC2A 2LUXA 2LLTA 2OPOA 4A4CA 2JC2A 1EXRA 1DJXA 1MF8B 2KFGA 2L0PA 3CLNA 1CMGA 3VGOA 1KFUL 2KGRA 2O5GA 3CTNA 1MXLC 1EG3A 4QJ5B 1DJZA 1F8HA 3CR2A 1L7ZA 3BUXB 2KOTA 4PHJA 3OP0A 5I2OA 3BQ3A 5CSIA 1OZSA 2K2FA 4HRHA 1N2DA 4XJKA 3CR4X 1X02A 1NWDA 2M8UA 1YRUB 1UHNA 4OVNF 1SR6B 1TTXA 2MHHA 3EVRA 1FW4A 3LCPC 2BL0B 1SYMA 2P6BB 1Y1AA 1KK7Z 4GUKA 2ZNDA 2JT0A 5JJGA 2JOJA 1DTLA 3ICBA 1S26D 4YBHB 5PALA 3I5HB 2KAYA 3E3RA 4NDCA 2BCAA 3PALA 1KSMA 1K93D 1S36A 1WLZA 4MVFA 1NCZA 1WDCB 1F4QA 3AAKA 2KAXA 3PN7C 2F33A 2H61C 3PLFB 1NP8A 3LLEA 2CCMA 1DJYA 1QX5B 3GK2A 1QLKA 4I5LB 2KGBC 1F54A 1SPYA 1HT9A 1AP4A 1MQ1A 2K7OA 1CFPA 2GGZA 1ZOTB 3KF9A 5CSJA 1PK0D 3I5IB 3TZ1A 3DVKA 4PHNA 2DOQA 3MSEB 3AKAA 1DF0B 2ZKMX 3BOWB 3CZTX 1OMRA 2LM5A 2GGMA 3O4YA 4JWQA 3SIAA 3TS5B 3D10A 1U5IA 2FJUB 2LANA 1JF2A 2IS9A 2PASA 1U5IB 2KQYA 4C0JA 2NCPA 4YGCB 3C1VA 3I5GB 1B8RA 1B8LA 3SIBA 1QIWA 2WNDA 1A03A 4GGNA 3DF0A 5AANA 1QX7A 1V1GA 2CBLA 1KCYA 2Y1NA 3DF0B 1J7QA 4MSPA 1KWOC 1RTP1 3OX6A 2LC5A 3PM8A 2MBXA 1SL9A 1B7TY 1LXFC 2F3YA 3WHTB 1RROA 2LVIA 4P2YB 3WHUB 5CSNA 1RK9A 1ALWA 4GAOA 1TNWA 4PCWA 5HKZA 2K8MB 3NSKA 1QVIY 1LA0A 1SK6D 1J1DA 3BUMB 3CWGA 2OS8C 2JTTA 1IRJA 1CNPA 3BYAA 1YVHA 1CDNA 1UHJA 1WY9A 2LE9B 2LHLA 5B8IB 5JOLA 2F3ZA 2LMTA 1DMOA 1NX2A 1AHRA 1L2OB 3KPXA 2ZRSA 3EK4A 1N65A 2CNPA 4OCIA 2KBMA 2F2PA 3DVEA 4CIDA 1PVBA 1QLSA 2HQWA 1IH0A 2MLEC 2WCFA 1XO5A 1JFJA 4PHKA 4QJ4B 1M45A 5KTYA 1BT6A 1S6IA 2LVKA 2PVBA 1FPWA 3LL8B 4M2PA 1W7JB 3JVTC 4U8DA 4YRUA 4C0KA 3IQQA 1DJGA 1XK4A 1TNXA 2L4HA 1TN4A 1IGVA 1MHOA 1TCOB 1VRKA 3EVVA 1CB1A 3JTDC 1Y1UA 2E30A 2LNKA 1S6CA 3VRPA 1A2XA 2EC6B 2JT3A 2BKIB 1S5GY 2BE4A 4WQ2A 1GQMA 2COLB 4MN0A 4ZCVA 1SCVA 1JSAA 2LHIA 2JULA 4D1EA 1DJHA 1OSAA 3CGAA 3I5FC 3GK1A 1XFYO 2CT9A 1BOCA 1ODBA 3AAJA 4MZJA 4HRGA 2L2EA 2KI4B 1OMVA 4OV2A 2PSRA 1DGVA 3FWBA 4F0ZB 4UPGA 3O78A 3SG3A 1FI5A 3K21A 4CLNA 1JUOA 1YUUA 1XFZO 1SKTA 1G4YR 1K96A 2MRDA 4YGDB 4PHMA 4ETOA 3I5HC 1CFFA 3DVJA 1A4PA 1Y0VH 2MA2A 4HREE 4MRXA 1PRWA 1SW8A 2HPSA 1BU3A 1UWOA 1OMDA 1XYDA 2M1UA 4MEWA 3O2PA 2JU0A 5IBWA 1NCXA 1TNPA 4GNKB 5CPVA 1Y6WA 2KFFA 3LK0A 1A75B 2KBIA 4OKHA 2BECA 1BF5A 1SMGA 1UHIA 4TNCA 1V1FA 4DIRA 2BE6A 4JPZB 4WRIA 1RFJA 1QXPA 4N1GA 4AQJA 3AKBA 3I5IC 2KNEA 2QACA 5I2QA 5I8NA 1F71A 1K9PA 1XFVO 1YURA 1LVCD 3TS5C 1SY9A 1J1EA 1CM1A 4P5OE 2JXCA 1RWYA 1S6JA 1DF0A 3BOWA 2KI6C 2L50A 3H4SE 4ORCB 3O6BA 1KQMB 3NSIA 5DKQA 3WNXB 1N0YA 2AAOA 1Y1XA 2OTGC 3I5GC 3VRQA 4GPLB 4GFTA 3OB1B 4ICBA 2G2BA 1KK8C 5AERA 3DD4A 2MAZA 2K7CA 1UUSA 1IKUA 2NCOA 2JT8A 2I2RE 1H8BA 1IWQA 3GK4X 2BBNA 1BR1B 2LMVA 2PRUA 2QPTA 4YI8A 3KEVA 3PN7B 5D7FA 1CTRA 4M2QA 1QS7A 2V53A 1CLLA 3EKHA 1F4OA 1S5GZ 2L4IA 4XYNA 3A8RA 5CSFA 2JNXA 1UURA 2JTZA 2FOTA 1BG1A 1IJ5A 2KYCA 1LKJA
chains in the Genus database with same CATH superfamily
4PE4A 2ZNEA 2EGDA 1YX8A 1YVLA 2L2CA 2Q91A 3GOFA 5F6TA 3CR5X 4GBAA 2KYFA 1CLMA 1RJVA 2LLUA 3LK1A 4MLWA 1YUSA 4HSZA 2SCPA 2D8NA 1KK7Y 4F7FA 4L9MA 1B9AA 4PE0A 2F2OA 1SL7A 3VRNA 1DJIA 1T14A 2I18A 2WC5A 3CS1A 4OR9B 3IF7A 1IQ3A 3QRXA 1YRTB 5I94A 1MWNA 1TIZA 2FCEA 1DVIA 1XK4C 2BCBA 2I7AA 2M7NA 2KFHA 3L4LA 4MRYA 5HLVA 1WLMA 2LMUA 4I5KA 1LINA 2L98A 5I2LA 1WRZA 2EC6C 2RGIA 1E8AA 1SCMC 2KHNA 3PSRA 3S0GA 1XVJA 4JKTA 1S3PA 4N5XA 4GGFA 4DCKA 1TCFA 1ZMZA 1MUXA 2JWWA 2O60A 2ZRTA 5GQQC 1NX0A 2PMYA 1JWDA 1DC1A 2F8PA 3FIAA 5AFPA 2E6WA 1GJYA 3R72A 2EHBA 1BODA 3SG5A 1CLBA 4USLA 1TUJA 1HQVA 1QASA 1ZACA 2KSPA 1AJ4A 1C7WA 3NSLA 3PM2A 1B4CA 1PALA 3FE6A 2PALA 1QV0A 3BUWB 5J3XA 1QV1A 4INXA 3BUNB 1XFRA 1AJ5A 4CFRA 2P70A 2R2IA 4QJ3B 3VB1A 1NX3A 2LVJA 1TOPA 2JPTA 3SG6A 1CDMA 3D78A 3BUOB 1GGWA 1KQVA 1SR6C 2WCHA 1QJTA 5HLOA 3FWCA 2BL0C 3RLZA 3TDUA 2GV5A 1NCYA 2WOSA 3JVTB 4CFQA 1C07A 1J7RA 4ORBB 1D1OA 2K61A 1UHKA 2BKHB 5BPJA 1QTXA 1S1EA 4Q04A 1OE9B 1R2UA 2I94A 2NLNA 5DKNA 1MXEA 2JQ6A 5KU1A 4YGAA 3RM1A 5D69A 1BJFA 3D0YB 4FQOA 4FTGA 1J7OA 2GTEA 1IQ5A 1CM4A 1SNLA 1WDCC 3NHIA 1EJ3A 3OB2B 5DKRA 4PE7A 1A75A 2LCPA 1M46A 4MZKA 2L51A 3TUYB 4BY5A 2B1UA 3I5FB 3BJHA 1NYAA 1W7IB 1B7TZ 1NUBA 2Y4QA 1BMOA 3TDIA 1SRAA 4PDZA 2AUCA 3NXAA 5AXIA 5TNCA 3TDZA 3PFVA 1B8CA 4INWA 2LP3A 2Q4UA 1QVIZ 1NX1A 5FYXA 3ZWHA 1CDPA 1F55A 4XJKB 4KYNA 1M39A 2WCLA 1KQMC 1M63B 3DY9A 1IJ6A 1RECA 2KAVA 5KSZA 1H4BA 1JBAA 2ISDA 2MJWB 3VRRA 2MLFC 3VROA 1QX2A 1FF1A 1K2HA 2M29A 1CFCA 1CKKA 2ZN8A 2LAPA 1IG5A 4NDBA 1YR5A 4R1EA 1R6PA 2JZIA 3Q8IA 2K7DA 1G33A 4YGBB 3SG2A 2A4JA 2WCBA 3UNWA 1AVSA 4JQ0D 3L4AA 2LV7A 2HETA 4AQIA 5FI2A 1DELA 4ZCUA 1XFUO 4ORAB 1XFWO 4DUQA 1K94A 2G9BA 4PALA 4BY4A 1M31A 2NXQA 2H61A 2ZN9A 1OOJA 1FBVA 2HQ8A 1YX7A 2WC6A 3A4UB 1QWVA 2BNXA 4M2OA 3OGNA 2M9GA 4YGEB 2L5XB 1J55A 2ZFDA 1C7VA 1Q80A 1B47A 2KI6D 3EK8A 5AEQA 1K9UA 5HKYA 3R1OA 1CMFA 1JF0A 1K95A 3PATA 1FI6A 1AK8A 1UHHA 1K8UA 1L2OC 3CZ1A 4DRWA 2QDIA 1YTZC 1G8IA 5ER5A 1QATA 4CPVA 1ALVA 1DT7B 2OTGB 2KLEA 4IJ7A 4E68A 2WORA 2AMIA 3DVMA 4I5NB 1TNQA 5HYDA 1DGUA 1OQPA 1KK8B 1ZUZA 1K9KA 1OZOA 2CXJA 3IQOA 1XFXO 1EL4A 1MR8A 2KDHA 1CDLA 2WC8A 3F45A 2JXLA 1PSBA 3D76A 1SL8A 2M97A 4I5JA 