1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CALBINDIN D9K)
molecule tags Metal binding protein
source organism Bos taurus
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
3EVVA 2L4HA 2WOSA 5AANA 3JTDB 1K95A 4UPGA 4CFQA 3OX5A 4OV2A 3CGAA 1S36A 3F45A 3LL8B 2KAVA 1J1EA 1CTRA 1JF0A 3OB1B 3PM8A 2BCBA 1B8CA 1OE9B 1QIVA 3PN7B 1CFDA 2AAOA 3I5FC 2L51A 3TS5B 2EC6C 1WRZA 1CLLA 1QASA 1SCMC 3EK4A 1WDCB 4HRGA 2NCOA 2F33A 1KQVA 1TOPA 5AEQA 2ZN8A 5K89A 4WQ3A 4GAOA 2LP2A 2F3ZA 1OQPA 4YGCB 1KFUL 4C0LA 1B8LA 4QJ3B 4MVFA 3FWBA 1ALWA 2FCDA 2LUCA 4MLWA 4GBAA 2CCMA 3SIBA 1QV1A 3GK4X 2LNKA 2DOQA 1F8HA 2OS8B 4MRYA 4AOMA 3WNXB 4WQ2A 1FI5A 2KI6C 1SYMA 2KNEA 1AP4A 1S1EA 1UHKA 2MBXA 5I2LA 1IJ6A 1B7TZ 2LLUA 1AK8A 3BUNB 1ZACA 2ZRSA 4GUKA 1KWOC 2BL0C 3VGOA 1RJVA 2HETA 2QPTA 2MAZA 2PVBA 2AUCA 1QX2A 5D69A 4M2QA 1W7IB 1CDPA 1LKJA 5HKWA 4BY4A 1OMRA 3BXKA 2LMTA 5TNCA 1WRLA 4DS7A 2BKIB 4P2YB 1MXLC 1TN4A 2RGIA 4NDCA 1OOJA 1UHIA 5GQQC 2KAXA 4HREE 3BYAA 1C7VA 2WC8A 2PRUA 2JQ6A 1OZSA 1TNXA 2WORA 3TZ1A 5CSNA 1RFJA 4OCIA 3DVJA 1KSOA 1Y0VH 1CM4A 2LAPA 1N0YA 3CR5X 3EK7A 4PE7A 5DKRA 1XFXO 2KHNA 1JSAA 3A4UB 1J1DA 5HYDA 3AKAA 3SG7A 1XVJA 4N1FA 3LK1A 4GGNA 1F54A 3TDUA 1QVIZ 4NQGA 1FW4A 4QJ5B 1JBAA 4IL1A 1GGZA 1K8UA 3OB2B 3JTDC 3BUOB 1L2OB 1S26D 3KEVA 1CFPA 3SG2A 1CLMA 1M45A 1JUOA 3ICBA 4N5XA 3WHUB 2LVVA 1XO5A 3BOWA 1YVLA 1B47A 1MR8A 2JULA 2M1KB 1AJ4A 3EKJA 2JNXA 5I2OA 3QRXA 1CDMA 1XFYO 3CLNA 2M97A 2BE4A 4ORCB 1CFCA 1ZUZA 2L5XB 3EKHA 4HRHA 3PFVA 4JPZB 1XFZO 1IQ5A 1BT6A 1TRFA 1K9KA 2V53A 2KI4B 4CLNA 1QIWA 3H4SE 1BOCA 2KGRA 2L98A 2O5GA 1IH0A 1FPWA 2JXCA 1C7WA 1G4YR 3DF0B 4YBHB 1QLKA 2PSRA 1KFXL 2B1UA 5IBWA 4GGFC 1YRTB 2Y4QA 1XFVO 1A75A 1AVSA 2BBMA 4PCWA 2L2EA 2NLNA 2NZ0A 1LA3A 2QACA 2K2AA 2GV5A 2MHHA 2L50A 2JTZA 3A8RA 4ZCUA 2E6WA 3O6BA 5KSZA 2ISDA 3TDZA 1CM1A 3SG4A 4HSZA 1AHRA 1V1GA 2P6BB 1ZFSA 1KK7Z 3D10A 5DKNA 3JVTC 4CFRA 1SR6B 5PALA 1F4OA 1G33A 3NSLA 1QTXA 1NIWA 2I2RE 1L2OC 2MJWB 2WNDA 3M0WA 1J7QA 4MN0A 1PSRA 1XFUO 1Y1XA 3PLFB 1J7OA 2JZIA 1WRKA 2LHIA 3D0YA 2JT0A 5ER4X 1KQMC 4I5JA 3DF0A 1QATA 5CSFA 3TUYB 1EL4A 1MHOA 2H2KA 3IQQA 1NX1A 2K7DA 4DUQA 3DD4A 1B4CA 4M2OA 1B1GA 2K8MB 3CTNA 3MSEB 2LMUA 3WHTB 2NCPA 5HKYA 1B8RA 1NX3A 2M7LA 2F2OA 4PE1A 1H4BA 1DJGA 2BKHB 2JC2A 2M1UA 1EXRA 4YGDB 2GGZA 1NX0A 2LVKA 2Q91A 1M31A 1SRAA 2KOTA 4ETOA 1PRWA 4Q04A 2LMVA 2JWWA 3VRRA 4FTGA 2JPTA 1CMGA 5B8IB 1LA0A 4XJKA 1RTP1 1MWNA 1UP5A 2SCPA 2BE6A 2LLSA 3FWCA 2KFGA 3OHMB 4YRUA 3HX4A 3O78A 4PHKA 1BF5A 4YI9A 4MEWA 4R1EA 2KBMA 1CLBA 4YI8A 2CTNA 4ZCVA 5AFPA 2LE9B 4USLA 1B7TY 1RK9A 1SNLA 2KI6D 2M8UA 5JOLA 1K94A 1OMDA 3I5HC 3I5FB 1PALA 1SW8A 2K2FA 3EVUA 3NSIA 2KYCA 2I18A 2NXQA 1NX2A 1JWDA 3NXAA 2JRFA 3CWGA 4PHNA 1FI6A 1G8IA 2FJUB 1YR5A 3IF7A 1BG1A 3VRQA 1B9AA 1W7JB 4MZJA 4D1EA 4YGBB 1X02A 1SY9A 2MLFC 1MXEA 2JNFA 1F55A 4MZKA 1DVIA 3I5HB 1K9UA 2TN4A 1E8AA 3OX6A 1S6IA 1UHJA 2IS9A 3E3RA 1NYAA 2JT3A 2LLTA 1CDLA 1J55A 4XYNA 1IRJA 2E30A 3GK1A 4YGEB 1QVIY 2PMYA 3EK8A 2LC5A 1SR6C 3BQ3A 1R6PA 1HT9A 4OR9B 5HKZA 1CDNA 1YX8A 2BCAA 4M2PA 4C0JA 1MQ1A 1SCVA 2MA2A 4I5LB 3TS5C 5I2QA 2HF5A 5ER5A 1SK6D 1DMOA 1DF0B 2OPOA 2ZRTA 1QS7A 1SL9A 1UHHA 4PE0A 3I5IC 2F3YA 5KU1A 2WCFA 3SIAA 2R2IA 3IQOA 1QLSA 2JU0A 2LCPA 1DF0A 2LP3A 1TIZA 3NSOA 1BODA 1S3PA 2LUXA 1QV0A 1AJ5A 1LINA 2ZKMX 4NDDA 1F71A 1EG4A 2EHBA 1KFUS 4N1GA 1IGVA 3DVMA 1DJXA 1V1FA 3BUWB 3SG5A 1NCXA 1BMOA 1JF2A 2PASA 2BCXA 4C0KA 3BUMB 3PN7C 1DJIA 1YVHA 4GNKB 4PE4A 2CXJA 1XFWO 2G2BA 2OTGC 2KQYA 4TNCA 2KAYA 4ORBB 4E68A 1KWOB 3K21A 4OVNF 1A03A 2KQ6A 3DVKA 4I5KA 3RM1A 2K7BA 1F4QA 2O60A 1WLZA 2I7AA 3KF9A 1BR1B 1FF1A 1K9PA 1UUSA 3VRNA 1A4PA 1M39A 1KCYA 1D1OA 1EG3A 2F8PA 1LVCD 3HCMA 1QJTA 2KDHA 4A4BA 3CS1A 2KBIA 1ZOTB 4DCKA 4JQ0D 4QJ4B 1PK0D 1SKTA 2WCEA 1C07A 1J7PA 3BUXB 1PVBA 1A29A 4AQIA 1NP8A 2D8NA 2KFHA 3GOFA 4P5OE 3O2PA 1PULA 3PSRA 4GPLB 1NCZA 3AKBA 1OSAA 2HQWA 2CBLA 2PALA 1S6JA 2LANA 3PALA 3I5IB 4PDZA 1OZOA 3LK0A 2BECA 1GQMA 4CPVA 1FBVA 5F6TA 3CR2A 1CMFA 1JC2A 1RROA 2ZN9A 1S6CA 4JWQA 3KO0A 4NDBA 1S5GY 2M29A 2M7NA 1CNPA 1YURA 1DGVA 2LM5A 4F0ZB 1Y1AA 2JOJA 4FQOA 3WXAA 5CPVA 1U5IA 5J3XA 2KYFA 5BPJA 1YTZC 3SG3A 1H8BA 1U5IB 1GGWA 1TCFA 3FIAA 4PHJA 5HLVA 2Q4UA 2Y5IA 3AAKA 1IKUA 1CB1A 1DJZA 1YX7A 1PVAA 2K0JA 1Q80A 2Y1MA 2CNPA 3LLEA 1IQ3A 1XK4A 1RECA 1DJWA 1KK8B 1GJYA 2KI4C 5JJGA 1OMVA 3I5GC 1N65A 5AERA 4BY5A 2ZFDA 1TTXA 1NCYA 1MUXA 2KFFA 3ZNIA 3CZTX 1RWYA 2Y1NA 1DJYA 1BLQA 1CFFA 3OP0A 1J7RA 1SL8A 2LV7A 1YRUB 1LXFC 3NSKA 2MLEC 3PATA 1ODBA 4MZLA 4DRWA 2FCEA 2VRGA 1PSBA 3O4YA 1NPQA 2K61A 5D7FA 2OTGB 4L9MA 4PALA 1R2UA 2H61A 2K7CA 1NWDA 1TCOB 3CR4X 1AUIB 1TNPA 1TNWA 2M3WA 2SASA 1K96A 4OKHA 5KTYA 1UURA 3EVRA 1HQVA 2LHLA 3JVTB 3SG6A 1QX7A 2MRDA 4GGFA 2BBNA 2COLB 3KHEA 4A4CA 1YUTA 3VRPA 1SBJA 2EC6B 5CSJA 1A75B 1KQMB 3TUYC 3FS7A 2H61C 1S5GZ 4MBEA 1SMGA 2BL0B 4CIDA 2L4IA 1M46A 1VRKA 1N2DA 2L0PA 5HLOA 1IWQA 4YGAA 5G08A 1L7ZA 2JT8A 1M63B 2M0RA 1IG5A 1F70A 1EH2A 1KK8C 5AXIA 1Y1UA 3AAJA 1BU3A 1XYDA 1DGUA 1XA5A 2FOTA 3I5GB 3VROA 3LCPC 1K90D 3D0YB 1NUBA 3DVEA 2HPSA 5FYXA 2AMIA 2LVIA 5I8NA 1UHNA 3C1VA 2KSPA 4ORAB 1XK4C 1WY9A 1JFKA 2EGDA 1SCMB 3TDIA 4MSPA 2K7OA 3BOWB 4XJKB 2ZNEA 2JTTA 4ICBA 1DTLA 4WRIA 4DIRA 1WLMA 2I94A 1WDCC 5CSIA 1BR4B 2HQ8A 1KFXS 1CKKA 1NSHA 3RLZA 2WCBA 4U8DA 3SJSA 2A4JA 4PHMA 2M49B 2GGMA 2OS8C 1JFJA 2CT9A 1UWOA 3KPXA 1ZMZA 1QXPA 1KSMA 1EJ3A 1ALVA 1K93D 1A2XA 1MF8B 4GFTA 1DJHA 1IJ5A 2ZNDA 2G9BA 1K2HA 1TNQA 2LVJA 1DT7B 1SL7A 1SPYA 1Y6WA 3GK2A 3ZWHA 4MRXA 2F2PA 2JXLA 2KGBC 5DKQA 2M9GA 1QX5B 1KK7Y 1YUUA 4AQJA 1YUSA 1BJFA 4I5NB
