1GJYA

The x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
MDPLYGYFASVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLNPQTVNSIAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSAQQGMVNFSYDDFIQCVMTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding
molecule keywords SORCIN
publication title The Crystal Structure of the Sorcin Calcium Binding Domain Provides a Model of Ca(2+)-Dependent Processes in the Full-Length Protein
pubmed doi rcsb
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gjyA00
1ALWA 2JNXA 1OMVA 1CFPA 4ICBA 1DJIA 3KO0A 4MSPA 4DIRA 1YUSA 2LHLA 2JQ6A 1K94A 3SG6A 3BUWB 1CKKA 2L0PA 3HX4A 4MVFA 1B7TZ 2BCXA 4ORBB 2KI4C 1QJTA 1LVCD 2MAZA 1MXEA 1BR4B 1NX1A 1W7IB 2QPTA 1QVIY 2MBXA 2JNFA 2M49B 3CTNA 2KOTA 3BUNB 1HT9A 2Y4QA 1Y6WA 4BY4A 1OMDA 2M0RA 4QJ5B 1QTXA 1OOJA 1QXPA 2AMIA 2KBMA 2K7BA 4A4BA 1JBAA 3H4SE 3BYAA 3I5FC 3D10A 1FPWA 2MHHA 5AFPA 1F54A 3OHMB 3PN7C 5PALA 2COLB 3SJSA 1J7OA 1K9PA 2K7OA 1KK7Z 2E30A 4JQ0D 4OV2A 1S5GY 1F4QA 1IG5A 1XFZO 2LE9B 1J1DA 1EG3A 1SL7A 3I5HB 1RK9A 1JUOA 2I18A 1YUTA 2EHBA 2ZKMX 1IGVA 1KQMB 2E6WA 2HQWA 1FI5A 2JZIA 1TN4A 1XYDA 3KF9A 3RM1A 1N2DA 2F2OA 4N5XA 1VRKA 1A4PA 5IBWA 1KK8C 1TRFA 4TNCA 1KSOA 2KFGA 3AAJA 1QX7A 1UHKA 1BODA 1GGZA 4MRXA 1FF1A 1K9KA 1MUXA 2BCAA 5ER5A 1J7PA 2O5GA 3VRPA 4YRUA 3FWBA 1AJ4A 1CFFA 1CM4A 1WRLA 1CM1A 3SG3A 2KSPA 4YGAA 1A75B 2KAVA 3VROA 1S26D 2BECA 2JT3A 3EVRA 1XFYO 2LP2A 3TS5C 1BJFA 2M29A 3LLEA 1XK4A 2Q91A 1J7RA 2MRDA 3PATA 1TNQA 1A75A 2RGIA 5HLVA 2F3ZA 1CTRA 2OTGB 3I5GC 3RLZA 3EK4A 1RJVA 3A8RA 3TDIA 1LKJA 2Q4UA 1BLQA 1SCMB 2FCEA 1DJYA 1IJ6A 4L9MA 4DCKA 3ICBA 3SIAA 4GPLB 2JT0A 3OP0A 2EGDA 1SKTA 1JSAA 2SCPA 2KGBC 3E3RA 1RWYA 2LHIA 2M3WA 3D0YA 3DD4A 3O2PA 3CR4X 2LM5A 1XA5A 2GGZA 2IS9A 3I5IB 3EK7A 1AVSA 1DJZA 3IQQA 1N0YA 4GAOA 1F71A 3CLNA 1K96A 1WLZA 1LA3A 1TNPA 3LCPC 2JPTA 3CR2A 1KSMA 3MSEB 4YI8A 2I2RE 2KFFA 2NXQA 2LUXA 2D8NA 1CNPA 2NLNA 3BQ3A 1WLMA 2KDHA 1AHRA 2M7LA 2ZRTA 2CT9A 1KWOB 3WNXB 4OKHA 2BBMA 2K7CA 2WC8A 1L2OC 3EVVA 5AEQA 1ZFSA 2M7NA 1NX2A 3EK8A 2BKIB 1A03A 5DKQA 1CDMA 3AAKA 4AOMA 1RTP1 2F8PA 2KHNA 2M1KB 4JPZB 3SG2A 3WHUB 4WQ2A 1S1EA 1AJ5A 1CFDA 5HLOA 1G4YR 4CFRA 3K21A 1DGVA 1G33A 2HF5A 4M2QA 1S6JA 1TCOB 1YR5A 2L2EA 4D1EA 4BY5A 3EVUA 4HSZA 1PSBA 1MWNA 1YX8A 2GGMA 2BBNA 1WDCC 5CPVA 1CLBA 1K2HA 1YUUA 1CDLA 2MJWB 1YTZC 2I7AA 3DVMA 3OX6A 4FTGA 1H4BA 3TUYC 1QVIZ 1QX2A 1DVIA 4HRGA 1R6PA 5B8IB 5I8NA 4XJKB 1B1GA 1MQ1A 1K8UA 3VRRA 4DUQA 1HQVA 1NCZA 2KQ6A 4PHMA 2KYCA 4DRWA 1TTXA 4NDCA 4YI9A 3SG4A 3VGOA 4YGCB 1V1GA 4CPVA 4XJKA 2HPSA 1B9AA 4HRHA 1PVBA 1KFUL 1YVLA 1NSHA 1S5GZ 2KI6C 1J1EA 2NCPA 1SRAA 1QATA 3DVKA 3VRQA 2GV5A 3WXAA 2EC6B 1ODBA 1EJ3A 2KAYA 3HCMA 3FS7A 3GK4X 4MEWA 1TIZA 2JC2A 2CCMA 1IJ5A 2K7DA 1U5IB 2WNDA 1KFUS 4ZCUA 2L51A 4PE4A 3JVTC 5K89A 4USLA 3WHTB 3PALA 2KYFA 1B8CA 1UHJA 1SL8A 1DTLA 1JFJA 4CIDA 2K2AA 4QJ4B 1U5IA 1SR6C 5AERA 2Y1MA 2KI4B 2MLEC 5AXIA 1RFJA 1AK8A 4GUKA 2A4JA 1UWOA 1NWDA 2BE4A 2H2KA 5GQQC 1EXRA 4NDDA 3CGAA 1MHOA 2OS8C 2DOQA 3I5FB 2BL0C 2JT8A 5D7FA 5TNCA 2AUCA 2R2IA 1DJWA 4GNKB 4YGDB 3PN7B 2FCDA 4P2YB 1DF0B 1WRKA 2LLSA 2Y5IA 1OSAA 2JRFA 4FQOA 2CTNA 1AP4A 5HKWA 1K9UA 3TDZA 2PALA 3KHEA 2L5XB 1SW8A 2ZN9A 1IKUA 1SCMC 4PE0A 5J3XA 2TN4A 1DF0A 4MZJA 2ZN8A 3GK1A 1SCVA 2LLUA 3DVJA 1K90D 2PRUA 3NSLA 3D0YB 4IL1A 5KTYA 1TNXA 4WQ3A 1LINA 3ZWHA 1QV0A 3OB2B 2BE6A 4YGEB 1KK8B 4DS7A 2M8UA 1BT6A 4GBAA 1Y1UA 3KEVA 3O78A 3M0WA 1F8HA 2KFHA 1C7WA 4I5NB 4YBHB 1JF0A 1XFWO 1EL4A 1D1OA 1PK0D 1LA0A 2M1UA 5HKZA 3LK1A 1UHHA 1OZSA 1X02A 5G08A 1PVAA 2JWWA 4Q04A 1SMGA 1NPQA 4ETOA 1XFUO 1PULA 1OQPA 1UP5A 2BCBA 3O6BA 3TDUA 3TS5B 1UHIA 1OE9B 1KFXS 3AKAA 1F70A 1ZACA 4NDBA 3I5GB 1SK6D 5HKYA 4XYNA 1IRJA 4PCWA 1SYMA 3BOWB 1UUSA 2L4IA 5KU1A 1FW4A 3PM8A 4MRYA 1CLLA 1QLSA 2JTZA 3NSOA 1YURA 1H8BA 3JTDC 1F4OA 3ZNIA 4C0LA 2LC5A 2HETA 3NXAA 1ALVA 1IWQA 3BOWA 1S3PA 1SNLA 2B1UA 2CNPA 2LLTA 3C1VA 1ZOTB 4N1GA 1B8RA 4QJ3B 1QV1A 4MBEA 5DKRA 2WOSA 4I5JA 4NQGA 2FJUB 4OCIA 1JC2A 4CFQA 1J7QA 1QLKA 3PLFB 5BPJA 1QASA 1Y0VH 5HYDA 3DF0B 1DGUA 1C07A 1BF5A 1B47A 2L98A 1YX7A 3CWGA 2G2BA 2LAPA 3GK2A 2ZRSA 1FBVA 3GOFA 1ZUZA 1RROA 3DF0A 2PSRA 1BU3A 1E8AA 1L2OB 3LK0A 4PE1A 2EC6C 2KGRA 2M97A 1PRWA 1RECA 1SBJA 1QS7A 3LL8B 1M45A 2LMVA 2LANA 3I5HC 1NP8A 2VRGA 4MZKA 4PDZA 4MLWA 3BXKA 1IQ5A 2JU0A 1G8IA 1TOPA 2ZNEA 1W7JB 3CS1A 1KQMC 1A2XA 1DMOA 1WDCB 1YRTB 1CMGA 1TNWA 1YVHA 1FI6A 3BUXB 4GGFC 1SPYA 3F45A 2SASA 2JTTA 3TUYB 1NCYA 4N1FA 2O60A 2F33A 2K0JA 2KAXA 1B7TY 1S6IA 1KCYA 1GJYA 3DVEA 2I94A 1UURA 1WY9A 1S36A 2JXCA 2JULA 4R1EA 2KBIA 5KSZA 2P6BB 4A4CA 1SL9A 4HREE 1XK4C 4C0KA 1NUBA 4F0ZB 3EKHA 3PSRA 2HQ8A 2NZ0A 4JWQA 3SIBA 5D69A 1MXLC 1NCXA 1KK7Y 2WORA 2L50A 1DJHA 3IQOA 2LUCA 1K93D 2JXLA 1M31A 1V1FA 4PE7A 2LMTA 2OTGC 1MR8A 2K61A 2L4HA 2ZFDA 1AUIB 2CBLA 3JVTB 2V53A 3CR5X 4GGNA 4PHKA 2PMYA 4CLNA 2LV7A 1R2UA 2AAOA 1GGWA 1ZMZA 4P5OE 4C0JA 1CDNA 1SR6B 1WRZA 3AKBA 1M46A 1CB1A 4GGFA 1QIVA 1TCFA 4ZCVA 1BR1B 2ISDA 3I5IC 1LXFC 2KNEA 1XVJA 1A29A 4WRIA 3BUOB 4M2PA 5CSFA 1BOCA 5I2QA 5I2LA 2OS8B 1JF2A 1XFXO 2BL0B 2Y1NA 1EH2A 1EG4A 2BKHB 4GFTA 1CDPA 1C7VA 2ZNDA 1Y1AA 2H61C 1JWDA 1PALA 1KFXL 2CXJA 5CSNA 3OB1B 1M39A 1KWOC 1IQ3A 1YRUB 1J55A 2QACA 2LCPA 2WCBA 1Y1XA 2MA2A 2LP3A 5CSJA 1BG1A 1B4CA 2LVJA 1Q80A 3KPXA 3IF7A 3NSIA 4MN0A 1CMFA 1GQMA 2MLFC 1SY9A 1L7ZA 4MZLA 1XO5A 1K95A 4U8DA 3PFVA 2WCFA 2K8MB 4PALA 3EKJA 2LVVA 1F55A 3BUMB 2FOTA 1IH0A 3FIAA 2LVIA 5JOLA 2M9GA 2LNKA 3FWCA 4PHNA 5ER4X 2KQYA 4YGBB 3CZTX 3TZ1A 1PSRA 3NSKA 5I2OA 4I5KA 1NX0A 1N65A 3OX5A 5F6TA 1NX3A 2WCEA 2LMUA 3O4YA 2JOJA 3SG7A 5FYXA 4M2OA 1B8LA 5JJGA 3QRXA 2KI6D 2NCOA 1DT7B 4I5LB 1BMOA 4UPGA 2H61A 1S6CA 2G9BA 1OMRA 2F2PA 1QIWA 4OVNF 4AQJA 1OZOA 5CSIA 1MF8B 4ORAB 3A4UB 4PHJA 3VRNA 2LVKA 2PASA 1M63B 1KQVA 1NYAA 2F3YA 4OR9B 1QX5B 1CFCA 2PVBA 4ORCB 5AANA 2OPOA 1JFKA 1XFVO 2K2FA 1NIWA 3JTDB 4E68A 1DJXA 4AQIA 5DKNA 1UHNA 3SG5A 1DJGA 1CLMA