5EL2A 2KLDA 2H8VA 1WRKA 1B1GA 4WQ3A 1GGZA 3FS7A 4GGFC 1EH2A 2K7BA 2M0RA 1NSHA 3HCMA 3S0BA 1KSOA 1EG4A 1KWOB 2NZ0A 3D77A 3EKJA 2BCXA 1C3ZA 2M49B 1BR4B 1KFXS 2M3WA 5ER4X 2K60A 4PT1A 5K89A 3OHMB 2LLSA 1DJWA 1PVAA 2OS8B 4MZLA 1YUTA 2JNFA 5FI7A 2KI4C 3SG7A 2M7LA 3BXKA 4N1FA 1LA3A 1WRLA 2VRGA 1JFKA 1SBJA 1QIVA 2WCEA 2LP2A 3B87A 3NSOA 2HF5A 5D3OA 1J7PA 1KFUS 1OOFA 1PULA 3SS3A 1K90D 4AOMA 5G08A 2LUCA 2FCDA 3M0WA 4PE1A 3SG4A 3KO0A 3KHEA 1F70A 2K0JA 3EVUA 3ZNIA 2CTNA 2LVVA 2H2KA 3OX5A 3SJSA 1CFDA 3D75A 1NIWA 3R1VA 3V2LA 1A29A 1UP5A 2SASA 1BLQA 2K2AA 3HX4A 4DS7A 4C0LA 2Y5IA 3FE8A 5HKWA 1PSRA 1SCMB 1NPQA 2M1KB 4IL1A 4NQGA 3WXAA 4MBEA 1KFXL 3D0YA 2Y1MA 4NDDA 1TRFA 2BBMA 3JTDB 1AUIB 1ZFSA 5FI6A 3TUYC 2JPOA 1TUZA 3UO9A 2JRFA 3CZ2A 4YI9A 2QEBA 3DXLA 2KQ6A 3EK7A 1XA5A 2TN4A 1JC2A 3B88A 2LUXA 2LLTA 2OPOA 4A4CA 2JC2A 1EXRA 1DJXA 1MF8B 2KFGA 2L0PA 3CLNA 1CMGA 1IIOA 3VGOA 1KFUL 2KGRA 2O5GA 3CTNA 1MXLC 1EG3A 4QJ5B 1DJZA 1F8HA 3CR2A 1L7ZA 3BUXB 1P28A 2KOTA 4PHJA 3OP0A 5I2OA 3BQ3A 5CSIA 1OZSA 2K2FA 4HRHA 1N2DA 4XJKA 3CR4X 1X02A 1NWDA 2M8UA 1YRUB 1UHNA 4OVNF 1SR6B 1TTXA 2MHHA 3EVRA 1FW4A 3LCPC 2BL0B 1SYMA 2WCJA 2P6BB 1Y1AA 1KK7Z 3IVTA 4GUKA 2ZNDA 2WCKA 2JT0A 5JJGA 1OOIX 2JOJA 1DTLA 3ICBA 1S26D 4YBHB 5PALA 3I5HB 2BAPA 2KAYA 3E3RA 4NDCA 2BCAA 3PALA 1KSMA 1Z4HA 1K93D 1S36A 1WLZA 4MVFA 1NCZA 1WDCB 1F4QA 3AAKA 2KAXA 3PN7C 3CDNA 2F33A 3OBVA 2H61C 3PLFB 1NP8A 3K1EA 3LLEA 2CCMA 2L5YA 3DYEA 3RZSA 1DJYA 1QX5B 3GK2A 1QLKA 4I5LB 2KGBC 3L47A 1F54A 1SPYA 1HT9A 1AP4A 1C3YA 1MQ1A 2K7OA 1CFPA 2GGZA 1ZOTB 3KF9A 5CSJA 1PK0D 3I5IB 3TZ1A 3DVKA 4PHNA 2DOQA 3MSEB 3AKAA 1DF0B 2ZKMX 3BOWB 3CZTX 3NGVA 1OMRA 2LM5A 2GGMA 3O4YA 4JWQA 3SIAA 3TS5B 3D10A 1U5IA 3B86A 1OW4A 2FJUB 2LANA 1JF2A 2IS9A 2PASA 1U5IB 2KQYA 4C0JA 2ERBA 2NCPA 4YGCB 3C1VA 3I5GB 1B8RA 1B8LA 3SIBA 3CZ0A 1QIWA 2WNDA 1A03A 3SS5A 4GGNA 3DF0A 5AANA 1QX7A 1V1GA 3BFAA 2CBLA 1KCYA 2Y1NA 3DF0B 1J7QA 4MSPA 1KWOC 1RTP1 3OX6A 2LC5A 3PM8A 3B6XA 2MBXA 1SL9A 1B7TY 1LXFC 2F3YA 2PQLA 3WHTB 2P71A 1RROA 2LVIA 4P2YB 5HL1A 3WHUB 5CSNA 1RK9A 1ALWA 4GAOA 1TNWA 4PCWA 5HKZA 2K8MB 3NSKA 1QVIY 1LA0A 1SK6D 1J1DA 3BFBA 3BUMB 3CWGA 2OS8C 2JTTA 1IRJA 1CNPA 3BYAA 1YVHA 1CDNA 1UHJA 1WY9A 2LE9B 2LHLA 3D73A 1ORGA 5JOLA 5B8IB 2F3ZA 2LMTA 1DMOA 1NX2A 1AHRA 1L2OB 3KPXA 3NHTA 2ZRSA 3EK4A 2FJYA 1N65A 2CNPA 4OCIA 2KBMA 2F2PA 3DVEA 4CIDA 1PVBA 1QLSA 2HQWA 3S0FA 1IH0A 2MLEC 2WCMA 2WCFA 1XO5A 1JFJA 2QEHA 4PHKA 4QJ4B 1M45A 5KTYA 1BT6A 1S6IA 2LVKA 2PVBA 1OOGA 1FPWA 3LL8B 4M2PA 1W7JB 3JVTC 4U8DA 4YRUA 3EG5B 4C0KA 3IQQA 1DJGA 1XK4A 1TNXA 2L4HA 3SS4A 1TN4A 1IGVA 1MHOA 1TCOB 1VRKA 3EVVA 1CB1A 3JTDC 1Y1UA 2E30A 2LNKA 1S6CA 3VRPA 1A2XA 2EC6B 2JT3A 2BKIB 1S5GY 2BE4A 4WQ2A 1GQMA 2COLB 4MN0A 4ZCVA 1SCVA 1W9ZA 1JSAA 2LHIA 2JULA 3S0EA 4D1EA 1DJHA 1OSAA 3CGAA 3I5FC 3GK1A 1XFYO 2CT9A 3D74A 1BOCA 1ODBA 3AAJA 3QMEA 4MZJA 4HRGA 2L2EA 2KI4B 1OMVA 4OV2A 2PSRA 1DGVA 1LS8A 3FWBA 4F0ZB 4UPGA 3O78A 1GM0A 3SG3A 1FI5A 3K21A 4OZDA 4CLNA 1JUOA 1YUUA 1XFZO 2QEOA 3CYZA 1SKTA 3B7AA 1G4YR 1K96A 2MRDA 4YGDB 4PHMA 4ETOA 3DZTA 3I5HC 1CFFA 3DVJA 1A4PA 1Y0VH 2MA2A 5DICA 4HREE 4MRXA 1PRWA 1SW8A 4JD9A 2HPSA 1BU3A 1UWOA 1OMDA 1XYDA 2M1UA 4MEWA 3O2PA 2JU0A 2YGUA 5IBWA 1NCXA 1TNPA 4GNKB 5CPVA 1Y6WA 3PJIA 2KFFA 3LK0A 3S0AA 1A75B 2KBIA 4OKHA 2BECA 1BF5A 1SMGA 1UHIA 4TNCA 1V1FA 4DIRA 2BE6A 4JPZB 2KPHA 4WRIA 1RFJA 3R1PA 1QXPA 4N1GA 4AQJA 3FE9A 3AKBA 3I5IC 2KNEA 2QACA 2PYQA 3N7HA 5I2QA 5I8NA 1F71A 1K9PA 1SSEB 1XFVO 1YURA 1LVCD 3TS5C 1SY9A 1J1EA 1CM1A 4P5OE 1Z2CB 2JXCA 1RWYA 3BFHA 1S6JA 1DF0A 3BOWA 2KI6C 2L50A 3H4SE 4ORCB 1DQEA 3O6BA 1KQMB 3NSIA 5DKQA 3CABA 3WNXB 1N0YA 2AAOA 1Y1XA 2OTGC 3I5GC 4FQTA 3VRQA 4GPLB 4GFTA 1OOHA 3OB1B 4ICBA 3S0DA 2G2BA 1KK8C 2QEVA 5AERA 3DD4A 2MAZA 2K7CA 1UUSA 1IKUA 3O4XA 2NCOA 2JT8A 2I2RE 1H8BA 1IWQA 3GK4X 2BBNA 1TWOA 1BR1B 2LMVA 2PRUA 2QPTA 4YI8A 3KEVA 3PN7B 5D7FA 1CTRA 4M2QA 1DEKA 1QS7A 2V53A 1CLLA 3EKHA 1F4OA 1S5GZ 4A4BA 2L4IA 4XYNA 3A8RA 5CSFA 2JNXA 1UURA 2JTZA 2FOTA 1BG1A 1IJ5A 2KYCA 1LKJA
chains in the Genus database with same CATH topology
4PE4A 2ZNEA 2EGDA 1YX8A 1YVLA 2Q91A 3GOFA 5F6TA 3CR5X 4GBAA 2KYFA 1CLMA 1RJVA 2LLUA 3LK1A 4MLWA 1YUSA 4HSZA 2SCPA 2D8NA 1KK7Y 4L9MA 1B9AA 4PE0A 2F2OA 1SL7A 3VRNA 1DJIA 2I18A 4OR9B 3CS1A 3IF7A 1IQ3A 3QRXA 1YRTB 1MWNA 1TIZA 2FCEA 1DVIA 1XK4C 2BCBA 2I7AA 2M7NA 2KFHA 4MRYA 5HLVA 1WLMA 2LMUA 4I5KA 1LINA 2L98A 5I2LA 1WRZA 2EC6C 2RGIA 1E8AA 1SCMC 2KHNA 3PSRA 1XVJA 1S3PA 4N5XA 4GGFA 4DCKA 1TCFA 1ZMZA 1MUXA 2JWWA 2O60A 2ZRTA 5GQQC 1NX0A 2PMYA 1JWDA 2F8PA 3FIAA 5AFPA 2E6WA 1GJYA 2EHBA 1BODA 3SG5A 1CLBA 4USLA 1B4CA 1HQVA 1QASA 1ZACA 2KSPA 1AJ4A 1C7WA 3NSLA 1PALA 2PALA 1QV0A 3BUWB 5J3XA 1QV1A 3BUNB 1AJ5A 4CFRA 2R2IA 4QJ3B 1NX3A 2LVJA 1TOPA 2JPTA 3SG6A 1CDMA 3BUOB 1GGWA 1KQVA 1SR6C 1QJTA 5HLOA 3FWCA 2BL0C 3RLZA 3TDUA 2GV5A 1NCYA 2WOSA 3JVTB 4CFQA 1C07A 1J7RA 4ORBB 1D1OA 2K61A 1UHKA 2BKHB 5BPJA 1QTXA 1S1EA 4Q04A 1OE9B 1R2UA 2I94A 2NLNA 5DKNA 1MXEA 2JQ6A 5KU1A 4YGAA 3RM1A 5D69A 1BJFA 3D0YB 