chains in the Genus database with same CATH superfamily
3EVVA 2L4HA 2WOSA 5AANA 3S0BA 3JTDB 1K95A 3DY9A 4UPGA 4CFQA 3OX5A 4OV2A 3CGAA 1S36A 3F45A 3LL8B 1Z2CB 1J1EA 1CTRA 1JF0A 2KAVA 1C3ZA 2BCBA 1B8CA 1OE9B 1QIVA 3PM8A 3PN7B 1CFDA 3OB1B 2AAOA 3I5FC 2L51A 3TS5B 2EC6C 1WRZA 1CLLA 1QASA 1SCMC 3EK4A 1WDCB 1Z4HA 4HRGA 2NCOA 2F33A 1KQVA 1TOPA 5AEQA 2ZN8A 5K89A 3SS4A 4WQ3A 4GAOA 2LP2A 2F3ZA 1OQPA 4YGCB 3S0DA 1KFUL 4C0LA 1B8LA 4QJ3B 4MVFA 3FWBA 1ALWA 2FCDA 2LUCA 4MLWA 4GBAA 2CCMA 3SIBA 1QV1A 3GK4X 2LNKA 2DOQA 1F8HA 2OS8B 4MRYA 4AOMA 3WNXB 4WQ2A 1FI5A 4INWA 2KI6C 1OOHA 1SYMA 2KNEA 1AP4A 2L2CA 1S1EA 1UHKA 2MBXA 5I2LA 1IJ6A 1B7TZ 2LLUA 1AK8A 3BUNB 1ZACA 2ZRSA 4GUKA 1KWOC 2BL0C 3VGOA 1RJVA 2HETA 5FI6A 2QPTA 2MAZA 2PVBA 2AUCA 1QX2A 5D69A 4M2QA 1W7IB 1CDPA 1LKJA 5HKWA 4BY4A 1OMRA 3BXKA 2LMTA 5TNCA 1WRLA 3S0GA 3DYEA 3BFBA 2BKIB 4P2YB 1MXLC 1TN4A 2RGIA 4NDCA 1OOJA 1UHIA 4DS7A 5GQQC 2KAXA 4JKTA 3NHTA 3BYAA 4HREE 1C7VA 2WC8A 2PRUA 3D74A 2JQ6A 1OZSA 1OOIX 1TNXA 2WORA 3TZ1A 5CSNA 1RFJA 4OCIA 3DVJA 1KSOA 2L5YA 1Y0VH 1CM4A 2LAPA 3R1PA 1N0YA 2KPHA 3CR5X 3EK7A 4PE7A 5DKRA 1XFXO 2KHNA 1JSAA 3A4UB 1J1DA 5HYDA 3AKAA 4IJ7A 4INXA 3SG7A 1XVJA 4N1FA 3LK1A 4GGNA 1F54A 3TDUA 1QVIZ 4NQGA 1FW4A 4QJ5B 3B86A 1JBAA 4IL1A 1GGZA 1GM0A 1K8UA 3OB2B 3JTDC 3BUOB 1L2OB 1S26D 4PT1A 3KEVA 1CFPA 3SG2A 1CLMA 1M45A 1JUOA 3ICBA 4N5XA 3WHUB 2LVVA 1XO5A 3BOWA 1YVLA 3Q8IA 1B47A 1MR8A 2JULA 2M1KB 1AJ4A 3EKJA 2JNXA 5I2OA 3QRXA 1CDMA 1XFYO 3CLNA 1TWOA 1TUZA 2BE4A 2M97A 1ZUZA 4ORCB 1CFCA 2L5XB 3EKHA 4HRHA 3N7HA 3PFVA 4JPZB 1XFZO 1IQ5A 1BT6A 1TRFA 3BFAA 1K9KA 2V53A 2KI4B 4CLNA 1QIWA 3H4SE 3IVTA 1BOCA 2KGRA 2L98A 2O5GA 1IH0A 1FPWA 2JXCA 1C7WA 1G4YR 3DF0B 4YBHB 1QLKA 2PSRA 1KFXL 2B1UA 5IBWA 4GGFC 2WCHA 1YRTB 2Y4QA 1XFVO 1A75A 1AVSA 2BBMA 3R1OA 4PCWA 2L2EA 2NLNA 2NZ0A 1LA3A 2QACA 2K2AA 1LS8A 2GV5A 3B87A 2MHHA 2L50A 2JTZA 2QEHA 3A8RA 4ZCUA 2E6WA 3O6BA 5KSZA 2ISDA 3TDZA 1CM1A 3CYZA 3CZ2A 3SG4A 4HSZA 1AHRA 1V1GA 2P6BB 1ZFSA 1KK7Z 3D10A 2GTEA 5DKNA 3JVTC 4CFRA 1SR6B 5PALA 1F4OA 1G33A 3NSLA 1QTXA 1NIWA 2I2RE 1L2OC 2MJWB 2WNDA 3M0WA 1J7QA 4MN0A 1PSRA 1XFUO 1Y1XA 3O4XA 3PLFB 2JZIA 1J7OA 1WRKA 2LHIA 3D0YA 2JT0A 4FQTA 5ER4X 1DC1A 1KQMC 4I5JA 3DF0A 1QATA 5CSFA 3TUYB 1EL4A 1MHOA 1P28A 3BJHA 2H2KA 3IQQA 1NX1A 2K7DA 4DUQA 3DD4A 1B4CA 4M2OA 1B1GA 2K8MB 3CTNA 3MSEB 2LMUA 3WHTB 2NCPA 5HKYA 1B8RA 1NX3A 2M7LA 2F2OA 4PE1A 1H4BA 1DJGA 3DZTA 2BKHB 2JC2A 2M1UA 1EXRA 3L47A 4YGDB 2GGZA 1NX0A 2LVKA 2Q91A 1M31A 1SRAA 2KOTA 3K1EA 5FI7A 4ETOA 1PRWA 4Q04A 2WC6A 2LMVA 1OOGA 2JWWA 3VRRA 4FTGA 2JPTA 1CMGA 2K60A 3UO9A 1W9ZA 5B8IB 1LA0A 4XJKA 5FI2A 1RTP1 1MWNA 1UP5A 2SCPA 2BE6A 2LLSA 3FWCA 2KFGA 3OHMB 4YRUA 3HX4A 3O78A 4PHKA 1BF5A 4YI9A 4MEWA 4R1EA 2KBMA 1CLBA 4YI8A 2CTNA 4ZCVA 2WCLA 5AFPA 2LE9B 4USLA 1B7TY 1RK9A 1SNLA 2KI6D 2M8UA 3D77A 3FE6A 3EG5B 5JOLA 1QWVA 1K94A 1OMDA 3I5HC 1SSEB 3I5FB 1PALA 1SW8A 2K2FA 3EVUA 3NSIA 2KYCA 2I18A 2NXQA 1NX2A 1JWDA 3NXAA 2JRFA 3CWGA 4PHNA 1FI6A 1G8IA 1YR5A 2FJUB 3IF7A 1BG1A 3VRQA 1B9AA 1W7JB 4MZJA 4D1EA 4YGBB 1X02A 1SY9A 2MLFC 3NGVA 3S0EA 1MXEA 2JNFA 1F55A 4MZKA 1DVIA 3I5HB 1K9UA 2TN4A 1E8AA 2QEBA 3OX6A 1S6IA 1UHJA 2IS9A 3E3RA 1NYAA 2JT3A 2LLTA 1CDLA 1J55A 4XYNA 1IRJA 2E30A 3GK1A 4YGEB 1QVIY 2PMYA 3B7AA 3EK8A 2LC5A 1SR6C 3BQ3A 1R6PA 3NHIA 1HT9A 4OR9B 5HKZA 4F7FA 1YX8A 2BCAA 1CDNA 4M2PA 4C0JA 1MQ1A 1SCVA 2MA2A 4I5LB 3TS5C 5I2QA 2HF5A 5ER5A 1SK6D 3CZ0A 1DMOA 1DF0B 2OPOA 2ZRTA 1DEKA 1QS7A 1SL9A 1UHHA 4PE0A 3I5IC 2F3YA 5KU1A 2WCFA 3SIAA 2R2IA 3IQOA 1QLSA 2JU0A 2LCPA 1DF0A 2LP3A 1TIZA 3NSOA 2WCKA 1BODA 1S3PA 2QDIA 2FJYA 2LUXA 1QV0A 1AJ5A 1LINA 2ZKMX 4NDDA 1F71A 1EG4A 2EHBA 1KFUS 4N1GA 1IGVA 3DVMA 1DJXA 1V1FA 3BUWB 3SG5A 1NCXA 2QEOA 1BMOA 1JF2A 2PASA 2BCXA 4C0KA 3BUMB 3PN7C 1DJIA 1YVHA 4GNKB 4PE4A 2CXJA 1XFWO 2G2BA 2OTGC 2KQYA 4TNCA 2KAYA 4ORBB 2ERBA 4E68A 1KWOB 1TUJA 3K21A 4OVNF 1A03A 2KQ6A 3DVKA 4I5KA 3RM1A 2K7BA 1F4QA 2O60A 1WLZA 2I7AA 2P70A 1BR1B 3KF9A 1K9PA 1FF1A 1UUSA 2PQLA 3VRNA 1A4PA 1M39A 2WC5A 3UNWA 1KCYA 1D1OA 1C3YA 1EG3A 2F8PA 1LVCD 3HCMA 1QJTA 2KDHA 4A4BA 3CS1A 2KBIA 1ZOTB 4DCKA 4JQ0D 4QJ4B 1PK0D 1SKTA 2WCEA 3SS3A 1C07A 1J7PA 3BUXB 3CDNA 1PVBA 1A29A 4AQIA 1NP8A 2D8NA 2KFHA 3GOFA 4P5OE 3O2PA 1PULA 3PSRA 4GPLB 1NCZA 3AKBA 1OSAA 2HQWA 2CBLA 2PALA 1S6JA 2LANA 3PALA 3I5IB 4PDZA 3S0AA 1OZOA 3LK0A 2BECA 1GQMA 4CPVA 1FBVA 5F6TA 3CR2A 1CMFA 1JC2A 1RROA 2ZN9A 1S6CA 5I94A 4JWQA 1IIOA 3KO0A 3L4LA 4NDBA 3CZ1A 1S5GY 2M29A 2M7NA 2WCMA 1YURA 5D3OA 1CNPA 1DGVA 2H8VA 2LM5A 4F0ZB 1Y1AA 2JOJA 4FQOA 3WXAA 5CPVA 1U5IA 4JD9A 3RZSA 5J3XA 3L4AA 2KYFA 2P71A 5BPJA 1YTZC 3SG3A 2WCJA 1H8BA 3PM2A 1U5IB 1GGWA 1TCFA 3FIAA 4PHJA 5HLVA 2Q4UA 2Y5IA 3AAKA 3S0FA 1IKUA 1CB1A 1DJZA 1YX7A 1PVAA 2K0JA 1Q80A 2Y1MA 2CNPA 3LLEA 1IQ3A 1XK4A 1RECA 1DJWA 1KK8B 1GJYA 2KI4C 5JJGA 1OMVA 3I5GC 1N65A 5AERA 3D78A 4BY5A 2ZFDA 1TTXA 1NCYA 1MUXA 2KFFA 3ZNIA 3CZTX 1RWYA 2Y1NA 1DJYA 1BLQA 1CFFA 3OP0A 1J7RA 3FE9A 2BNXA 2PYQA 1SL8A 3VB1A 2LV7A 1YRUB 1LXFC 3NSKA 2MLEC 3PATA 1ODBA 4MZLA 4DRWA 1XFRA 2FCEA 2VRGA 1PSBA 3O4YA 1NPQA 2K61A 5D7FA 2OTGB 4L9MA 4PALA 1R2UA 2H61A 3R1VA 3V2LA 2K7CA 1NWDA 1TCOB 3CR4X 1AUIB 1TNPA 1TNWA 3OGNA 2M3WA 