chains in the Genus database with same CATH superfamily
1ALWA 2JNXA 1OMVA 1CFPA 4ICBA 1DJIA 3KO0A 5I94A 4MSPA 4DIRA 1YUSA 2LHLA 2JQ6A 1K94A 3SG6A 3BUWB 1CKKA 2L0PA 3HX4A 4MVFA 1B7TZ 2BCXA 4ORBB 2KI4C 1QJTA 1LVCD 2MAZA 1MXEA 1BR4B 1NX1A 1W7IB 2QPTA 1QVIY 5D3OA 2JNFA 2M49B 2WCMA 3CTNA 3L4LA 2KOTA 3BUNB 1HT9A 2Y4QA 3OBVA 1Y6WA 4BY4A 1OMDA 2M0RA 4QJ5B 3N7HA 1QTXA 1OOJA 1QXPA 2AMIA 2KBMA 2K7BA 4A4BA 1JBAA 3H4SE 3BYAA 3I5FC 3D10A 1FPWA 3D74A 3CABA 2MHHA 5AFPA 1F54A 3OHMB 3PN7C 5PALA 2COLB 3SJSA 3O4XA 1J7OA 1K9PA 2BAPA 2K7OA 1KK7Z 3DZTA 2E30A 4JQ0D 4OV2A 1S5GY 1F4QA 1IG5A 1XFZO 2LE9B 1J1DA 1EG3A 1SL7A 3I5HB 1RK9A 1JUOA 2I18A 2PYQA 1YUTA 2EHBA 2ZKMX 1IGVA 3D75A 1KQMB 2E6WA 2HQWA 1FI5A 2JZIA 1TN4A 1XYDA 3KF9A 3RM1A 1N2DA 2F2OA 4N5XA 1VRKA 1A4PA 5IBWA 1KK8C 1TRFA 4TNCA 1KSOA 2KFGA 3AAJA 1QX7A 1UHKA 1BODA 1GGZA 1TWOA 4MRXA 1FF1A 1K9KA 1MUXA 1XFRA 2BCAA 5ER5A 1J7PA 2O5GA 3VRPA 1DQEA 4YRUA 3FWBA 1AJ4A 2QEOA 1CM4A 1WRLA 1CFFA 1CM1A 3SG3A 2KSPA 2WCLA 4YGAA 3B7AA 3UO9A 1A75B 1T14A 3PM2A 2KAVA 3VROA 1S26D 2BECA 2JT3A 3EVRA 1XFYO 2LP2A 3D77A 3TS5C 1BJFA 2M29A 3LLEA 1XK4A 2Q91A 1J7RA 2MRDA 3PATA 1TNQA 1A75A 2RGIA 2MBXA 5HLVA 3SS5A 2F3ZA 1CTRA 2OTGB 3I5GC 3RLZA 3EK4A 1RJVA 3L4AA 3A8RA 3TDIA 1LKJA 2Q4UA 1BLQA 1SCMB 2FCEA 3BJHA 1DJYA 1IJ6A 4L9MA 3UNWA 4DCKA 3ICBA 3SIAA 4GPLB 2JT0A 3OP0A 2EGDA 3DYEA 1SKTA 4KYNA 1JSAA 2SCPA 2KGBC 1C3YA 3E3RA 1RWYA 2LHIA 2M3WA 3D0YA 3DD4A 3O2PA 3CR4X 2LM5A 1XA5A 2GGZA 2IS9A 3I5IB 3EK7A 1AVSA 1DJZA 3IQQA 1N0YA 4GAOA 1F71A 3CLNA 1K96A 1WLZA 1LA3A 1TNPA 3LCPC 2JPTA 3CYZA 3CR2A 1KSMA 3PJIA 3MSEB 4YI8A 2I2RE 2KFFA 2NXQA 2LUXA 2D8NA 4JKTA 1CNPA 3VB1A 2NLNA 3BQ3A 1WLMA 2KDHA 1DC1A 1AHRA 2M7LA 2ZRTA 2CT9A 1KWOB 3WNXB 4OKHA 3DY9A 2BBMA 2K7CA 3RZSA 2WC8A 1L2OC 3EVVA 5AEQA 1ZFSA 2M7NA 1NX2A 3EK8A 2BKIB 1A03A 5DKQA 1CDMA 3AAKA 4AOMA 1RTP1 4FQTA 2F8PA 2KHNA 2M1KB 4JPZB 3SG2A 3WHUB 4WQ2A 2L5YA 1S1EA 1AJ5A 1CFDA 5HLOA 1G4YR 3BFHA 4CFRA 3SS4A 3K21A 1DGVA 1G33A 2HF5A 4M2QA 1S6JA 1TCOB 1YR5A 2L2EA 4D1EA 4BY5A 3EVUA 1C3ZA 4HSZA 1PSBA 1MWNA 1OOHA 1YX8A 2BBNA 1WDCC 2GGMA 5CPVA 1CLBA 1K2HA 2BNXA 1YUUA 1CDLA 2MJWB 1YTZC 2I7AA 3DVMA 3OX6A 4FTGA 1H4BA 3TUYC 1QVIZ 1QX2A 1DVIA 4HRGA 4JD9A 1R6PA 3QMEA 5B8IB 5I8NA 4XJKB 1B1GA 1MQ1A 1K8UA 3VRRA 4DUQA 1HQVA 1NCZA 2KQ6A 4PHMA 2KYCA 4DRWA 1TTXA 4NDCA 4YI9A 3CZ0A 3SG4A 3VGOA 4YGCB 1V1GA 4CPVA 4XJKA 2HPSA 1B9AA 4HRHA 1PVBA 1KFUL 1YVLA 1NSHA 1S5GZ 2KI6C 1J1EA 2NCPA 1SRAA 3BFBA 1QATA 3DVKA 3VRQA 2GV5A 3WXAA 2EC6B 1ODBA 1EJ3A 1QWVA 2KAYA 3HCMA 3FS7A 2WC5A 3GK4X 4MEWA 1TIZA 2JC2A 2CCMA 1IJ5A 2K7DA 2JPOA 1U5IB 1OOFA 2WNDA 1KFUS 4ZCUA 2L51A 4PE4A 3JVTC 5K89A 4USLA 3WHTB 3PALA 2KYFA 3IVTA 1B8CA 1UHJA 1SL8A 1DTLA 1JFJA 4CIDA 2K2AA 4QJ4B 1U5IA 1SR6C 4F7FA 2Y1MA 5AERA 3B6XA 2KI4B 2MLEC 2PQLA 5AXIA 1RFJA 3DXLA 1AK8A 4GUKA 2A4JA 3S0EA 3FE6A 3NHIA 1UWOA 1NWDA 2BE4A 2H2KA 5GQQC 1EXRA 4NDDA 5FI2A 3CGAA 1MHOA 2OS8C 2DOQA 3I5FB 2BL0C 2JT8A 5D7FA 5TNCA 2AUCA 2R2IA 1DJWA 4GNKB 4YGDB 1GM0A 3PN7B 2FCDA 4P2YB 1DF0B 1WRKA 2LLSA 2KPHA 2Y5IA 1DEKA 1OSAA 2JRFA 4FQOA 2CTNA 1AP4A 5HKWA 1K9UA 3TDZA 2PALA 3KHEA 2L5XB 1SW8A 2ZN9A 1IKUA 1SCMC 5FI7A 4PE0A 5J3XA 2TN4A 1DF0A 2KLDA 4MZJA 1TUJA 1TUZA 2ZN8A 3GK1A 1SCVA 2LLUA 3DVJA 1K90D 2PRUA 3NSLA 3D0YB 4IL1A 5KTYA 1TNXA 4WQ3A 1LINA 3ZWHA 1QV0A 3OB2B 2QEBA 2BE6A 4YGEB 1KK8B 4DS7A 2M8UA 1BT6A 4GBAA 1Y1UA 3S0FA 3KEVA 3O78A 3M0WA 3R72A 1F8HA 2KFHA 1C7WA 4I5NB 4YBHB 1JF0A 1XFWO 1EL4A 1D1OA 1PK0D 1LA0A 1SSEB 3NGVA 2M1UA 2WCHA 5HKZA 3LK1A 1UHHA 1OZSA 1X02A 3D73A 5G08A 1PVAA 2JWWA 3V2LA 4Q04A 1DELA 1SMGA 1NPQA 4ETOA 1XFUO 1PULA 5DICA 1OQPA 1UP5A 2BCBA 3O6BA 3TDUA 3TS5B 2P70A 1UHIA 1OE9B 1KFXS 3AKAA 1F70A 1ZACA 4NDBA 3I5GB 1SK6D 5HKYA 4XYNA 1IRJA 4PCWA 1SYMA 3BOWB 1UUSA 2L4IA 5KU1A 1FW4A 3PM8A 4MRYA 1CLLA 1QLSA 2JTZA 3NSOA 1YURA 3B87A 4OZDA 3JTDC 2K60A 1H8BA 1F4OA 3ZNIA 4C0LA 2LC5A 4PT1A 2HETA 3NXAA 1ALVA 1IWQA 3BOWA 1S3PA 1SNLA 2B1UA 2CNPA 2LLTA 3C1VA 1ZOTB 4N1GA 1B8RA 4QJ3B 1QV1A 4MBEA 5DKRA 1ORGA 2WOSA 4I5JA 4NQGA 2FJUB 4OCIA 1JC2A 3R1VA 4CFQA 1QLKA 3PLFB 5BPJA 1J7QA 1QASA 1Y0VH 5HYDA 3DF0B 1DGUA 1C07A 1BF5A 4INXA 1B47A 2L98A 1YX7A 3CWGA 2G2BA 2L2CA 2LAPA 3GK2A 3R1OA 2ZRSA 1FBVA 3GOFA 1ZUZA 1RROA 3DF0A 2PSRA 3R1PA 1BU3A 1E8AA 1L2OB 3LK0A 3B86A 4PE1A 2EC6C 2ERBA 2KGRA 3OGNA 2M97A 3FE9A 1PRWA 1RECA 1SBJA 1QS7A 3LL8B 1M45A 2LMVA 2LANA 3I5HC 1NP8A 2VRGA 4MZKA 4PDZA 3K1EA 4MLWA 3BXKA 1IQ5A 2JU0A 3B88A 1G8IA 1TOPA 2ZNEA 1W7JB 2WC6A 3CS1A 1KQMC 1A2XA 1DMOA 1WDCB 1YRTB 1CMGA 1TNWA 1YVHA 1FI6A 3BUXB 4GGFC 1SPYA 3F45A 2SASA 2JTTA 3TUYB 1NCYA 3CDNA 2O60A 4N1FA 2F33A 2K0JA 2KAXA 1B7TY 1S6IA 1KCYA 1GJYA 3DVEA 2I94A 1UURA 1WY9A 1S36A 5EL2A 2JXCA 2JULA 4R1EA 2KBIA 5KSZA 2P6BB 4A4CA 1SL9A 4HREE 1XK4C 4C0KA 4IJ7A 1NUBA 1W9ZA 4F0ZB 2KLEA 3EKHA 3PSRA 1OOGA 2HQ8A 2NZ0A 4JWQA 3SIBA 3S0GA 5D69A 1MXLC 1NCXA 3S0AA 1KK7Y 2WORA 2L50A 1DJHA 3IQOA 2LUCA 1K93D 2JXLA 