1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords PROTEIN (CALBINDIN D9K)
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
2LV7A 2KQYA 2NLNA 2WORA 1Q80A 2AMIA 2E30A 2NCOA 4YI8A 3PLFB 1S36A 4MRYA 1K94A 4MSPA 1KK7Z 1K93D 2K2AA 3NSLA 2JTTA 4ORBB 3BUXB 2JT3A 2I18A 5PALA 4YI9A 3PALA 1R6PA 5DKQA 1A29A 4D1EA 1QV0A 3I5GB 3LCPC 3NSOA 2LVIA 1SR6B 2BECA 2LVJA 3OB1B 2I7AA 1CLMA 1KWOC 4Q04A 1IQ5A 1TIZA 3BUMB 2MA2A 3CZTX 4DRWA 1G4YR 1WLZA 2BBMA 1S26D 1B4CA 3TUYC 1PULA 4HSZA 5HKWA 1C7WA 1SR6C 2PMYA 3O6BA 2KSPA 4OR9B 3QRXA 2EGDA 2O5GA 1S5GY 1QX7A 1AHRA 1S6JA 1S1EA 5AERA 1F70A 2IS9A 1MR8A 1K9UA 1KQMC 4QJ4B 2HPSA 3JTDB 5KTYA 2LNKA 1KSMA 3D0YB 1XA5A 3GK4X 2ZKMX 1BMOA 1YUUA 1G8IA 4USLA 3KF9A 4XYNA 4DCKA 1TCOB 2FOTA 1JFKA 1YVLA 4OVNF 1DTLA 2M1UA 3OB2B 4OKHA 4WRIA 4PDZA 4GGNA 4A4CA 2CXJA 3H4SE 1G33A 4BY4A 1QVIZ 1Y1AA 5CSIA 1SNLA 1DJWA 3DVEA 3VRRA 5IBWA 3AAKA 1F54A 4HRHA 1BT6A 1GJYA 3SG3A 1L7ZA 3WNXB 2M29A 1CM4A 1ZUZA 4YGDB 3CTNA 2LP3A 1ALWA 2JWWA 2KAYA 2F33A 1NX2A 4PALA 1QVIY 2VRGA 1J7PA 1Y1UA 1WRLA 2BKIB 4MN0A 4I5KA 1BODA 3FIAA 1J1EA 5I2OA 2WC8A 1PALA 3HX4A 4OCIA 1RWYA 1FF1A 1D1OA 2F2OA 4WQ3A 1OQPA 2NZ0A 3MSEB 1IG5A 3RLZA 3CR5X 1TCFA 4PE0A 3SG6A 2K61A 2ZRTA 3DF0A 3OP0A 3VROA 1N65A 1A03A 5DKRA 4GFTA 2K8MB 2MLEC 3WXAA 3OX6A 1YTZC 3JVTB 4PE7A 4MZLA 4CFRA 1BR1B 1OMRA 1B1GA 2M7NA 2KFFA 3CLNA 2LCPA 4N5XA 2AUCA 5CSNA 1UWOA 2Q91A 2LUCA 4OV2A 1EXRA 1BF5A 1MXLC 2JPTA 2JOJA 4GGFC 3WHTB 2MLFC 2KI6C 4GAOA 1JWDA 2ZN8A 5I2QA 2BL0B 1N2DA 1OOJA 2BBNA 3TS5B 4ZCVA 2L51A 1OE9B 1KK8C 2KGBC 2JQ6A 1PVAA 2MJWB 4DIRA 1K9KA 3I5HC 5CPVA 3WHUB 4GUKA 1RJVA 3A4UB 1TRFA 3EVUA 2ISDA 3D0YA 1NP8A 1B8CA 1CTRA 2LMUA 4CLNA 1QV1A 5HLVA 2KI6D 1XVJA 1NX3A 3RM1A 4E68A 1GQMA 1UHJA 2QACA 3VRQA 5B8IB 2L98A 2FJUB 2HF5A 2MHHA 1XFZO 1UUSA 4MEWA 1JF0A 1S3PA 2JNXA 5JJGA 2BCBA 1DJYA 1NX0A 1YR5A 1H8BA 2KYFA 2LANA 3DVKA 3HCMA 1PRWA 2GV5A 1RROA 1U5IA 1XK4A 2LLTA 5ER5A 2KHNA 3SG4A 2EHBA 1EG4A 1WY9A 3IQQA 4PHKA 3ICBA 1J7QA 4YGEB 1W7JB 1AP4A 1HT9A 1M46A 1Y0VH 2LMVA 4CFQA 1OMDA 2G2BA 3KEVA 1QASA 1F55A 1GGZA 3DD4A 4HRGA 3SIAA 3LK1A 1AJ4A 2WNDA 2PVBA 2KI4C 4CIDA 2KDHA 4ICBA 3SG2A 1KQMB 3CS1A 1CLLA 1A75A 3KPXA 1F4QA 5DKNA 3EKHA 1BR4B 3IF7A 1F4OA 2CNPA 3D10A 1WLMA 1FW4A 4ORCB 5I2LA 1SL9A 2JT0A 2ZNEA 4ORAB 4PE1A 2M8UA 2F8PA 2I2RE 3BOWB 1JC2A 3BOWA 3I5FB 2K2FA 4MZKA 1SW8A 2LUXA 2LMTA 2Y5IA 2M0RA 1B9AA 3GK1A 2LVVA 1AVSA 1SKTA 2KYCA 3PN7B 2NXQA 1MXEA 1K96A 1CFCA 1AUIB 2OS8C 1KSOA 4M2PA 4BY5A 1B7TZ 1UHHA 3DVJA 2D8NA 2LM5A 2GGZA 1TTXA 2P6BB 2Y1MA 3EK8A 4PHJA 4YGBB 2JXCA 5ER4X 1CM1A 1JSAA 1S6IA 3DF0B 2BE4A 1UP5A 4NDCA 1DT7B 1CLBA 3EKJA 2A4JA 3F45A 3BUWB 1BLQA 2KBMA 1HQVA 2AAOA 1NCYA 2PRUA 1KFUS 2K7CA 1ZFSA 2KBIA 1C7VA 2I94A 4NQGA 1KCYA 1K2HA 1UHKA 1CKKA 1KFXS 4DUQA 1J1DA 4I5JA 1H4BA 2EC6C 2GGMA 1DGVA 5HKYA 1SK6D 2WCEA 1JF2A 3K21A 1N0YA 2L0PA 4MVFA 3LL8B 1PK0D 2CBLA 2H61C 1LKJA 2G9BA 1FBVA 1SBJA 2KAVA 2V53A 3BXKA 4GNKB 1CMFA 4JWQA 3PATA 1TNPA 4C0LA 3CWGA 1SMGA 4IL1A 1CFPA 4AOMA 1SL8A 2JULA 2CT9A 1BJFA 3AKBA 1F8HA 1ZOTB 4JPZB 2LHLA 2M97A 3BUNB 5I8NA 2MRDA 4DS7A 1QLKA 1QIWA 1QX5B 1MWNA 1NCZA 2BCXA 2BL0C 1WDCC 4U8DA 1A75B 2EC6B 3VRPA 1J55A 1K95A 2WCBA 3FWCA 4CPVA 5K89A 1CDLA 1TN4A 2O60A 3FWBA 1SYMA 1E8AA 1MQ1A 1ALVA 3VGOA 4NDBA 1Y1XA 2K7BA 4NDDA 2DOQA 1RECA 1NCXA 2BE6A 1F71A 1XFUO 1CFFA 3BYAA 5D7FA 3NSKA 1YUSA 3JTDC 1YURA 1LXFC 3SIBA 2Y1NA 3TUYB 1FI6A 3KHEA 3GK2A 1DJXA 2PALA 5D69A 1NWDA 2K0JA 1KWOB 1J7OA 3I5IC 1A2XA 2LP2A 4N1GA 3EVVA 1RK9A 1XO5A 1GGWA 1NYAA 5BPJA 1CNPA 1K8UA 2WOSA 2F2PA 1QIVA 1M31A 1WDCB 5AFPA 1IH0A 1W7IB 1EG3A 1OZSA 3I5FC 1TNXA 2OTGB 1B8RA 3I5GC 1JBAA 1QXPA 3LLEA 1QATA 5G08A 1IJ5A 1LVCD 3ZNIA 3I5HB 1QTXA 2JU0A 2JZIA 3IQOA 4I5NB 4R1EA 4YRUA 1IKUA 1FI5A 1OMVA 3PM8A 2L50A 2LAPA 2MAZA 3TDUA 3O2PA 1YVHA 3SG5A 2Y4QA 2FCDA 2KFGA 3NSIA 4P2YB 4YBHB 4XJKA 3AKAA 3FS7A 2BCAA 4I5LB 1AJ5A 4HREE 1S5GZ 1UHIA 3NXAA 2KGRA 4MLWA 4FTGA 3VRNA 2WCFA 4M2OA 1NIWA 4ETOA 4N1FA 1JFJA 1SPYA 3PN7C 2BKHB 4GBAA 5JOLA 1L2OB 2SCPA 5AANA 1EH2A 1MUXA 5HLOA 1CDNA 1CB1A 1QX2A 1YX8A 1TOPA 1XFWO 2JTZA 3BUOB 4QJ3B 4TNCA 5FYXA 2L5XB 3BQ3A 1DF0A 1SCMC 3PSRA 4ZCUA 1QLSA 1UHNA 1YRUB 3ZWHA 1AK8A 1B7TY 4YGAA 5AEQA 4WQ2A 4P5OE 1NPQA 1DVIA 1DJGA 1KK8B 2M7LA 2TN4A 5GQQC 1IGVA 2PASA 1KQVA 1QJTA 3A8RA 3EVRA 3KO0A 1KK7Y 2RGIA 1JUOA 1M39A 2OS8B 1B8LA 1BU3A 1CDMA 2HQ8A 2K7DA 2LHIA 3AAJA 4PCWA 1K9PA 1LA3A 2CCMA 2JC2A 4F0ZB 3TZ1A 1R2UA 3M0WA 1ZMZA 2PSRA 5J3XA 3GOFA 4AQIA 4GGFA 3EK4A 2L4HA 3JVTC 1PSRA 5F6TA 1B47A 1V1GA 5HYDA 4JQ0D 1C07A 1YX7A 2KI4B 2JNFA 4UPGA 1IQ3A 1IWQA 1MHOA 2FCEA 1OZOA 1TNQA 4QJ5B 1DJIA 2L2EA 1CMGA 2LLSA 1Y6WA 2LLUA 3E3RA 1MF8B 3SJSA 1VRKA 2JT8A 2JRFA 4AQJA 2LVKA 1LA0A 2OPOA 1WRZA 4GPLB 2H61A 1YUTA 1UURA 1XFYO 1YRTB 2M1KB 1U5IB 2SASA 1PVBA 1DJZA 4M2QA 1WRKA 3SG7A 1ODBA 4MRXA 1SCVA 1DGUA 4MZJA 3TDIA 3CGAA 1RFJA 1LINA 2E6WA 2JXLA 2QPTA 1DMOA 4PHMA 2K7OA 1M63B 3CR2A 3OX5A 2R2IA 1TNWA 2ZFDA 4PE4A 2KOTA 5AXIA 4PHNA 2HQWA 4A4BA 3PFVA 1XFVO 1CDPA 3OHMB 4C0KA 2F3ZA 1SRAA 3EK7A 1EL4A 2OTGC 4FQOA 5HKZA 1IJ6A 5KSZA 1ZACA 5CSJA 2ZN9A 3LK0A 2F3YA 3C1VA 4L9MA 1CFDA 4C0JA 1SCMB 2H2KA 2KQ6A 1IRJA 3O78A 2MBXA 1X02A 3I5IB 1PSBA 2M9GA 2M3WA 1BOCA 4YGCB 1V1FA 1NUBA 1NSHA 2CTNA 1KFXL 1M45A 1SY9A 2B1UA 2LC5A 3CR4X 1J7RA 1QS7A 1RTP1 1KFUL 2HETA 1FPWA 1DJHA 1SL7A 2M49B 1A4PA 5TNCA 3O4YA 5CSFA 2L4IA 1XFXO 3DVMA 1S6CA 2KNEA 1OSAA 5KU1A 1NX1A 2LE9B 2KAXA 1K90D 2NCPA 2ZNDA 2KFHA 4MBEA 2ZRSA 1DF0B 3TDZA 1BG1A 2Q4UA 1XK4C 3TS5C 1L2OC 4XJKB 1EJ3A 2COLB 1XYDA