2SASA 1K96A 4OKHA 5KTYA 3QMEA 1UURA 3EVRA 1HQVA 2LHLA 3JVTB 3SG6A 1QX7A 2MRDA 4GGFA 2BBNA 2COLB 3KHEA 4A4CA 1YUTA 3VRPA 1SBJA 2EC6B 5CSJA 1A75B 5HL1A 1DQEA 1KQMB 3TUYC 3FS7A 2H61C 3FE8A 1S5GZ 4MBEA 1SMGA 2BL0B 2YGUA 3B6XA 4CIDA 2L4IA 3D76A 1M46A 1VRKA 1N2DA 2L0PA 5HLOA 1IWQA 3B88A 2BAPA 4YGAA 4OZDA 5G08A 1L7ZA 2JT8A 2KLEA 1M63B 3D73A 2M0RA 1IG5A 1F70A 1EH2A 1KK8C 5AXIA 1Y1UA 3AAJA 1BU3A 1XYDA 1DGUA 1XA5A 2FOTA 3I5GB 3OBVA 3VROA 5DICA 3LCPC 1K90D 3D0YB 1NUBA 3DVEA 2HPSA 5FYXA 2AMIA 3DXLA 2LVIA 3BFHA 5I8NA 1UHNA 4KYNA 3C1VA 2KSPA 4ORAB 1OOFA 1XK4C 1WY9A 1JFKA 2EGDA 2QEVA 1SCMB 3TDIA 4MSPA 2K7OA 3BOWB 2JPOA 4XJKB 2ZNEA 2JTTA 4ICBA 5EL2A 1ORGA 1DTLA 4WRIA 4DIRA 1WLMA 1OW4A 1WDCC 2I94A 5CSIA 1BR4B 2HQ8A 1KFXS 1CKKA 1NSHA 3RLZA 3CABA 2WCBA 4U8DA 3SJSA 1DELA 2A4JA 4PHMA 2KLDA 2M49B 2GGMA 2OS8C 1JFJA 2CT9A 1UWOA 3PJIA 3KPXA 1ZMZA 1QXPA 1T14A 1KSMA 1EJ3A 1ALVA 1K93D 1A2XA 1MF8B 4GFTA 1DJHA 1IJ5A 2ZNDA 2G9BA 3SS5A 1TNQA 1K2HA 2LVJA 1DT7B 3D75A 1SL7A 3R72A 1SPYA 1Y6WA 3GK2A 3ZWHA 4MRXA 2F2PA 2JXLA 2KGBC 5DKQA 2M9GA 1QX5B 1KK7Y 1YUUA 4AQJA 1YUSA 1BJFA 4I5NB
chains in the Genus database with same CATH topology
3EVVA 2L4HA 2WOSA 5AANA 3JTDB 1K95A 4UPGA 4CFQA 3OX5A 4OV2A 3CGAA 1S36A 3F45A 3LL8B 2KAVA 1J1EA 1CTRA 1JF0A 3OB1B 3PM8A 2BCBA 1B8CA 1OE9B 1QIVA 3PN7B 1CFDA 2AAOA 3I5FC 2L51A 3TS5B 2EC6C 1WRZA 1CLLA 1QASA 1SCMC 3EK4A 1WDCB 4HRGA 2NCOA 2F33A 1KQVA 1TOPA 5AEQA 2ZN8A 5K89A 4WQ3A 4GAOA 2LP2A 2F3ZA 1OQPA 4YGCB 1KFUL 4C0LA 1B8LA 4QJ3B 4MVFA 3FWBA 1ALWA 2FCDA 2LUCA 4MLWA 4GBAA 2CCMA 3SIBA 1QV1A 3GK4X 2LNKA 2DOQA 1F8HA 2OS8B 4MRYA 4AOMA 3WNXB 4WQ2A 1FI5A 2KI6C 1SYMA 2KNEA 1AP4A 1S1EA 1UHKA 2MBXA 5I2LA 1IJ6A 1B7TZ 2LLUA 1AK8A 3BUNB 1ZACA 2ZRSA 4GUKA 1KWOC 2BL0C 3VGOA 1RJVA 2HETA 2QPTA 2MAZA 2PVBA 2AUCA 1QX2A 5D69A 4M2QA 1W7IB 1CDPA 1LKJA 5HKWA 4BY4A 1OMRA 3BXKA 2LMTA 5TNCA 1WRLA 4DS7A 2BKIB 4P2YB 1MXLC 1TN4A 2RGIA 4NDCA 1OOJA 1UHIA 5GQQC 2KAXA 4HREE 3BYAA 1C7VA 2WC8A 2PRUA 2JQ6A 1OZSA 1TNXA 2WORA 3TZ1A 5CSNA 1RFJA 4OCIA 3DVJA 1KSOA 1Y0VH 1CM4A 2LAPA 1N0YA 3CR5X 3EK7A 4PE7A 5DKRA 1XFXO 2KHNA 1JSAA 3A4UB 1J1DA 5HYDA 3AKAA 3SG7A 1XVJA 4N1FA 3LK1A 4GGNA 1F54A 3TDUA 1QVIZ 4NQGA 1FW4A 4QJ5B 1JBAA 4IL1A 1GGZA 1K8UA 3OB2B 3JTDC 3BUOB 1L2OB 1S26D 3KEVA 1CFPA 3SG2A 1CLMA 1M45A 1JUOA 3ICBA 4N5XA 3WHUB 2LVVA 1XO5A 3BOWA 1YVLA 1B47A 1MR8A 2JULA 2M1KB 1AJ4A 3EKJA 2JNXA 5I2OA 3QRXA 1CDMA 1XFYO 3CLNA 2M97A 2BE4A 4ORCB 1CFCA 1ZUZA 2L5XB 3EKHA 4HRHA 3PFVA 4JPZB 1XFZO 1IQ5A 1BT6A 1TRFA 1K9KA 2V53A 2KI4B 4CLNA 1QIWA 3H4SE 1BOCA 2KGRA 2L98A 2O5GA 1IH0A 1FPWA 2JXCA 1C7WA 1G4YR 3DF0B 4YBHB 1QLKA 2PSRA 1KFXL 2B1UA 5IBWA 4GGFC 1YRTB 2Y4QA 1XFVO 1A75A 1AVSA 2BBMA 4PCWA 2L2EA 2NLNA 2NZ0A 1LA3A 2QACA 2K2AA 2GV5A 2MHHA 2L50A 2JTZA 3A8RA 4ZCUA 2E6WA 3O6BA 5KSZA 2ISDA 3TDZA 1CM1A 3SG4A 4HSZA 1AHRA 1V1GA 2P6BB 1ZFSA 1KK7Z 3D10A 5DKNA 3JVTC 4CFRA 1SR6B 5PALA 1F4OA 1G33A 3NSLA 1QTXA 1NIWA 2I2RE 1L2OC 2MJWB 2WNDA 3M0WA 1J7QA 4MN0A 1PSRA 1XFUO 1Y1XA 3PLFB 1J7OA 2JZIA 1WRKA 2LHIA 3D0YA 2JT0A 5ER4X 1KQMC 4I5JA 3DF0A 1QATA 5CSFA 3TUYB 1EL4A 1MHOA 2H2KA 3IQQA 1NX1A 2K7DA 4DUQA 3DD4A 1B4CA 4M2OA 1B1GA 2K8MB 3CTNA 3MSEB 2LMUA 3WHTB 2NCPA 5HKYA 1B8RA 1NX3A 2M7LA 2F2OA 4PE1A 1H4BA 1DJGA 2BKHB 2JC2A 2M1UA 1EXRA 4YGDB 2GGZA 1NX0A 2LVKA 2Q91A 1M31A 1SRAA 2KOTA 4ETOA 1PRWA 4Q04A 2LMVA 2JWWA 3VRRA 4FTGA 2JPTA 1CMGA 5B8IB 1LA0A 4XJKA 1RTP1 1MWNA 1UP5A 2SCPA 2BE6A 2LLSA 3FWCA 2KFGA 3OHMB 4YRUA 3HX4A 3O78A 4PHKA 1BF5A 4YI9A 4MEWA 4R1EA 2KBMA 1CLBA 4YI8A 2CTNA 4ZCVA 5AFPA 2LE9B 4USLA 1B7TY 1RK9A 1SNLA 2KI6D 2M8UA 5JOLA 1K94A 1OMDA 3I5HC 3I5FB 1PALA 1SW8A 2K2FA 3EVUA 3NSIA 2KYCA 2I18A 2NXQA 1NX2A 1JWDA 3NXAA 2JRFA 3CWGA 4PHNA 1FI6A 1G8IA 2FJUB 1YR5A 3IF7A 1BG1A 3VRQA 1B9AA 1W7JB 4MZJA 4D1EA 4YGBB 1X02A 1SY9A 2MLFC 1MXEA 2JNFA 1F55A 4MZKA 1DVIA 3I5HB 1K9UA 2TN4A 1E8AA 3OX6A 1S6IA 1UHJA 2IS9A 3E3RA 1NYAA 2JT3A 2LLTA 1CDLA 1J55A 4XYNA 1IRJA 2E30A 3GK1A 4YGEB 1QVIY 2PMYA 3EK8A 2LC5A 1SR6C 3BQ3A 1R6PA 1HT9A 4OR9B 5HKZA 1CDNA 1YX8A 2BCAA 4M2PA 4C0JA 1MQ1A 1SCVA 2MA2A 4I5LB 3TS5C 5I2QA 2HF5A 5ER5A 1SK6D 1DMOA 1DF0B 2OPOA 2ZRTA 1QS7A 1SL9A 1UHHA 4PE0A 3I5IC 2F3YA 5KU1A 2WCFA 3SIAA 2R2IA 3IQOA 1QLSA 2JU0A 2LCPA 1DF0A 2LP3A 1TIZA 3NSOA 1BODA 1S3PA 2LUXA 1QV0A 1AJ5A 1LINA 2ZKMX 4NDDA 1F71A 1EG4A 2EHBA 1KFUS 4N1GA 1IGVA 3DVMA 1DJXA 1V1FA 3BUWB 3SG5A 1NCXA 1BMOA 1JF2A 2PASA 2BCXA 4C0KA 3BUMB 3PN7C 1DJIA 1YVHA 4GNKB 4PE4A 2CXJA 1XFWO 2G2BA 2OTGC 2KQYA 4TNCA 2KAYA 4ORBB 4E68A 1KWOB 3K21A 4OVNF 1A03A 2KQ6A 3DVKA 4I5KA 3RM1A 2K7BA 1F4QA 2O60A 1WLZA 2I7AA 3KF9A 1BR1B 1FF1A 1K9PA 1UUSA 3VRNA 1A4PA 1M39A 1KCYA 1D1OA 1EG3A 2F8PA 1LVCD 3HCMA 1QJTA 2KDHA 4A4BA 3CS1A 2KBIA 1ZOTB 4DCKA 4JQ0D 4QJ4B 1PK0D 1SKTA 2WCEA 1C07A 1J7PA 3BUXB 1PVBA 1A29A 4AQIA 1NP8A 2D8NA 2KFHA 3GOFA 4P5OE 3O2PA 1PULA 3PSRA 4GPLB 1NCZA 3AKBA 1OSAA 2HQWA 2CBLA 2PALA 1S6JA 2LANA 3PALA 3I5IB 4PDZA 1OZOA 3LK0A 2BECA 1GQMA 4CPVA 1FBVA 5F6TA 3CR2A 1CMFA 1JC2A 1RROA 2ZN9A 1S6CA 4JWQA 3KO0A 4NDBA 1S5GY 2M29A 2M7NA 1CNPA 1YURA 1DGVA 2LM5A 4F0ZB 1Y1AA 2JOJA 4FQOA 3WXAA 5CPVA 1U5IA 5J3XA 2KYFA 5BPJA 1YTZC 3SG3A 1H8BA 1U5IB 1GGWA 1TCFA 3FIAA 4PHJA 5HLVA 2Q4UA 2Y5IA 3AAKA 1IKUA 1CB1A 1DJZA 1YX7A 1PVAA 2K0JA 1Q80A 2Y1MA 2CNPA 3LLEA 1IQ3A 1XK4A 1RECA 1DJWA 1KK8B 1GJYA 2KI4C 5JJGA 1OMVA 3I5GC 1N65A 5AERA 4BY5A 2ZFDA 1TTXA 1NCYA 1MUXA 