1M31A 1V1FA 4PE7A 2H8VA 2LMTA 2OTGC 1IIOA 1MR8A 2K61A 2L4HA 2ZFDA 3CZ2A 1AUIB 2CBLA 3JVTB 2V53A 3CR5X 4GGNA 4PHKA 1Z2CB 2PMYA 4CLNA 3BFAA 2LV7A 2QEHA 3L47A 1R2UA 2AAOA 1GGWA 1ZMZA 3FE8A 4P5OE 4C0JA 1CDNA 1SR6B 1WRZA 3AKBA 1M46A 1CB1A 4GGFA 1QIVA 1TCFA 4ZCVA 1BR1B 2ISDA 3I5IC 1LXFC 2KNEA 1XVJA 1A29A 4WRIA 3BUOB 4M2PA 5CSFA 1BOCA 5I2QA 5I2LA 2OS8B 2QEVA 1JF2A 1XFXO 2BL0B 2Y1NA 1EH2A 1EG4A 2BKHB 4GFTA 1CDPA 1C7VA 2ZNDA 1Y1AA 2H61C 1JWDA 1PALA 1KFXL 2CXJA 5CSNA 3OB1B 1M39A 1KWOC 2WCJA 1IQ3A 1YRUB 1J55A 2QACA 2LCPA 2WCBA 1Y1XA 2MA2A 2LP3A 3Q8IA 5CSJA 3S0DA 1BG1A 1B4CA 2LVJA 1Q80A 3KPXA 3IF7A 3NSIA 4MN0A 1CMFA 1GQMA 2MLFC 1SY9A 1L7ZA 3NHTA 4MZLA 1XO5A 1K95A 4U8DA 3PFVA 3CZ1A 2WCFA 2K8MB 4PALA 3EKJA 3S0BA 2LVVA 1F55A 3BUMB 2FOTA 1OW4A 1IH0A 3FIAA 2LVIA 5JOLA 2M9GA 2LNKA 3FWCA 4PHNA 5ER4X 2KQYA 4YGBB 3CZTX 3TZ1A 1PSRA 3NSKA 5I2OA 4I5KA 5FI6A 1NX0A 1N65A 3D78A 3OX5A 1NX3A 2WCEA 2LMUA 5F6TA 3O4YA 2JOJA 3SG7A 2WCKA 2GTEA 5FYXA 2QDIA 1B8LA 4M2OA 3QRXA 2KI6D 2NCOA 4INWA 5JJGA 1DT7B 1LS8A 4I5LB 1BMOA 2P71A 4UPGA 2H61A 1S6CA 2G9BA 1OMRA 2F2PA 1QIWA 4OVNF 4AQJA 1OZOA 5CSIA 1P28A 5HL1A 1MF8B 4ORAB 3A4UB 2FJYA 4PHJA 3VRNA 2LVKA 2PASA 1Z4HA 1M63B 1KQVA 1NYAA 2F3YA 4OR9B 3EG5B 2YGUA 1QX5B 1OOIX 1CFCA 2PVBA 4ORCB 5AANA 2OPOA 1JFKA 1XFVO 3SS3A 2K2FA 1NIWA 3JTDB 4E68A 1DJXA 4AQIA 5DKNA 1UHNA 3D76A 3SG5A 1DJGA 1CLMA
chains in the Genus database with same CATH topology
1ALWA 2JNXA 1OMVA 1CFPA 4ICBA 1DJIA 3KO0A 4MSPA 4DIRA 1YUSA 2LHLA 2JQ6A 1K94A 3SG6A 3BUWB 1CKKA 2L0PA 3HX4A 4MVFA 1B7TZ 2BCXA 4ORBB 2KI4C 1QJTA 1LVCD 2MAZA 1MXEA 1BR4B 1NX1A 1W7IB 2QPTA 1QVIY 2MBXA 2JNFA 2M49B 3CTNA 2KOTA 3BUNB 1HT9A 2Y4QA 1Y6WA 4BY4A 1OMDA 2M0RA 4QJ5B 1QTXA 1OOJA 1QXPA 2AMIA 2KBMA 2K7BA 4A4BA 1JBAA 3H4SE 3BYAA 3I5FC 3D10A 1FPWA 2MHHA 5AFPA 1F54A 3OHMB 3PN7C 5PALA 2COLB 3SJSA 1J7OA 1K9PA 2K7OA 1KK7Z 2E30A 4JQ0D 4OV2A 1S5GY 1F4QA 1IG5A 1XFZO 2LE9B 1J1DA 1EG3A 1SL7A 3I5HB 1RK9A 1JUOA 2I18A 1YUTA 2EHBA 2ZKMX 1IGVA 1KQMB 2E6WA 2HQWA 1FI5A 2JZIA 1TN4A 1XYDA 3KF9A 3RM1A 1N2DA 2F2OA 4N5XA 1VRKA 1A4PA 5IBWA 1KK8C 1TRFA 4TNCA 1KSOA 2KFGA 3AAJA 1QX7A 1UHKA 1BODA 1GGZA 4MRXA 1FF1A 1K9KA 1MUXA 2BCAA 5ER5A 1J7PA 2O5GA 3VRPA 4YRUA 3FWBA 1AJ4A 1CFFA 1CM4A 1WRLA 1CM1A 3SG3A 2KSPA 4YGAA 1A75B 2KAVA 3VROA 1S26D 2BECA 2JT3A 3EVRA 1XFYO 2LP2A 3TS5C 1BJFA 2M29A 3LLEA 1XK4A 2Q91A 1J7RA 2MRDA 3PATA 1TNQA 1A75A 2RGIA 5HLVA 2F3ZA 1CTRA 2OTGB 3I5GC 3RLZA 3EK4A 1RJVA 3A8RA 3TDIA 1LKJA 2Q4UA 1BLQA 1SCMB 2FCEA 1DJYA 1IJ6A 4L9MA 4DCKA 3ICBA 3SIAA 4GPLB 2JT0A 3OP0A 2EGDA 1SKTA 1JSAA 2SCPA 2KGBC 3E3RA 1RWYA 2LHIA 2M3WA 3D0YA 3DD4A 3O2PA 3CR4X 2LM5A 1XA5A 2GGZA 2IS9A 3I5IB 3EK7A 1AVSA 1DJZA 3IQQA 1N0YA 4GAOA 1F71A 3CLNA 1K96A 1WLZA 1LA3A 1TNPA 3LCPC 2JPTA 3CR2A 1KSMA 3MSEB 4YI8A 2I2RE 2KFFA 2NXQA 2LUXA 2D8NA 1CNPA 2NLNA 3BQ3A 1WLMA 2KDHA 1AHRA 2M7LA 2ZRTA 2CT9A 1KWOB 3WNXB 4OKHA 2BBMA 2K7CA 2WC8A 1L2OC 3EVVA 5AEQA 1ZFSA 2M7NA 1NX2A 3EK8A 2BKIB 1A03A 5DKQA 1CDMA 3AAKA 4AOMA 1RTP1 2F8PA 2KHNA 2M1KB 4JPZB 3SG2A 3WHUB 4WQ2A 1S1EA 1AJ5A 1CFDA 5HLOA 1G4YR 4CFRA 3K21A 1DGVA 1G33A 2HF5A 4M2QA 1S6JA 1TCOB 1YR5A 2L2EA 4D1EA 4BY5A 3EVUA 4HSZA 1PSBA 1MWNA 1YX8A 2GGMA 2BBNA 1WDCC 5CPVA 1CLBA 1K2HA 1YUUA 1CDLA 2MJWB 1YTZC 2I7AA 3DVMA 3OX6A 4FTGA 1H4BA 3TUYC 1QVIZ 1QX2A 1DVIA 4HRGA 1R6PA 5B8IB 5I8NA 4XJKB 1B1GA 1MQ1A 1K8UA 3VRRA 4DUQA 1HQVA 1NCZA 2KQ6A 4PHMA 2KYCA 4DRWA 1TTXA 4NDCA 4YI9A 3SG4A 3VGOA 4YGCB 1V1GA 4CPVA 4XJKA 2HPSA 1B9AA 4HRHA 1PVBA 1KFUL 1YVLA 1NSHA 1S5GZ 2KI6C 1J1EA 2NCPA 1SRAA 1QATA 3DVKA 3VRQA 2GV5A 3WXAA 2EC6B 1ODBA 1EJ3A 2KAYA 3HCMA 3FS7A 3GK4X 4MEWA 1TIZA 2JC2A 2CCMA 1IJ5A 2K7DA 1U5IB 2WNDA 1KFUS 4ZCUA 2L51A 4PE4A 3JVTC 5K89A 4USLA 3WHTB 3PALA 2KYFA 1B8CA 1UHJA 1SL8A 1DTLA 1JFJA 4CIDA 2K2AA 4QJ4B 1U5IA 1SR6C 5AERA 2Y1MA 2KI4B 2MLEC 5AXIA 1RFJA 1AK8A 4GUKA 2A4JA 1UWOA 1NWDA 2BE4A 2H2KA 5GQQC 1EXRA 4NDDA 3CGAA 1MHOA 2OS8C 2DOQA 3I5FB 2BL0C 2JT8A 5D7FA 5TNCA 2AUCA 2R2IA 1DJWA 4GNKB 4YGDB 3PN7B 2FCDA 4P2YB 1DF0B 1WRKA 2LLSA 2Y5IA 1OSAA 2JRFA 4FQOA 2CTNA 1AP4A 5HKWA 1K9UA 3TDZA 2PALA 3KHEA 2L5XB 1SW8A 2ZN9A 1IKUA 1SCMC 4PE0A 5J3XA 2TN4A 1DF0A 4MZJA 2ZN8A 3GK1A 1SCVA 2LLUA 3DVJA 1K90D 2PRUA 3NSLA 3D0YB 4IL1A 5KTYA 1TNXA 4WQ3A 1LINA 3ZWHA 1QV0A 3OB2B 2BE6A 4YGEB 1KK8B 4DS7A 2M8UA 1BT6A 4GBAA 1Y1UA 3KEVA 3O78A 3M0WA 1F8HA 2KFHA 1C7WA 4I5NB 4YBHB 1JF0A 1XFWO 1EL4A 1D1OA 1PK0D 1LA0A 2M1UA 5HKZA 3LK1A 1UHHA 1OZSA 1X02A 5G08A 1PVAA 2JWWA 4Q04A 1SMGA 1NPQA 4ETOA 1XFUO 1PULA 1OQPA 1UP5A 2BCBA 3O6BA 3TDUA 3TS5B 1UHIA 1OE9B 1KFXS 3AKAA 1F70A 1ZACA 4NDBA 3I5GB 1SK6D 5HKYA 4XYNA 1IRJA 4PCWA 1SYMA 3BOWB 1UUSA 2L4IA 5KU1A 1FW4A 3PM8A 4MRYA 1CLLA 1QLSA 2JTZA 3NSOA 1YURA 1H8BA 3JTDC 1F4OA 3ZNIA 4C0LA 2LC5A 2HETA 3NXAA 1ALVA 1IWQA 3BOWA 1S3PA 1SNLA 2B1UA 2CNPA 2LLTA 3C1VA 1ZOTB 4N1GA 1B8RA 4QJ3B 1QV1A 4MBEA 5DKRA 2WOSA 4I5JA 4NQGA 2FJUB 4OCIA 1JC2A 4CFQA 1J7QA 1QLKA 3PLFB 5BPJA 1QASA 1Y0VH 5HYDA 3DF0B 1DGUA 1C07A 1BF5A 1B47A 2L98A 1YX7A 3CWGA 2G2BA 2LAPA 3GK2A 2ZRSA 1FBVA 3GOFA 1ZUZA 1RROA 3DF0A 2PSRA 1BU3A 1E8AA 1L2OB 3LK0A 4PE1A 2EC6C 2KGRA 2M97A 1PRWA 1RECA 1SBJA 1QS7A 3LL8B 1M45A 2LMVA 2LANA 3I5HC 1NP8A 2VRGA 4MZKA 4PDZA 4MLWA 3BXKA 1IQ5A 2JU0A 1G8IA 1TOPA 2ZNEA 1W7JB 3CS1A 1KQMC 1A2XA 1DMOA 1WDCB 1YRTB 1CMGA 1TNWA 1YVHA 1FI6A 3BUXB 4GGFC 1SPYA 3F45A 2SASA 2JTTA 3TUYB 1NCYA 4N1FA 2O60A 2F33A 2K0JA 2KAXA 1B7TY 1S6IA 1KCYA 1GJYA 