4FQOA 4FTGA 1J7OA 1IQ5A 1CM4A 1SNLA 1WDCC 1EJ3A 3OB2B 5DKRA 4PE7A 1A75A 2LCPA 1M46A 4MZKA 2L51A 3TUYB 4BY5A 2B1UA 3I5FB 1NYAA 1W7IB 1B7TZ 1NUBA 2Y4QA 1BMOA 3TDIA 1SRAA 4PDZA 2AUCA 3NXAA 5AXIA 5TNCA 3TDZA 3PFVA 1B8CA 2LP3A 2Q4UA 1QVIZ 1NX1A 5FYXA 3ZWHA 1CDPA 1F55A 4XJKB 1M39A 1KQMC 1M63B 1IJ6A 1RECA 2KAVA 5KSZA 1H4BA 1JBAA 2ISDA 2MJWB 3VRRA 2MLFC 3VROA 1QX2A 1FF1A 1K2HA 2M29A 1CFCA 1CKKA 2ZN8A 2LAPA 1IG5A 4NDBA 1YR5A 4R1EA 1R6PA 2JZIA 2K7DA 1G33A 4YGBB 3SG2A 2A4JA 2WCBA 1AVSA 4JQ0D 2LV7A 2HETA 4AQIA 4ZCUA 1XFUO 4ORAB 1XFWO 4DUQA 1K94A 2G9BA 4PALA 4BY4A 1M31A 2NXQA 2H61A 2ZN9A 1OOJA 1FBVA 2HQ8A 1YX7A 3A4UB 4M2OA 2M9GA 4YGEB 2L5XB 1J55A 2ZFDA 1C7VA 1Q80A 1B47A 2KI6D 3EK8A 5AEQA 1K9UA 5HKYA 1CMFA 1FI6A 1JF0A 1K95A 3PATA 1AK8A 1UHHA 1K8UA 1L2OC 4DRWA 1YTZC 1G8IA 5ER5A 1QATA 4CPVA 1ALVA 1DT7B 2OTGB 4E68A 2WORA 2AMIA 3DVMA 4I5NB 1TNQA 5HYDA 1DGUA 1OQPA 1KK8B 1ZUZA 1K9KA 1OZOA 2CXJA 3IQOA 1XFXO 1EL4A 1MR8A 2KDHA 1CDLA 2WC8A 3F45A 2JXLA 1PSBA 1SL8A 2M97A 4I5JA 1WRKA 1B1GA 4WQ3A 1GGZA 3FS7A 4GGFC 1EH2A 2K7BA 2M0RA 1NSHA 3HCMA 1KSOA 1EG4A 1KWOB 2NZ0A 3EKJA 2BCXA 2M49B 1BR4B 1KFXS 2M3WA 5ER4X 5K89A 3OHMB 2LLSA 1DJWA 1PVAA 2OS8B 4MZLA 1YUTA 2JNFA 2KI4C 3SG7A 2M7LA 3BXKA 4N1FA 1LA3A 1WRLA 2VRGA 1JFKA 1SBJA 1QIVA 2WCEA 2LP2A 3NSOA 4A4BA 2HF5A 1J7PA 1KFUS 1PULA 1K90D 4AOMA 5G08A 2LUCA 2FCDA 3M0WA 4PE1A 3SG4A 3KO0A 3KHEA 1F70A 2K0JA 3EVUA 3ZNIA 2CTNA 2LVVA 2H2KA 3OX5A 3SJSA 1CFDA 1NIWA 1A29A 1UP5A 2SASA 1BLQA 2K2AA 3HX4A 4DS7A 4C0LA 2Y5IA 5HKWA 1PSRA 1SCMB 1NPQA 2M1KB 4IL1A 4NQGA 3WXAA 4MBEA 1KFXL 3D0YA 2Y1MA 4NDDA 1TRFA 2BBMA 3JTDB 1AUIB 1ZFSA 3TUYC 2JRFA 4YI9A 2KQ6A 3EK7A 1XA5A 2TN4A 1JC2A 2LUXA 2LLTA 2OPOA 4A4CA 2JC2A 1EXRA 1DJXA 1MF8B 2KFGA 2L0PA 3CLNA 1CMGA 3VGOA 1KFUL 2KGRA 2O5GA 3CTNA 1MXLC 1EG3A 4QJ5B 1DJZA 1F8HA 3CR2A 1L7ZA 3BUXB 2KOTA 4PHJA 3OP0A 5I2OA 3BQ3A 5CSIA 1OZSA 2K2FA 4HRHA 1N2DA 4XJKA 3CR4X 1X02A 1NWDA 2M8UA 1YRUB 1UHNA 4OVNF 1SR6B 1TTXA 2MHHA 3EVRA 1FW4A 3LCPC 2BL0B 1SYMA 2P6BB 1Y1AA 1KK7Z 4GUKA 2ZNDA 2JT0A 5JJGA 2JOJA 1DTLA 3ICBA 1S26D 4YBHB 5PALA 3I5HB 2KAYA 3E3RA 4NDCA 2BCAA 3PALA 1KSMA 1K93D 1S36A 1WLZA 4MVFA 1NCZA 1WDCB 1F4QA 3AAKA 2KAXA 3PN7C 2F33A 2H61C 3PLFB 1NP8A 3LLEA 2CCMA 1DJYA 1QX5B 3GK2A 1QLKA 4I5LB 2KGBC 1F54A 1SPYA 1HT9A 1AP4A 1MQ1A 2K7OA 1CFPA 2GGZA 1ZOTB 3KF9A 5CSJA 1PK0D 3I5IB 3TZ1A 3DVKA 4PHNA 2DOQA 3MSEB 3AKAA 1DF0B 2ZKMX 3BOWB 3CZTX 1OMRA 2LM5A 2GGMA 3O4YA 4JWQA 3SIAA 3TS5B 3D10A 1U5IA 2FJUB 2LANA 1JF2A 2IS9A 2PASA 1U5IB 2KQYA 4C0JA 2NCPA 4YGCB 3C1VA 3I5GB 1B8RA 1B8LA 3SIBA 1QIWA 2WNDA 1A03A 4GGNA 3DF0A 5AANA 1QX7A 1V1GA 2CBLA 1KCYA 2Y1NA 3DF0B 1J7QA 4MSPA 1KWOC 1RTP1 3OX6A 2LC5A 3PM8A 2MBXA 1SL9A 1B7TY 1LXFC 2F3YA 3WHTB 1RROA 2LVIA 4P2YB 3WHUB 5CSNA 1RK9A 1ALWA 4GAOA 1TNWA 4PCWA 5HKZA 2K8MB 3NSKA 1QVIY 1LA0A 1SK6D 1J1DA 3BUMB 3CWGA 2OS8C 2JTTA 1IRJA 1CNPA 3BYAA 1YVHA 1CDNA 1UHJA 1WY9A 2LE9B 2LHLA 5B8IB 5JOLA 2F3ZA 2LMTA 1DMOA 1NX2A 1AHRA 1L2OB 3KPXA 2ZRSA 3EK4A 1N65A 2CNPA 4OCIA 2KBMA 2F2PA 3DVEA 4CIDA 1PVBA 1QLSA 2HQWA 1IH0A 2MLEC 2WCFA 1XO5A 1JFJA 4PHKA 4QJ4B 1M45A 5KTYA 1BT6A 1S6IA 2LVKA 2PVBA 1FPWA 3LL8B 4M2PA 1W7JB 3JVTC 4U8DA 4YRUA 4C0KA 3IQQA 1DJGA 1XK4A 1TNXA 2L4HA 1TN4A 1IGVA 1MHOA 1TCOB 1VRKA 3EVVA 1CB1A 3JTDC 1Y1UA 2E30A 2LNKA 1S6CA 3VRPA 1A2XA 2EC6B 2JT3A 2BKIB 1S5GY 2BE4A 4WQ2A 1GQMA 2COLB 4MN0A 4ZCVA 1SCVA 1JSAA 2LHIA 2JULA 4D1EA 1DJHA 1OSAA 3CGAA 3I5FC 3GK1A 1XFYO 2CT9A 1BOCA 1ODBA 3AAJA 4MZJA 4HRGA 2L2EA 2KI4B 1OMVA 4OV2A 2PSRA 1DGVA 3FWBA 4F0ZB 4UPGA 3O78A 3SG3A 1FI5A 3K21A 4CLNA 1JUOA 1YUUA 1XFZO 1SKTA 1G4YR 1K96A 2MRDA 4YGDB 4PHMA 4ETOA 3I5HC 1CFFA 3DVJA 1A4PA 1Y0VH 2MA2A 4HREE 4MRXA 1PRWA 1SW8A 2HPSA 1BU3A 1UWOA 1OMDA 1XYDA 2M1UA 4MEWA 3O2PA 2JU0A 5IBWA 1NCXA 1TNPA 4GNKB 5CPVA 1Y6WA 2KFFA 3LK0A 1A75B 2KBIA 4OKHA 2BECA 1BF5A 1SMGA 1UHIA 4TNCA 1V1FA 4DIRA 2BE6A 4JPZB 4WRIA 1RFJA 1QXPA 4N1GA 4AQJA 3AKBA 3I5IC 2KNEA 2QACA 5I2QA 5I8NA 1F71A 1K9PA 1XFVO 1YURA 1LVCD 3TS5C 1SY9A 1J1EA 1CM1A 4P5OE 2JXCA 1RWYA 1S6JA 1DF0A 3BOWA 2KI6C 2L50A 3H4SE 4ORCB 3O6BA 1KQMB 3NSIA 5DKQA 3WNXB 1N0YA 2AAOA 1Y1XA 2OTGC 3I5GC 3VRQA 4GPLB 4GFTA 3OB1B 4ICBA 2G2BA 1KK8C 5AERA 3DD4A 2MAZA 2K7CA 1UUSA 1IKUA 2NCOA 2JT8A 2I2RE 1H8BA 1IWQA 3GK4X 2BBNA 1BR1B 2LMVA 2PRUA 2QPTA 4YI8A 3KEVA 3PN7B 5D7FA 1CTRA 4M2QA 1QS7A 2V53A 1CLLA 3EKHA 1F4OA 1S5GZ 2L4IA 4XYNA 3A8RA 5CSFA 2JNXA 1UURA 2JTZA 2FOTA 1BG1A 1IJ5A 2KYCA 1LKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE4 A;  2ZNE A;  2EGD A;  1YX8 A;  1YVL A;  2Q91 A;  3GOF A;  5F6T A;  3CR5 X;  4GBA A;  2KYF A;  1CLM A;  1RJV A;  2LLU A;  3LK1 A;  4MLW A;  1YUS A;  4HSZ A;  2SCP A;  2D8N A;  1KK7 Y;  4L9M A;  1B9A A;  4PE0 A;  2F2O A;  1SL7 A;  3VRN A;  1DJI A;  2I18 A;  4OR9 B;  3CS1 A;  3IF7 A;  1IQ3 A;  3QRX A;  1YRT B;  1MWN A;  1TIZ A;  2FCE A;  1DVI A;  1XK4 C;  2BCB A;  2I7A A;  2M7N A;  2KFH A;  4MRY A;  5HLV A;  1WLM A;  2LMU A;  4I5K A;  1LIN A;  2L98 A;  5I2L A;  1WRZ A;  2EC6 C;  2RGI A;  1E8A A;  1SCM