2KFFA 3ZNIA 3CZTX 1RWYA 2Y1NA 1DJYA 1BLQA 1CFFA 3OP0A 1J7RA 1SL8A 2LV7A 1YRUB 1LXFC 3NSKA 2MLEC 3PATA 1ODBA 4MZLA 4DRWA 2FCEA 2VRGA 1PSBA 3O4YA 1NPQA 2K61A 5D7FA 2OTGB 4L9MA 4PALA 1R2UA 2H61A 2K7CA 1NWDA 1TCOB 3CR4X 1AUIB 1TNPA 1TNWA 2M3WA 2SASA 1K96A 4OKHA 5KTYA 1UURA 3EVRA 1HQVA 2LHLA 3JVTB 3SG6A 1QX7A 2MRDA 4GGFA 2BBNA 2COLB 3KHEA 4A4CA 1YUTA 3VRPA 1SBJA 2EC6B 5CSJA 1A75B 1KQMB 3TUYC 3FS7A 2H61C 1S5GZ 4MBEA 1SMGA 2BL0B 4CIDA 2L4IA 1M46A 1VRKA 1N2DA 2L0PA 5HLOA 1IWQA 4YGAA 5G08A 1L7ZA 2JT8A 1M63B 2M0RA 1IG5A 1F70A 1EH2A 1KK8C 5AXIA 1Y1UA 3AAJA 1BU3A 1XYDA 1DGUA 1XA5A 2FOTA 3I5GB 3VROA 3LCPC 1K90D 3D0YB 1NUBA 3DVEA 2HPSA 5FYXA 2AMIA 2LVIA 5I8NA 1UHNA 3C1VA 2KSPA 4ORAB 1XK4C 1WY9A 1JFKA 2EGDA 1SCMB 3TDIA 4MSPA 2K7OA 3BOWB 4XJKB 2ZNEA 2JTTA 4ICBA 1DTLA 4WRIA 4DIRA 1WLMA 2I94A 1WDCC 5CSIA 1BR4B 2HQ8A 1KFXS 1CKKA 1NSHA 3RLZA 2WCBA 4U8DA 3SJSA 2A4JA 4PHMA 2M49B 2GGMA 2OS8C 1JFJA 2CT9A 1UWOA 3KPXA 1ZMZA 1QXPA 1KSMA 1EJ3A 1ALVA 1K93D 1A2XA 1MF8B 4GFTA 1DJHA 1IJ5A 2ZNDA 2G9BA 1K2HA 1TNQA 2LVJA 1DT7B 1SL7A 1SPYA 1Y6WA 3GK2A 3ZWHA 4MRXA 2F2PA 2JXLA 2KGBC 5DKQA 2M9GA 1QX5B 1KK7Y 1YUUA 4AQJA 1YUSA 1BJFA 4I5NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  2L4H A;  2WOS A;  5AAN A;  3JTD B;  1K95 A;  4UPG A;  4CFQ A;  3OX5 A;  4OV2 A;  3CGA A;  1S36 A;  3F45 A;  3LL8 B;  2KAV A;  1J1E A;  1CTR A;  1JF0 A;  3OB1 B;  3PM8 A;  2BCB A;  1B8C A;  1OE9 B;  1QIV A;  3PN7 B;  1CFD A;  2AAO A;  3I5F C;  2L51 A;  3TS5 B;  2EC6 C;  1WRZ A;  1CLL A;  1QAS A;  1SCM C;  3EK4 A;  1WDC B;  4HRG A;  2NCO A;  2F33 A;  1KQV A;  1TOP A;  5AEQ A;  2ZN8 A;  5K89 A;  4WQ3 A;  4GAO A;  2LP2 A;  2F3Z A;  1OQP A;  4YGC B;  1KFU L;  4C0L A;  1B8L A;  4QJ3 B;  4MVF A;  3FWB A;  1ALW A;  2FCD A;  2LUC A;  4MLW A;  4GBA A;  2CCM A;  3SIB A;  1QV1 A;  3GK4 X;  2LNK A;  2DOQ A;  1F8H A;  2OS8 B;  4MRY A;  4AOM A;  3WNX B;  4WQ2 A;  1FI5 A;  2KI6 C;  1SYM A;  2KNE A;  1AP4 A;  1S1E A;  1UHK A;  2MBX A;  5I2L A;  1IJ6 A;  1B7T Z;  2LLU A;  1AK8 A;  3BUN B;  1ZAC A;  2ZRS A;  4GUK A;  1KWO C;  2BL0 C;  3VGO A;  1RJV A;  2HET A;  2QPT A;  2MAZ A;  2PVB A;  2AUC A;  1QX2 A;  5D69 A;  4M2Q A;  1W7I B;  1CDP A;  1LKJ A;  5HKW A;  4BY4 A;  1OMR A;  3BXK A;  2LMT A;  5TNC A;  1WRL A;  4DS7 A;  2BKI B;  4P2Y B;  1MXL C;  1TN4 A;  2RGI A;  4NDC A;  1OOJ A;  1UHI A;  5GQQ C;  2KAX A;  4HRE E;  3BYA A;  1C7V A;  2WC8 A;  2PRU A;  2JQ6 A;  1OZS A;  1TNX A;  2WOR A;  3TZ1 A;  5CSN A;  1RFJ A;  4OCI A;  3DVJ A;  1KSO A;  1Y0V H;  1CM4 A;  2LAP A;  1N0Y A;  3CR5 X;  3EK7 A;  4PE7 A;  5DKR A;  1XFX O;  2KHN A;  1JSA A;  3A4U B;  1J1D A;  5HYD A;  3AKA A;  3SG7 A;  1XVJ A;  4N1F A;  3LK1 A;  4GGN A;  1F54 A;  3TDU A;  1QVI Z;  4NQG A;  1FW4 A;  4QJ5 B;  1JBA A;  4IL1 A;  1GGZ A;  1K8U A;  3OB2 B;  3JTD C;  3BUO B;  1L2O B;  1S26 D;  3KEV A;  1CFP A;  3SG2 A;  1CLM A;  1M45 A;  1JUO A;  3ICB A;  4N5X A;  3WHU B;  2LVV A;  1XO5 A;  3BOW A;  1YVL A;  1B47 A;  1MR8 A;  2JUL A;  2M1K B;  1AJ4 A;  3EKJ A;  2JNX A;  5I2O A;  3QRX A;  1CDM A;  1XFY O;  3CLN A;  2M97 A;  2BE4 A;  4ORC B;  1CFC A;  1ZUZ A;  2L5X B;  3EKH A;  4HRH A;  3PFV A;  4JPZ B;  1XFZ O;  1IQ5 A;  1BT6 A;  1TRF A;  1K9K A;  2V53 A;  2KI4 B;  4CLN A;  1QIW A;  3H4S E;  1BOC A;  2KGR A;  2L98 A;  2O5G A;  1IH0 A;  1FPW A;  2JXC A;  1C7W A;  1G4Y R;  3DF0 B;  4YBH B;  1QLK A;  2PSR A;  1KFX L;  2B1U A;  5IBW A;  4GGF C;  1YRT B;  2Y4Q A;  1XFV O;  1A75 A;  1AVS A;  2BBM A;  4PCW A;  2L2E A;  2NLN A;  2NZ0 A;  1LA3 A;  2QAC A;  2K2A A;  2GV5 A;  2MHH A;  2L50 A;  2JTZ A;  3A8R A;  4ZCU A;  2E6W A;  3O6B A;  5KSZ A;  2ISD A;  3TDZ A;  1CM1 A;  3SG4 A;  4HSZ A;  1AHR A;  1V1G A;  2P6B B;  1ZFS A;  1KK7 Z;  3D10 A;  5DKN A;  3JVT C;  4CFR A;  1SR6 B;  5PAL A;  1F4O A;  1G33 A;  3NSL A;  1QTX A;  1NIW A;  2I2R E;  1L2O C;  2MJW B;  2WND A;  3M0W A;  1J7Q A;  4MN0 A;  1PSR A;  1XFU O;  1Y1X A;  3PLF B;  1J7O A;  2JZI A;  1WRK A;  2LHI A;  3D0Y A;  2JT0 A;  5ER4 X;  1KQM C;  4I5J A;  3DF0 A;  1QAT A;  5CSF A;  3TUY B;  1EL4 A;  1MHO A;  2H2K A;  3IQQ A;  1NX1 A;  2K7D A;  4DUQ A;  3DD4 A;  1B4C A;  4M2O A;  1B1G A;  2K8M B;  3CTN A;  3MSE B;  2LMU A;  3WHT B;  2NCP A;  5HKY A;  1B8R A;  1NX3 A;  2M7L A;  2F2O A;  4PE1 A;  1H4B A;  1DJG A;  2BKH B;  2JC2 A;  2M1U A;  1EXR A;  4YGD B;  2GGZ A;  1NX0 A;  2LVK A;  2Q91 A;  1M31 A;  1SRA A;  2KOT A;  4ETO A;  1PRW A;  4Q04 A;  2LMV A;  2JWW A;  3VRR A;  4FTG A;  2JPT A;  1CMG A;  5B8I B;  1LA0 A;  4XJK A;  1RTP 1;  1MWN A;  1UP5 A;  2SCP A;  2BE6 A;  2LLS A;  3FWC A;  2KFG A;  3OHM B;  4YRU A;  3HX4 A;  3O78 A;  4PHK A;  1BF5 A;  4YI9 A;  4MEW A;  4R1E A;  2KBM A;  1CLB A;  4YI8 A;  2CTN A;  4ZCV A;  5AFP A;  2LE9 B;  4USL A;  1B7T Y;  1RK9 A;  1SNL A;  2KI6 D;  2M8U A;  5JOL A;  1K94 A;  1OMD A;  3I5H C;  3I5F B;  1PAL A;  1SW8 A;  2K2F A;  3EVU A;  3NSI A;  2KYC A;  2I18 A;  2NXQ A;  1NX2 A;  1JWD A;  3NXA A;  2JRF A;  3CWG A;  4PHN A;  1FI6 A;  1G8I A;  2FJU B;  1YR5 A;  3IF7 A;  1BG1 A;  3VRQ A;  1B9A A;  1W7J B;  4MZJ A;  4D1E A;  4YGB B;  1X02 A;  1SY9 A;  2MLF C;  1MXE A;  2JNF A;  1F55 A;  4MZK A;  1DVI A;  3I5H B;  1K9U A;  2TN4 A;  1E8A A;  3OX6 A;  1S6I A;  1UHJ A;  2IS9 A;  3E3R A;  1NYA A;  2JT3 A;  2LLT A;  1CDL A;  1J55 A;  4XYN A;  1IRJ A;  2E30 