3DVEA 2I94A 1UURA 1WY9A 1S36A 2JXCA 2JULA 4R1EA 2KBIA 5KSZA 2P6BB 4A4CA 1SL9A 4HREE 1XK4C 4C0KA 1NUBA 4F0ZB 3EKHA 3PSRA 2HQ8A 2NZ0A 4JWQA 3SIBA 5D69A 1MXLC 1NCXA 1KK7Y 2WORA 2L50A 1DJHA 3IQOA 2LUCA 1K93D 2JXLA 1M31A 1V1FA 4PE7A 2LMTA 2OTGC 1MR8A 2K61A 2L4HA 2ZFDA 1AUIB 2CBLA 3JVTB 2V53A 3CR5X 4GGNA 4PHKA 2PMYA 4CLNA 2LV7A 1R2UA 2AAOA 1GGWA 1ZMZA 4P5OE 4C0JA 1CDNA 1SR6B 1WRZA 3AKBA 1M46A 1CB1A 4GGFA 1QIVA 1TCFA 4ZCVA 1BR1B 2ISDA 3I5IC 1LXFC 2KNEA 1XVJA 1A29A 4WRIA 3BUOB 4M2PA 5CSFA 1BOCA 5I2QA 5I2LA 2OS8B 1JF2A 1XFXO 2BL0B 2Y1NA 1EH2A 1EG4A 2BKHB 4GFTA 1CDPA 1C7VA 2ZNDA 1Y1AA 2H61C 1JWDA 1PALA 1KFXL 2CXJA 5CSNA 3OB1B 1M39A 1KWOC 1IQ3A 1YRUB 1J55A 2QACA 2LCPA 2WCBA 1Y1XA 2MA2A 2LP3A 5CSJA 1BG1A 1B4CA 2LVJA 1Q80A 3KPXA 3IF7A 3NSIA 4MN0A 1CMFA 1GQMA 2MLFC 1SY9A 1L7ZA 4MZLA 1XO5A 1K95A 4U8DA 3PFVA 2WCFA 2K8MB 4PALA 3EKJA 2LVVA 1F55A 3BUMB 2FOTA 1IH0A 3FIAA 2LVIA 5JOLA 2M9GA 2LNKA 3FWCA 4PHNA 5ER4X 2KQYA 4YGBB 3CZTX 3TZ1A 1PSRA 3NSKA 5I2OA 4I5KA 1NX0A 1N65A 3OX5A 5F6TA 1NX3A 2WCEA 2LMUA 3O4YA 2JOJA 3SG7A 5FYXA 4M2OA 1B8LA 5JJGA 3QRXA 2KI6D 2NCOA 1DT7B 4I5LB 1BMOA 4UPGA 2H61A 1S6CA 2G9BA 1OMRA 2F2PA 1QIWA 4OVNF 4AQJA 1OZOA 5CSIA 1MF8B 4ORAB 3A4UB 4PHJA 3VRNA 2LVKA 2PASA 1M63B 1KQVA 1NYAA 2F3YA 4OR9B 1QX5B 1CFCA 2PVBA 4ORCB 5AANA 2OPOA 1JFKA 1XFVO 2K2FA 1NIWA 3JTDB 4E68A 1DJXA 4AQIA 5DKNA 1UHNA 3SG5A 1DJGA 1CLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALW A;  2JNX A;  1OMV A;  1CFP A;  4ICB A;  1DJI A;  3KO0 A;  4MSP A;  4DIR A;  1YUS A;  2LHL A;  2JQ6 A;  1K94 A;  3SG6 A;  3BUW B;  1CKK A;  2L0P A;  3HX4 A;  4MVF A;  1B7T Z;  2BCX A;  4ORB B;  2KI4 C;  1QJT A;  1LVC D;  2MAZ A;  1MXE A;  1BR4 B;  1NX1 A;  1W7I B;  2QPT A;  1QVI Y;  2MBX A;  2JNF A;  2M49 B;  3CTN A;  2KOT A;  3BUN B;  1HT9 A;  2Y4Q A;  1Y6W A;  4BY4 A;  1OMD A;  2M0R A;  4QJ5 B;  1QTX A;  1OOJ A;  1QXP A;  2AMI A;  2KBM A;  2K7B A;  4A4B A;  1JBA A;  3H4S E;  3BYA A;  3I5F C;  3D10 A;  1FPW A;  2MHH A;  5AFP A;  1F54 A;  3OHM B;  3PN7 C;  5PAL A;  2COL B;  3SJS A;  1J7O A;  1K9P A;  2K7O A;  1KK7 Z;  2E30 A;  4JQ0 D;  4OV2 A;  1S5G Y;  1F4Q A;  1IG5 A;  1XFZ O;  2LE9 B;  1J1D A;  1EG3 A;  1SL7 A;  3I5H B;  1RK9 A;  1JUO A;  2I18 A;  1YUT A;  2EHB A;  2ZKM X;  1IGV A;  1KQM B;  2E6W A;  2HQW A;  1FI5 A;  2JZI A;  1TN4 A;  1XYD A;  3KF9 A;  3RM1 A;  1N2D A;  2F2O A;  4N5X A;  1VRK A;  1A4P A;  5IBW A;  1KK8 C;  1TRF A;  4TNC A;  1KSO A;  2KFG A;  3AAJ A;  1QX7 A;  1UHK A;  1BOD A;  1GGZ A;  4MRX A;  1FF1 A;  1K9K A;  1MUX A;  2BCA A;  5ER5 A;  1J7P A;  2O5G A;  3VRP A;  4YRU A;  3FWB A;  1AJ4 A;  1CFF A;  1CM4 A;  1WRL A;  1CM1 A;  3SG3 A;  2KSP A;  4YGA A;  1A75 B;  2KAV A;  3VRO A;  1S26 D;  2BEC A;  2JT3 A;  3EVR A;  1XFY O;  2LP2 A;  3TS5 C;  1BJF A;  2M29 A;  3LLE A;  1XK4 A;  2Q91 A;  1J7R A;  2MRD A;  3PAT A;  1TNQ A;  1A75 A;  2RGI A;  5HLV A;  2F3Z A;  1CTR A;  2OTG B;  3I5G C;  3RLZ A;  3EK4 A;  1RJV A;  3A8R A;  3TDI A;  1LKJ A;  2Q4U A;  1BLQ A;  1SCM B;  2FCE A;  1DJY A;  1IJ6 A;  4L9M A;  4DCK A;  3ICB A;  3SIA A;  4GPL B;  2JT0 A;  3OP0 A;  2EGD A;  1SKT A;  1JSA A;  2SCP A;  2KGB C;  3E3R A;  1RWY A;  2LHI A;  2M3W A;  3D0Y A;  3DD4 A;  3O2P A;  3CR4 X;  2LM5 A;  1XA5 A;  2GGZ A;  2IS9 A;  3I5I B;  3EK7 A;  1AVS A;  1DJZ A;  3IQQ A;  1N0Y A;  4GAO A;  1F71 A;  3CLN A;  1K96 A;  1WLZ A;  1LA3 A;  1TNP A;  3LCP C;  2JPT A;  3CR2 A;  1KSM A;  3MSE B;  4YI8 A;  2I2R E;  2KFF A;  2NXQ A;  2LUX A;  2D8N A;  1CNP A;  2NLN A;  3BQ3 A;  1WLM A;  2KDH A;  1AHR A;  2M7L A;  2ZRT A;  2CT9 A;  1KWO B;  3WNX B;  4OKH A;  2BBM A;  2K7C A;  2WC8 A;  1L2O C;  3EVV A;  5AEQ A;  1ZFS A;  2M7N A;  1NX2 A;  3EK8 A;  2BKI B;  1A03 A;  5DKQ A;  1CDM A;  3AAK A;  4AOM A;  1RTP 1;  2F8P A;  2KHN A;  2M1K B;  4JPZ B;  3SG2 A;  3WHU B;  4WQ2 A;  1S1E A;  1AJ5 A;  1CFD A;  5HLO A;  1G4Y R;  4CFR A;  3K21 A;  1DGV A;  1G33 A;  2HF5 A;  4M2Q A;  1S6J A;  1TCO B;  1YR5 A;  2L2E A;  4D1E A;  4BY5 A;  3EVU A;  4HSZ A;  1PSB A;  1MWN A;  1YX8 A;  2GGM A;  2BBN A;  1WDC C;  5CPV A;  1CLB A;  1K2H A;  1YUU A;  1CDL A;  2MJW B;  1YTZ C;  2I7A A;  3DVM A;  3OX6 A;  4FTG A;  1H4B A;  3TUY C;  1QVI Z;  1QX2 A;  1DVI A;  4HRG A;  1R6P A;  5B8I B;  5I8N A;  4XJK B;  1B1G A;  1MQ1 A;  1K8U A;  3VRR A;  4DUQ A;  1HQV A;  1NCZ A;  2KQ6 A;  4PHM A;  2KYC A;  4DRW A;  1TTX A;  4NDC A;  4YI9 A;  3SG4 A;  3VGO A;  4YGC B;  1V1G A;  4CPV A;  4XJK A;  2HPS A;  1B9A A;  4HRH A;  1PVB A;  1KFU L;  1YVL A;  1NSH A;  1S5G Z;  2KI6 C;  1J1E A;  2NCP A;  1SRA A;  1QAT A;  3DVK A;  3VRQ A;  2GV5 A;  3WXA A;  2EC6 B;  1ODB A;  1EJ3 A;  2KAY A;  3HCM A;  3FS7 A;  3GK4 X;  4MEW A;  1TIZ A;  2JC2 A;  2CCM A;  1IJ5 A;  2K7D A;  1U5I B;  2WND A;  1KFU S;  4ZCU A;  2L51 A;  4PE4 A;  3JVT C;  5K89 A;  4USL A;  3WHT B;  3PAL A;  2KYF A;  1B8C A;  1UHJ A;  1SL8 A;  1DTL A;  1JFJ A;  4CID A;  2K2A A;  4QJ4 B;  1U5I A;  1SR6 C;  5AER A;  2Y1M A;  2KI4 B;  2MLE C;  5AXI A;  1RFJ A;  1AK8 A;  4GUK A;  2A4J A;  1UWO A;  1NWD A;  2BE4 A;  2H2K A;  5GQQ C;  1EXR A;  4NDD A;  3CGA A;  1MHO A;  2OS8 C;  2DOQ A;  3I5F B;  2BL0 C;  2JT8 A;  5D7F A;  5TNC A;  2AUC A;  2R2I A;  1DJW A;  4GNK B;  4YGD B;  3PN7 B;  2FCD A;  4P2Y B;  1DF0 B;  1WRK A;  2LLS A;  2Y5I A;  1OSA A;  2JRF A;  4FQO A;  2CTN A;  1AP4 A;  5HKW A;  1K9U A;  3TDZ A;  2PAL