chains in the Genus database with same CATH superfamily
2LV7A 2KQYA 2NLNA 2WORA 1Q80A 2AMIA 2E30A 2NCOA 4YI8A 3PLFB 1S36A 4MRYA 1K94A 4MSPA 1KK7Z 1K93D 3PJIA 2K2AA 3NSLA 3BJHA 2JTTA 4ORBB 3BUXB 2JT3A 2I18A 5PALA 2WCJA 4YI9A 3PALA 1R6PA 5DKQA 1A29A 4D1EA 1QV0A 3I5GB 1Z2CB 3LCPC 2LVIA 1SR6B 2BECA 2LVJA 3NSOA 2I7AA 3OB1B 4INWA 1CLMA 1KWOC 1DQEA 4Q04A 1IQ5A 1TIZA 3BUMB 2MA2A 3CZTX 4DRWA 1G4YR 1WLZA 2BBMA 1S26D 1B4CA 3TUYC 2QEOA 1PULA 4HSZA 5HKWA 1C7WA 1SR6C 2PMYA 3O6BA 2KSPA 4OR9B 3QRXA 2EGDA 3FE9A 2KLEA 2O5GA 2L2CA 1S5GY 1QX7A 5D3OA 1AHRA 1S6JA 1S1EA 5AERA 3UNWA 1F70A 2IS9A 1MR8A 1K9UA 1KQMC 4QJ4B 2HPSA 3JTDB 3PM2A 5KTYA 2LNKA 1KSMA 3UO9A 3D0YB 1XA5A 3GK4X 4INXA 2ZKMX 2WC6A 1BMOA 1YUUA 1G8IA 4USLA 3KF9A 4XYNA 4DCKA 1TCOB 2FOTA 3NGVA 1JFKA 1YVLA 4OVNF 3BFHA 1DTLA 2M1UA 3OB2B 4OKHA 4WRIA 4PDZA 4GGNA 4A4CA 1P28A 2CXJA 3H4SE 3BFAA 4JKTA 1G33A 4BY4A 3S0FA 1QVIZ 1Y1AA 5CSIA 3B86A 1SNLA 1DJWA 3DVEA 3VRRA 5IBWA 3AAKA 1F54A 3EG5B 4HRHA 1BT6A 1GJYA 3SG3A 1L7ZA 3WNXB 2M29A 1CM4A 1ZUZA 4YGDB 3CTNA 2LP3A 1ALWA 2JWWA 2KAYA 2F33A 1NX2A 4PALA 1IIOA 1QVIY 2VRGA 2YGUA 1J7PA 1Y1UA 1WRLA 2BKIB 4MN0A 4I5KA 1BODA 3FIAA 3R1OA 1J1EA 2KPHA 3SS5A 5I2OA 2WC8A 1PALA 3HX4A 4OCIA 1RWYA 1FF1A 1D1OA 2F2OA 4WQ3A 1OQPA 2NZ0A 3MSEB 1IG5A 3RLZA 3L4LA 2GTEA 3CR5X 1TCFA 4PE0A 3SG6A 2K61A 2ZRTA 3DF0A 1C3YA 3OP0A 3VB1A 1N65A 3VROA 1A03A 5DKRA 4GFTA 2K8MB 4IJ7A 2MLEC 3WXAA 3OX6A 1YTZC 3JVTB 4PE7A 4MZLA 4FQTA 3DY9A 1BR1B 1OMRA 4CFRA 2H8VA 2M7NA 2KFFA 3CLNA 4F7FA 1B1GA 2LCPA 4PT1A 4N5XA 2AUCA 5CSNA 1UWOA 2Q91A 2LUCA 4OV2A 1EXRA 1BF5A 1MXLC 2JPTA 2JOJA 4GGFC 3WHTB 2MLFC 2KI6C 4GAOA 1JWDA 2ZN8A 5I2QA 2BL0B 1N2DA 1OOJA 2BBNA 3TS5B 4ZCVA 2L51A 3D75A 1OE9B 1KK8C 2KGBC 3D76A 2JQ6A 1PVAA 2MJWB 4DIRA 1K9KA 3I5HC 5CPVA 1DEKA 3WHUB 4GUKA 1RJVA 3A4UB 1TUZA 1TRFA 3EVUA 2ISDA 3D0YA 3RZSA 1NP8A 1B8CA 1CTRA 2LMUA 4CLNA 1SSEB 1QV1A 5HLVA 2KI6D 1XVJA 3B6XA 1NX3A 3RM1A 4E68A 1GQMA 1UHJA 2QACA 3R72A 3VRQA 5B8IB 3SS3A 2L98A 2FJUB 2HF5A 2MHHA 1XFZO 1UUSA 4MEWA 1JF0A 1S3PA 2JNXA 3R1VA 5JJGA 2BCBA 1DJYA 1NX0A 1YR5A 3D77A 1H8BA 2KYFA 2LANA 3DVKA 3HCMA 1PRWA 1XK4A 1RROA 1U5IA 2GV5A 2LLTA 5ER5A 2KHNA 3SG4A 2EHBA 1EG4A 1WY9A 3IQQA 4PHKA 3ICBA 1J7QA 4YGEB 1ORGA 1W7JB 1AP4A 1HT9A 1M46A 1Y0VH 2LMVA 4CFQA 1OMDA 2G2BA 3KEVA 1QASA 3K1EA 1F55A 1GGZA 3DD4A 4HRGA 3SIAA 3LK1A 1AJ4A 2WNDA 2PVBA 5HL1A 2KI4C 4CIDA 2KDHA 4ICBA 3SG2A 1KQMB 3CS1A 1CLLA 1A75A 3KPXA 1F4QA 5DKNA 3EKHA 1BR4B 3IF7A 1F4OA 2CNPA 3D10A 1WLMA 1FW4A 4ORCB 5I2LA 1SL9A 2JT0A 2ZNEA 4ORAB 4PE1A 2M8UA 2F8PA 2I2RE 3BOWB 1JC2A 3BOWA 3I5FB 2K2FA 4MZKA 1SW8A 5FI2A 2LUXA 2LMTA 2Y5IA 2M0RA 1B9AA 3GK1A 2LVVA 3L4AA 1AVSA 1SKTA 2KYCA 3PN7B 2NXQA 1MXEA 1K96A 1CFCA 1AUIB 2OS8C 1KSOA 4M2PA 4BY5A 1B7TZ 1UHHA 3DVJA 2D8NA 2LM5A 2GGZA 1TTXA 1C3ZA 2P6BB 2Y1MA 3EK8A 4PHJA 4YGBB 2JXCA 5ER4X 1CM1A 1JSAA 1S6IA 3DF0B 2BE4A 1UP5A 2WCKA 4NDCA 1DT7B 3EKJA 2A4JA 1CLBA 3F45A 3BUWB 1OOHA 1BLQA 2KBMA 1HQVA 2AAOA 1NCYA 1GM0A 2PRUA 1KFUS 2K7CA 1ZFSA 2KBIA 1CMGA 2WCLA 1C7VA 2I94A 4NQGA 1KCYA 1K2HA 1UHKA 1W9ZA 2K60A 1CKKA 1KFXS 4DUQA 1J1DA 4I5JA 1H4BA 2EC6C 3CZ2A 2GGMA 1DGVA 5HKYA 1SK6D 2WCEA 3QMEA 1JF2A 3K21A 1N0YA 3CZ0A 2L0PA 4MVFA 3LL8B 1PK0D 2CBLA 2H61C 1LKJA 1FBVA 2G9BA 1SBJA 2KAVA 2V53A 3BXKA 4GNKB 1CMFA 4JWQA 3PATA 1TNPA 4C0LA 3R1PA 3CWGA 1SMGA 4IL1A 1CFPA 2QEHA 4AOMA 1SL8A 2JULA 3DZTA 2CT9A 1BJFA 3AKBA 3S0DA 1F8HA 1ZOTB 4JPZB 2LHLA 2M97A 3BUNB 3S0BA 5I8NA 2MRDA 3CYZA 4DS7A 1QLKA 1QIWA 1QX5B 1MWNA 1NCZA 2BCXA 2BL0C 1WDCC 4U8DA 1A75B 2EC6B 3VRPA 1J55A 1K95A 3DXLA 3D78A 2WCBA 3FWCA 3OGNA 2BAPA 4CPVA 5K89A 1CDLA 1TN4A 2O60A 3FWBA 1SYMA 1E8AA 1XFRA 1MQ1A 1ALVA 3VGOA 4NDBA 4JD9A 1Y1XA 2K7BA 4NDDA 2DOQA 1RECA 1NCXA 2BE6A 2BNXA 2WCHA 1XFUO 1F71A 1CFFA 3BYAA 5D7FA 3NSKA 2WC5A 1YUSA 3JTDC 1YURA 1LXFC 3SIBA 5DICA 2Y1NA 3TUYB 1FI6A 3KHEA 3GK2A 1DJXA 2PALA 5D69A 1NWDA 2PYQA 4KYNA 2K0JA 1KWOB 1J7OA 1T14A 3I5IC 3FE6A 1A2XA 2LP2A 4N1GA 1DC1A 3EVVA 1RK9A 1XO5A 3IVTA 1GGWA 1NYAA 5BPJA 1CNPA 1K8UA 2WOSA 2F2PA 3B88A 1QIVA 1M31A 1WDCB 5AFPA 1IH0A 1W7IB 1EG3A 2QDIA 1OZSA 3I5FC 3CDNA 1TNXA 2OTGB 1B8RA 3CZ1A 3I5GC 1JBAA 1QXPA 3LLEA 1QATA 5G08A 1IJ5A 1LVCD 3ZNIA 3I5HB 1QTXA 2JU0A 2JZIA 3IQOA 4I5NB 4R1EA 3S0EA 3SS4A 4YRUA 1DMOA 3B7AA 1IKUA 1FI5A 1OMVA 3PM8A 2L50A 2LAPA 2MAZA 3TDUA 3O2PA 5EL2A 1YVHA 3SG5A 2Y4QA 2FCDA 2KFGA 3NSIA 3DYEA 4P2YB 3S0AA 4YBHB 4XJKA 3AKAA 2ERBA 2BCAA 3B87A 3FS7A 4I5LB 1AJ5A 1LS8A 4HREE 1S5GZ 1UHIA 3NXAA 2KGRA 4MLWA 4FTGA 3VRNA 2WCFA 4M2OA 1NIWA 4ETOA 3V2LA 4N1FA 1JFJA 1SPYA 3PN7C 2BKHB 4GBAA 1OOGA 5JOLA 1L2OB 2SCPA 5AANA 1EH2A 1MUXA 5HLOA 1CDNA 1CB1A 1QX2A 1YX8A 1TOPA 1XFWO 2JTZA 3BUOB 4QJ3B 4TNCA 5FYXA 2L5XB 3BQ3A 1DF0A 1SCMC 3PSRA 4ZCUA 1QLSA 1UHNA 1YRUB 3ZWHA 1AK8A 1B7TY 4YGAA 5AEQA 4WQ2A 2JPOA 4P5OE 1NPQA 1DVIA 1DJGA 1KK8B 2M7LA 2TN4A 5GQQC 1IGVA 2PASA 1KQVA 1QJTA 3A8RA 3EVRA 3KO0A 1KK7Y 2RGIA 1JUOA 1M39A 1QWVA 2OS8B 1B8LA 1BU3A 1CDMA 2HQ8A 2K7DA 3D73A 2LHIA 3AAJA 4PCWA 1K9PA 1LA3A 2CCMA 2JC2A 1Z4HA 4F0ZB 3TZ1A 1R2UA 3M0WA 1ZMZA 2PSRA 5J3XA 3GOFA 4AQIA 4GGFA 3EK4A 1OOFA 2L4HA 3JVTC 1PSRA 5F6TA 1B47A 1V1GA 5HYDA 4JQ0D 1C07A 2WCMA 1YX7A 2KI4B 2JNFA 3CABA 4UPGA 1IQ3A 1IWQA 1MHOA 2FCEA 1OZOA 1TNQA 