A;  3GK1 A;  4YGE B;  1QVI Y;  2PMY A;  3EK8 A;  2LC5 A;  1SR6 C;  3BQ3 A;  1R6P A;  1HT9 A;  4OR9 B;  5HKZ A;  1CDN A;  1YX8 A;  2BCA A;  4M2P A;  4C0J A;  1MQ1 A;  1SCV A;  2MA2 A;  4I5L B;  3TS5 C;  5I2Q A;  2HF5 A;  5ER5 A;  1SK6 D;  1DMO A;  1DF0 B;  2OPO A;  2ZRT A;  1QS7 A;  1SL9 A;  1UHH A;  4PE0 A;  3I5I C;  2F3Y A;  5KU1 A;  2WCF A;  3SIA A;  2R2I A;  3IQO A;  1QLS A;  2JU0 A;  2LCP A;  1DF0 A;  2LP3 A;  1TIZ A;  3NSO A;  1BOD A;  1S3P A;  2LUX A;  1QV0 A;  1AJ5 A;  1LIN A;  2ZKM X;  4NDD A;  1F71 A;  1EG4 A;  2EHB A;  1KFU S;  4N1G A;  1IGV A;  3DVM A;  1DJX A;  1V1F A;  3BUW B;  3SG5 A;  1NCX A;  1BMO A;  1JF2 A;  2PAS A;  2BCX A;  4C0K A;  3BUM B;  3PN7 C;  1DJI A;  1YVH A;  4GNK B;  4PE4 A;  2CXJ A;  1XFW O;  2G2B A;  2OTG C;  2KQY A;  4TNC A;  2KAY A;  4ORB B;  4E68 A;  1KWO B;  3K21 A;  4OVN F;  1A03 A;  2KQ6 A;  3DVK A;  4I5K A;  3RM1 A;  2K7B A;  1F4Q A;  2O60 A;  1WLZ A;  2I7A A;  3KF9 A;  1BR1 B;  1FF1 A;  1K9P A;  1UUS A;  3VRN A;  1A4P A;  1M39 A;  1KCY A;  1D1O A;  1EG3 A;  2F8P A;  1LVC D;  3HCM A;  1QJT A;  2KDH A;  4A4B A;  3CS1 A;  2KBI A;  1ZOT B;  4DCK A;  4JQ0 D;  4QJ4 B;  1PK0 D;  1SKT A;  2WCE A;  1C07 A;  1J7P A;  3BUX B;  1PVB A;  1A29 A;  4AQI A;  1NP8 A;  2D8N A;  2KFH A;  3GOF A;  4P5O E;  3O2P A;  1PUL A;  3PSR A;  4GPL B;  1NCZ A;  3AKB A;  1OSA A;  2HQW A;  2CBL A;  2PAL A;  1S6J A;  2LAN A;  3PAL A;  3I5I B;  4PDZ A;  1OZO A;  3LK0 A;  2BEC A;  1GQM A;  4CPV A;  1FBV A;  5F6T A;  3CR2 A;  1CMF A;  1JC2 A;  1RRO A;  2ZN9 A;  1S6C A;  4JWQ A;  3KO0 A;  4NDB A;  1S5G Y;  2M29 A;  2M7N A;  1CNP A;  1YUR A;  1DGV A;  2LM5 A;  4F0Z B;  1Y1A A;  2JOJ A;  4FQO A;  3WXA A;  5CPV A;  1U5I A;  5J3X A;  2KYF A;  5BPJ A;  1YTZ C;  3SG3 A;  1H8B A;  1U5I B;  1GGW A;  1TCF A;  3FIA A;  4PHJ A;  5HLV A;  2Q4U A;  2Y5I A;  3AAK A;  1IKU A;  1CB1 A;  1DJZ A;  1YX7 A;  1PVA A;  2K0J A;  1Q80 A;  2Y1M A;  2CNP A;  3LLE A;  1IQ3 A;  1XK4 A;  1REC A;  1DJW A;  1KK8 B;  1GJY A;  2KI4 C;  5JJG A;  1OMV A;  3I5G C;  1N65 A;  5AER A;  4BY5 A;  2ZFD A;  1TTX A;  1NCY A;  1MUX A;  2KFF A;  3ZNI A;  3CZT X;  1RWY A;  2Y1N A;  1DJY A;  1BLQ A;  1CFF A;  3OP0 A;  1J7R A;  1SL8 A;  2LV7 A;  1YRU B;  1LXF C;  3NSK A;  2MLE C;  3PAT A;  1ODB A;  4MZL A;  4DRW A;  2FCE A;  2VRG A;  1PSB A;  3O4Y A;  1NPQ A;  2K61 A;  5D7F A;  2OTG B;  4L9M A;  4PAL A;  1R2U A;  2H61 A;  2K7C A;  1NWD A;  1TCO B;  3CR4 X;  1AUI B;  1TNP A;  1TNW A;  2M3W A;  2SAS A;  1K96 A;  4OKH A;  5KTY A;  1UUR A;  3EVR A;  1HQV A;  2LHL A;  3JVT B;  3SG6 A;  1QX7 A;  2MRD A;  4GGF A;  2BBN A;  2COL B;  3KHE A;  4A4C A;  1YUT A;  3VRP A;  1SBJ A;  2EC6 B;  5CSJ A;  1A75 B;  1KQM B;  3TUY C;  3FS7 A;  2H61 C;  1S5G Z;  4MBE A;  1SMG A;  2BL0 B;  4CID A;  2L4I A;  1M46 A;  1VRK A;  1N2D A;  2L0P A;  5HLO A;  1IWQ A;  4YGA A;  5G08 A;  1L7Z A;  2JT8 A;  1M63 B;  2M0R A;  1IG5 A;  1F70 A;  1EH2 A;  1KK8 C;  5AXI A;  1Y1U A;  3AAJ A;  1BU3 A;  1XYD A;  1DGU A;  1XA5 A;  2FOT A;  3I5G B;  3VRO A;  3LCP C;  1K90 D;  3D0Y B;  1NUB A;  3DVE A;  2HPS A;  5FYX A;  2AMI A;  2LVI A;  5I8N A;  1UHN A;  3C1V A;  2KSP A;  4ORA B;  1XK4 C;  1WY9 A;  1JFK A;  2EGD A;  1SCM B;  3TDI A;  4MSP A;  2K7O A;  3BOW B;  4XJK B;  2ZNE A;  2JTT A;  4ICB A;  1DTL A;  4WRI A;  4DIR A;  1WLM A;  2I94 A;  1WDC C;  5CSI A;  1BR4 B;  2HQ8 A;  1KFX S;  1CKK A;  1NSH A;  3RLZ A;  2WCB A;  4U8D A;  3SJS A;  2A4J A;  4PHM A;  2M49 B;  2GGM A;  2OS8 C;  1JFJ A;  2CT9 A;  1UWO A;  3KPX A;  1ZMZ A;  1QXP A;  1KSM A;  1EJ3 A;  1ALV A;  1K93 D;  1A2X A;  1MF8 B;  4GFT A;  1DJH A;  1IJ5 A;  2ZND A;  2G9B A;  1K2H A;  1TNQ A;  2LVJ A;  1DT7 B;  1SL7 A;  1SPY A;  1Y6W A;  3GK2 A;  3ZWH A;  4MRX A;  2F2P A;  2JXL A;  2KGB C;  5DKQ A;  2M9G A;  1QX5 B;  1KK7 Y;  1YUU A;  4AQJ A;  1YUS A;  1BJF A;  4I5N B; 
#chains in the Genus database with same CATH topology
 3EVV A;  2L4H A;  2WOS A;  5AAN A;  3S0B A;  3JTD B;  1K95 A;  3DY9 A;  4UPG A;  4CFQ A;  3OX5 A;  4OV2 A;  3CGA A;  1S36 A;  3F45 A;  3LL8 B;  1Z2C B;  1J1E A;  1CTR A;  1JF0 A;  2KAV A;  1C3Z A;  2BCB A;  1B8C A;  1OE9 B;  1QIV A;  3PM8 A;  3PN7 B;  1CFD A;  3OB1 B;  2AAO A;  3I5F C;  2L51 A;  3TS5 B;  2EC6 C;  1WRZ A;  1CLL A;  1QAS A;  1SCM C;  3EK4 A;  1WDC B;  1Z4H A;  4HRG A;  2NCO A;  2F33 A;  1KQV A;  1TOP A;  5AEQ A;  2ZN8 A;  5K89 A;  3SS4 A;  4WQ3 A;  4GAO A;  2LP2 A;  2F3Z A;  1OQP A;  4YGC B;  3S0D A;  1KFU L;  4C0L A;  1B8L A;  4QJ3 B;  4MVF A;  3FWB A;  1ALW A;  2FCD A;  2LUC A;  4MLW A;  4GBA A;  2CCM A;  3SIB A;  1QV1 A;  3GK4 X;  2LNK A;  2DOQ A;  1F8H A;  2OS8 B;  4MRY A;  4AOM A;  3WNX B;  4WQ2 A;  1FI5 A;  4INW A;  2KI6 C;  1OOH A;  1SYM A;  2KNE A;  1AP4 A;  2L2C A;  1S1E A;  1UHK A;  2MBX A;  5I2L A;  1IJ6 A;  1B7T Z;  2LLU A;  1AK8 A;  3BUN B;  1ZAC A;  2ZRS A;  4GUK A;  1KWO C;  2BL0 C;  3VGO A;  1RJV A;  2HET A;  5FI6 A;  2QPT A;  2MAZ A;  2PVB A;  2AUC A;  1QX2 A;  5D69 A;  4M2Q A;  1W7I B;  1CDP A;  1LKJ A;  5HKW A;  4BY4 A;  1OMR A;  3BXK A;  2LMT A;  5TNC A;  1WRL A;  3S0G A;  3DYE A;  3BFB A;  2BKI B;  4P2Y B;  1MXL C;  1TN4 A;  2RGI A;  4NDC A;  1OOJ A;  1UHI A;  4DS7 A;  5GQQ C;  2KAX A;  4JKT A;  3NHT A;  3BYA A;  4HRE E;  1C7V A;  2WC8 A;  2PRU A;  3D74 A;  2JQ6 A;  1OZS A;  1OOI