A;  3KHE A;  2L5X B;  1SW8 A;  2ZN9 A;  1IKU A;  1SCM C;  4PE0 A;  5J3X A;  2TN4 A;  1DF0 A;  4MZJ A;  2ZN8 A;  3GK1 A;  1SCV A;  2LLU A;  3DVJ A;  1K90 D;  2PRU A;  3NSL A;  3D0Y B;  4IL1 A;  5KTY A;  1TNX A;  4WQ3 A;  1LIN A;  3ZWH A;  1QV0 A;  3OB2 B;  2BE6 A;  4YGE B;  1KK8 B;  4DS7 A;  2M8U A;  1BT6 A;  4GBA A;  1Y1U A;  3KEV A;  3O78 A;  3M0W A;  1F8H A;  2KFH A;  1C7W A;  4I5N B;  4YBH B;  1JF0 A;  1XFW O;  1EL4 A;  1D1O A;  1PK0 D;  1LA0 A;  2M1U A;  5HKZ A;  3LK1 A;  1UHH A;  1OZS A;  1X02 A;  5G08 A;  1PVA A;  2JWW A;  4Q04 A;  1SMG A;  1NPQ A;  4ETO A;  1XFU O;  1PUL A;  1OQP A;  1UP5 A;  2BCB A;  3O6B A;  3TDU A;  3TS5 B;  1UHI A;  1OE9 B;  1KFX S;  3AKA A;  1F70 A;  1ZAC A;  4NDB A;  3I5G B;  1SK6 D;  5HKY A;  4XYN A;  1IRJ A;  4PCW A;  1SYM A;  3BOW B;  1UUS A;  2L4I A;  5KU1 A;  1FW4 A;  3PM8 A;  4MRY A;  1CLL A;  1QLS A;  2JTZ A;  3NSO A;  1YUR A;  1H8B A;  3JTD C;  1F4O A;  3ZNI A;  4C0L A;  2LC5 A;  2HET A;  3NXA A;  1ALV A;  1IWQ A;  3BOW A;  1S3P A;  1SNL A;  2B1U A;  2CNP A;  2LLT A;  3C1V A;  1ZOT B;  4N1G A;  1B8R A;  4QJ3 B;  1QV1 A;  4MBE A;  5DKR A;  2WOS A;  4I5J A;  4NQG A;  2FJU B;  4OCI A;  1JC2 A;  4CFQ A;  1J7Q A;  1QLK A;  3PLF B;  5BPJ A;  1QAS A;  1Y0V H;  5HYD A;  3DF0 B;  1DGU A;  1C07 A;  1BF5 A;  1B47 A;  2L98 A;  1YX7 A;  3CWG A;  2G2B A;  2LAP A;  3GK2 A;  2ZRS A;  1FBV A;  3GOF A;  1ZUZ A;  1RRO A;  3DF0 A;  2PSR A;  1BU3 A;  1E8A A;  1L2O B;  3LK0 A;  4PE1 A;  2EC6 C;  2KGR A;  2M97 A;  1PRW A;  1REC A;  1SBJ A;  1QS7 A;  3LL8 B;  1M45 A;  2LMV A;  2LAN A;  3I5H C;  1NP8 A;  2VRG A;  4MZK A;  4PDZ A;  4MLW A;  3BXK A;  1IQ5 A;  2JU0 A;  1G8I A;  1TOP A;  2ZNE A;  1W7J B;  3CS1 A;  1KQM C;  1A2X A;  1DMO A;  1WDC B;  1YRT B;  1CMG A;  1TNW A;  1YVH A;  1FI6 A;  3BUX B;  4GGF C;  1SPY A;  3F45 A;  2SAS A;  2JTT A;  3TUY B;  1NCY A;  4N1F A;  2O60 A;  2F33 A;  2K0J A;  2KAX A;  1B7T Y;  1S6I A;  1KCY A;  1GJY A;  3DVE A;  2I94 A;  1UUR A;  1WY9 A;  1S36 A;  2JXC A;  2JUL A;  4R1E A;  2KBI A;  5KSZ A;  2P6B B;  4A4C A;  1SL9 A;  4HRE E;  1XK4 C;  4C0K A;  1NUB A;  4F0Z B;  3EKH A;  3PSR A;  2HQ8 A;  2NZ0 A;  4JWQ A;  3SIB A;  5D69 A;  1MXL C;  1NCX A;  1KK7 Y;  2WOR A;  2L50 A;  1DJH A;  3IQO A;  2LUC A;  1K93 D;  2JXL A;  1M31 A;  1V1F A;  4PE7 A;  2LMT A;  2OTG C;  1MR8 A;  2K61 A;  2L4H A;  2ZFD A;  1AUI B;  2CBL A;  3JVT B;  2V53 A;  3CR5 X;  4GGN A;  4PHK A;  2PMY A;  4CLN A;  2LV7 A;  1R2U A;  2AAO A;  1GGW A;  1ZMZ A;  4P5O E;  4C0J A;  1CDN A;  1SR6 B;  1WRZ A;  3AKB A;  1M46 A;  1CB1 A;  4GGF A;  1QIV A;  1TCF A;  4ZCV A;  1BR1 B;  2ISD A;  3I5I C;  1LXF C;  2KNE A;  1XVJ A;  1A29 A;  4WRI A;  3BUO B;  4M2P A;  5CSF A;  1BOC A;  5I2Q A;  5I2L A;  2OS8 B;  1JF2 A;  1XFX O;  2BL0 B;  2Y1N A;  1EH2 A;  1EG4 A;  2BKH B;  4GFT A;  1CDP A;  1C7V A;  2ZND A;  1Y1A A;  2H61 C;  1JWD A;  1PAL A;  1KFX L;  2CXJ A;  5CSN A;  3OB1 B;  1M39 A;  1KWO C;  1IQ3 A;  1YRU B;  1J55 A;  2QAC A;  2LCP A;  2WCB A;  1Y1X A;  2MA2 A;  2LP3 A;  5CSJ A;  1BG1 A;  1B4C A;  2LVJ A;  1Q80 A;  3KPX A;  3IF7 A;  3NSI A;  4MN0 A;  1CMF A;  1GQM A;  2MLF C;  1SY9 A;  1L7Z A;  4MZL A;  1XO5 A;  1K95 A;  4U8D A;  3PFV A;  2WCF A;  2K8M B;  4PAL A;  3EKJ A;  2LVV A;  1F55 A;  3BUM B;  2FOT A;  1IH0 A;  3FIA A;  2LVI A;  5JOL A;  2M9G A;  2LNK A;  3FWC A;  4PHN A;  5ER4 X;  2KQY A;  4YGB B;  3CZT X;  3TZ1 A;  1PSR A;  3NSK A;  5I2O A;  4I5K A;  1NX0 A;  1N65 A;  3OX5 A;  5F6T A;  1NX3 A;  2WCE A;  2LMU A;  3O4Y A;  2JOJ A;  3SG7 A;  5FYX A;  4M2O A;  1B8L A;  5JJG A;  3QRX A;  2KI6 D;  2NCO A;  1DT7 B;  4I5L B;  1BMO A;  4UPG A;  2H61 A;  1S6C A;  2G9B A;  1OMR A;  2F2P A;  1QIW A;  4OVN F;  4AQJ A;  1OZO A;  5CSI A;  1MF8 B;  4ORA B;  3A4U B;  4PHJ A;  3VRN A;  2LVK A;  2PAS A;  1M63 B;  1KQV A;  1NYA A;  2F3Y A;  4OR9 B;  1QX5 B;  1CFC A;  2PVB A;  4ORC B;  5AAN A;  2OPO A;  1JFK A;  1XFV O;  2K2F A;  1NIW A;  3JTD B;  4E68 A;  1DJX A;  4AQI A;  5DKN A;  1UHN A;  3SG5 A;  1DJG A;  1CLM A; 
#chains in the Genus database with same CATH topology
 1ALW A;  2JNX A;  1OMV A;  1CFP A;  4ICB A;  1DJI A;  3KO0 A;  5I94 A;  4MSP A;  4DIR A;  1YUS A;  2LHL A;  2JQ6 A;  1K94 A;  3SG6 A;  3BUW B;  1CKK A;  2L0P A;  3HX4 A;  4MVF A;  1B7T Z;  2BCX A;  4ORB B;  2KI4 C;  1QJT A;  1LVC D;  2MAZ A;  1MXE A;  1BR4 B;  1NX1 A;  1W7I B;  2QPT A;  1QVI Y;  5D3O A;  2JNF A;  2M49 B;  2WCM A;  3CTN A;  3L4L A;  2KOT A;  3BUN B;  1HT9 A;  2Y4Q A;  3OBV A;  1Y6W A;  4BY4 A;  1OMD A;  2M0R A;  4QJ5 B;  3N7H A;  1QTX A;  1OOJ A;  1QXP A;  2AMI A;  2KBM A;  2K7B A;  4A4B A;  1JBA A;  3H4S E;  3BYA A;  3I5F C;  3D10 A;  1FPW A;  3D74 A;  3CAB A;  2MHH A;  5AFP A;  1F54 A;  3OHM B;  3PN7 C;  5PAL A;  2COL B;  3SJS A;  3O4X A;  1J7O A;  1K9P A;  2BAP A;  2K7O A;  1KK7 Z;  3DZT A;  2E30 A;  4JQ0 D;  4OV2 A;  1S5G Y;  1F4Q A;  1IG5 A;  1XFZ O;  2LE9 B;  1J1D A;  1EG3 A;  1SL7 A;  3I5H B;  1RK9 A;  1JUO A;  2I18 A;  2PYQ A;  1YUT A;  2EHB A;  2ZKM X;  1IGV A;  3D75 A;  1KQM B;  2E6W A;  2HQW A;  1FI5 A;  2JZI A;  1TN4 A;  1XYD A;  3KF9 A;  3RM1 A;  1N2D A;  2F2O A;  4N5X A;  1VRK A;  1A4P A;  5IBW A;  1KK8 C;  1TRF A;  4TNC A;  1KSO A;  2KFG A;  3AAJ A;  1QX7 A;  1UHK A;  1BOD A;  1GGZ A;  1TWO A;  4MRX A;  1FF1 A;  1K9K A;  1MUX A;  1XFR A;  2BCA A;  5ER5 A;  