4QJ5B 1DJIA 2L2EA 2P71A 2LLSA 2P70A 4OZDA 1Y6WA 2LLUA 3E3RA 1MF8B 3SJSA 1VRKA 2JT8A 2QEBA 2JRFA 4AQJA 2QEVA 2LVKA 1LA0A 2KLDA 2OPOA 1WRZA 4GPLB 2H61A 1YUTA 3Q8IA 1UURA 1XFYO 3N7HA 1YRTB 2M1KB 5FI6A 1U5IB 2SASA 1PVBA 1DJZA 2L5YA 1WRKA 4M2QA 3SG7A 1ODBA 4MRXA 1SCVA 1DGUA 4MZJA 3O4XA 3CGAA 1RFJA 1LINA 2E6WA 2JXLA 2QPTA 3TDIA 4PHMA 1DELA 2K7OA 1M63B 3CR2A 3OX5A 2R2IA 1TNWA 2ZFDA 3NHIA 2KOTA 4PE4A 5AXIA 4PHNA 2HQWA 4A4BA 3PFVA 1OOIX 1CDPA 1XFVO 2PQLA 3OHMB 2F3ZA 4C0KA 1SRAA 3EK7A 1EL4A 2OTGC 3FE8A 4FQOA 5HKZA 1IJ6A 5I94A 1ZACA 5KSZA 5CSJA 2ZN9A 3LK0A 2F3YA 3C1VA 4L9MA 1CFDA 1TWOA 1SCMB 4C0JA 2H2KA 2KQ6A 1IRJA 3O78A 2MBXA 1X02A 3S0GA 3I5IB 1PSBA 2M9GA 2M3WA 1BOCA 4YGCB 1V1FA 1NUBA 1NSHA 2CTNA 3NHTA 1KFXL 1M45A 1SY9A 1OW4A 2B1UA 2LC5A 3CR4X 1J7RA 3L47A 1QS7A 1RTP1 1KFUL 2HETA 1FPWA 1DJHA 1TUJA 1SL7A 2M49B 3D74A 1A4PA 5TNCA 3BFBA 3O4YA 5CSFA 2L4IA 1XFXO 3DVMA 1S6CA 2KNEA 1OSAA 5KU1A 1NX1A 2FJYA 2KAXA 1K90D 2LE9B 2NCPA 2KFHA 2ZNDA 2ZRSA 1DF0B 4MBEA 3TDZA 1BG1A 5FI7A 2Q4UA 1XK4C 3TS5C 1L2OC 4XJKB 1EJ3A 3OBVA 2COLB 1XYDA
chains in the Genus database with same CATH topology
2LV7A 2KQYA 2NLNA 2WORA 1Q80A 2AMIA 2E30A 2NCOA 4YI8A 3PLFB 1S36A 4MRYA 1K94A 4MSPA 1KK7Z 1K93D 2K2AA 3NSLA 2JTTA 4ORBB 3BUXB 2JT3A 2I18A 5PALA 4YI9A 3PALA 1R6PA 5DKQA 1A29A 4D1EA 1QV0A 3I5GB 3LCPC 3NSOA 2LVIA 1SR6B 2BECA 2LVJA 3OB1B 2I7AA 1CLMA 1KWOC 4Q04A 1IQ5A 1TIZA 3BUMB 2MA2A 3CZTX 4DRWA 1G4YR 1WLZA 2BBMA 1S26D 1B4CA 3TUYC 1PULA 4HSZA 5HKWA 1C7WA 1SR6C 2PMYA 3O6BA 2KSPA 4OR9B 3QRXA 2EGDA 2O5GA 1S5GY 1QX7A 1AHRA 1S6JA 1S1EA 5AERA 1F70A 2IS9A 1MR8A 1K9UA 1KQMC 4QJ4B 2HPSA 3JTDB 5KTYA 2LNKA 1KSMA 3D0YB 1XA5A 3GK4X 2ZKMX 1BMOA 1YUUA 1G8IA 4USLA 3KF9A 4XYNA 4DCKA 1TCOB 2FOTA 1JFKA 1YVLA 4OVNF 1DTLA 2M1UA 3OB2B 4OKHA 4WRIA 4PDZA 4GGNA 4A4CA 2CXJA 3H4SE 1G33A 4BY4A 1QVIZ 1Y1AA 5CSIA 1SNLA 1DJWA 3DVEA 3VRRA 5IBWA 3AAKA 1F54A 4HRHA 1BT6A 1GJYA 3SG3A 1L7ZA 3WNXB 2M29A 1CM4A 1ZUZA 4YGDB 3CTNA 2LP3A 1ALWA 2JWWA 2KAYA 2F33A 1NX2A 4PALA 1QVIY 2VRGA 1J7PA 1Y1UA 1WRLA 2BKIB 4MN0A 4I5KA 1BODA 3FIAA 1J1EA 5I2OA 2WC8A 1PALA 3HX4A 4OCIA 1RWYA 1FF1A 1D1OA 2F2OA 4WQ3A 1OQPA 2NZ0A 3MSEB 1IG5A 3RLZA 3CR5X 1TCFA 4PE0A 3SG6A 2K61A 2ZRTA 3DF0A 3OP0A 3VROA 1N65A 1A03A 5DKRA 4GFTA 2K8MB 2MLEC 3WXAA 3OX6A 1YTZC 3JVTB 4PE7A 4MZLA 4CFRA 1BR1B 1OMRA 1B1GA 2M7NA 2KFFA 3CLNA 2LCPA 4N5XA 2AUCA 5CSNA 1UWOA 2Q91A 2LUCA 4OV2A 1EXRA 1BF5A 1MXLC 2JPTA 2JOJA 4GGFC 3WHTB 2MLFC 2KI6C 4GAOA 1JWDA 2ZN8A 5I2QA 2BL0B 1N2DA 1OOJA 2BBNA 3TS5B 4ZCVA 2L51A 1OE9B 1KK8C 2KGBC 2JQ6A 1PVAA 2MJWB 4DIRA 1K9KA 3I5HC 5CPVA 3WHUB 4GUKA 1RJVA 3A4UB 1TRFA 3EVUA 2ISDA 3D0YA 1NP8A 1B8CA 1CTRA 2LMUA 4CLNA 1QV1A 5HLVA 2KI6D 1XVJA 1NX3A 3RM1A 4E68A 1GQMA 1UHJA 2QACA 3VRQA 5B8IB 2L98A 2FJUB 2HF5A 2MHHA 1XFZO 1UUSA 4MEWA 1JF0A 1S3PA 2JNXA 5JJGA 2BCBA 1DJYA 1NX0A 1YR5A 1H8BA 2KYFA 2LANA 3DVKA 3HCMA 1PRWA 2GV5A 1RROA 1U5IA 1XK4A 2LLTA 5ER5A 2KHNA 3SG4A 2EHBA 1EG4A 1WY9A 3IQQA 4PHKA 3ICBA 1J7QA 4YGEB 1W7JB 1AP4A 1HT9A 1M46A 1Y0VH 2LMVA 4CFQA 1OMDA 2G2BA 3KEVA 1QASA 1F55A 1GGZA 3DD4A 4HRGA 3SIAA 3LK1A 1AJ4A 2WNDA 2PVBA 2KI4C 4CIDA 2KDHA 4ICBA 3SG2A 1KQMB 3CS1A 1CLLA 1A75A 3KPXA 1F4QA 5DKNA 3EKHA 1BR4B 3IF7A 1F4OA 2CNPA 3D10A 1WLMA 1FW4A 4ORCB 5I2LA 1SL9A 2JT0A 2ZNEA 4ORAB 4PE1A 2M8UA 2F8PA 2I2RE 3BOWB 1JC2A 3BOWA 3I5FB 2K2FA 4MZKA 1SW8A 2LUXA 2LMTA 2Y5IA 2M0RA 1B9AA 3GK1A 2LVVA 1AVSA 1SKTA 2KYCA 3PN7B 2NXQA 1MXEA 1K96A 1CFCA 1AUIB 2OS8C 1KSOA 4M2PA 4BY5A 1B7TZ 1UHHA 3DVJA 2D8NA 2LM5A 2GGZA 1TTXA 2P6BB 2Y1MA 3EK8A 4PHJA 4YGBB 2JXCA 5ER4X 1CM1A 1JSAA 1S6IA 3DF0B 2BE4A 1UP5A 4NDCA 1DT7B 1CLBA 3EKJA 2A4JA 3F45A 3BUWB 1BLQA 2KBMA 1HQVA 2AAOA 1NCYA 2PRUA 1KFUS 2K7CA 1ZFSA 2KBIA 1C7VA 2I94A 4NQGA 1KCYA 1K2HA 1UHKA 1CKKA 1KFXS 4DUQA 1J1DA 4I5JA 1H4BA 2EC6C 2GGMA 1DGVA 5HKYA 1SK6D 2WCEA 1JF2A 3K21A 1N0YA 2L0PA 4MVFA 3LL8B 1PK0D 2CBLA 2H61C 1LKJA 2G9BA 1FBVA 1SBJA 2KAVA 2V53A 3BXKA 4GNKB 1CMFA 4JWQA 3PATA 1TNPA 4C0LA 3CWGA 1SMGA 4IL1A 1CFPA 4AOMA 1SL8A 2JULA 2CT9A 1BJFA 3AKBA 1F8HA 1ZOTB 4JPZB 2LHLA 2M97A 3BUNB 5I8NA 2MRDA 4DS7A 1QLKA 1QIWA 1QX5B 1MWNA 1NCZA 2BCXA 2BL0C 1WDCC 4U8DA 1A75B 2EC6B 3VRPA 1J55A 1K95A 2WCBA 3FWCA 4CPVA 5K89A 1CDLA 1TN4A 2O60A 3FWBA 1SYMA 1E8AA 1MQ1A 1ALVA 3VGOA 4NDBA 1Y1XA 2K7BA 4NDDA 2DOQA 1RECA 1NCXA 2BE6A 1F71A 1XFUO 1CFFA 3BYAA 5D7FA 3NSKA 1YUSA 3JTDC 1YURA 1LXFC 3SIBA 2Y1NA 3TUYB 1FI6A 3KHEA 3GK2A 1DJXA 2PALA 5D69A 1NWDA 2K0JA 1KWOB 1J7OA 3I5IC 1A2XA 2LP2A 4N1GA 3EVVA 1RK9A 1XO5A 1GGWA 1NYAA 5BPJA 1CNPA 1K8UA 2WOSA 2F2PA 1QIVA 1M31A 1WDCB 5AFPA 1IH0A 1W7IB 1EG3A 1OZSA 3I5FC 1TNXA 2OTGB 1B8RA 3I5GC 1JBAA 1QXPA 3LLEA 1QATA 5G08A 1IJ5A 1LVCD 3ZNIA 3I5HB 1QTXA 2JU0A 2JZIA 3IQOA 4I5NB 4R1EA 4YRUA 1IKUA 1FI5A 1OMVA 3PM8A 2L50A 2LAPA 2MAZA 3TDUA 3O2PA 1YVHA 3SG5A 2Y4QA 2FCDA 2KFGA 3NSIA 4P2YB 4YBHB 4XJKA 3AKAA 3FS7A 2BCAA 4I5LB 1AJ5A 4HREE 1S5GZ 1UHIA 3NXAA 2KGRA 4MLWA 4FTGA 3VRNA 2WCFA 4M2OA 1NIWA 4ETOA 4N1FA 1JFJA 1SPYA 3PN7C 2BKHB 4GBAA 5JOLA 1L2OB 2SCPA 5AANA 1EH2A 1MUXA 5HLOA 1CDNA 1CB1A 1QX2A 1YX8A 1TOPA 1XFWO 2JTZA 3BUOB 4QJ3B 4TNCA 5FYXA 2L5XB 3BQ3A 1DF0A 1SCMC 3PSRA 4ZCUA 1QLSA 1UHNA 1YRUB 3ZWHA 1AK8A 1B7TY 4YGAA 5AEQA 4WQ2A 4P5OE 1NPQA 1DVIA 1DJGA 1KK8B 2M7LA 2TN4A 5GQQC 1IGVA 2PASA 1KQVA 1QJTA 3A8RA 3EVRA 3KO0A 1KK7Y 2RGIA 1JUOA 1M39A 2OS8B 1B8LA 1BU3A 1CDMA 2HQ8A 2K7DA 2LHIA 3AAJA 