C;  2KHN A;  3PSR A;  1XVJ A;  1S3P A;  4N5X A;  4GGF A;  4DCK A;  1TCF A;  1ZMZ A;  1MUX A;  2JWW A;  2O60 A;  2ZRT A;  5GQQ C;  1NX0 A;  2PMY A;  1JWD A;  2F8P A;  3FIA A;  5AFP A;  2E6W A;  1GJY A;  2EHB A;  1BOD A;  3SG5 A;  1CLB A;  4USL A;  1B4C A;  1HQV A;  1QAS A;  1ZAC A;  2KSP A;  1AJ4 A;  1C7W A;  3NSL A;  1PAL A;  2PAL A;  1QV0 A;  3BUW B;  5J3X A;  1QV1 A;  3BUN B;  1AJ5 A;  4CFR A;  2R2I A;  4QJ3 B;  1NX3 A;  2LVJ A;  1TOP A;  2JPT A;  3SG6 A;  1CDM A;  3BUO B;  1GGW A;  1KQV A;  1SR6 C;  1QJT A;  5HLO A;  3FWC A;  2BL0 C;  3RLZ A;  3TDU A;  2GV5 A;  1NCY A;  2WOS A;  3JVT B;  4CFQ A;  1C07 A;  1J7R A;  4ORB B;  1D1O A;  2K61 A;  1UHK A;  2BKH B;  5BPJ A;  1QTX A;  1S1E A;  4Q04 A;  1OE9 B;  1R2U A;  2I94 A;  2NLN A;  5DKN A;  1MXE A;  2JQ6 A;  5KU1 A;  4YGA A;  3RM1 A;  5D69 A;  1BJF A;  3D0Y B;  4FQO A;  4FTG A;  1J7O A;  1IQ5 A;  1CM4 A;  1SNL A;  1WDC C;  1EJ3 A;  3OB2 B;  5DKR A;  4PE7 A;  1A75 A;  2LCP A;  1M46 A;  4MZK A;  2L51 A;  3TUY B;  4BY5 A;  2B1U A;  3I5F B;  1NYA A;  1W7I B;  1B7T Z;  1NUB A;  2Y4Q A;  1BMO A;  3TDI A;  1SRA A;  4PDZ A;  2AUC A;  3NXA A;  5AXI A;  5TNC A;  3TDZ A;  3PFV A;  1B8C A;  2LP3 A;  2Q4U A;  1QVI Z;  1NX1 A;  5FYX A;  3ZWH A;  1CDP A;  1F55 A;  4XJK B;  1M39 A;  1KQM C;  1M63 B;  1IJ6 A;  1REC A;  2KAV A;  5KSZ A;  1H4B A;  1JBA A;  2ISD A;  2MJW B;  3VRR A;  2MLF C;  3VRO A;  1QX2 A;  1FF1 A;  1K2H A;  2M29 A;  1CFC A;  1CKK A;  2ZN8 A;  2LAP A;  1IG5 A;  4NDB A;  1YR5 A;  4R1E A;  1R6P A;  2JZI A;  2K7D A;  1G33 A;  4YGB B;  3SG2 A;  2A4J A;  2WCB A;  1AVS A;  4JQ0 D;  2LV7 A;  2HET A;  4AQI A;  4ZCU A;  1XFU O;  4ORA B;  1XFW O;  4DUQ A;  1K94 A;  2G9B A;  4PAL A;  4BY4 A;  1M31 A;  2NXQ A;  2H61 A;  2ZN9 A;  1OOJ A;  1FBV A;  2HQ8 A;  1YX7 A;  3A4U B;  4M2O A;  2M9G A;  4YGE B;  2L5X B;  1J55 A;  2ZFD A;  1C7V A;  1Q80 A;  1B47 A;  2KI6 D;  3EK8 A;  5AEQ A;  1K9U A;  5HKY A;  1CMF A;  1FI6 A;  1JF0 A;  1K95 A;  3PAT A;  1AK8 A;  1UHH A;  1K8U A;  1L2O C;  4DRW A;  1YTZ C;  1G8I A;  5ER5 A;  1QAT A;  4CPV A;  1ALV A;  1DT7 B;  2OTG B;  4E68 A;  2WOR A;  2AMI A;  3DVM A;  4I5N B;  1TNQ A;  5HYD A;  1DGU A;  1OQP A;  1KK8 B;  1ZUZ A;  1K9K A;  1OZO A;  2CXJ A;  3IQO A;  1XFX O;  1EL4 A;  1MR8 A;  2KDH A;  1CDL A;  2WC8 A;  3F45 A;  2JXL A;  1PSB A;  1SL8 A;  2M97 A;  4I5J A;  1WRK A;  1B1G A;  4WQ3 A;  1GGZ A;  3FS7 A;  4GGF C;  1EH2 A;  2K7B A;  2M0R A;  1NSH A;  3HCM A;  1KSO A;  1EG4 A;  1KWO B;  2NZ0 A;  3EKJ A;  2BCX A;  2M49 B;  1BR4 B;  1KFX S;  2M3W A;  5ER4 X;  5K89 A;  3OHM B;  2LLS A;  1DJW A;  1PVA A;  2OS8 B;  4MZL A;  1YUT A;  2JNF A;  2KI4 C;  3SG7 A;  2M7L A;  3BXK A;  4N1F A;  1LA3 A;  1WRL A;  2VRG A;  1JFK A;  1SBJ A;  1QIV A;  2WCE A;  2LP2 A;  3NSO A;  4A4B A;  2HF5 A;  1J7P A;  1KFU S;  1PUL A;  1K90 D;  4AOM A;  5G08 A;  2LUC A;  2FCD A;  3M0W A;  4PE1 A;  3SG4 A;  3KO0 A;  3KHE A;  1F70 A;  2K0J A;  3EVU A;  3ZNI A;  2CTN A;  2LVV A;  2H2K A;  3OX5 A;  3SJS A;  1CFD A;  1NIW A;  1A29 A;  1UP5 A;  2SAS A;  1BLQ A;  2K2A A;  3HX4 A;  4DS7 A;  4C0L A;  2Y5I A;  5HKW A;  1PSR A;  1SCM B;  1NPQ A;  2M1K B;  4IL1 A;  4NQG A;  3WXA A;  4MBE A;  1KFX L;  3D0Y A;  2Y1M A;  4NDD A;  1TRF A;  2BBM A;  3JTD B;  1AUI B;  1ZFS A;  3TUY C;  2JRF A;  4YI9 A;  2KQ6 A;  3EK7 A;  1XA5 A;  2TN4 A;  1JC2 A;  2LUX A;  2LLT A;  2OPO A;  4A4C A;  2JC2 A;  1EXR A;  1DJX A;  1MF8 B;  2KFG A;  2L0P A;  3CLN A;  1CMG A;  3VGO A;  1KFU L;  2KGR A;  2O5G A;  3CTN A;  1MXL C;  1EG3 A;  4QJ5 B;  1DJZ A;  1F8H A;  3CR2 A;  1L7Z A;  3BUX B;  2KOT A;  4PHJ A;  3OP0 A;  5I2O A;  3BQ3 A;  5CSI A;  1OZS A;  2K2F A;  4HRH A;  1N2D A;  4XJK A;  3CR4 X;  1X02 A;  1NWD A;  2M8U A;  1YRU B;  1UHN A;  4OVN F;  1SR6 B;  1TTX A;  2MHH A;  3EVR A;  1FW4 A;  3LCP C;  2BL0 B;  1SYM A;  2P6B B;  1Y1A A;  1KK7 Z;  4GUK A;  2ZND A;  2JT0 A;  5JJG A;  2JOJ A;  1DTL A;  3ICB A;  1S26 D;  4YBH B;  5PAL A;  3I5H B;  2KAY A;  3E3R A;  4NDC A;  2BCA A;  3PAL A;  1KSM A;  1K93 D;  1S36 A;  1WLZ A;  4MVF A;  1NCZ A;  1WDC B;  1F4Q A;  3AAK A;  2KAX A;  3PN7 C;  2F33 A;  2H61 C;  3PLF B;  1NP8 A;  3LLE A;  2CCM A;  1DJY A;  1QX5 B;  3GK2 A;  1QLK A;  4I5L B;  2KGB C;  1F54 A;  1SPY A;  1HT9 A;  1AP4 A;  1MQ1 A;  2K7O A;  1CFP A;  2GGZ A;  1ZOT B;  3KF9 A;  5CSJ A;  1PK0 D;  3I5I B;  3TZ1 A;  3DVK A;  4PHN A;  2DOQ A;  3MSE B;  3AKA A;  1DF0 B;  2ZKM X;  3BOW B;  3CZT X;  1OMR A;  2LM5 A;  2GGM A;  3O4Y A;  4JWQ A;  3SIA A;  3TS5 B;  3D10 A;  1U5I A;  2FJU B;  2LAN A;  1JF2 A;  2IS9 A;  2PAS A;  1U5I B;  2KQY A;  4C0J A;  2NCP A;  4YGC B;  3C1V A;  3I5G B;  1B8R A;  1B8L A;  3SIB A;  1QIW A;  2WND A;  1A03 A;  4GGN A;  3DF0 A;  5AAN A;  1QX7 A;  1V1G A;  2CBL A;  1KCY A;  2Y1N A;  3DF0 B;  1J7Q A;  4MSP A;  1KWO C;  1RTP 1;  3OX6 A;  2LC5 A;  3PM8 A;  2MBX A;  1SL9 A;  1B7T Y;  1LXF C;  2F3Y A;  3WHT B;  1RRO A;  2LVI A;  4P2Y B;  3WHU B;  5CSN A;  1RK9 