X;  1TNX A;  2WOR A;  3TZ1 A;  5CSN A;  1RFJ A;  4OCI A;  3DVJ A;  1KSO A;  2L5Y A;  1Y0V H;  1CM4 A;  2LAP A;  3R1P A;  1N0Y A;  2KPH A;  3CR5 X;  3EK7 A;  4PE7 A;  5DKR A;  1XFX O;  2KHN A;  1JSA A;  3A4U B;  1J1D A;  5HYD A;  3AKA A;  4IJ7 A;  4INX A;  3SG7 A;  1XVJ A;  4N1F A;  3LK1 A;  4GGN A;  1F54 A;  3TDU A;  1QVI Z;  4NQG A;  1FW4 A;  4QJ5 B;  3B86 A;  1JBA A;  4IL1 A;  1GGZ A;  1GM0 A;  1K8U A;  3OB2 B;  3JTD C;  3BUO B;  1L2O B;  1S26 D;  4PT1 A;  3KEV A;  1CFP A;  3SG2 A;  1CLM A;  1M45 A;  1JUO A;  3ICB A;  4N5X A;  3WHU B;  2LVV A;  1XO5 A;  3BOW A;  1YVL A;  3Q8I A;  1B47 A;  1MR8 A;  2JUL A;  2M1K B;  1AJ4 A;  3EKJ A;  2JNX A;  5I2O A;  3QRX A;  1CDM A;  1XFY O;  3CLN A;  1TWO A;  1TUZ A;  2BE4 A;  2M97 A;  1ZUZ A;  4ORC B;  1CFC A;  2L5X B;  3EKH A;  4HRH A;  3N7H A;  3PFV A;  4JPZ B;  1XFZ O;  1IQ5 A;  1BT6 A;  1TRF A;  3BFA A;  1K9K A;  2V53 A;  2KI4 B;  4CLN A;  1QIW A;  3H4S E;  3IVT A;  1BOC A;  2KGR A;  2L98 A;  2O5G A;  1IH0 A;  1FPW A;  2JXC A;  1C7W A;  1G4Y R;  3DF0 B;  4YBH B;  1QLK A;  2PSR A;  1KFX L;  2B1U A;  5IBW A;  4GGF C;  2WCH A;  1YRT B;  2Y4Q A;  1XFV O;  1A75 A;  1AVS A;  2BBM A;  3R1O A;  4PCW A;  2L2E A;  2NLN A;  2NZ0 A;  1LA3 A;  2QAC A;  2K2A A;  1LS8 A;  2GV5 A;  3B87 A;  2MHH A;  2L50 A;  2JTZ A;  2QEH A;  3A8R A;  4ZCU A;  2E6W A;  3O6B A;  5KSZ A;  2ISD A;  3TDZ A;  1CM1 A;  3CYZ A;  3CZ2 A;  3SG4 A;  4HSZ A;  1AHR A;  1V1G A;  2P6B B;  1ZFS A;  1KK7 Z;  3D10 A;  2GTE A;  5DKN A;  3JVT C;  4CFR A;  1SR6 B;  5PAL A;  1F4O A;  1G33 A;  3NSL A;  1QTX A;  1NIW A;  2I2R E;  1L2O C;  2MJW B;  2WND A;  3M0W A;  1J7Q A;  4MN0 A;  1PSR A;  1XFU O;  1Y1X A;  3O4X A;  3PLF B;  2JZI A;  1J7O A;  1WRK A;  2LHI A;  3D0Y A;  2JT0 A;  4FQT A;  5ER4 X;  1DC1 A;  1KQM C;  4I5J A;  3DF0 A;  1QAT A;  5CSF A;  3TUY B;  1EL4 A;  1MHO A;  1P28 A;  3BJH A;  2H2K A;  3IQQ A;  1NX1 A;  2K7D A;  4DUQ A;  3DD4 A;  1B4C A;  4M2O A;  1B1G A;  2K8M B;  3CTN A;  3MSE B;  2LMU A;  3WHT B;  2NCP A;  5HKY A;  1B8R A;  1NX3 A;  2M7L A;  2F2O A;  4PE1 A;  1H4B A;  1DJG A;  3DZT A;  2BKH B;  2JC2 A;  2M1U A;  1EXR A;  3L47 A;  4YGD B;  2GGZ A;  1NX0 A;  2LVK A;  2Q91 A;  1M31 A;  1SRA A;  2KOT A;  3K1E A;  5FI7 A;  4ETO A;  1PRW A;  4Q04 A;  2WC6 A;  2LMV A;  1OOG A;  2JWW A;  3VRR A;  4FTG A;  2JPT A;  1CMG A;  2K60 A;  3UO9 A;  1W9Z A;  5B8I B;  1LA0 A;  4XJK A;  5FI2 A;  1RTP 1;  1MWN A;  1UP5 A;  2SCP A;  2BE6 A;  2LLS A;  3FWC A;  2KFG A;  3OHM B;  4YRU A;  3HX4 A;  3O78 A;  4PHK A;  1BF5 A;  4YI9 A;  4MEW A;  4R1E A;  2KBM A;  1CLB A;  4YI8 A;  2CTN A;  4ZCV A;  2WCL A;  5AFP A;  2LE9 B;  4USL A;  1B7T Y;  1RK9 A;  1SNL A;  2KI6 D;  2M8U A;  3D77 A;  3FE6 A;  3EG5 B;  5JOL A;  1QWV A;  1K94 A;  1OMD A;  3I5H C;  1SSE B;  3I5F B;  1PAL A;  1SW8 A;  2K2F A;  3EVU A;  3NSI A;  2KYC A;  2I18 A;  2NXQ A;  1NX2 A;  1JWD A;  3NXA A;  2JRF A;  3CWG A;  4PHN A;  1FI6 A;  1G8I A;  1YR5 A;  2FJU B;  3IF7 A;  1BG1 A;  3VRQ A;  1B9A A;  1W7J B;  4MZJ A;  4D1E A;  4YGB B;  1X02 A;  1SY9 A;  2MLF C;  3NGV A;  3S0E A;  1MXE A;  2JNF A;  1F55 A;  4MZK A;  1DVI A;  3I5H B;  1K9U A;  2TN4 A;  1E8A A;  2QEB A;  3OX6 A;  1S6I A;  1UHJ A;  2IS9 A;  3E3R A;  1NYA A;  2JT3 A;  2LLT A;  1CDL A;  1J55 A;  4XYN A;  1IRJ A;  2E30 A;  3GK1 A;  4YGE B;  1QVI Y;  2PMY A;  3B7A A;  3EK8 A;  2LC5 A;  1SR6 C;  3BQ3 A;  1R6P A;  3NHI A;  1HT9 A;  4OR9 B;  5HKZ A;  4F7F A;  1YX8 A;  2BCA A;  1CDN A;  4M2P A;  4C0J A;  1MQ1 A;  1SCV A;  2MA2 A;  4I5L B;  3TS5 C;  5I2Q A;  2HF5 A;  5ER5 A;  1SK6 D;  3CZ0 A;  1DMO A;  1DF0 B;  2OPO A;  2ZRT A;  1DEK A;  1QS7 A;  1SL9 A;  1UHH A;  4PE0 A;  3I5I C;  2F3Y A;  5KU1 A;  2WCF A;  3SIA A;  2R2I A;  3IQO A;  1QLS A;  2JU0 A;  2LCP A;  1DF0 A;  2LP3 A;  1TIZ A;  3NSO A;  2WCK A;  1BOD A;  1S3P A;  2QDI A;  2FJY A;  2LUX A;  1QV0 A;  1AJ5 A;  1LIN A;  2ZKM X;  4NDD A;  1F71 A;  1EG4 A;  2EHB A;  1KFU S;  4N1G A;  1IGV A;  3DVM A;  1DJX A;  1V1F A;  3BUW B;  3SG5 A;  1NCX A;  2QEO A;  1BMO A;  1JF2 A;  2PAS A;  2BCX A;  4C0K A;  3BUM B;  3PN7 C;  1DJI A;  1YVH A;  4GNK B;  4PE4 A;  2CXJ A;  1XFW O;  2G2B A;  2OTG C;  2KQY A;  4TNC A;  2KAY A;  4ORB B;  2ERB A;  4E68 A;  1KWO B;  1TUJ A;  3K21 A;  4OVN F;  1A03 A;  2KQ6 A;  3DVK A;  4I5K A;  3RM1 A;  2K7B A;  1F4Q A;  2O60 A;  1WLZ A;  2I7A A;  2P70 A;  1BR1 B;  3KF9 A;  1K9P A;  1FF1 A;  1UUS A;  2PQL A;  3VRN A;  1A4P A;  1M39 A;  2WC5 A;  3UNW A;  1KCY A;  1D1O A;  1C3Y A;  1EG3 A;  2F8P A;  1LVC D;  3HCM A;  1QJT A;  2KDH A;  4A4B A;  3CS1 A;  2KBI A;  1ZOT B;  4DCK A;  4JQ0 D;  4QJ4 B;  1PK0 D;  1SKT A;  2WCE A;  3SS3 A;  1C07 A;  1J7P A;  3BUX B;  3CDN A;  1PVB A;  1A29 A;  4AQI A;  1NP8 A;  2D8N A;  2KFH A;  3GOF A;  4P5O E;  3O2P A;  1PUL A;  3PSR A;  4GPL B;  1NCZ A;  3AKB A;  1OSA A;  2HQW A;  2CBL A;  2PAL A;  1S6J A;  2LAN A;  3PAL A;  3I5I B;  4PDZ A;  3S0A A;  1OZO A;  3LK0 A;  2BEC A;  1GQM A;  4CPV A;  1FBV A;  5F6T A;  3CR2 A;  1CMF A;  1JC2 A;  1RRO A;  2ZN9 A;  1S6C A;  5I94 A;  4JWQ A;  1IIO A;  3KO0 A;  3L4L A;  4NDB A;  3CZ1 A;  1S5G Y;  2M29 A;  2M7N A;  2WCM A;  1YUR A;  5D3O A;  1CNP A;  1DGV A;  2H8V A;  2LM5 A;  4F0Z B;  1Y1A A;  2JOJ A;  4FQO A;  3WXA A;  5CPV A;  1U5I A;  4JD9 A;  3RZS A;  5J3X A;  3L4A