4PCWA 1K9PA 1LA3A 2CCMA 2JC2A 4F0ZB 3TZ1A 1R2UA 3M0WA 1ZMZA 2PSRA 5J3XA 3GOFA 4AQIA 4GGFA 3EK4A 2L4HA 3JVTC 1PSRA 5F6TA 1B47A 1V1GA 5HYDA 4JQ0D 1C07A 1YX7A 2KI4B 2JNFA 4UPGA 1IQ3A 1IWQA 1MHOA 2FCEA 1OZOA 1TNQA 4QJ5B 1DJIA 2L2EA 1CMGA 2LLSA 1Y6WA 2LLUA 3E3RA 1MF8B 3SJSA 1VRKA 2JT8A 2JRFA 4AQJA 2LVKA 1LA0A 2OPOA 1WRZA 4GPLB 2H61A 1YUTA 1UURA 1XFYO 1YRTB 2M1KB 1U5IB 2SASA 1PVBA 1DJZA 4M2QA 1WRKA 3SG7A 1ODBA 4MRXA 1SCVA 1DGUA 4MZJA 3TDIA 3CGAA 1RFJA 1LINA 2E6WA 2JXLA 2QPTA 1DMOA 4PHMA 2K7OA 1M63B 3CR2A 3OX5A 2R2IA 1TNWA 2ZFDA 4PE4A 2KOTA 5AXIA 4PHNA 2HQWA 4A4BA 3PFVA 1XFVO 1CDPA 3OHMB 4C0KA 2F3ZA 1SRAA 3EK7A 1EL4A 2OTGC 4FQOA 5HKZA 1IJ6A 5KSZA 1ZACA 5CSJA 2ZN9A 3LK0A 2F3YA 3C1VA 4L9MA 1CFDA 4C0JA 1SCMB 2H2KA 2KQ6A 1IRJA 3O78A 2MBXA 1X02A 3I5IB 1PSBA 2M9GA 2M3WA 1BOCA 4YGCB 1V1FA 1NUBA 1NSHA 2CTNA 1KFXL 1M45A 1SY9A 2B1UA 2LC5A 3CR4X 1J7RA 1QS7A 1RTP1 1KFUL 2HETA 1FPWA 1DJHA 1SL7A 2M49B 1A4PA 5TNCA 3O4YA 5CSFA 2L4IA 1XFXO 3DVMA 1S6CA 2KNEA 1OSAA 5KU1A 1NX1A 2LE9B 2KAXA 1K90D 2NCPA 2ZNDA 2KFHA 4MBEA 2ZRSA 1DF0B 3TDZA 1BG1A 2Q4UA 1XK4C 3TS5C 1L2OC 4XJKB 1EJ3A 2COLB 1XYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV7 A;  2KQY A;  2NLN A;  2WOR A;  1Q80 A;  2AMI A;  2E30 A;  2NCO A;  4YI8 A;  3PLF B;  1S36 A;  4MRY A;  1K94 A;  4MSP A;  1KK7 Z;  1K93 D;  2K2A A;  3NSL A;  2JTT A;  4ORB B;  3BUX B;  2JT3 A;  2I18 A;  5PAL A;  4YI9 A;  3PAL A;  1R6P A;  5DKQ A;  1A29 A;  4D1E A;  1QV0 A;  3I5G B;  3LCP C;  3NSO A;  2LVI A;  1SR6 B;  2BEC A;  2LVJ A;  3OB1 B;  2I7A A;  1CLM A;  1KWO C;  4Q04 A;  1IQ5 A;  1TIZ A;  3BUM B;  2MA2 A;  3CZT X;  4DRW A;  1G4Y R;  1WLZ A;  2BBM A;  1S26 D;  1B4C A;  3TUY C;  1PUL A;  4HSZ A;  5HKW A;  1C7W A;  1SR6 C;  2PMY A;  3O6B A;  2KSP A;  4OR9 B;  3QRX A;  2EGD A;  2O5G A;  1S5G Y;  1QX7 A;  1AHR A;  1S6J A;  1S1E A;  5AER A;  1F70 A;  2IS9 A;  1MR8 A;  1K9U A;  1KQM C;  4QJ4 B;  2HPS A;  3JTD B;  5KTY A;  2LNK A;  1KSM A;  3D0Y B;  1XA5 A;  3GK4 X;  2ZKM X;  1BMO A;  1YUU A;  1G8I A;  4USL A;  3KF9 A;  4XYN A;  4DCK A;  1TCO B;  2FOT A;  1JFK A;  1YVL A;  4OVN F;  1DTL A;  2M1U A;  3OB2 B;  4OKH A;  4WRI A;  4PDZ A;  4GGN A;  4A4C A;  2CXJ A;  3H4S E;  1G33 A;  4BY4 A;  1QVI Z;  1Y1A A;  5CSI A;  1SNL A;  1DJW A;  3DVE A;  3VRR A;  5IBW A;  3AAK A;  1F54 A;  4HRH A;  1BT6 A;  1GJY A;  3SG3 A;  1L7Z A;  3WNX B;  2M29 A;  1CM4 A;  1ZUZ A;  4YGD B;  3CTN A;  2LP3 A;  1ALW A;  2JWW A;  2KAY A;  2F33 A;  1NX2 A;  4PAL A;  1QVI Y;  2VRG A;  1J7P A;  1Y1U A;  1WRL A;  2BKI B;  4MN0 A;  4I5K A;  1BOD A;  3FIA A;  1J1E A;  5I2O A;  2WC8 A;  1PAL A;  3HX4 A;  4OCI A;  1RWY A;  1FF1 A;  1D1O A;  2F2O A;  4WQ3 A;  1OQP A;  2NZ0 A;  3MSE B;  1IG5 A;  3RLZ A;  3CR5 X;  1TCF A;  4PE0 A;  3SG6 A;  2K61 A;  2ZRT A;  3DF0 A;  3OP0 A;  3VRO A;  1N65 A;  1A03 A;  5DKR A;  4GFT A;  2K8M B;  2MLE C;  3WXA A;  3OX6 A;  1YTZ C;  3JVT B;  4PE7 A;  4MZL A;  4CFR A;  1BR1 B;  1OMR A;  1B1G A;  2M7N A;  2KFF A;  3CLN A;  2LCP A;  4N5X A;  2AUC A;  5CSN A;  1UWO A;  2Q91 A;  2LUC A;  4OV2 A;  1EXR A;  1BF5 A;  1MXL C;  2JPT A;  2JOJ A;  4GGF C;  3WHT B;  2MLF C;  2KI6 C;  4GAO A;  1JWD A;  2ZN8 A;  5I2Q A;  2BL0 B;  1N2D A;  1OOJ A;  2BBN A;  3TS5 B;  4ZCV A;  2L51 A;  1OE9 B;  1KK8 C;  2KGB C;  2JQ6 A;  1PVA A;  2MJW B;  4DIR A;  1K9K A;  3I5H C;  5CPV A;  3WHU B;  4GUK A;  1RJV A;  3A4U B;  1TRF A;  3EVU A;  2ISD A;  3D0Y A;  1NP8 A;  1B8C A;  1CTR A;  2LMU A;  4CLN A;  1QV1 A;  5HLV A;  2KI6 D;  1XVJ A;  1NX3 A;  3RM1 A;  4E68 A;  1GQM A;  1UHJ A;  2QAC A;  3VRQ A;  5B8I B;  2L98 A;  2FJU B;  2HF5 A;  2MHH A;  1XFZ O;  1UUS A;  4MEW A;  1JF0 A;  1S3P A;  2JNX A;  5JJG A;  2BCB A;  1DJY A;  1NX0 A;  1YR5 A;  1H8B A;  2KYF A;  2LAN A;  3DVK A;  3HCM A;  1PRW A;  2GV5 A;  1RRO A;  1U5I A;  1XK4 A;  2LLT A;  5ER5 A;  2KHN A;  3SG4 A;  2EHB A;  1EG4 A;  1WY9 A;  3IQQ A;  4PHK A;  3ICB A;  1J7Q A;  4YGE B;  1W7J B;  1AP4 A;  1HT9 A;  1M46 A;  1Y0V H;  2LMV A;  4CFQ A;  1OMD A;  2G2B A;  3KEV A;  1QAS A;  1F55 A;  1GGZ A;  3DD4 A;  4HRG A;  3SIA A;  3LK1 A;  1AJ4 A;  2WND A;  2PVB A;  2KI4 C;  4CID A;  2KDH A;  4ICB A;  3SG2 A;  1KQM B;  3CS1 A;  1CLL A;  1A75 A;  3KPX A;  1F4Q A;  5DKN A;  3EKH A;  1BR4 B;  3IF7 A;  1F4O A;  2CNP A;  3D10 A;  1WLM A;  1FW4 A;  4ORC B;  5I2L A;  1SL9 A;  2JT0 A;  2ZNE A;  4ORA B;  4PE1 A;  2M8U A;  2F8P A;  2I2R E;  3BOW B;  1JC2 A;  3BOW A;  3I5F B;  2K2F A;  4MZK A;  1SW8 A;  2LUX A;  2LMT A;  2Y5I A;  2M0R A;  1B9A A;  3GK1 A;  2LVV A;  1AVS A;  1SKT A;  2KYC A;  3PN7 B;  2NXQ A;  1MXE A;  1K96 A;  1CFC A;  1AUI B;  2OS8 C;  1KSO A;  4M2P A;  4BY5 A;  1B7T Z;  1UHH A;  3DVJ A;  2D8N A;  2LM5 A;  2GGZ A;  1TTX A;  2P6B B;  2Y1M A;  3EK8 A;  4PHJ A;  4YGB B;  2JXC A;  5ER4 X;  1CM1 A;  1JSA A;  1S6I A;  3DF0 B;  2BE4 A;  1UP5 A;  4NDC A;  1DT7 B;  1CLB A;  3EKJ A;  2A4J A;  3F45 A;  3BUW B;  1BLQ A;  2KBM A;  1HQV A;  2AAO A;  1NCY A;  2PRU A;  1KFU S;  2K7C A;  1ZFS A;  2KBI A;  1C7V A;  2I94 A;  4NQG A;  1KCY A;  1K2H A;  1UHK A;  1CKK A;  1KFX S;  4DUQ A;  1J1D A;  4I5J A;  1H4B A;  2EC6 C;  2GGM A;  1DGV A;  5HKY A;  1SK6 D;  2WCE A;  1JF2 A;  3K21 A;  1N0Y A;  2L0P A;  4MVF A;  3LL8 B;  1PK0 D;  2CBL A;  2H61 C;  1LKJ A;  2G9B A;  1FBV A;  1SBJ A;  2KAV A;  