A;  1ALW A;  4GAO A;  1TNW A;  4PCW A;  5HKZ A;  2K8M B;  3NSK A;  1QVI Y;  1LA0 A;  1SK6 D;  1J1D A;  3BUM B;  3CWG A;  2OS8 C;  2JTT A;  1IRJ A;  1CNP A;  3BYA A;  1YVH A;  1CDN A;  1UHJ A;  1WY9 A;  2LE9 B;  2LHL A;  5B8I B;  5JOL A;  2F3Z A;  2LMT A;  1DMO A;  1NX2 A;  1AHR A;  1L2O B;  3KPX A;  2ZRS A;  3EK4 A;  1N65 A;  2CNP A;  4OCI A;  2KBM A;  2F2P A;  3DVE A;  4CID A;  1PVB A;  1QLS A;  2HQW A;  1IH0 A;  2MLE C;  2WCF A;  1XO5 A;  1JFJ A;  4PHK A;  4QJ4 B;  1M45 A;  5KTY A;  1BT6 A;  1S6I A;  2LVK A;  2PVB A;  1FPW A;  3LL8 B;  4M2P A;  1W7J B;  3JVT C;  4U8D A;  4YRU A;  4C0K A;  3IQQ A;  1DJG A;  1XK4 A;  1TNX A;  2L4H A;  1TN4 A;  1IGV A;  1MHO A;  1TCO B;  1VRK A;  3EVV A;  1CB1 A;  3JTD C;  1Y1U A;  2E30 A;  2LNK A;  1S6C A;  3VRP A;  1A2X A;  2EC6 B;  2JT3 A;  2BKI B;  1S5G Y;  2BE4 A;  4WQ2 A;  1GQM A;  2COL B;  4MN0 A;  4ZCV A;  1SCV A;  1JSA A;  2LHI A;  2JUL A;  4D1E A;  1DJH A;  1OSA A;  3CGA A;  3I5F C;  3GK1 A;  1XFY O;  2CT9 A;  1BOC A;  1ODB A;  3AAJ A;  4MZJ A;  4HRG A;  2L2E A;  2KI4 B;  1OMV A;  4OV2 A;  2PSR A;  1DGV A;  3FWB A;  4F0Z B;  4UPG A;  3O78 A;  3SG3 A;  1FI5 A;  3K21 A;  4CLN A;  1JUO A;  1YUU A;  1XFZ O;  1SKT A;  1G4Y R;  1K96 A;  2MRD A;  4YGD B;  4PHM A;  4ETO A;  3I5H C;  1CFF A;  3DVJ A;  1A4P A;  1Y0V H;  2MA2 A;  4HRE E;  4MRX A;  1PRW A;  1SW8 A;  2HPS A;  1BU3 A;  1UWO A;  1OMD A;  1XYD A;  2M1U A;  4MEW A;  3O2P A;  2JU0 A;  5IBW A;  1NCX A;  1TNP A;  4GNK B;  5CPV A;  1Y6W A;  2KFF A;  3LK0 A;  1A75 B;  2KBI A;  4OKH A;  2BEC A;  1BF5 A;  1SMG A;  1UHI A;  4TNC A;  1V1F A;  4DIR A;  2BE6 A;  4JPZ B;  4WRI A;  1RFJ A;  1QXP A;  4N1G A;  4AQJ A;  3AKB A;  3I5I C;  2KNE A;  2QAC A;  5I2Q A;  5I8N A;  1F71 A;  1K9P A;  1XFV O;  1YUR A;  1LVC D;  3TS5 C;  1SY9 A;  1J1E A;  1CM1 A;  4P5O E;  2JXC A;  1RWY A;  1S6J A;  1DF0 A;  3BOW A;  2KI6 C;  2L50 A;  3H4S E;  4ORC B;  3O6B A;  1KQM B;  3NSI A;  5DKQ A;  3WNX B;  1N0Y A;  2AAO A;  1Y1X A;  2OTG C;  3I5G C;  3VRQ A;  4GPL B;  4GFT A;  3OB1 B;  4ICB A;  2G2B A;  1KK8 C;  5AER A;  3DD4 A;  2MAZ A;  2K7C A;  1UUS A;  1IKU A;  2NCO A;  2JT8 A;  2I2R E;  1H8B A;  1IWQ A;  3GK4 X;  2BBN A;  1BR1 B;  2LMV A;  2PRU A;  2QPT A;  4YI8 A;  3KEV A;  3PN7 B;  5D7F A;  1CTR A;  4M2Q A;  1QS7 A;  2V53 A;  1CLL A;  3EKH A;  1F4O A;  1S5G Z;  2L4I A;  4XYN A;  3A8R A;  5CSF A;  2JNX A;  1UUR A;  2JTZ A;  2FOT A;  1BG1 A;  1IJ5 A;  2KYC A;  1LKJ A; 
#chains in the Genus database with same CATH topology
 4PE4 A;  2ZNE A;  2EGD A;  1YX8 A;  1YVL A;  2L2C A;  2Q91 A;  3GOF A;  5F6T A;  3CR5 X;  4GBA A;  2KYF A;  1CLM A;  1RJV A;  2LLU A;  3LK1 A;  4MLW A;  1YUS A;  4HSZ A;  2SCP A;  2D8N A;  1KK7 Y;  4F7F A;  4L9M A;  1B9A A;  4PE0 A;  2F2O A;  1SL7 A;  3VRN A;  1DJI A;  1T14 A;  2I18 A;  2WC5 A;  3CS1 A;  4OR9 B;  3IF7 A;  1IQ3 A;  3QRX A;  1YRT B;  5I94 A;  1MWN A;  1TIZ A;  2FCE A;  1DVI A;  1XK4 C;  2BCB A;  2I7A A;  2M7N A;  2KFH A;  3L4L A;  4MRY A;  5HLV A;  1WLM A;  2LMU A;  4I5K A;  1LIN A;  2L98 A;  5I2L A;  1WRZ A;  2EC6 C;  2RGI A;  1E8A A;  1SCM C;  2KHN A;  3PSR A;  3S0G A;  1XVJ A;  4JKT A;  1S3P A;  4N5X A;  4GGF A;  4DCK A;  1TCF A;  1ZMZ A;  1MUX A;  2JWW A;  2O60 A;  2ZRT A;  5GQQ C;  1NX0 A;  2PMY A;  1JWD A;  1DC1 A;  2F8P A;  3FIA A;  5AFP A;  2E6W A;  1GJY A;  3R72 A;  2EHB A;  1BOD A;  3SG5 A;  1CLB A;  4USL A;  1TUJ A;  1HQV A;  1QAS A;  1ZAC A;  2KSP A;  1AJ4 A;  1C7W A;  3NSL A;  3PM2 A;  1B4C A;  1PAL A;  3FE6 A;  2PAL A;  1QV0 A;  3BUW B;  5J3X A;  1QV1 A;  4INX A;  3BUN B;  1XFR A;  1AJ5 A;  4CFR A;  2P70 A;  2R2I A;  4QJ3 B;  3VB1 A;  1NX3 A;  2LVJ A;  1TOP A;  2JPT A;  3SG6 A;  1CDM A;  3D78 A;  3BUO B;  1GGW A;  1KQV A;  1SR6 C;  2WCH A;  1QJT A;  5HLO A;  3FWC A;  2BL0 C;  3RLZ A;  3TDU A;  2GV5 A;  1NCY A;  2WOS A;  3JVT B;  4CFQ A;  1C07 A;  1J7R A;  4ORB B;  1D1O A;  2K61 A;  1UHK A;  2BKH B;  5BPJ A;  1QTX A;  1S1E A;  4Q04 A;  1OE9 B;  1R2U A;  2I94 A;  2NLN A;  5DKN A;  1MXE A;  2JQ6 A;  5KU1 A;  4YGA A;  3RM1 A;  5D69 A;  1BJF A;  3D0Y B;  4FQO A;  4FTG A;  1J7O A;  2GTE A;  1IQ5 A;  1CM4 A;  1SNL A;  1WDC C;  3NHI A;  1EJ3 A;  3OB2 B;  5DKR A;  4PE7 A;  1A75 A;  2LCP A;  1M46 A;  4MZK A;  2L51 A;  3TUY B;  4BY5 A;  2B1U A;  3I5F B;  3BJH A;  1NYA A;  1W7I B;  1B7T Z;  1NUB A;  2Y4Q A;  1BMO A;  3TDI A;  1SRA A;  4PDZ A;  2AUC A;  3NXA A;  5AXI A;  5TNC A;  3TDZ A;  3PFV A;  1B8C A;  4INW A;  2LP3 A;  2Q4U A;  1QVI Z;  1NX1 A;  5FYX A;  3ZWH A;  1CDP A;  1F55 A;  4XJK B;  4KYN A;  1M39 A;  2WCL A;  1KQM C;  1M63 B;  3DY9 A;  1IJ6 A;  1REC A;  2KAV A;  5KSZ A;  1H4B A;  1JBA A;  2ISD A;  2MJW B;  3VRR A;  2MLF C;  3VRO A;  1QX2 A;  1FF1 A;  1K2H A;  2M29 A;  1CFC A;  1CKK A;  2ZN8 A;  2LAP A;  1IG5 A;  4NDB A;  1YR5 A;  4R1E A;  1R6P A;  2JZI A;  3Q8I A;  2K7D A;  1G33 A;  4YGB B;  3SG2 A;  2A4J A;  2WCB A;  3UNW A;  1AVS A;  4JQ0 D;  3L4A A;  2LV7 A;  2HET