A;  2KYF A;  2P71 A;  5BPJ A;  1YTZ C;  3SG3 A;  2WCJ A;  1H8B A;  3PM2 A;  1U5I B;  1GGW A;  1TCF A;  3FIA A;  4PHJ A;  5HLV A;  2Q4U A;  2Y5I A;  3AAK A;  3S0F A;  1IKU A;  1CB1 A;  1DJZ A;  1YX7 A;  1PVA A;  2K0J A;  1Q80 A;  2Y1M A;  2CNP A;  3LLE A;  1IQ3 A;  1XK4 A;  1REC A;  1DJW A;  1KK8 B;  1GJY A;  2KI4 C;  5JJG A;  1OMV A;  3I5G C;  1N65 A;  5AER A;  3D78 A;  4BY5 A;  2ZFD A;  1TTX A;  1NCY A;  1MUX A;  2KFF A;  3ZNI A;  3CZT X;  1RWY A;  2Y1N A;  1DJY A;  1BLQ A;  1CFF A;  3OP0 A;  1J7R A;  3FE9 A;  2BNX A;  2PYQ A;  1SL8 A;  3VB1 A;  2LV7 A;  1YRU B;  1LXF C;  3NSK A;  2MLE C;  3PAT A;  1ODB A;  4MZL A;  4DRW A;  1XFR A;  2FCE A;  2VRG A;  1PSB A;  3O4Y A;  1NPQ A;  2K61 A;  5D7F A;  2OTG B;  4L9M A;  4PAL A;  1R2U A;  2H61 A;  3R1V A;  3V2L A;  2K7C A;  1NWD A;  1TCO B;  3CR4 X;  1AUI B;  1TNP A;  1TNW A;  3OGN A;  2M3W A;  2SAS A;  1K96 A;  4OKH A;  5KTY A;  3QME A;  1UUR A;  3EVR A;  1HQV A;  2LHL A;  3JVT B;  3SG6 A;  1QX7 A;  2MRD A;  4GGF A;  2BBN A;  2COL B;  3KHE A;  4A4C A;  1YUT A;  3VRP A;  1SBJ A;  2EC6 B;  5CSJ A;  1A75 B;  5HL1 A;  1DQE A;  1KQM B;  3TUY C;  3FS7 A;  2H61 C;  3FE8 A;  1S5G Z;  4MBE A;  1SMG A;  2BL0 B;  2YGU A;  3B6X A;  4CID A;  2L4I A;  3D76 A;  1M46 A;  1VRK A;  1N2D A;  2L0P A;  5HLO A;  1IWQ A;  3B88 A;  2BAP A;  4YGA A;  4OZD A;  5G08 A;  1L7Z A;  2JT8 A;  2KLE A;  1M63 B;  3D73 A;  2M0R A;  1IG5 A;  1F70 A;  1EH2 A;  1KK8 C;  5AXI A;  1Y1U A;  3AAJ A;  1BU3 A;  1XYD A;  1DGU A;  1XA5 A;  2FOT A;  3I5G B;  3OBV A;  3VRO A;  5DIC A;  3LCP C;  1K90 D;  3D0Y B;  1NUB A;  3DVE A;  2HPS A;  5FYX A;  2AMI A;  3DXL A;  2LVI A;  3BFH A;  5I8N A;  1UHN A;  4KYN A;  3C1V A;  2KSP A;  4ORA B;  1OOF A;  1XK4 C;  1WY9 A;  1JFK A;  2EGD A;  2QEV A;  1SCM B;  3TDI A;  4MSP A;  2K7O A;  3BOW B;  2JPO A;  4XJK B;  2ZNE A;  2JTT A;  4ICB A;  5EL2 A;  1ORG A;  1DTL A;  4WRI A;  4DIR A;  1WLM A;  1OW4 A;  1WDC C;  2I94 A;  5CSI A;  1BR4 B;  2HQ8 A;  1KFX S;  1CKK A;  1NSH A;  3RLZ A;  3CAB A;  2WCB A;  4U8D A;  3SJS A;  1DEL A;  2A4J A;  4PHM A;  2KLD A;  2M49 B;  2GGM A;  2OS8 C;  1JFJ A;  2CT9 A;  1UWO A;  3PJI A;  3KPX A;  1ZMZ A;  1QXP A;  1T14 A;  1KSM A;  1EJ3 A;  1ALV A;  1K93 D;  1A2X A;  1MF8 B;  4GFT A;  1DJH A;  1IJ5 A;  2ZND A;  2G9B A;  3SS5 A;  1TNQ A;  1K2H A;  2LVJ A;  1DT7 B;  3D75 A;  1SL7 A;  3R72 A;  1SPY A;  1Y6W A;  3GK2 A;  3ZWH A;  4MRX A;  2F2P A;  2JXL A;  2KGB C;  5DKQ A;  2M9G A;  1QX5 B;  1KK7 Y;  1YUU A;  4AQJ A;  1YUS A;  1BJF A;  4I5N B; 
#chains in the Genus database with same CATH homology
 3EVV A;  2L4H A;  2WOS A;  5AAN A;  3JTD B;  1K95 A;  4UPG A;  4CFQ A;  3OX5 A;  4OV2 A;  3CGA A;  1S36 A;  3F45 A;  3LL8 B;  2KAV A;  1J1E A;  1CTR A;  1JF0 A;  3OB1 B;  3PM8 A;  2BCB A;  1B8C A;  1OE9 B;  1QIV A;  3PN7 B;  1CFD A;  2AAO A;  3I5F C;  2L51 A;  3TS5 B;  2EC6 C;  1WRZ A;  1CLL A;  1QAS A;  1SCM C;  3EK4 A;  1WDC B;  4HRG A;  2NCO A;  2F33 A;  1KQV A;  1TOP A;  5AEQ A;  2ZN8 A;  5K89 A;  4WQ3 A;  4GAO A;  2LP2 A;  2F3Z A;  1OQP A;  4YGC B;  1KFU L;  4C0L A;  1B8L A;  4QJ3 B;  4MVF A;  3FWB A;  1ALW A;  2FCD A;  2LUC A;  4MLW A;  4GBA A;  2CCM A;  3SIB A;  1QV1 A;  3GK4 X;  2LNK A;  2DOQ A;  1F8H A;  2OS8 B;  4MRY A;  4AOM A;  3WNX B;  4WQ2 A;  1FI5 A;  2KI6 C;  1SYM A;  2KNE A;  1AP4 A;  1S1E A;  1UHK A;  2MBX A;  5I2L A;  1IJ6 A;  1B7T Z;  2LLU A;  1AK8 A;  3BUN B;  1ZAC A;  2ZRS A;  4GUK A;  1KWO C;  2BL0 C;  3VGO A;  1RJV A;  2HET A;  2QPT A;  2MAZ A;  2PVB A;  2AUC A;  1QX2 A;  5D69 A;  4M2Q A;  1W7I B;  1CDP A;  1LKJ A;  5HKW A;  4BY4 A;  1OMR A;  3BXK A;  2LMT A;  5TNC A;  1WRL A;  4DS7 A;  2BKI B;  4P2Y B;  1MXL C;  1TN4 A;  2RGI A;  4NDC A;  1OOJ A;  1UHI A;  5GQQ C;  2KAX A;  4HRE E;  3BYA A;  1C7V A;  2WC8 A;  2PRU A;  2JQ6 A;  1OZS A;  1TNX A;  2WOR A;  3TZ1 A;  5CSN A;  1RFJ A;  4OCI A;  3DVJ A;  1KSO A;  1Y0V H;  1CM4 A;  2LAP A;  1N0Y A;  3CR5 X;  3EK7 A;  4PE7 A;  5DKR A;  1XFX O;  2KHN A;  1JSA A;  3A4U B;  1J1D A;  5HYD A;  3AKA A;  3SG7 A;  1XVJ A;  4N1F A;  3LK1 A;  4GGN A;  1F54 A;  3TDU A;  1QVI Z;  4NQG A;  1FW4 A;  4QJ5 B;  1JBA A;  4IL1 A;  1GGZ A;  1K8U A;  3OB2 B;  3JTD C;  3BUO B;  1L2O B;  1S26 D;  3KEV A;  1CFP A;  3SG2 A;  1CLM A;  1M45 A;  1JUO A;  3ICB A;  4N5X A;  3WHU B;  2LVV A;  1XO5 A;  3BOW A;  1YVL A;  1B47 A;  1MR8 A;  2JUL A;  2M1K B;  1AJ4 A;  3EKJ A;  2JNX A;  5I2O A;  3QRX A;  1CDM A;  1XFY O;  3CLN A;  2M97 A;  2BE4 A;  4ORC B;  1CFC A;  1ZUZ A;  2L5X B;  3EKH A;  4HRH A;  3PFV A;  4JPZ B;  1XFZ O;  1IQ5 A;  1BT6 A;  1TRF A;  1K9K A;  2V53 A;  2KI4 B;  4CLN A;  1QIW A;  3H4S E;  1BOC A;  2KGR A;  2L98 A;  2O5G A;  1IH0 A;  1FPW A;  2JXC A;  1C7W A;  1G4Y R;  3DF0 B;  4YBH B;  1QLK A;  2PSR A;  1KFX L;  2B1U A;  5IBW A;  4GGF C;  1YRT B;  2Y4Q A;  1XFV O;  1A75 A;  1AVS A;  2BBM A;  4PCW A;  2L2E A;  2NLN A;  2NZ0 A;  1LA3 A;  2QAC A;  2K2A A;  2GV5 A;  2MHH A;  2L50 A;  2JTZ A;  3A8R A;  4ZCU A;  2E6W A;  3O6B A;  5KSZ A;  2ISD A;  3TDZ A;  1CM1 A;  3SG4 A;  4HSZ A;  1AHR A;  1V1G A;  2P6B B;  1ZFS A;  1KK7 Z;  3D10 A;  5DKN A;  3JVT C;  4CFR A;  1SR6 B;  5PAL A;  1F4O A;  1G33 A;  3NSL A;  1QTX A;  1NIW A;  2I2R E;  1L2O C;  2MJW B;  2WND A;  3M0W A;  1J7Q A;  4MN0 A;  1PSR A;  1XFU O;  1Y1X