2V53 A;  3BXK A;  4GNK B;  1CMF A;  4JWQ A;  3PAT A;  1TNP A;  4C0L A;  3CWG A;  1SMG A;  4IL1 A;  1CFP A;  4AOM A;  1SL8 A;  2JUL A;  2CT9 A;  1BJF A;  3AKB A;  1F8H A;  1ZOT B;  4JPZ B;  2LHL A;  2M97 A;  3BUN B;  5I8N A;  2MRD A;  4DS7 A;  1QLK A;  1QIW A;  1QX5 B;  1MWN A;  1NCZ A;  2BCX A;  2BL0 C;  1WDC C;  4U8D A;  1A75 B;  2EC6 B;  3VRP A;  1J55 A;  1K95 A;  2WCB A;  3FWC A;  4CPV A;  5K89 A;  1CDL A;  1TN4 A;  2O60 A;  3FWB A;  1SYM A;  1E8A A;  1MQ1 A;  1ALV A;  3VGO A;  4NDB A;  1Y1X A;  2K7B A;  4NDD A;  2DOQ A;  1REC A;  1NCX A;  2BE6 A;  1F71 A;  1XFU O;  1CFF A;  3BYA A;  5D7F A;  3NSK A;  1YUS A;  3JTD C;  1YUR A;  1LXF C;  3SIB A;  2Y1N A;  3TUY B;  1FI6 A;  3KHE A;  3GK2 A;  1DJX A;  2PAL A;  5D69 A;  1NWD A;  2K0J A;  1KWO B;  1J7O A;  3I5I C;  1A2X A;  2LP2 A;  4N1G A;  3EVV A;  1RK9 A;  1XO5 A;  1GGW A;  1NYA A;  5BPJ A;  1CNP A;  1K8U A;  2WOS A;  2F2P A;  1QIV A;  1M31 A;  1WDC B;  5AFP A;  1IH0 A;  1W7I B;  1EG3 A;  1OZS A;  3I5F C;  1TNX A;  2OTG B;  1B8R A;  3I5G C;  1JBA A;  1QXP A;  3LLE A;  1QAT A;  5G08 A;  1IJ5 A;  1LVC D;  3ZNI A;  3I5H B;  1QTX A;  2JU0 A;  2JZI A;  3IQO A;  4I5N B;  4R1E A;  4YRU A;  1IKU A;  1FI5 A;  1OMV A;  3PM8 A;  2L50 A;  2LAP A;  2MAZ A;  3TDU A;  3O2P A;  1YVH A;  3SG5 A;  2Y4Q A;  2FCD A;  2KFG A;  3NSI A;  4P2Y B;  4YBH B;  4XJK A;  3AKA A;  3FS7 A;  2BCA A;  4I5L B;  1AJ5 A;  4HRE E;  1S5G Z;  1UHI A;  3NXA A;  2KGR A;  4MLW A;  4FTG A;  3VRN A;  2WCF A;  4M2O A;  1NIW A;  4ETO A;  4N1F A;  1JFJ A;  1SPY A;  3PN7 C;  2BKH B;  4GBA A;  5JOL A;  1L2O B;  2SCP A;  5AAN A;  1EH2 A;  1MUX A;  5HLO A;  1CDN A;  1CB1 A;  1QX2 A;  1YX8 A;  1TOP A;  1XFW O;  2JTZ A;  3BUO B;  4QJ3 B;  4TNC A;  5FYX A;  2L5X B;  3BQ3 A;  1DF0 A;  1SCM C;  3PSR A;  4ZCU A;  1QLS A;  1UHN A;  1YRU B;  3ZWH A;  1AK8 A;  1B7T Y;  4YGA A;  5AEQ A;  4WQ2 A;  4P5O E;  1NPQ A;  1DVI A;  1DJG A;  1KK8 B;  2M7L A;  2TN4 A;  5GQQ C;  1IGV A;  2PAS A;  1KQV A;  1QJT A;  3A8R A;  3EVR A;  3KO0 A;  1KK7 Y;  2RGI A;  1JUO A;  1M39 A;  2OS8 B;  1B8L A;  1BU3 A;  1CDM A;  2HQ8 A;  2K7D A;  2LHI A;  3AAJ A;  4PCW A;  1K9P A;  1LA3 A;  2CCM A;  2JC2 A;  4F0Z B;  3TZ1 A;  1R2U A;  3M0W A;  1ZMZ A;  2PSR A;  5J3X A;  3GOF A;  4AQI A;  4GGF A;  3EK4 A;  2L4H A;  3JVT C;  1PSR A;  5F6T A;  1B47 A;  1V1G A;  5HYD A;  4JQ0 D;  1C07 A;  1YX7 A;  2KI4 B;  2JNF A;  4UPG A;  1IQ3 A;  1IWQ A;  1MHO A;  2FCE A;  1OZO A;  1TNQ A;  4QJ5 B;  1DJI A;  2L2E A;  1CMG A;  2LLS A;  1Y6W A;  2LLU A;  3E3R A;  1MF8 B;  3SJS A;  1VRK A;  2JT8 A;  2JRF A;  4AQJ A;  2LVK A;  1LA0 A;  2OPO A;  1WRZ A;  4GPL B;  2H61 A;  1YUT A;  1UUR A;  1XFY O;  1YRT B;  2M1K B;  1U5I B;  2SAS A;  1PVB A;  1DJZ A;  4M2Q A;  1WRK A;  3SG7 A;  1ODB A;  4MRX A;  1SCV A;  1DGU A;  4MZJ A;  3TDI A;  3CGA A;  1RFJ A;  1LIN A;  2E6W A;  2JXL A;  2QPT A;  1DMO A;  4PHM A;  2K7O A;  1M63 B;  3CR2 A;  3OX5 A;  2R2I A;  1TNW A;  2ZFD A;  4PE4 A;  2KOT A;  5AXI A;  4PHN A;  2HQW A;  4A4B A;  3PFV A;  1XFV O;  1CDP A;  3OHM B;  4C0K A;  2F3Z A;  1SRA A;  3EK7 A;  1EL4 A;  2OTG C;  4FQO A;  5HKZ A;  1IJ6 A;  5KSZ A;  1ZAC A;  5CSJ A;  2ZN9 A;  3LK0 A;  2F3Y A;  3C1V A;  4L9M A;  1CFD A;  4C0J A;  1SCM B;  2H2K A;  2KQ6 A;  1IRJ A;  3O78 A;  2MBX A;  1X02 A;  3I5I B;  1PSB A;  2M9G A;  2M3W A;  1BOC A;  4YGC B;  1V1F A;  1NUB A;  1NSH A;  2CTN A;  1KFX L;  1M45 A;  1SY9 A;  2B1U A;  2LC5 A;  3CR4 X;  1J7R A;  1QS7 A;  1RTP 1;  1KFU L;  2HET A;  1FPW A;  1DJH A;  1SL7 A;  2M49 B;  1A4P A;  5TNC A;  3O4Y A;  5CSF A;  2L4I A;  1XFX O;  3DVM A;  1S6C A;  2KNE A;  1OSA A;  5KU1 A;  1NX1 A;  2LE9 B;  2KAX A;  1K90 D;  2NCP A;  2ZND A;  2KFH A;  4MBE A;  2ZRS A;  1DF0 B;  3TDZ A;  1BG1 A;  2Q4U A;  1XK4 C;  3TS5 C;  1L2O C;  4XJK B;  1EJ3 A;  2COL B;  1XYD A; 
#chains in the Genus database with same CATH topology
 2LV7 A;  2KQY A;  2NLN A;  2WOR A;  1Q80 A;  2AMI A;  2E30 A;  2NCO A;  4YI8 A;  3PLF B;  1S36 A;  4MRY A;  1K94 A;  4MSP A;  1KK7 Z;  1K93 D;  3PJI A;  2K2A A;  3NSL A;  3BJH A;  2JTT A;  4ORB B;  3BUX B;  2JT3 A;  2I18 A;  5PAL A;  2WCJ A;  4YI9 A;  3PAL A;  1R6P A;  5DKQ A;  1A29 A;  4D1E A;  1QV0 A;  3I5G B;  1Z2C B;  3LCP C;  2LVI A;  1SR6 B;  2BEC A;  2LVJ A;  3NSO A;  2I7A A;  3OB1 B;  4INW A;  1CLM A;  1KWO C;  1DQE A;  4Q04 A;  1IQ5 A;  1TIZ A;  3BUM B;  2MA2 A;  3CZT X;  4DRW A;  1G4Y R;  1WLZ A;  2BBM A;  1S26 D;  1B4C A;  3TUY C;  2QEO A;  1PUL A;  4HSZ A;  5HKW A;  1C7W A;  1SR6 C;  2PMY A;  3O6B A;  2KSP A;  4OR9 B;  3QRX A;  2EGD A;  3FE9 A;  2KLE A;  2O5G A;  2L2C A;  1S5G Y;  1QX7 A;  5D3O A;  1AHR A;  1S6J A;  1S1E A;  5AER A;  3UNW A;  1F70 A;  2IS9 A;  1MR8 A;  1K9U A;  1KQM C;  4QJ4 B;  2HPS A;  3JTD B;  3PM2 A;  5KTY A;  2LNK A;  1KSM A;  3UO9 A;  3D0Y B;  1XA5 A;  3GK4 X;  4INX A;  2ZKM X;  2WC6 A;  1BMO A;  1YUU A;  1G8I A;  4USL A;  3KF9 A;  4XYN A;  4DCK A;  1TCO B;  2FOT A;  3NGV A;  1JFK A;  1YVL A;  4OVN F;  3BFH A;  1DTL A;  2M1U A;  3OB2 B;  4OKH A;  4WRI A;  4PDZ A;  4GGN A;  4A4C A;  1P28 A;  2CXJ A;  3H4S E;  3BFA A;  4JKT A;  1G33 A;  4BY4 A;  3S0F A;  1QVI Z;  1Y1A A;  5CSI A;  3B86 A;  1SNL A;  1DJW A;  3DVE A;  3VRR A;  5IBW A;  3AAK A;  1F54 A;  3EG5 B;  4HRH A;  1BT6 A;  1GJY A;  3SG3 A;  