A;  4AQI A;  5FI2 A;  1DEL A;  4ZCU A;  1XFU O;  4ORA B;  1XFW O;  4DUQ A;  1K94 A;  2G9B A;  4PAL A;  4BY4 A;  1M31 A;  2NXQ A;  2H61 A;  2ZN9 A;  1OOJ A;  1FBV A;  2HQ8 A;  1YX7 A;  2WC6 A;  3A4U B;  1QWV A;  2BNX A;  4M2O A;  3OGN A;  2M9G A;  4YGE B;  2L5X B;  1J55 A;  2ZFD A;  1C7V A;  1Q80 A;  1B47 A;  2KI6 D;  3EK8 A;  5AEQ A;  1K9U A;  5HKY A;  3R1O A;  1CMF A;  1JF0 A;  1K95 A;  3PAT A;  1FI6 A;  1AK8 A;  1UHH A;  1K8U A;  1L2O C;  3CZ1 A;  4DRW A;  2QDI A;  1YTZ C;  1G8I A;  5ER5 A;  1QAT A;  4CPV A;  1ALV A;  1DT7 B;  2OTG B;  2KLE A;  4IJ7 A;  4E68 A;  2WOR A;  2AMI A;  3DVM A;  4I5N B;  1TNQ A;  5HYD A;  1DGU A;  1OQP A;  1KK8 B;  1ZUZ A;  1K9K A;  1OZO A;  2CXJ A;  3IQO A;  1XFX O;  1EL4 A;  1MR8 A;  2KDH A;  1CDL A;  2WC8 A;  3F45 A;  2JXL A;  1PSB A;  3D76 A;  1SL8 A;  2M97 A;  4I5J A;  5EL2 A;  2KLD A;  2H8V A;  1WRK A;  1B1G A;  4WQ3 A;  1GGZ A;  3FS7 A;  4GGF C;  1EH2 A;  2K7B A;  2M0R A;  1NSH A;  3HCM A;  3S0B A;  1KSO A;  1EG4 A;  1KWO B;  2NZ0 A;  3D77 A;  3EKJ A;  2BCX A;  1C3Z A;  2M49 B;  1BR4 B;  1KFX S;  2M3W A;  5ER4 X;  2K60 A;  4PT1 A;  5K89 A;  3OHM B;  2LLS A;  1DJW A;  1PVA A;  2OS8 B;  4MZL A;  1YUT A;  2JNF A;  5FI7 A;  2KI4 C;  3SG7 A;  2M7L A;  3BXK A;  4N1F A;  1LA3 A;  1WRL A;  2VRG A;  1JFK A;  1SBJ A;  1QIV A;  2WCE A;  2LP2 A;  3B87 A;  3NSO A;  2HF5 A;  5D3O A;  1J7P A;  1KFU S;  1OOF A;  1PUL A;  3SS3 A;  1K90 D;  4AOM A;  5G08 A;  2LUC A;  2FCD A;  3M0W A;  4PE1 A;  3SG4 A;  3KO0 A;  3KHE A;  1F70 A;  2K0J A;  3EVU A;  3ZNI A;  2CTN A;  2LVV A;  2H2K A;  3OX5 A;  3SJS A;  1CFD A;  3D75 A;  1NIW A;  3R1V A;  3V2L A;  1A29 A;  1UP5 A;  2SAS A;  1BLQ A;  2K2A A;  3HX4 A;  4DS7 A;  4C0L A;  2Y5I A;  3FE8 A;  5HKW A;  1PSR A;  1SCM B;  1NPQ A;  2M1K B;  4IL1 A;  4NQG A;  3WXA A;  4MBE A;  1KFX L;  3D0Y A;  2Y1M A;  4NDD A;  1TRF A;  2BBM A;  3JTD B;  1AUI B;  1ZFS A;  5FI6 A;  3TUY C;  2JPO A;  1TUZ A;  3UO9 A;  2JRF A;  3CZ2 A;  4YI9 A;  2QEB A;  3DXL A;  2KQ6 A;  3EK7 A;  1XA5 A;  2TN4 A;  1JC2 A;  3B88 A;  2LUX A;  2LLT A;  2OPO A;  4A4C A;  2JC2 A;  1EXR A;  1DJX A;  1MF8 B;  2KFG A;  2L0P A;  3CLN A;  1CMG A;  1IIO A;  3VGO A;  1KFU L;  2KGR A;  2O5G A;  3CTN A;  1MXL C;  1EG3 A;  4QJ5 B;  1DJZ A;  1F8H A;  3CR2 A;  1L7Z A;  3BUX B;  1P28 A;  2KOT A;  4PHJ A;  3OP0 A;  5I2O A;  3BQ3 A;  5CSI A;  1OZS A;  2K2F A;  4HRH A;  1N2D A;  4XJK A;  3CR4 X;  1X02 A;  1NWD A;  2M8U A;  1YRU B;  1UHN A;  4OVN F;  1SR6 B;  1TTX A;  2MHH A;  3EVR A;  1FW4 A;  3LCP C;  2BL0 B;  1SYM A;  2WCJ A;  2P6B B;  1Y1A A;  1KK7 Z;  3IVT A;  4GUK A;  2ZND A;  2WCK A;  2JT0 A;  5JJG A;  1OOI X;  2JOJ A;  1DTL A;  3ICB A;  1S26 D;  4YBH B;  5PAL A;  3I5H B;  2BAP A;  2KAY A;  3E3R A;  4NDC A;  2BCA A;  3PAL A;  1KSM A;  1Z4H A;  1K93 D;  1S36 A;  1WLZ A;  4MVF A;  1NCZ A;  1WDC B;  1F4Q A;  3AAK A;  2KAX A;  3PN7 C;  3CDN A;  2F33 A;  3OBV A;  2H61 C;  3PLF B;  1NP8 A;  3K1E A;  3LLE A;  2CCM A;  2L5Y A;  3DYE A;  3RZS A;  1DJY A;  1QX5 B;  3GK2 A;  1QLK A;  4I5L B;  2KGB C;  3L47 A;  1F54 A;  1SPY A;  1HT9 A;  1AP4 A;  1C3Y A;  1MQ1 A;  2K7O A;  1CFP A;  2GGZ A;  1ZOT B;  3KF9 A;  5CSJ A;  1PK0 D;  3I5I B;  3TZ1 A;  3DVK A;  4PHN A;  2DOQ A;  3MSE B;  3AKA A;  1DF0 B;  2ZKM X;  3BOW B;  3CZT X;  3NGV A;  1OMR A;  2LM5 A;  2GGM A;  3O4Y A;  4JWQ A;  3SIA A;  3TS5 B;  3D10 A;  1U5I A;  3B86 A;  1OW4 A;  2FJU B;  2LAN A;  1JF2 A;  2IS9 A;  2PAS A;  1U5I B;  2KQY A;  4C0J A;  2ERB A;  2NCP A;  4YGC B;  3C1V A;  3I5G B;  1B8R A;  1B8L A;  3SIB A;  3CZ0 A;  1QIW A;  2WND A;  1A03 A;  3SS5 A;  4GGN A;  3DF0 A;  5AAN A;  1QX7 A;  1V1G A;  3BFA A;  2CBL A;  1KCY A;  2Y1N A;  3DF0 B;  1J7Q A;  4MSP A;  1KWO C;  1RTP 1;  3OX6 A;  2LC5 A;  3PM8 A;  3B6X A;  2MBX A;  1SL9 A;  1B7T Y;  1LXF C;  2F3Y A;  2PQL A;  3WHT B;  2P71 A;  1RRO A;  2LVI A;  4P2Y B;  5HL1 A;  3WHU B;  5CSN A;  1RK9 A;  1ALW A;  4GAO A;  1TNW A;  4PCW A;  5HKZ A;  2K8M B;  3NSK A;  1QVI Y;  1LA0 A;  1SK6 D;  1J1D A;  3BFB A;  3BUM B;  3CWG A;  2OS8 C;  2JTT A;  1IRJ A;  1CNP A;  3BYA A;  1YVH A;  1CDN A;  1UHJ A;  1WY9 A;  2LE9 B;  2LHL A;  3D73 A;  1ORG A;  5JOL A;  5B8I B;  2F3Z A;  2LMT A;  1DMO A;  1NX2 A;  1AHR A;  1L2O B;  3KPX A;  3NHT A;  2ZRS A;  3EK4 A;  2FJY A;  1N65 A;  2CNP A;  4OCI A;  2KBM A;  2F2P A;  3DVE A;  4CID A;  1PVB A;  1QLS A;  2HQW A;  3S0F A;  1IH0 A;  2MLE C;  2WCM A;  2WCF A;  1XO5 A;  1JFJ A;  2QEH A;  4PHK A;  4QJ4 B;  1M45 A;  5KTY A;  1BT6 A;  1S6I A;  2LVK A;  2PVB A;  1OOG A;  1FPW A;  3LL8 B;  4M2P A;  1W7J B;  3JVT C;  4U8D A;  4YRU A;  3EG5 B;  4C0K A;  3IQQ A;  1DJG A;  1XK4 A;  1TNX A;  2L4H A;  3SS4 A;  1TN4 A;  1IGV A;  1MHO A;  1TCO B;  1VRK A;  3EVV A;  1CB1 A;  3JTD C;  1Y1U A;  2E30 A;  2LNK A;  1S6C A;  3VRP A;  1A2X A;  2EC6 B;  2JT3 A;  2BKI B;  1S5G Y;  2BE4 A;  4WQ2 A;  1GQM A;  2COL B;  4MN0 A;  4ZCV A;  1SCV A;  1W9Z A;  1JSA A;  2LHI A;  2JUL