1J7P A;  2O5G A;  3VRP A;  1DQE A;  4YRU A;  3FWB A;  1AJ4 A;  2QEO A;  1CM4 A;  1WRL A;  1CFF A;  1CM1 A;  3SG3 A;  2KSP A;  2WCL A;  4YGA A;  3B7A A;  3UO9 A;  1A75 B;  1T14 A;  3PM2 A;  2KAV A;  3VRO A;  1S26 D;  2BEC A;  2JT3 A;  3EVR A;  1XFY O;  2LP2 A;  3D77 A;  3TS5 C;  1BJF A;  2M29 A;  3LLE A;  1XK4 A;  2Q91 A;  1J7R A;  2MRD A;  3PAT A;  1TNQ A;  1A75 A;  2RGI A;  2MBX A;  5HLV A;  3SS5 A;  2F3Z A;  1CTR A;  2OTG B;  3I5G C;  3RLZ A;  3EK4 A;  1RJV A;  3L4A A;  3A8R A;  3TDI A;  1LKJ A;  2Q4U A;  1BLQ A;  1SCM B;  2FCE A;  3BJH A;  1DJY A;  1IJ6 A;  4L9M A;  3UNW A;  4DCK A;  3ICB A;  3SIA A;  4GPL B;  2JT0 A;  3OP0 A;  2EGD A;  3DYE A;  1SKT A;  4KYN A;  1JSA A;  2SCP A;  2KGB C;  1C3Y A;  3E3R A;  1RWY A;  2LHI A;  2M3W A;  3D0Y A;  3DD4 A;  3O2P A;  3CR4 X;  2LM5 A;  1XA5 A;  2GGZ A;  2IS9 A;  3I5I B;  3EK7 A;  1AVS A;  1DJZ A;  3IQQ A;  1N0Y A;  4GAO A;  1F71 A;  3CLN A;  1K96 A;  1WLZ A;  1LA3 A;  1TNP A;  3LCP C;  2JPT A;  3CYZ A;  3CR2 A;  1KSM A;  3PJI A;  3MSE B;  4YI8 A;  2I2R E;  2KFF A;  2NXQ A;  2LUX A;  2D8N A;  4JKT A;  1CNP A;  3VB1 A;  2NLN A;  3BQ3 A;  1WLM A;  2KDH A;  1DC1 A;  1AHR A;  2M7L A;  2ZRT A;  2CT9 A;  1KWO B;  3WNX B;  4OKH A;  3DY9 A;  2BBM A;  2K7C A;  3RZS A;  2WC8 A;  1L2O C;  3EVV A;  5AEQ A;  1ZFS A;  2M7N A;  1NX2 A;  3EK8 A;  2BKI B;  1A03 A;  5DKQ A;  1CDM A;  3AAK A;  4AOM A;  1RTP 1;  4FQT A;  2F8P A;  2KHN A;  2M1K B;  4JPZ B;  3SG2 A;  3WHU B;  4WQ2 A;  2L5Y A;  1S1E A;  1AJ5 A;  1CFD A;  5HLO A;  1G4Y R;  3BFH A;  4CFR A;  3SS4 A;  3K21 A;  1DGV A;  1G33 A;  2HF5 A;  4M2Q A;  1S6J A;  1TCO B;  1YR5 A;  2L2E A;  4D1E A;  4BY5 A;  3EVU A;  1C3Z A;  4HSZ A;  1PSB A;  1MWN A;  1OOH A;  1YX8 A;  2BBN A;  1WDC C;  2GGM A;  5CPV A;  1CLB A;  1K2H A;  2BNX A;  1YUU A;  1CDL A;  2MJW B;  1YTZ C;  2I7A A;  3DVM A;  3OX6 A;  4FTG A;  1H4B A;  3TUY C;  1QVI Z;  1QX2 A;  1DVI A;  4HRG A;  4JD9 A;  1R6P A;  3QME A;  5B8I B;  5I8N A;  4XJK B;  1B1G A;  1MQ1 A;  1K8U A;  3VRR A;  4DUQ A;  1HQV A;  1NCZ A;  2KQ6 A;  4PHM A;  2KYC A;  4DRW A;  1TTX A;  4NDC A;  4YI9 A;  3CZ0 A;  3SG4 A;  3VGO A;  4YGC B;  1V1G A;  4CPV A;  4XJK A;  2HPS A;  1B9A A;  4HRH A;  1PVB A;  1KFU L;  1YVL A;  1NSH A;  1S5G Z;  2KI6 C;  1J1E A;  2NCP A;  1SRA A;  3BFB A;  1QAT A;  3DVK A;  3VRQ A;  2GV5 A;  3WXA A;  2EC6 B;  1ODB A;  1EJ3 A;  1QWV A;  2KAY A;  3HCM A;  3FS7 A;  2WC5 A;  3GK4 X;  4MEW A;  1TIZ A;  2JC2 A;  2CCM A;  1IJ5 A;  2K7D A;  2JPO A;  1U5I B;  1OOF A;  2WND A;  1KFU S;  4ZCU A;  2L51 A;  4PE4 A;  3JVT C;  5K89 A;  4USL A;  3WHT B;  3PAL A;  2KYF A;  3IVT A;  1B8C A;  1UHJ A;  1SL8 A;  1DTL A;  1JFJ A;  4CID A;  2K2A A;  4QJ4 B;  1U5I A;  1SR6 C;  4F7F A;  2Y1M A;  5AER A;  3B6X A;  2KI4 B;  2MLE C;  2PQL A;  5AXI A;  1RFJ A;  3DXL A;  1AK8 A;  4GUK A;  2A4J A;  3S0E A;  3FE6 A;  3NHI A;  1UWO A;  1NWD A;  2BE4 A;  2H2K A;  5GQQ C;  1EXR A;  4NDD A;  5FI2 A;  3CGA A;  1MHO A;  2OS8 C;  2DOQ A;  3I5F B;  2BL0 C;  2JT8 A;  5D7F A;  5TNC A;  2AUC A;  2R2I A;  1DJW A;  4GNK B;  4YGD B;  1GM0 A;  3PN7 B;  2FCD A;  4P2Y B;  1DF0 B;  1WRK A;  2LLS A;  2KPH A;  2Y5I A;  1DEK A;  1OSA A;  2JRF A;  4FQO A;  2CTN A;  1AP4 A;  5HKW A;  1K9U A;  3TDZ A;  2PAL A;  3KHE A;  2L5X B;  1SW8 A;  2ZN9 A;  1IKU A;  1SCM C;  5FI7 A;  4PE0 A;  5J3X A;  2TN4 A;  1DF0 A;  2KLD A;  4MZJ A;  1TUJ A;  1TUZ A;  2ZN8 A;  3GK1 A;  1SCV A;  2LLU A;  3DVJ A;  1K90 D;  2PRU A;  3NSL A;  3D0Y B;  4IL1 A;  5KTY A;  1TNX A;  4WQ3 A;  1LIN A;  3ZWH A;  1QV0 A;  3OB2 B;  2QEB A;  2BE6 A;  4YGE B;  1KK8 B;  4DS7 A;  2M8U A;  1BT6 A;  4GBA A;  1Y1U A;  3S0F A;  3KEV A;  3O78 A;  3M0W A;  3R72 A;  1F8H A;  2KFH A;  1C7W A;  4I5N B;  4YBH B;  1JF0 A;  1XFW O;  1EL4 A;  1D1O A;  1PK0 D;  1LA0 A;  1SSE B;  3NGV A;  2M1U A;  2WCH A;  5HKZ A;  3LK1 A;  1UHH A;  1OZS A;  1X02 A;  3D73 A;  5G08 A;  1PVA A;  2JWW A;  3V2L A;  4Q04 A;  1DEL A;  1SMG A;  1NPQ A;  4ETO A;  1XFU O;  1PUL A;  5DIC A;  1OQP A;  1UP5 A;  2BCB A;  3O6B A;  3TDU A;  3TS5 B;  2P70 A;  1UHI A;  1OE9 B;  1KFX S;  3AKA A;  1F70 A;  1ZAC A;  4NDB A;  3I5G B;  1SK6 D;  5HKY A;  4XYN A;  1IRJ A;  4PCW A;  1SYM A;  3BOW B;  1UUS A;  2L4I A;  5KU1 A;  1FW4 A;  3PM8 A;  4MRY A;  1CLL A;  1QLS A;  2JTZ A;  3NSO A;  1YUR A;  3B87 A;  4OZD A;  3JTD C;  2K60 A;  1H8B A;  1F4O A;  3ZNI A;  4C0L A;  2LC5 A;  4PT1 A;  2HET A;  3NXA A;  1ALV A;  1IWQ A;  3BOW A;  1S3P A;  1SNL A;  2B1U A;  2CNP A;  2LLT A;  3C1V A;  1ZOT B;  4N1G A;  1B8R A;  4QJ3 B;  1QV1 A;  4MBE A;  5DKR A;  1ORG A;  2WOS A;  4I5J A;  4NQG A;  2FJU B;  4OCI A;  1JC2 A;  3R1V A;  4CFQ A;  1QLK A;  3PLF B;  5BPJ A;  1J7Q A;  1QAS A;  1Y0V H;  5HYD A;  3DF0 B;  1DGU A;  1C07 A;  1BF5 A;  4INX A;  1B47 A;  2L98 A;  1YX7 A;  3CWG A;  2G2B A;  2L2C A;  2LAP A;  3GK2 A;  3R1O A;  2ZRS A;  1FBV A;  3GOF A;  1ZUZ A;  1RRO A;  3DF0 A;  2PSR A;  3R1P A;  1BU3 A;  1E8A A;  1L2O B;  3LK0 A;  3B86 A;  4PE1 A;  2EC6 C;  2ERB A;  2KGR A;  3OGN A;  2M97 A;  3FE9 A;  1PRW A;  1REC A;  1SBJ A;  1QS7 A;  3LL8 B;  1M45 A;  2LMV A;  2LAN A;  3I5H C;  1NP8 A;  2VRG A;  4MZK A;  4PDZ A;  3K1E A;  4MLW A;  3BXK A;  1IQ5 A;  2JU0 A;  3B88 A;  1G8I A;  1TOP A;  2ZNE A;  1W7J B;  2WC6 A;  3CS1 A;  1KQM C;  1A2X A;  1DMO A;  1WDC B;  1YRT B;  1CMG A;  1TNW A;  