1L7Z A;  3WNX B;  2M29 A;  1CM4 A;  1ZUZ A;  4YGD B;  3CTN A;  2LP3 A;  1ALW A;  2JWW A;  2KAY A;  2F33 A;  1NX2 A;  4PAL A;  1IIO A;  1QVI Y;  2VRG A;  2YGU A;  1J7P A;  1Y1U A;  1WRL A;  2BKI B;  4MN0 A;  4I5K A;  1BOD A;  3FIA A;  3R1O A;  1J1E A;  2KPH A;  3SS5 A;  5I2O A;  2WC8 A;  1PAL A;  3HX4 A;  4OCI A;  1RWY A;  1FF1 A;  1D1O A;  2F2O A;  4WQ3 A;  1OQP A;  2NZ0 A;  3MSE B;  1IG5 A;  3RLZ A;  3L4L A;  2GTE A;  3CR5 X;  1TCF A;  4PE0 A;  3SG6 A;  2K61 A;  2ZRT A;  3DF0 A;  1C3Y A;  3OP0 A;  3VB1 A;  1N65 A;  3VRO A;  1A03 A;  5DKR A;  4GFT A;  2K8M B;  4IJ7 A;  2MLE C;  3WXA A;  3OX6 A;  1YTZ C;  3JVT B;  4PE7 A;  4MZL A;  4FQT A;  3DY9 A;  1BR1 B;  1OMR A;  4CFR A;  2H8V A;  2M7N A;  2KFF A;  3CLN A;  4F7F A;  1B1G A;  2LCP A;  4PT1 A;  4N5X A;  2AUC A;  5CSN A;  1UWO A;  2Q91 A;  2LUC A;  4OV2 A;  1EXR A;  1BF5 A;  1MXL C;  2JPT A;  2JOJ A;  4GGF C;  3WHT B;  2MLF C;  2KI6 C;  4GAO A;  1JWD A;  2ZN8 A;  5I2Q A;  2BL0 B;  1N2D A;  1OOJ A;  2BBN A;  3TS5 B;  4ZCV A;  2L51 A;  3D75 A;  1OE9 B;  1KK8 C;  2KGB C;  3D76 A;  2JQ6 A;  1PVA A;  2MJW B;  4DIR A;  1K9K A;  3I5H C;  5CPV A;  1DEK A;  3WHU B;  4GUK A;  1RJV A;  3A4U B;  1TUZ A;  1TRF A;  3EVU A;  2ISD A;  3D0Y A;  3RZS A;  1NP8 A;  1B8C A;  1CTR A;  2LMU A;  4CLN A;  1SSE B;  1QV1 A;  5HLV A;  2KI6 D;  1XVJ A;  3B6X A;  1NX3 A;  3RM1 A;  4E68 A;  1GQM A;  1UHJ A;  2QAC A;  3R72 A;  3VRQ A;  5B8I B;  3SS3 A;  2L98 A;  2FJU B;  2HF5 A;  2MHH A;  1XFZ O;  1UUS A;  4MEW A;  1JF0 A;  1S3P A;  2JNX A;  3R1V A;  5JJG A;  2BCB A;  1DJY A;  1NX0 A;  1YR5 A;  3D77 A;  1H8B A;  2KYF A;  2LAN A;  3DVK A;  3HCM A;  1PRW A;  1XK4 A;  1RRO A;  1U5I A;  2GV5 A;  2LLT A;  5ER5 A;  2KHN A;  3SG4 A;  2EHB A;  1EG4 A;  1WY9 A;  3IQQ A;  4PHK A;  3ICB A;  1J7Q A;  4YGE B;  1ORG A;  1W7J B;  1AP4 A;  1HT9 A;  1M46 A;  1Y0V H;  2LMV A;  4CFQ A;  1OMD A;  2G2B A;  3KEV A;  1QAS A;  3K1E A;  1F55 A;  1GGZ A;  3DD4 A;  4HRG A;  3SIA A;  3LK1 A;  1AJ4 A;  2WND A;  2PVB A;  5HL1 A;  2KI4 C;  4CID A;  2KDH A;  4ICB A;  3SG2 A;  1KQM B;  3CS1 A;  1CLL A;  1A75 A;  3KPX A;  1F4Q A;  5DKN A;  3EKH A;  1BR4 B;  3IF7 A;  1F4O A;  2CNP A;  3D10 A;  1WLM A;  1FW4 A;  4ORC B;  5I2L A;  1SL9 A;  2JT0 A;  2ZNE A;  4ORA B;  4PE1 A;  2M8U A;  2F8P A;  2I2R E;  3BOW B;  1JC2 A;  3BOW A;  3I5F B;  2K2F A;  4MZK A;  1SW8 A;  5FI2 A;  2LUX A;  2LMT A;  2Y5I A;  2M0R A;  1B9A A;  3GK1 A;  2LVV A;  3L4A A;  1AVS A;  1SKT A;  2KYC A;  3PN7 B;  2NXQ A;  1MXE A;  1K96 A;  1CFC A;  1AUI B;  2OS8 C;  1KSO A;  4M2P A;  4BY5 A;  1B7T Z;  1UHH A;  3DVJ A;  2D8N A;  2LM5 A;  2GGZ A;  1TTX A;  1C3Z A;  2P6B B;  2Y1M A;  3EK8 A;  4PHJ A;  4YGB B;  2JXC A;  5ER4 X;  1CM1 A;  1JSA A;  1S6I A;  3DF0 B;  2BE4 A;  1UP5 A;  2WCK A;  4NDC A;  1DT7 B;  3EKJ A;  2A4J A;  1CLB A;  3F45 A;  3BUW B;  1OOH A;  1BLQ A;  2KBM A;  1HQV A;  2AAO A;  1NCY A;  1GM0 A;  2PRU A;  1KFU S;  2K7C A;  1ZFS A;  2KBI A;  1CMG A;  2WCL A;  1C7V A;  2I94 A;  4NQG A;  1KCY A;  1K2H A;  1UHK A;  1W9Z A;  2K60 A;  1CKK A;  1KFX S;  4DUQ A;  1J1D A;  4I5J A;  1H4B A;  2EC6 C;  3CZ2 A;  2GGM A;  1DGV A;  5HKY A;  1SK6 D;  2WCE A;  3QME A;  1JF2 A;  3K21 A;  1N0Y A;  3CZ0 A;  2L0P A;  4MVF A;  3LL8 B;  1PK0 D;  2CBL A;  2H61 C;  1LKJ A;  1FBV A;  2G9B A;  1SBJ A;  2KAV A;  2V53 A;  3BXK A;  4GNK B;  1CMF A;  4JWQ A;  3PAT A;  1TNP A;  4C0L A;  3R1P A;  3CWG A;  1SMG A;  4IL1 A;  1CFP A;  2QEH A;  4AOM A;  1SL8 A;  2JUL A;  3DZT A;  2CT9 A;  1BJF A;  3AKB A;  3S0D A;  1F8H A;  1ZOT B;  4JPZ B;  2LHL A;  2M97 A;  3BUN B;  3S0B A;  5I8N A;  2MRD A;  3CYZ A;  4DS7 A;  1QLK A;  1QIW A;  1QX5 B;  1MWN A;  1NCZ A;  2BCX A;  2BL0 C;  1WDC C;  4U8D A;  1A75 B;  2EC6 B;  3VRP A;  1J55 A;  1K95 A;  3DXL A;  3D78 A;  2WCB A;  3FWC A;  3OGN A;  2BAP A;  4CPV A;  5K89 A;  1CDL A;  1TN4 A;  2O60 A;  3FWB A;  1SYM A;  1E8A A;  1XFR A;  1MQ1 A;  1ALV A;  3VGO A;  4NDB A;  4JD9 A;  1Y1X A;  2K7B A;  4NDD A;  2DOQ A;  1REC A;  1NCX A;  2BE6 A;  2BNX A;  2WCH A;  1XFU O;  1F71 A;  1CFF A;  3BYA A;  5D7F A;  3NSK A;  2WC5 A;  1YUS A;  3JTD C;  1YUR A;  1LXF C;  3SIB A;  5DIC A;  2Y1N A;  3TUY B;  1FI6 A;  3KHE A;  3GK2 A;  1DJX A;  2PAL A;  5D69 A;  1NWD A;  2PYQ A;  4KYN A;  2K0J A;  1KWO B;  1J7O A;  1T14 A;  3I5I C;  3FE6 A;  1A2X A;  2LP2 A;  4N1G A;  1DC1 A;  3EVV A;  1RK9 A;  1XO5 A;  3IVT A;  1GGW A;  1NYA A;  5BPJ A;  1CNP A;  1K8U A;  2WOS A;  2F2P A;  3B88 A;  1QIV A;  1M31 A;  1WDC B;  5AFP A;  1IH0 A;  1W7I B;  1EG3 A;  2QDI A;  1OZS A;  3I5F C;  3CDN A;  1TNX A;  2OTG B;  1B8R A;  3CZ1 A;  3I5G C;  1JBA A;  1QXP A;  3LLE A;  1QAT A;  5G08 A;  1IJ5 A;  1LVC D;  3ZNI A;  3I5H B;  1QTX A;  2JU0 A;  2JZI A;  3IQO A;  4I5N B;  4R1E A;  3S0E A;  3SS4 A;  4YRU A;  1DMO A;  3B7A A;  1IKU A;  1FI5 A;  1OMV A;  3PM8 A;  2L50 A;  2LAP A;  2MAZ A;  3TDU A;  3O2P A;  5EL2 A;  1YVH A;  3SG5 A;  2Y4Q A;  2FCD A;  2KFG A;  3NSI A;  3DYE A;  4P2Y B;  3S0A A;  4YBH B;  4XJK A;  3AKA A;  2ERB A;  2BCA A;  3B87 A;  3FS7 A;  4I5L B;  1AJ5 A;  1LS8 A;  4HRE E;  1S5G Z;  1UHI A;  3NXA A;  2KGR A;  4MLW A;  4FTG A;  3VRN A;  2WCF A;  4M2O A;  1NIW A;  4ETO A;  3V2L A;  4N1F A;  1JFJ A;  1SPY A;  3PN7 C;  2BKH B;  4GBA A;  1OOG A;  5JOL A;  1L2O B;  2SCP