A;  3S0E A;  4D1E A;  1DJH A;  1OSA A;  3CGA A;  3I5F C;  3GK1 A;  1XFY O;  2CT9 A;  3D74 A;  1BOC A;  1ODB A;  3AAJ A;  3QME A;  4MZJ A;  4HRG A;  2L2E A;  2KI4 B;  1OMV A;  4OV2 A;  2PSR A;  1DGV A;  1LS8 A;  3FWB A;  4F0Z B;  4UPG A;  3O78 A;  1GM0 A;  3SG3 A;  1FI5 A;  3K21 A;  4OZD A;  4CLN A;  1JUO A;  1YUU A;  1XFZ O;  2QEO A;  3CYZ A;  1SKT A;  3B7A A;  1G4Y R;  1K96 A;  2MRD A;  4YGD B;  4PHM A;  4ETO A;  3DZT A;  3I5H C;  1CFF A;  3DVJ A;  1A4P A;  1Y0V H;  2MA2 A;  5DIC A;  4HRE E;  4MRX A;  1PRW A;  1SW8 A;  4JD9 A;  2HPS A;  1BU3 A;  1UWO A;  1OMD A;  1XYD A;  2M1U A;  4MEW A;  3O2P A;  2JU0 A;  2YGU A;  5IBW A;  1NCX A;  1TNP A;  4GNK B;  5CPV A;  1Y6W A;  3PJI A;  2KFF A;  3LK0 A;  3S0A A;  1A75 B;  2KBI A;  4OKH A;  2BEC A;  1BF5 A;  1SMG A;  1UHI A;  4TNC A;  1V1F A;  4DIR A;  2BE6 A;  4JPZ B;  2KPH A;  4WRI A;  1RFJ A;  3R1P A;  1QXP A;  4N1G A;  4AQJ A;  3FE9 A;  3AKB A;  3I5I C;  2KNE A;  2QAC A;  2PYQ A;  3N7H A;  5I2Q A;  5I8N A;  1F71 A;  1K9P A;  1SSE B;  1XFV O;  1YUR A;  1LVC D;  3TS5 C;  1SY9 A;  1J1E A;  1CM1 A;  4P5O E;  1Z2C B;  2JXC A;  1RWY A;  3BFH A;  1S6J A;  1DF0 A;  3BOW A;  2KI6 C;  2L50 A;  3H4S E;  4ORC B;  1DQE A;  3O6B A;  1KQM B;  3NSI A;  5DKQ A;  3CAB A;  3WNX B;  1N0Y A;  2AAO A;  1Y1X A;  2OTG C;  3I5G C;  4FQT A;  3VRQ A;  4GPL B;  4GFT A;  1OOH A;  3OB1 B;  4ICB A;  3S0D A;  2G2B A;  1KK8 C;  2QEV A;  5AER A;  3DD4 A;  2MAZ A;  2K7C A;  1UUS A;  1IKU A;  3O4X A;  2NCO A;  2JT8 A;  2I2R E;  1H8B A;  1IWQ A;  3GK4 X;  2BBN A;  1TWO A;  1BR1 B;  2LMV A;  2PRU A;  2QPT A;  4YI8 A;  3KEV A;  3PN7 B;  5D7F A;  1CTR A;  4M2Q A;  1DEK A;  1QS7 A;  2V53 A;  1CLL A;  3EKH A;  1F4O A;  1S5G Z;  4A4B A;  2L4I A;  4XYN A;  3A8R A;  5CSF A;  2JNX A;  1UUR A;  2JTZ A;  2FOT A;  1BG1 A;  1IJ5 A;  2KYC A;  1LKJ A; 
#chains in the Genus database with same CATH homology
 4PE4 A;  2ZNE A;  2EGD A;  1YX8 A;  1YVL A;  2Q91 A;  3GOF A;  5F6T A;  3CR5 X;  4GBA A;  2KYF A;  1CLM A;  1RJV A;  2LLU A;  3LK1 A;  4MLW A;  1YUS A;  4HSZ A;  2SCP A;  2D8N A;  1KK7 Y;  4L9M A;  1B9A A;  4PE0 A;  2F2O A;  1SL7 A;  3VRN A;  1DJI A;  2I18 A;  4OR9 B;  3CS1 A;  3IF7 A;  1IQ3 A;  3QRX A;  1YRT B;  1MWN A;  1TIZ A;  2FCE A;  1DVI A;  1XK4 C;  2BCB A;  2I7A A;  2M7N A;  2KFH A;  4MRY A;  5HLV A;  1WLM A;  2LMU A;  4I5K A;  1LIN A;  2L98 A;  5I2L A;  1WRZ A;  2EC6 C;  2RGI A;  1E8A A;  1SCM C;  2KHN A;  3PSR A;  1XVJ A;  1S3P A;  4N5X A;  4GGF A;  4DCK A;  1TCF A;  1ZMZ A;  1MUX A;  2JWW A;  2O60 A;  2ZRT A;  5GQQ C;  1NX0 A;  2PMY A;  1JWD A;  2F8P A;  3FIA A;  5AFP A;  2E6W A;  1GJY A;  2EHB A;  1BOD A;  3SG5 A;  1CLB A;  4USL A;  1B4C A;  1HQV A;  1QAS A;  1ZAC A;  2KSP A;  1AJ4 A;  1C7W A;  3NSL A;  1PAL A;  2PAL A;  1QV0 A;  3BUW B;  5J3X A;  1QV1 A;  3BUN B;  1AJ5 A;  4CFR A;  2R2I A;  4QJ3 B;  1NX3 A;  2LVJ A;  1TOP A;  2JPT A;  3SG6 A;  1CDM A;  3BUO B;  1GGW A;  1KQV A;  1SR6 C;  1QJT A;  5HLO A;  3FWC A;  2BL0 C;  3RLZ A;  3TDU A;  2GV5 A;  1NCY A;  2WOS A;  3JVT B;  4CFQ A;  1C07 A;  1J7R A;  4ORB B;  1D1O A;  2K61 A;  1UHK A;  2BKH B;  5BPJ A;  1QTX A;  1S1E A;  4Q04 A;  1OE9 B;  1R2U A;  2I94 A;  2NLN A;  5DKN A;  1MXE A;  2JQ6 A;  5KU1 A;  4YGA A;  3RM1 A;  5D69 A;  1BJF A;  3D0Y B;  4FQO A;  4FTG A;  1J7O A;  1IQ5 A;  1CM4 A;  1SNL A;  1WDC C;  1EJ3 A;  3OB2 B;  5DKR A;  4PE7 A;  1A75 A;  2LCP A;  1M46 A;  4MZK A;  2L51 A;  3TUY B;  4BY5 A;  2B1U A;  3I5F B;  1NYA A;  1W7I B;  1B7T Z;  1NUB A;  2Y4Q A;  1BMO A;  3TDI A;  1SRA A;  4PDZ A;  2AUC A;  3NXA A;  5AXI A;  5TNC A;  3TDZ A;  3PFV A;  1B8C A;  2LP3 A;  2Q4U A;  1QVI Z;  1NX1 A;  5FYX A;  3ZWH A;  1CDP A;  1F55 A;  4XJK B;  1M39 A;  1KQM C;  1M63 B;  1IJ6 A;  1REC A;  2KAV A;  5KSZ A;  1H4B A;  1JBA A;  2ISD A;  2MJW B;  3VRR A;  2MLF C;  3VRO A;  1QX2 A;  1FF1 A;  1K2H A;  2M29 A;  1CFC A;  1CKK A;  2ZN8 A;  2LAP A;  1IG5 A;  4NDB A;  1YR5 A;  4R1E A;  1R6P A;  2JZI A;  2K7D A;  1G33 A;  4YGB B;  3SG2 A;  2A4J A;  2WCB A;  1AVS A;  4JQ0 D;  2LV7 A;  2HET A;  4AQI A;  4ZCU A;  1XFU O;  4ORA B;  1XFW O;  4DUQ A;  1K94 A;  2G9B A;  4PAL A;  4BY4 A;  1M31 A;  2NXQ A;  2H61 A;  2ZN9 A;  1OOJ A;  1FBV A;  2HQ8 A;  1YX7 A;  3A4U B;  4M2O A;  2M9G A;  4YGE B;  2L5X B;  1J55 A;  2ZFD A;  1C7V A;  1Q80 A;  1B47 A;  2KI6 D;  3EK8 A;  5AEQ A;  1K9U A;  5HKY A;  1CMF A;  1FI6 A;  1JF0 A;  1K95 A;  3PAT A;  1AK8 A;  1UHH A;  1K8U A;  1L2O C;  4DRW A;  1YTZ C;  1G8I A;  5ER5 A;  1QAT A;  4CPV A;  1ALV A;  1DT7 B;  2OTG B;  4E68 A;  2WOR A;  2AMI A;  3DVM A;  4I5N B;  1TNQ A;  5HYD A;  1DGU A;  1OQP A;  1KK8 B;  1ZUZ A;  1K9K A;  1OZO A;  2CXJ A;  3IQO A;  1XFX O;  1EL4 A;  1MR8 A;  2KDH A;  1CDL A;  2WC8 A;  3F45 A;  2JXL A;  1PSB A;  1SL8 A;  2M97 A;  4I5J A;  1WRK A;  1B1G A;  4WQ3 A;  1GGZ A;  3FS7 A;  4GGF C;  1EH2 A;  2K7B A;  2M0R A;  1NSH A;  3HCM A;  1KSO A;  1EG4 A;  1KWO B;  2NZ0 A;  3EKJ A;  2BCX