1YVH A;  1FI6 A;  3BUX B;  4GGF C;  1SPY A;  3F45 A;  2SAS A;  2JTT A;  3TUY B;  1NCY A;  3CDN A;  2O60 A;  4N1F A;  2F33 A;  2K0J A;  2KAX A;  1B7T Y;  1S6I A;  1KCY A;  1GJY A;  3DVE A;  2I94 A;  1UUR A;  1WY9 A;  1S36 A;  5EL2 A;  2JXC A;  2JUL A;  4R1E A;  2KBI A;  5KSZ A;  2P6B B;  4A4C A;  1SL9 A;  4HRE E;  1XK4 C;  4C0K A;  4IJ7 A;  1NUB A;  1W9Z A;  4F0Z B;  2KLE A;  3EKH A;  3PSR A;  1OOG A;  2HQ8 A;  2NZ0 A;  4JWQ A;  3SIB A;  3S0G A;  5D69 A;  1MXL C;  1NCX A;  3S0A A;  1KK7 Y;  2WOR A;  2L50 A;  1DJH A;  3IQO A;  2LUC A;  1K93 D;  2JXL A;  1M31 A;  1V1F A;  4PE7 A;  2H8V A;  2LMT A;  2OTG C;  1IIO A;  1MR8 A;  2K61 A;  2L4H A;  2ZFD A;  3CZ2 A;  1AUI B;  2CBL A;  3JVT B;  2V53 A;  3CR5 X;  4GGN A;  4PHK A;  1Z2C B;  2PMY A;  4CLN A;  3BFA A;  2LV7 A;  2QEH A;  3L47 A;  1R2U A;  2AAO A;  1GGW A;  1ZMZ A;  3FE8 A;  4P5O E;  4C0J A;  1CDN A;  1SR6 B;  1WRZ A;  3AKB A;  1M46 A;  1CB1 A;  4GGF A;  1QIV A;  1TCF A;  4ZCV A;  1BR1 B;  2ISD A;  3I5I C;  1LXF C;  2KNE A;  1XVJ A;  1A29 A;  4WRI A;  3BUO B;  4M2P A;  5CSF A;  1BOC A;  5I2Q A;  5I2L A;  2OS8 B;  2QEV A;  1JF2 A;  1XFX O;  2BL0 B;  2Y1N A;  1EH2 A;  1EG4 A;  2BKH B;  4GFT A;  1CDP A;  1C7V A;  2ZND A;  1Y1A A;  2H61 C;  1JWD A;  1PAL A;  1KFX L;  2CXJ A;  5CSN A;  3OB1 B;  1M39 A;  1KWO C;  2WCJ A;  1IQ3 A;  1YRU B;  1J55 A;  2QAC A;  2LCP A;  2WCB A;  1Y1X A;  2MA2 A;  2LP3 A;  3Q8I A;  5CSJ A;  3S0D A;  1BG1 A;  1B4C A;  2LVJ A;  1Q80 A;  3KPX A;  3IF7 A;  3NSI A;  4MN0 A;  1CMF A;  1GQM A;  2MLF C;  1SY9 A;  1L7Z A;  3NHT A;  4MZL A;  1XO5 A;  1K95 A;  4U8D A;  3PFV A;  3CZ1 A;  2WCF A;  2K8M B;  4PAL A;  3EKJ A;  3S0B A;  2LVV A;  1F55 A;  3BUM B;  2FOT A;  1OW4 A;  1IH0 A;  3FIA A;  2LVI A;  5JOL A;  2M9G A;  2LNK A;  3FWC A;  4PHN A;  5ER4 X;  2KQY A;  4YGB B;  3CZT X;  3TZ1 A;  1PSR A;  3NSK A;  5I2O A;  4I5K A;  5FI6 A;  1NX0 A;  1N65 A;  3D78 A;  3OX5 A;  1NX3 A;  2WCE A;  2LMU A;  5F6T A;  3O4Y A;  2JOJ A;  3SG7 A;  2WCK A;  2GTE A;  5FYX A;  2QDI A;  1B8L A;  4M2O A;  3QRX A;  2KI6 D;  2NCO A;  4INW A;  5JJG A;  1DT7 B;  1LS8 A;  4I5L B;  1BMO A;  2P71 A;  4UPG A;  2H61 A;  1S6C A;  2G9B A;  1OMR A;  2F2P A;  1QIW A;  4OVN F;  4AQJ A;  1OZO A;  5CSI A;  1P28 A;  5HL1 A;  1MF8 B;  4ORA B;  3A4U B;  2FJY A;  4PHJ A;  3VRN A;  2LVK A;  2PAS A;  1Z4H A;  1M63 B;  1KQV A;  1NYA A;  2F3Y A;  4OR9 B;  3EG5 B;  2YGU A;  1QX5 B;  1OOI X;  1CFC A;  2PVB A;  4ORC B;  5AAN A;  2OPO A;  1JFK A;  1XFV O;  3SS3 A;  2K2F A;  1NIW A;  3JTD B;  4E68 A;  1DJX A;  4AQI A;  5DKN A;  1UHN A;  3D76 A;  3SG5 A;  1DJG A;  1CLM A; 
#chains in the Genus database with same CATH homology
 1ALW A;  2JNX A;  1OMV A;  1CFP A;  4ICB A;  1DJI A;  3KO0 A;  4MSP A;  4DIR A;  1YUS A;  2LHL A;  2JQ6 A;  1K94 A;  3SG6 A;  3BUW B;  1CKK A;  2L0P A;  3HX4 A;  4MVF A;  1B7T Z;  2BCX A;  4ORB B;  2KI4 C;  1QJT A;  1LVC D;  2MAZ A;  1MXE A;  1BR4 B;  1NX1 A;  1W7I B;  2QPT A;  1QVI Y;  2MBX A;  2JNF A;  2M49 B;  3CTN A;  2KOT A;  3BUN B;  1HT9 A;  2Y4Q A;  1Y6W A;  4BY4 A;  1OMD A;  2M0R A;  4QJ5 B;  1QTX A;  1OOJ A;  1QXP A;  2AMI A;  2KBM A;  2K7B A;  4A4B A;  1JBA A;  3H4S E;  3BYA A;  3I5F C;  3D10 A;  1FPW A;  2MHH A;  5AFP A;  1F54 A;  3OHM B;  3PN7 C;  5PAL A;  2COL B;  3SJS A;  1J7O A;  1K9P A;  2K7O A;  1KK7 Z;  2E30 A;  4JQ0 D;  4OV2 A;  1S5G Y;  1F4Q A;  1IG5 A;  1XFZ O;  2LE9 B;  1J1D A;  1EG3 A;  1SL7 A;  3I5H B;  1RK9 A;  1JUO A;  2I18 A;  1YUT A;  2EHB A;  2ZKM X;  1IGV A;  1KQM B;  2E6W A;  2HQW A;  1FI5 A;  2JZI A;  1TN4 A;  1XYD A;  3KF9 A;  3RM1 A;  1N2D A;  2F2O A;  4N5X A;  1VRK A;  1A4P A;  5IBW A;  1KK8 C;  1TRF A;  4TNC A;  1KSO A;  2KFG A;  3AAJ A;  1QX7 A;  1UHK A;  1BOD A;  1GGZ A;  4MRX A;  1FF1 A;  1K9K A;  1MUX A;  2BCA A;  5ER5 A;  1J7P A;  2O5G A;  3VRP A;  4YRU A;  3FWB A;  1AJ4 A;  1CFF A;  1CM4 A;  1WRL A;  1CM1 A;  3SG3 A;  2KSP A;  4YGA A;  1A75 B;  2KAV A;  3VRO A;  1S26 D;  2BEC A;  2JT3 A;  3EVR A;  1XFY O;  2LP2 A;  3TS5 C;  1BJF A;  2M29 A;  3LLE A;  1XK4 A;  2Q91 A;  1J7R A;  2MRD A;  3PAT A;  1TNQ A;  1A75 A;  2RGI A;  5HLV A;  2F3Z A;  1CTR A;  2OTG B;  3I5G C;  3RLZ A;  3EK4 A;  1RJV A;  3A8R A;  3TDI A;  1LKJ A;  2Q4U A;  1BLQ A;  1SCM B;  2FCE A;  1DJY A;  1IJ6 A;  4L9M A;  4DCK A;  3ICB A;  3SIA A;  4GPL B;  2JT0 A;  3OP0 A;  2EGD A;  1SKT A;  1JSA A;  2SCP A;  2KGB C;  3E3R A;  1RWY A;  2LHI A;  2M3W A;  3D0Y A;  3DD4 A;  3O2P A;  3CR4 X;  2LM5 A;  1XA5 A;  2GGZ A;  2IS9 A;  3I5I B;  3EK7 A;  1AVS A;  1DJZ A;  3IQQ A;  1N0Y A;  4GAO A;  1F71 A;  3CLN A;  1K96 A;  1WLZ A;  1LA3 A;  1TNP A;  3LCP C;  2JPT A;  3CR2 A;  1KSM A;  3MSE B;  4YI8 A;  2I2R E;  2KFF A;  2NXQ A;  2LUX A;  2D8N A;  1CNP A;  2NLN A;  3BQ3 A;  1WLM A;  2KDH A;  1AHR A;  2M7L A;  2ZRT A;  2CT9 A;  1KWO B;  3WNX B;  4OKH A;  2BBM A;  2K7C A;  2WC8 A;  1L2O C;  3EVV A;  5AEQ A;  1ZFS A;  2M7N A;  1NX2 A;  3EK8 A;  2BKI B;  1A03 A;  5DKQ A;  1CDM A;  3AAK A;  4AOM A;  1RTP 1;  2F8P A;  2KHN A;  2M1K B;  4JPZ B;  3SG2 A;  3WHU B;  4WQ2 A;  1S1E A;  1AJ5 A;  1CFD A;  5HLO A;  1G4Y R;  4CFR A;  3K21 A;  1DGV A;  1G33 A;  2HF5 A;  4M2Q A;  1S6J A;  1TCO B;  1YR5 A;  2L2E A;  4D1E A;  4BY5 A;  3EVU A;  4HSZ A;  1PSB A;  1MWN A;  1YX8 A;  2GGM A;  2BBN A;  1WDC C;  5CPV A;  1CLB A;  1K2H A;  1YUU