A;  3PLF B;  1J7O A;  2JZI A;  1WRK A;  2LHI A;  3D0Y A;  2JT0 A;  5ER4 X;  1KQM C;  4I5J A;  3DF0 A;  1QAT A;  5CSF A;  3TUY B;  1EL4 A;  1MHO A;  2H2K A;  3IQQ A;  1NX1 A;  2K7D A;  4DUQ A;  3DD4 A;  1B4C A;  4M2O A;  1B1G A;  2K8M B;  3CTN A;  3MSE B;  2LMU A;  3WHT B;  2NCP A;  5HKY A;  1B8R A;  1NX3 A;  2M7L A;  2F2O A;  4PE1 A;  1H4B A;  1DJG A;  2BKH B;  2JC2 A;  2M1U A;  1EXR A;  4YGD B;  2GGZ A;  1NX0 A;  2LVK A;  2Q91 A;  1M31 A;  1SRA A;  2KOT A;  4ETO A;  1PRW A;  4Q04 A;  2LMV A;  2JWW A;  3VRR A;  4FTG A;  2JPT A;  1CMG A;  5B8I B;  1LA0 A;  4XJK A;  1RTP 1;  1MWN A;  1UP5 A;  2SCP A;  2BE6 A;  2LLS A;  3FWC A;  2KFG A;  3OHM B;  4YRU A;  3HX4 A;  3O78 A;  4PHK A;  1BF5 A;  4YI9 A;  4MEW A;  4R1E A;  2KBM A;  1CLB A;  4YI8 A;  2CTN A;  4ZCV A;  5AFP A;  2LE9 B;  4USL A;  1B7T Y;  1RK9 A;  1SNL A;  2KI6 D;  2M8U A;  5JOL A;  1K94 A;  1OMD A;  3I5H C;  3I5F B;  1PAL A;  1SW8 A;  2K2F A;  3EVU A;  3NSI A;  2KYC A;  2I18 A;  2NXQ A;  1NX2 A;  1JWD A;  3NXA A;  2JRF A;  3CWG A;  4PHN A;  1FI6 A;  1G8I A;  2FJU B;  1YR5 A;  3IF7 A;  1BG1 A;  3VRQ A;  1B9A A;  1W7J B;  4MZJ A;  4D1E A;  4YGB B;  1X02 A;  1SY9 A;  2MLF C;  1MXE A;  2JNF A;  1F55 A;  4MZK A;  1DVI A;  3I5H B;  1K9U A;  2TN4 A;  1E8A A;  3OX6 A;  1S6I A;  1UHJ A;  2IS9 A;  3E3R A;  1NYA A;  2JT3 A;  2LLT A;  1CDL A;  1J55 A;  4XYN A;  1IRJ A;  2E30 A;  3GK1 A;  4YGE B;  1QVI Y;  2PMY A;  3EK8 A;  2LC5 A;  1SR6 C;  3BQ3 A;  1R6P A;  1HT9 A;  4OR9 B;  5HKZ A;  1CDN A;  1YX8 A;  2BCA A;  4M2P A;  4C0J A;  1MQ1 A;  1SCV A;  2MA2 A;  4I5L B;  3TS5 C;  5I2Q A;  2HF5 A;  5ER5 A;  1SK6 D;  1DMO A;  1DF0 B;  2OPO A;  2ZRT A;  1QS7 A;  1SL9 A;  1UHH A;  4PE0 A;  3I5I C;  2F3Y A;  5KU1 A;  2WCF A;  3SIA A;  2R2I A;  3IQO A;  1QLS A;  2JU0 A;  2LCP A;  1DF0 A;  2LP3 A;  1TIZ A;  3NSO A;  1BOD A;  1S3P A;  2LUX A;  1QV0 A;  1AJ5 A;  1LIN A;  2ZKM X;  4NDD A;  1F71 A;  1EG4 A;  2EHB A;  1KFU S;  4N1G A;  1IGV A;  3DVM A;  1DJX A;  1V1F A;  3BUW B;  3SG5 A;  1NCX A;  1BMO A;  1JF2 A;  2PAS A;  2BCX A;  4C0K A;  3BUM B;  3PN7 C;  1DJI A;  1YVH A;  4GNK B;  4PE4 A;  2CXJ A;  1XFW O;  2G2B A;  2OTG C;  2KQY A;  4TNC A;  2KAY A;  4ORB B;  4E68 A;  1KWO B;  3K21 A;  4OVN F;  1A03 A;  2KQ6 A;  3DVK A;  4I5K A;  3RM1 A;  2K7B A;  1F4Q A;  2O60 A;  1WLZ A;  2I7A A;  3KF9 A;  1BR1 B;  1FF1 A;  1K9P A;  1UUS A;  3VRN A;  1A4P A;  1M39 A;  1KCY A;  1D1O A;  1EG3 A;  2F8P A;  1LVC D;  3HCM A;  1QJT A;  2KDH A;  4A4B A;  3CS1 A;  2KBI A;  1ZOT B;  4DCK A;  4JQ0 D;  4QJ4 B;  1PK0 D;  1SKT A;  2WCE A;  1C07 A;  1J7P A;  3BUX B;  1PVB A;  1A29 A;  4AQI A;  1NP8 A;  2D8N A;  2KFH A;  3GOF A;  4P5O E;  3O2P A;  1PUL A;  3PSR A;  4GPL B;  1NCZ A;  3AKB A;  1OSA A;  2HQW A;  2CBL A;  2PAL A;  1S6J A;  2LAN A;  3PAL A;  3I5I B;  4PDZ A;  1OZO A;  3LK0 A;  2BEC A;  1GQM A;  4CPV A;  1FBV A;  5F6T A;  3CR2 A;  1CMF A;  1JC2 A;  1RRO A;  2ZN9 A;  1S6C A;  4JWQ A;  3KO0 A;  4NDB A;  1S5G Y;  2M29 A;  2M7N A;  1CNP A;  1YUR A;  1DGV A;  2LM5 A;  4F0Z B;  1Y1A A;  2JOJ A;  4FQO A;  3WXA A;  5CPV A;  1U5I A;  5J3X A;  2KYF A;  5BPJ A;  1YTZ C;  3SG3 A;  1H8B A;  1U5I B;  1GGW A;  1TCF A;  3FIA A;  4PHJ A;  5HLV A;  2Q4U A;  2Y5I A;  3AAK A;  1IKU A;  1CB1 A;  1DJZ A;  1YX7 A;  1PVA A;  2K0J A;  1Q80 A;  2Y1M A;  2CNP A;  3LLE A;  1IQ3 A;  1XK4 A;  1REC A;  1DJW A;  1KK8 B;  1GJY A;  2KI4 C;  5JJG A;  1OMV A;  3I5G C;  1N65 A;  5AER A;  4BY5 A;  2ZFD A;  1TTX A;  1NCY A;  1MUX A;  2KFF A;  3ZNI A;  3CZT X;  1RWY A;  2Y1N A;  1DJY A;  1BLQ A;  1CFF A;  3OP0 A;  1J7R A;  1SL8 A;  2LV7 A;  1YRU B;  1LXF C;  3NSK A;  2MLE C;  3PAT A;  1ODB A;  4MZL A;  4DRW A;  2FCE A;  2VRG A;  1PSB A;  3O4Y A;  1NPQ A;  2K61 A;  5D7F A;  2OTG B;  4L9M A;  4PAL A;  1R2U A;  2H61 A;  2K7C A;  1NWD A;  1TCO B;  3CR4 X;  1AUI B;  1TNP A;  1TNW A;  2M3W A;  2SAS A;  1K96 A;  4OKH A;  5KTY A;  1UUR A;  3EVR A;  1HQV A;  2LHL A;  3JVT B;  3SG6 A;  1QX7 A;  2MRD A;  4GGF A;  2BBN A;  2COL B;  3KHE A;  4A4C A;  1YUT A;  3VRP A;  1SBJ A;  2EC6 B;  5CSJ A;  1A75 B;  1KQM B;  3TUY C;  3FS7 A;  2H61 C;  1S5G Z;  4MBE A;  1SMG A;  2BL0 B;  4CID A;  2L4I A;  1M46 A;  1VRK A;  1N2D A;  2L0P A;  5HLO A;  1IWQ A;  4YGA A;  5G08 A;  1L7Z A;  2JT8 A;  1M63 B;  2M0R A;  1IG5 A;  1F70 A;  1EH2 A;  1KK8 C;  5AXI A;  1Y1U A;  3AAJ A;  1BU3 A;  1XYD A;  1DGU A;  1XA5 A;  2FOT A;  3I5G B;  3VRO A;  3LCP C;  1K90 D;  3D0Y B;  1NUB A;  3DVE A;  2HPS A;  5FYX A;  2AMI A;  2LVI A;  5I8N A;  1UHN A;  3C1V A;  2KSP A;  4ORA B;  1XK4 C;  1WY9 A;  1JFK A;  2EGD A;  1SCM B;  3TDI A;  4MSP A;  2K7O A;  3BOW B;  4XJK B;  2ZNE A;  2JTT A;  4ICB A;  1DTL A;  4WRI A;  4DIR A;  1WLM A;  2I94 A;  1WDC C;  5CSI A;  1BR4 B;  2HQ8 A;  1KFX S;  1CKK A;  1NSH A;  3RLZ A;  2WCB A;  4U8D A;  3SJS A;  2A4J A;  4PHM A;  2M49 B;  2GGM A;  2OS8 C;  1JFJ A;  2CT9 A;  1UWO A;  3KPX A;  1ZMZ A;  1QXP A;  1KSM A;  1EJ3 A;  1ALV A;  1K93 D;  1A2X A;  1MF8 B;  4GFT A;  1DJH A;  1IJ5 A;  2ZND A;  2G9B A;  1K2H A;  1TNQ A;  2LVJ A;  1DT7 B;  1SL7 A;  1SPY A;  1Y6W A;  3GK2 A;  3ZWH A;  4MRX A;  2F2P A;  2JXL A;  2KGB C;  5DKQ A;  2M9G A;  1QX5 B;  1KK7 Y;  1YUU A;  4AQJ A;  1YUS A;  1BJF A;  4I5N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...