A;  2M49 B;  1BR4 B;  1KFX S;  2M3W A;  5ER4 X;  5K89 A;  3OHM B;  2LLS A;  1DJW A;  1PVA A;  2OS8 B;  4MZL A;  1YUT A;  2JNF A;  2KI4 C;  3SG7 A;  2M7L A;  3BXK A;  4N1F A;  1LA3 A;  1WRL A;  2VRG A;  1JFK A;  1SBJ A;  1QIV A;  2WCE A;  2LP2 A;  3NSO A;  4A4B A;  2HF5 A;  1J7P A;  1KFU S;  1PUL A;  1K90 D;  4AOM A;  5G08 A;  2LUC A;  2FCD A;  3M0W A;  4PE1 A;  3SG4 A;  3KO0 A;  3KHE A;  1F70 A;  2K0J A;  3EVU A;  3ZNI A;  2CTN A;  2LVV A;  2H2K A;  3OX5 A;  3SJS A;  1CFD A;  1NIW A;  1A29 A;  1UP5 A;  2SAS A;  1BLQ A;  2K2A A;  3HX4 A;  4DS7 A;  4C0L A;  2Y5I A;  5HKW A;  1PSR A;  1SCM B;  1NPQ A;  2M1K B;  4IL1 A;  4NQG A;  3WXA A;  4MBE A;  1KFX L;  3D0Y A;  2Y1M A;  4NDD A;  1TRF A;  2BBM A;  3JTD B;  1AUI B;  1ZFS A;  3TUY C;  2JRF A;  4YI9 A;  2KQ6 A;  3EK7 A;  1XA5 A;  2TN4 A;  1JC2 A;  2LUX A;  2LLT A;  2OPO A;  4A4C A;  2JC2 A;  1EXR A;  1DJX A;  1MF8 B;  2KFG A;  2L0P A;  3CLN A;  1CMG A;  3VGO A;  1KFU L;  2KGR A;  2O5G A;  3CTN A;  1MXL C;  1EG3 A;  4QJ5 B;  1DJZ A;  1F8H A;  3CR2 A;  1L7Z A;  3BUX B;  2KOT A;  4PHJ A;  3OP0 A;  5I2O A;  3BQ3 A;  5CSI A;  1OZS A;  2K2F A;  4HRH A;  1N2D A;  4XJK A;  3CR4 X;  1X02 A;  1NWD A;  2M8U A;  1YRU B;  1UHN A;  4OVN F;  1SR6 B;  1TTX A;  2MHH A;  3EVR A;  1FW4 A;  3LCP C;  2BL0 B;  1SYM A;  2P6B B;  1Y1A A;  1KK7 Z;  4GUK A;  2ZND A;  2JT0 A;  5JJG A;  2JOJ A;  1DTL A;  3ICB A;  1S26 D;  4YBH B;  5PAL A;  3I5H B;  2KAY A;  3E3R A;  4NDC A;  2BCA A;  3PAL A;  1KSM A;  1K93 D;  1S36 A;  1WLZ A;  4MVF A;  1NCZ A;  1WDC B;  1F4Q A;  3AAK A;  2KAX A;  3PN7 C;  2F33 A;  2H61 C;  3PLF B;  1NP8 A;  3LLE A;  2CCM A;  1DJY A;  1QX5 B;  3GK2 A;  1QLK A;  4I5L B;  2KGB C;  1F54 A;  1SPY A;  1HT9 A;  1AP4 A;  1MQ1 A;  2K7O A;  1CFP A;  2GGZ A;  1ZOT B;  3KF9 A;  5CSJ A;  1PK0 D;  3I5I B;  3TZ1 A;  3DVK A;  4PHN A;  2DOQ A;  3MSE B;  3AKA A;  1DF0 B;  2ZKM X;  3BOW B;  3CZT X;  1OMR A;  2LM5 A;  2GGM A;  3O4Y A;  4JWQ A;  3SIA A;  3TS5 B;  3D10 A;  1U5I A;  2FJU B;  2LAN A;  1JF2 A;  2IS9 A;  2PAS A;  1U5I B;  2KQY A;  4C0J A;  2NCP A;  4YGC B;  3C1V A;  3I5G B;  1B8R A;  1B8L A;  3SIB A;  1QIW A;  2WND A;  1A03 A;  4GGN A;  3DF0 A;  5AAN A;  1QX7 A;  1V1G A;  2CBL A;  1KCY A;  2Y1N A;  3DF0 B;  1J7Q A;  4MSP A;  1KWO C;  1RTP 1;  3OX6 A;  2LC5 A;  3PM8 A;  2MBX A;  1SL9 A;  1B7T Y;  1LXF C;  2F3Y A;  3WHT B;  1RRO A;  2LVI A;  4P2Y B;  3WHU B;  5CSN A;  1RK9 A;  1ALW A;  4GAO A;  1TNW A;  4PCW A;  5HKZ A;  2K8M B;  3NSK A;  1QVI Y;  1LA0 A;  1SK6 D;  1J1D A;  3BUM B;  3CWG A;  2OS8 C;  2JTT A;  1IRJ A;  1CNP A;  3BYA A;  1YVH A;  1CDN A;  1UHJ A;  1WY9 A;  2LE9 B;  2LHL A;  5B8I B;  5JOL A;  2F3Z A;  2LMT A;  1DMO A;  1NX2 A;  1AHR A;  1L2O B;  3KPX A;  2ZRS A;  3EK4 A;  1N65 A;  2CNP A;  4OCI A;  2KBM A;  2F2P A;  3DVE A;  4CID A;  1PVB A;  1QLS A;  2HQW A;  1IH0 A;  2MLE C;  2WCF A;  1XO5 A;  1JFJ A;  4PHK A;  4QJ4 B;  1M45 A;  5KTY A;  1BT6 A;  1S6I A;  2LVK A;  2PVB A;  1FPW A;  3LL8 B;  4M2P A;  1W7J B;  3JVT C;  4U8D A;  4YRU A;  4C0K A;  3IQQ A;  1DJG A;  1XK4 A;  1TNX A;  2L4H A;  1TN4 A;  1IGV A;  1MHO A;  1TCO B;  1VRK A;  3EVV A;  1CB1 A;  3JTD C;  1Y1U A;  2E30 A;  2LNK A;  1S6C A;  3VRP A;  1A2X A;  2EC6 B;  2JT3 A;  2BKI B;  1S5G Y;  2BE4 A;  4WQ2 A;  1GQM A;  2COL B;  4MN0 A;  4ZCV A;  1SCV A;  1JSA A;  2LHI A;  2JUL A;  4D1E A;  1DJH A;  1OSA A;  3CGA A;  3I5F C;  3GK1 A;  1XFY O;  2CT9 A;  1BOC A;  1ODB A;  3AAJ A;  4MZJ A;  4HRG A;  2L2E A;  2KI4 B;  1OMV A;  4OV2 A;  2PSR A;  1DGV A;  3FWB A;  4F0Z B;  4UPG A;  3O78 A;  3SG3 A;  1FI5 A;  3K21 A;  4CLN A;  1JUO A;  1YUU A;  1XFZ O;  1SKT A;  1G4Y R;  1K96 A;  2MRD A;  4YGD B;  4PHM A;  4ETO A;  3I5H C;  1CFF A;  3DVJ A;  1A4P A;  1Y0V H;  2MA2 A;  4HRE E;  4MRX A;  1PRW A;  1SW8 A;  2HPS A;  1BU3 A;  1UWO A;  1OMD A;  1XYD A;  2M1U A;  4MEW A;  3O2P A;  2JU0 A;  5IBW A;  1NCX A;  1TNP A;  4GNK B;  5CPV A;  1Y6W A;  2KFF A;  3LK0 A;  1A75 B;  2KBI A;  4OKH A;  2BEC A;  1BF5 A;  1SMG A;  1UHI A;  4TNC A;  1V1F A;  4DIR A;  2BE6 A;  4JPZ B;  4WRI A;  1RFJ A;  1QXP A;  4N1G A;  4AQJ A;  3AKB A;  3I5I C;  2KNE A;  2QAC A;  5I2Q A;  5I8N A;  1F71 A;  1K9P A;  1XFV O;  1YUR A;  1LVC D;  3TS5 C;  1SY9 A;  1J1E A;  1CM1 A;  4P5O E;  2JXC A;  1RWY A;  1S6J A;  1DF0 A;  3BOW A;  2KI6 C;  2L50 A;  3H4S E;  4ORC B;  3O6B A;  1KQM B;  3NSI A;  5DKQ A;  3WNX B;  1N0Y A;  2AAO A;  1Y1X A;  2OTG C;  3I5G C;  3VRQ A;  4GPL B;  4GFT A;  3OB1 B;  4ICB A;  2G2B A;  1KK8 C;  5AER A;  3DD4 A;  2MAZ A;  2K7C A;  1UUS A;  1IKU A;  2NCO A;  2JT8 A;  2I2R E;  1H8B A;  1IWQ A;  3GK4 X;  2BBN A;  1BR1 B;  2LMV A;  2PRU A;  2QPT A;  4YI8 A;  3KEV A;  3PN7 B;  5D7F A;  1CTR A;  4M2Q A;  1QS7 A;  2V53 A;  1CLL A;  3EKH A;  1F4O A;  1S5G Z;  2L4I A;  4XYN A;  3A8R A;  5CSF A;  2JNX A;  1UUR A;  2JTZ A;  2FOT A;  1BG1 A;  1IJ5 A;  2KYC A;  1LKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...