A;  1CDL A;  2MJW B;  1YTZ C;  2I7A A;  3DVM A;  3OX6 A;  4FTG A;  1H4B A;  3TUY C;  1QVI Z;  1QX2 A;  1DVI A;  4HRG A;  1R6P A;  5B8I B;  5I8N A;  4XJK B;  1B1G A;  1MQ1 A;  1K8U A;  3VRR A;  4DUQ A;  1HQV A;  1NCZ A;  2KQ6 A;  4PHM A;  2KYC A;  4DRW A;  1TTX A;  4NDC A;  4YI9 A;  3SG4 A;  3VGO A;  4YGC B;  1V1G A;  4CPV A;  4XJK A;  2HPS A;  1B9A A;  4HRH A;  1PVB A;  1KFU L;  1YVL A;  1NSH A;  1S5G Z;  2KI6 C;  1J1E A;  2NCP A;  1SRA A;  1QAT A;  3DVK A;  3VRQ A;  2GV5 A;  3WXA A;  2EC6 B;  1ODB A;  1EJ3 A;  2KAY A;  3HCM A;  3FS7 A;  3GK4 X;  4MEW A;  1TIZ A;  2JC2 A;  2CCM A;  1IJ5 A;  2K7D A;  1U5I B;  2WND A;  1KFU S;  4ZCU A;  2L51 A;  4PE4 A;  3JVT C;  5K89 A;  4USL A;  3WHT B;  3PAL A;  2KYF A;  1B8C A;  1UHJ A;  1SL8 A;  1DTL A;  1JFJ A;  4CID A;  2K2A A;  4QJ4 B;  1U5I A;  1SR6 C;  5AER A;  2Y1M A;  2KI4 B;  2MLE C;  5AXI A;  1RFJ A;  1AK8 A;  4GUK A;  2A4J A;  1UWO A;  1NWD A;  2BE4 A;  2H2K A;  5GQQ C;  1EXR A;  4NDD A;  3CGA A;  1MHO A;  2OS8 C;  2DOQ A;  3I5F B;  2BL0 C;  2JT8 A;  5D7F A;  5TNC A;  2AUC A;  2R2I A;  1DJW A;  4GNK B;  4YGD B;  3PN7 B;  2FCD A;  4P2Y B;  1DF0 B;  1WRK A;  2LLS A;  2Y5I A;  1OSA A;  2JRF A;  4FQO A;  2CTN A;  1AP4 A;  5HKW A;  1K9U A;  3TDZ A;  2PAL A;  3KHE A;  2L5X B;  1SW8 A;  2ZN9 A;  1IKU A;  1SCM C;  4PE0 A;  5J3X A;  2TN4 A;  1DF0 A;  4MZJ A;  2ZN8 A;  3GK1 A;  1SCV A;  2LLU A;  3DVJ A;  1K90 D;  2PRU A;  3NSL A;  3D0Y B;  4IL1 A;  5KTY A;  1TNX A;  4WQ3 A;  1LIN A;  3ZWH A;  1QV0 A;  3OB2 B;  2BE6 A;  4YGE B;  1KK8 B;  4DS7 A;  2M8U A;  1BT6 A;  4GBA A;  1Y1U A;  3KEV A;  3O78 A;  3M0W A;  1F8H A;  2KFH A;  1C7W A;  4I5N B;  4YBH B;  1JF0 A;  1XFW O;  1EL4 A;  1D1O A;  1PK0 D;  1LA0 A;  2M1U A;  5HKZ A;  3LK1 A;  1UHH A;  1OZS A;  1X02 A;  5G08 A;  1PVA A;  2JWW A;  4Q04 A;  1SMG A;  1NPQ A;  4ETO A;  1XFU O;  1PUL A;  1OQP A;  1UP5 A;  2BCB A;  3O6B A;  3TDU A;  3TS5 B;  1UHI A;  1OE9 B;  1KFX S;  3AKA A;  1F70 A;  1ZAC A;  4NDB A;  3I5G B;  1SK6 D;  5HKY A;  4XYN A;  1IRJ A;  4PCW A;  1SYM A;  3BOW B;  1UUS A;  2L4I A;  5KU1 A;  1FW4 A;  3PM8 A;  4MRY A;  1CLL A;  1QLS A;  2JTZ A;  3NSO A;  1YUR A;  1H8B A;  3JTD C;  1F4O A;  3ZNI A;  4C0L A;  2LC5 A;  2HET A;  3NXA A;  1ALV A;  1IWQ A;  3BOW A;  1S3P A;  1SNL A;  2B1U A;  2CNP A;  2LLT A;  3C1V A;  1ZOT B;  4N1G A;  1B8R A;  4QJ3 B;  1QV1 A;  4MBE A;  5DKR A;  2WOS A;  4I5J A;  4NQG A;  2FJU B;  4OCI A;  1JC2 A;  4CFQ A;  1J7Q A;  1QLK A;  3PLF B;  5BPJ A;  1QAS A;  1Y0V H;  5HYD A;  3DF0 B;  1DGU A;  1C07 A;  1BF5 A;  1B47 A;  2L98 A;  1YX7 A;  3CWG A;  2G2B A;  2LAP A;  3GK2 A;  2ZRS A;  1FBV A;  3GOF A;  1ZUZ A;  1RRO A;  3DF0 A;  2PSR A;  1BU3 A;  1E8A A;  1L2O B;  3LK0 A;  4PE1 A;  2EC6 C;  2KGR A;  2M97 A;  1PRW A;  1REC A;  1SBJ A;  1QS7 A;  3LL8 B;  1M45 A;  2LMV A;  2LAN A;  3I5H C;  1NP8 A;  2VRG A;  4MZK A;  4PDZ A;  4MLW A;  3BXK A;  1IQ5 A;  2JU0 A;  1G8I A;  1TOP A;  2ZNE A;  1W7J B;  3CS1 A;  1KQM C;  1A2X A;  1DMO A;  1WDC B;  1YRT B;  1CMG A;  1TNW A;  1YVH A;  1FI6 A;  3BUX B;  4GGF C;  1SPY A;  3F45 A;  2SAS A;  2JTT A;  3TUY B;  1NCY A;  4N1F A;  2O60 A;  2F33 A;  2K0J A;  2KAX A;  1B7T Y;  1S6I A;  1KCY A;  1GJY A;  3DVE A;  2I94 A;  1UUR A;  1WY9 A;  1S36 A;  2JXC A;  2JUL A;  4R1E A;  2KBI A;  5KSZ A;  2P6B B;  4A4C A;  1SL9 A;  4HRE E;  1XK4 C;  4C0K A;  1NUB A;  4F0Z B;  3EKH A;  3PSR A;  2HQ8 A;  2NZ0 A;  4JWQ A;  3SIB A;  5D69 A;  1MXL C;  1NCX A;  1KK7 Y;  2WOR A;  2L50 A;  1DJH A;  3IQO A;  2LUC A;  1K93 D;  2JXL A;  1M31 A;  1V1F A;  4PE7 A;  2LMT A;  2OTG C;  1MR8 A;  2K61 A;  2L4H A;  2ZFD A;  1AUI B;  2CBL A;  3JVT B;  2V53 A;  3CR5 X;  4GGN A;  4PHK A;  2PMY A;  4CLN A;  2LV7 A;  1R2U A;  2AAO A;  1GGW A;  1ZMZ A;  4P5O E;  4C0J A;  1CDN A;  1SR6 B;  1WRZ A;  3AKB A;  1M46 A;  1CB1 A;  4GGF A;  1QIV A;  1TCF A;  4ZCV A;  1BR1 B;  2ISD A;  3I5I C;  1LXF C;  2KNE A;  1XVJ A;  1A29 A;  4WRI A;  3BUO B;  4M2P A;  5CSF A;  1BOC A;  5I2Q A;  5I2L A;  2OS8 B;  1JF2 A;  1XFX O;  2BL0 B;  2Y1N A;  1EH2 A;  1EG4 A;  2BKH B;  4GFT A;  1CDP A;  1C7V A;  2ZND A;  1Y1A A;  2H61 C;  1JWD A;  1PAL A;  1KFX L;  2CXJ A;  5CSN A;  3OB1 B;  1M39 A;  1KWO C;  1IQ3 A;  1YRU B;  1J55 A;  2QAC A;  2LCP A;  2WCB A;  1Y1X A;  2MA2 A;  2LP3 A;  5CSJ A;  1BG1 A;  1B4C A;  2LVJ A;  1Q80 A;  3KPX A;  3IF7 A;  3NSI A;  4MN0 A;  1CMF A;  1GQM A;  2MLF C;  1SY9 A;  1L7Z A;  4MZL A;  1XO5 A;  1K95 A;  4U8D A;  3PFV A;  2WCF A;  2K8M B;  4PAL A;  3EKJ A;  2LVV A;  1F55 A;  3BUM B;  2FOT A;  1IH0 A;  3FIA A;  2LVI A;  5JOL A;  2M9G A;  2LNK A;  3FWC A;  4PHN A;  5ER4 X;  2KQY A;  4YGB B;  3CZT X;  3TZ1 A;  1PSR A;  3NSK A;  5I2O A;  4I5K A;  1NX0 A;  1N65 A;  3OX5 A;  5F6T A;  1NX3 A;  2WCE A;  2LMU A;  3O4Y A;  2JOJ A;  3SG7 A;  5FYX A;  4M2O A;  1B8L A;  5JJG A;  3QRX A;  2KI6 D;  2NCO A;  1DT7 B;  4I5L B;  1BMO A;  4UPG A;  2H61 A;  1S6C A;  2G9B A;  1OMR A;  2F2P A;  1QIW A;  4OVN F;  4AQJ A;  1OZO A;  5CSI A;  1MF8 B;  4ORA B;  3A4U B;  4PHJ A;  3VRN A;  2LVK A;  2PAS A;  1M63 B;  1KQV A;  1NYA A;  2F3Y A;  4OR9 B;  1QX5 B;  1CFC A;  2PVB A;  4ORC B;  5AAN A;  2OPO A;  1JFK A;  1XFV O;  2K2F A;  1NIW A;  3JTD B;  4E68 A;  1DJX A;  4AQI A;  5DKN A;  1UHN A;  3SG5 A;  1DJG A;  1CLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...