A;  5AAN A;  1EH2 A;  1MUX A;  5HLO A;  1CDN A;  1CB1 A;  1QX2 A;  1YX8 A;  1TOP A;  1XFW O;  2JTZ A;  3BUO B;  4QJ3 B;  4TNC A;  5FYX A;  2L5X B;  3BQ3 A;  1DF0 A;  1SCM C;  3PSR A;  4ZCU A;  1QLS A;  1UHN A;  1YRU B;  3ZWH A;  1AK8 A;  1B7T Y;  4YGA A;  5AEQ A;  4WQ2 A;  2JPO A;  4P5O E;  1NPQ A;  1DVI A;  1DJG A;  1KK8 B;  2M7L A;  2TN4 A;  5GQQ C;  1IGV A;  2PAS A;  1KQV A;  1QJT A;  3A8R A;  3EVR A;  3KO0 A;  1KK7 Y;  2RGI A;  1JUO A;  1M39 A;  1QWV A;  2OS8 B;  1B8L A;  1BU3 A;  1CDM A;  2HQ8 A;  2K7D A;  3D73 A;  2LHI A;  3AAJ A;  4PCW A;  1K9P A;  1LA3 A;  2CCM A;  2JC2 A;  1Z4H A;  4F0Z B;  3TZ1 A;  1R2U A;  3M0W A;  1ZMZ A;  2PSR A;  5J3X A;  3GOF A;  4AQI A;  4GGF A;  3EK4 A;  1OOF A;  2L4H A;  3JVT C;  1PSR A;  5F6T A;  1B47 A;  1V1G A;  5HYD A;  4JQ0 D;  1C07 A;  2WCM A;  1YX7 A;  2KI4 B;  2JNF A;  3CAB A;  4UPG A;  1IQ3 A;  1IWQ A;  1MHO A;  2FCE A;  1OZO A;  1TNQ A;  4QJ5 B;  1DJI A;  2L2E A;  2P71 A;  2LLS A;  2P70 A;  4OZD A;  1Y6W A;  2LLU A;  3E3R A;  1MF8 B;  3SJS A;  1VRK A;  2JT8 A;  2QEB A;  2JRF A;  4AQJ A;  2QEV A;  2LVK A;  1LA0 A;  2KLD A;  2OPO A;  1WRZ A;  4GPL B;  2H61 A;  1YUT A;  3Q8I A;  1UUR A;  1XFY O;  3N7H A;  1YRT B;  2M1K B;  5FI6 A;  1U5I B;  2SAS A;  1PVB A;  1DJZ A;  2L5Y A;  1WRK A;  4M2Q A;  3SG7 A;  1ODB A;  4MRX A;  1SCV A;  1DGU A;  4MZJ A;  3O4X A;  3CGA A;  1RFJ A;  1LIN A;  2E6W A;  2JXL A;  2QPT A;  3TDI A;  4PHM A;  1DEL A;  2K7O A;  1M63 B;  3CR2 A;  3OX5 A;  2R2I A;  1TNW A;  2ZFD A;  3NHI A;  2KOT A;  4PE4 A;  5AXI A;  4PHN A;  2HQW A;  4A4B A;  3PFV A;  1OOI X;  1CDP A;  1XFV O;  2PQL A;  3OHM B;  2F3Z A;  4C0K A;  1SRA A;  3EK7 A;  1EL4 A;  2OTG C;  3FE8 A;  4FQO A;  5HKZ A;  1IJ6 A;  5I94 A;  1ZAC A;  5KSZ A;  5CSJ A;  2ZN9 A;  3LK0 A;  2F3Y A;  3C1V A;  4L9M A;  1CFD A;  1TWO A;  1SCM B;  4C0J A;  2H2K A;  2KQ6 A;  1IRJ A;  3O78 A;  2MBX A;  1X02 A;  3S0G A;  3I5I B;  1PSB A;  2M9G A;  2M3W A;  1BOC A;  4YGC B;  1V1F A;  1NUB A;  1NSH A;  2CTN A;  3NHT A;  1KFX L;  1M45 A;  1SY9 A;  1OW4 A;  2B1U A;  2LC5 A;  3CR4 X;  1J7R A;  3L47 A;  1QS7 A;  1RTP 1;  1KFU L;  2HET A;  1FPW A;  1DJH A;  1TUJ A;  1SL7 A;  2M49 B;  3D74 A;  1A4P A;  5TNC A;  3BFB A;  3O4Y A;  5CSF A;  2L4I A;  1XFX O;  3DVM A;  1S6C A;  2KNE A;  1OSA A;  5KU1 A;  1NX1 A;  2FJY A;  2KAX A;  1K90 D;  2LE9 B;  2NCP A;  2KFH A;  2ZND A;  2ZRS A;  1DF0 B;  4MBE A;  3TDZ A;  1BG1 A;  5FI7 A;  2Q4U A;  1XK4 C;  3TS5 C;  1L2O C;  4XJK B;  1EJ3 A;  3OBV A;  2COL B;  1XYD A; 
#chains in the Genus database with same CATH homology
 2LV7 A;  2KQY A;  2NLN A;  2WOR A;  1Q80 A;  2AMI A;  2E30 A;  2NCO A;  4YI8 A;  3PLF B;  1S36 A;  4MRY A;  1K94 A;  4MSP A;  1KK7 Z;  1K93 D;  2K2A A;  3NSL A;  2JTT A;  4ORB B;  3BUX B;  2JT3 A;  2I18 A;  5PAL A;  4YI9 A;  3PAL A;  1R6P A;  5DKQ A;  1A29 A;  4D1E A;  1QV0 A;  3I5G B;  3LCP C;  3NSO A;  2LVI A;  1SR6 B;  2BEC A;  2LVJ A;  3OB1 B;  2I7A A;  1CLM A;  1KWO C;  4Q04 A;  1IQ5 A;  1TIZ A;  3BUM B;  2MA2 A;  3CZT X;  4DRW A;  1G4Y R;  1WLZ A;  2BBM A;  1S26 D;  1B4C A;  3TUY C;  1PUL A;  4HSZ A;  5HKW A;  1C7W A;  1SR6 C;  2PMY A;  3O6B A;  2KSP A;  4OR9 B;  3QRX A;  2EGD A;  2O5G A;  1S5G Y;  1QX7 A;  1AHR A;  1S6J A;  1S1E A;  5AER A;  1F70 A;  2IS9 A;  1MR8 A;  1K9U A;  1KQM C;  4QJ4 B;  2HPS A;  3JTD B;  5KTY A;  2LNK A;  1KSM A;  3D0Y B;  1XA5 A;  3GK4 X;  2ZKM X;  1BMO A;  1YUU A;  1G8I A;  4USL A;  3KF9 A;  4XYN A;  4DCK A;  1TCO B;  2FOT A;  1JFK A;  1YVL A;  4OVN F;  1DTL A;  2M1U A;  3OB2 B;  4OKH A;  4WRI A;  4PDZ A;  4GGN A;  4A4C A;  2CXJ A;  3H4S E;  1G33 A;  4BY4 A;  1QVI Z;  1Y1A A;  5CSI A;  1SNL A;  1DJW A;  3DVE A;  3VRR A;  5IBW A;  3AAK A;  1F54 A;  4HRH A;  1BT6 A;  1GJY A;  3SG3 A;  1L7Z A;  3WNX B;  2M29 A;  1CM4 A;  1ZUZ A;  4YGD B;  3CTN A;  2LP3 A;  1ALW A;  2JWW A;  2KAY A;  2F33 A;  1NX2 A;  4PAL A;  1QVI Y;  2VRG A;  1J7P A;  1Y1U A;  1WRL A;  2BKI B;  4MN0 A;  4I5K A;  1BOD A;  3FIA A;  1J1E A;  5I2O A;  2WC8 A;  1PAL A;  3HX4 A;  4OCI A;  1RWY A;  1FF1 A;  1D1O A;  2F2O A;  4WQ3 A;  1OQP A;  2NZ0 A;  3MSE B;  1IG5 A;  3RLZ A;  3CR5 X;  1TCF A;  4PE0 A;  3SG6 A;  2K61 A;  2ZRT A;  3DF0 A;  3OP0 A;  3VRO A;  1N65 A;  1A03 A;  5DKR A;  4GFT A;  2K8M B;  2MLE C;  3WXA A;  3OX6 A;  1YTZ C;  3JVT B;  4PE7 A;  4MZL A;  4CFR A;  1BR1 B;  1OMR A;  1B1G A;  2M7N A;  2KFF A;  3CLN A;  2LCP A;  4N5X A;  2AUC A;  5CSN A;  1UWO A;  2Q91 A;  2LUC A;  4OV2 A;  1EXR A;  1BF5 A;  1MXL C;  2JPT A;  2JOJ A;  4GGF C;  3WHT B;  2MLF C;  2KI6 C;  4GAO A;  1JWD A;  2ZN8 A;  5I2Q A;  2BL0 B;  1N2D A;  1OOJ A;  2BBN A;  3TS5 B;  4ZCV A;  2L51 A;  1OE9 B;  1KK8 C;  2KGB C;  2JQ6 A;  1PVA A;  2MJW B;  4DIR A;  1K9K A;  3I5H C;  5CPV A;  3WHU B;  4GUK A;  1RJV A;  3A4U B;  1TRF A;  3EVU A;  2ISD A;  3D0Y A;  1NP8 A;  1B8C A;  1CTR A;  2LMU A;  4CLN A;  1QV1 A;  5HLV A;  2KI6 D;  1XVJ A;  1NX3 A;  3RM1 A;  4E68 A;  1GQM A;  1UHJ A;  2QAC A;  3VRQ A;  5B8I B;  2L98 A;  2FJU B;  2HF5 A;  2MHH A;  1XFZ O;  1UUS A;  4MEW A;  1JF0 A;  1S3P A;  2JNX A;  5JJG A;  2BCB A;  1DJY A;  1NX0 A;  1YR5 A;  1H8B A;  2KYF A;  2LAN A;  3DVK A;  3HCM A;  1PRW A;  2GV5 A;  1RRO A;  1U5I A;  1XK4 A;  2LLT A;  5ER5 A;  2KHN A;  3SG4 A;  2EHB A;  1EG4 A;  1WY9 A;  3IQQ A;  4PHK A;  3ICB A;  1J7Q A;  4YGE B;  1W7J B;  1AP4 A;  1HT9 A;  1M46 A;  1Y0V H;  2LMV A;  4CFQ A;  1OMD A;  2G2B A;  3KEV A;  1QAS A;  1F55 A;  1GGZ A;  3DD4 A;  4HRG A;  3SIA A;  3LK1 A;  1AJ4 A;  2WND A;  2PVB A;  2KI4 C;  4CID A;  2KDH A;  4ICB A;  3SG2 A;  1KQM B;  3CS1 A;  1CLL A;  1A75 A;  3KPX A;  1F4Q A;  5DKN A;  3EKH A;  1BR4 B;  3IF7 A;  1F4O A;  2CNP A;  3D10 A;  1WLM A;  1FW4 A;  4ORC B;  5I2L A;  1SL9 A;  2JT0 A;  2ZNE A;  4ORA B;  4PE1 A;  2M8U A;  2F8P A;  2I2R E;  3BOW B;  1JC2 A;  3BOW A;  3I5F B;  2K2F A;  4MZK A;  1SW8 A;  2LUX A;  2LMT A;  2Y5I A;  2M0R A;  1B9A A;  3GK1 A;  2LVV A;  1AVS A;  1SKT A;  2KYC A;  3PN7 B;  2NXQ A;  1MXE A;  1K96 A;  1CFC A;  1AUI B;  2OS8 C;  1KSO A;  4M2P A;  4BY5 A;  1B7T Z;  1UHH A;  3DVJ A;  2D8N A;  2LM5 A;  2GGZ A;  1TTX A;  2P6B B;  2Y1M A;  3EK8 A;  4PHJ A;  4YGB B;  2JXC A;  5ER4 X;  1CM1 A;  1JSA A;  1S6I A;  3DF0 B;  2BE4 A;  1UP5 A;  4NDC A;  1DT7 B;  1CLB A;  3EKJ A;  2A4J A;  3F45 A;  3BUW B;  1BLQ A;  2KBM A;  1HQV A;  2AAO A;  1NCY A;  2PRU A;  1KFU S;  2K7C A;  1ZFS A;  2KBI A;  1C7V A;  2I94 A;  4NQG A;  1KCY A;  1K2H A;  1UHK A;  1CKK A;  1KFX S;  4DUQ A;  1J1D A;  4I5J A;  1H4B A;  2EC6 C;  2GGM A;  1DGV A;  5HKY A;  1SK6 D;  2WCE A;  1JF2 A;  3K21 A;  1N0Y A;  2L0P A;  4MVF A;  3LL8 B;  1PK0 D;  2CBL A;  2H61 C;  1LKJ A;  2G9B A;  1FBV A;  1SBJ A;  2KAV A;  2V53 A;  3BXK A;  4GNK B;  1CMF A;  4JWQ A;  3PAT A;  1TNP A;  4C0L A;  3CWG A;  1SMG A;  4IL1 A;  1CFP A;  4AOM A;  1SL8 A;  2JUL A;  2CT9 A;  1BJF A;  3AKB A;  1F8H A;  1ZOT B;  4JPZ B;  2LHL A;  2M97 A;  3BUN B;  5I8N A;  2MRD A;  4DS7 A;  1QLK A;  1QIW A;  1QX5 B;  1MWN A;  1NCZ A;  2BCX A;  2BL0 C;  1WDC C;  4U8D A;  1A75 B;  2EC6 B;  3VRP A;  1J55 A;  1K95 A;  2WCB A;  3FWC A;  4CPV A;  5K89 A;  1CDL A;  1TN4 A;  2O60 A;  3FWB A;  1SYM A;  1E8A A;  1MQ1 A;  1ALV A;  3VGO A;  4NDB A;  1Y1X A;  2K7B A;  4NDD A;  2DOQ A;  1REC A;  1NCX A;  2BE6 A;  1F71 A;  1XFU O;  1CFF A;  3BYA A;  5D7F A;  3NSK A;  1YUS A;  3JTD C;  1YUR A;  1LXF C;  3SIB A;  2Y1N A;  3TUY B;  1FI6 A;  3KHE A;  3GK2 A;  1DJX A;  2PAL A;  5D69 A;  1NWD A;  2K0J A;  1KWO B;  1J7O A;  3I5I C;  1A2X A;  2LP2 A;  4N1G A;  3EVV A;  1RK9 A;  1XO5 A;  1GGW A;  1NYA A;  5BPJ A;  1CNP A;  1K8U A;  2WOS A;  2F2P A;  1QIV A;  1M31 A;  1WDC B;  5AFP A;  1IH0 A;  1W7I B;  1EG3 A;  1OZS A;  3I5F C;  1TNX A;  2OTG B;  1B8R A;  3I5G C;  1JBA A;  1QXP A;  3LLE A;  1QAT A;  5G08 A;  1IJ5 A;  1LVC D;  3ZNI A;  3I5H B;  1QTX A;  2JU0 A;  2JZI A;  3IQO A;  4I5N B;  4R1E A;  4YRU A;  1IKU A;  1FI5 A;  1OMV A;  3PM8 A;  2L50 A;  2LAP A;  2MAZ A;  3TDU A;  3O2P A;  1YVH A;  3SG5 A;  2Y4Q A;  2FCD A;  2KFG A;  3NSI A;  4P2Y B;  4YBH B;  4XJK A;  3AKA A;  3FS7 A;  2BCA A;  4I5L B;  1AJ5 A;  4HRE E;  1S5G Z;  1UHI A;  3NXA A;  2KGR A;  4MLW A;  4FTG A;  3VRN A;  2WCF A;  4M2O A;  1NIW A;  4ETO A;  4N1F A;  1JFJ A;  1SPY A;  3PN7 C;  2BKH B;  4GBA A;  5JOL A;  1L2O B;  2SCP A;  5AAN A;  1EH2 A;  1MUX A;  5HLO A;  1CDN A;  1CB1 A;  1QX2 A;  1YX8 A;  1TOP A;  1XFW O;  2JTZ A;  3BUO B;  4QJ3 B;  4TNC A;  5FYX A;  2L5X B;  3BQ3 A;  1DF0 A;  1SCM C;  3PSR A;  4ZCU A;  1QLS A;  1UHN A;  1YRU B;  3ZWH A;  1AK8 A;  1B7T Y;  4YGA A;  5AEQ A;  4WQ2 A;  4P5O E;  1NPQ A;  1DVI A;  1DJG A;  1KK8 B;  2M7L A;  2TN4 A;  5GQQ C;  1IGV A;  2PAS A;  1KQV A;  1QJT A;  3A8R A;  3EVR A;  3KO0 A;  1KK7 Y;  2RGI A;  1JUO A;  1M39 A;  2OS8 B;  1B8L A;  1BU3 A;  1CDM A;  2HQ8 A;  2K7D A;  2LHI A;  3AAJ A;  4PCW A;  1K9P A;  1LA3 A;  2CCM A;  2JC2 A;  4F0Z B;  3TZ1 A;  1R2U A;  3M0W A;  1ZMZ A;  2PSR A;  5J3X A;  3GOF A;  4AQI A;  4GGF A;  3EK4 A;  2L4H A;  3JVT C;  1PSR A;  5F6T A;  1B47 A;  1V1G A;  5HYD A;  4JQ0 D;  1C07 A;  1YX7 A;  2KI4 B;  2JNF A;  4UPG A;  1IQ3 A;  1IWQ A;  1MHO A;  2FCE A;  1OZO A;  1TNQ A;  4QJ5 B;  1DJI A;  2L2E A;  1CMG A;  2LLS A;  1Y6W A;  2LLU A;  3E3R A;  1MF8 B;  3SJS A;  1VRK A;  2JT8 A;  2JRF A;  4AQJ A;  2LVK A;  1LA0 A;  2OPO A;  1WRZ A;  4GPL B;  2H61 A;  1YUT A;  1UUR A;  1XFY O;  1YRT B;  2M1K B;  1U5I B;  2SAS A;  1PVB A;  1DJZ A;  4M2Q A;  1WRK A;  3SG7 A;  1ODB A;  4MRX A;  1SCV A;  1DGU A;  4MZJ A;  3TDI A;  3CGA A;  1RFJ A;  1LIN A;  2E6W A;  2JXL A;  2QPT A;  1DMO A;  4PHM A;  2K7O A;  1M63 B;  3CR2 A;  3OX5 A;  2R2I A;  1TNW A;  2ZFD A;  4PE4 A;  2KOT A;  5AXI A;  4PHN A;  2HQW A;  4A4B A;  3PFV A;  1XFV O;  1CDP A;  3OHM B;  4C0K A;  2F3Z A;  1SRA A;  3EK7 A;  1EL4 A;  2OTG C;  4FQO A;  5HKZ A;  1IJ6 A;  5KSZ A;  1ZAC A;  5CSJ A;  2ZN9 A;  3LK0 A;  2F3Y A;  3C1V A;  4L9M A;  1CFD A;  4C0J A;  1SCM B;  2H2K A;  2KQ6 A;  1IRJ A;  3O78 A;  2MBX A;  1X02 A;  3I5I B;  1PSB A;  2M9G A;  2M3W A;  1BOC A;  4YGC B;  1V1F A;  1NUB A;  1NSH A;  2CTN A;  1KFX L;  1M45 A;  1SY9 A;  2B1U A;  2LC5 A;  3CR4 X;  1J7R A;  1QS7 A;  1RTP 1;  1KFU L;  2HET A;  1FPW A;  1DJH A;  1SL7 A;  2M49 B;  1A4P A;  5TNC A;  3O4Y A;  5CSF A;  2L4I A;  1XFX O;  3DVM A;  1S6C A;  2KNE A;  1OSA A;  5KU1 A;  1NX1 A;  2LE9 B;  2KAX A;  1K90 D;  2NCP A;  2ZND A;  2KFH A;  4MBE A;  2ZRS A;  1DF0 B;  3TDZ A;  1BG1 A;  2Q4U A;  1XK4 C;  3TS5 C;  1L2O C;  4XJK B;  1EJ3 A;  2COL B;  1XYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...