1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CALBINDIN D9K)
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
1B7TY 1PVAA 2LNKA 4Q04A 3I5HC 4NDDA 1WDCB 1YR5A 2LP2A 3SG3A 1B1GA 3GK2A 3OB1B 1UP5A 1C7WA 3ZNIA 1K2HA 1N2DA 1YTZC 2FOTA 5AERA 1LXFC 1ZMZA 4ORAB 2EC6C 1JFJA 4AOMA 1RROA 1TIZA 4HSZA 3MSEB 1OMVA 1XA5A 3GK4X 1NCZA 3O6BA 1JWDA 1M31A 1MXLC 1NYAA 2KI6D 3SG5A 1IQ3A 1K9UA 4MZJA 2MBXA 3I5FB 2FCDA 1UHIA 1U5IB 1A03A 1MUXA 2GGZA 1CLBA 3H4SE 4NQGA 1KK8B 3NSIA 1TCOB 1LINA 2JULA 4PHJA 4C0KA 1QLKA 1AP4A 2AUCA 2LHIA 1K8UA 1S5GY 1PSBA 2WORA 2ZKMX 1H8BA 1BR4B 3D10A 3WHTB 4I5NB 4QJ3B 2TN4A 1SY9A 4PDZA 4I5JA 3TUYC 1B47A 3D0YA 2BCBA 4ZCVA 1EG4A 4GAOA 1AVSA 2K7OA 3DVMA 3EK4A 1B7TZ 5I8NA 2JNXA 2KNEA 2LCPA 1HQVA 3TZ1A 4PE4A 1X02A 2KGBC 4CPVA 3AKBA 1YUUA 3EK8A 2D8NA 1SYMA 2Y4QA 5AEQA 2KYFA 1SRAA 2M7NA 3OB2B 2JPTA 1SBJA 1OMRA 3VRPA 2LLUA 2KAYA 1CLMA 1TNPA 5HLVA 1L2OC 1KWOB 1DJHA 1NX2A 1ALVA 2M49B 3PN7B 1OMDA 4OVNF 1CMFA 2BCXA 4JWQA 1AJ5A 4OR9B 2CT9A 5B8IB 1TNWA 2OTGC 2H61C 2LLTA 1L7ZA 1Y0VH 1IRJA 1PALA 3O78A 4MN0A 1EG3A 4DUQA 2EHBA 1E8AA 3I5HB 1K9PA 3TS5B 4CIDA 4HRGA 1QX2A 2LAPA 4TNCA 3SG4A 5KSZA 1BODA 4YGEB 3AAKA 1ALWA 3SG2A 1BLQA 5HYDA 4MRYA 1DTLA 1EH2A 2ZRTA 1NP8A 1DJGA 1KFXS 2F33A 2QPTA 2KBMA 3M0WA 2ISDA 1TOPA 2LANA 2EC6B 3VGOA 1UUSA 2M3WA 1CDMA 1JF2A 2LHLA 3PALA 1XFYO 2JU0A 5I2QA 1KFUS 1J55A 3C1VA 2NLNA 3CZTX 4UPGA 1JBAA 2CTNA 1RK9A 2AMIA 1F70A 2SASA 3RM1A 4GFTA 4GGFA 1B4CA 1FW4A 2LUXA 5AANA 1MXEA 1AUIB 3DVEA 1JF0A 4ORBB 4HRHA 1BMOA 3AAJA 4WQ3A 2KI6C 3LK0A 1RECA 2L2EA 4JPZB 2WC8A 1FPWA 1FF1A 3FWBA 1XFXO 2ZRSA 5GQQC 4IL1A 3BUOB 2M97A 3RLZA 2MLFC 1LA0A 3PFVA 3TUYB 1D1OA 3LL8B 2Q4UA 1G8IA 5ER4X 2LLSA 3DF0B 1DJXA 2KAVA 3NXAA 3FS7A 2JZIA 5DKRA 1V1GA 3TDZA 5KTYA 1K95A 4C0JA 1KK7Y 3IQOA 1KFXL 3PLFB 1DMOA 4MLWA 1CMGA 3EKJA 1U5IA 1QJTA 2MLEC 3PATA 1ODBA 2PSRA 2KOTA 1BOCA 4XJKB 2OS8C 2BL0C 2LVIA 1Y1UA 4NDBA 2LVJA 1KFUL 1XVJA 1RJVA 1F4OA 1XFUO 2KDHA 3LK1A 1Q80A 4FQOA 1SW8A 3SG6A 1DGUA 2K7DA 1S1EA 5CSNA 4P5OE 1IKUA 4WQ2A 1K9KA 2F3ZA 3PM8A 2JTTA 1NX0A 2OTGB 1OZSA 1A29A 1CLLA 3CS1A 4PE0A 1YUSA 1M63B 2LV7A 4E68A 1Y1XA 1CM4A 2Q91A 1OQPA 4GGNA 5HKYA 3AKAA 3BXKA 3I5IC 5D69A 1ZFSA 3SIAA 1K90D 2M1KB 5FYXA 1CM1A 5I2LA 2K2FA 2BBNA 1LKJA 1SCVA 3I5GC 2ZFDA 4OV2A 3EK7A 1CKKA 2ZN9A 2M8UA 1SL8A 1NPQA 1J7OA 4QJ5B 3BQ3A 3O4YA 1DVIA 5AFPA 3SIBA 2B1UA 2BCAA 2ZNEA 4MSPA 2RGIA 3OHMB 3EKHA 5CSFA 2DOQA 2L5XB 3NSOA 4A4BA 3HX4A 4JQ0D 2LMVA 4YRUA 2E6WA 2I94A 3SG7A 1KK7Z 2KFHA 4YGAA 2Y5IA 2F2PA 2MA2A 1QASA 4OKHA 2LM5A 1S6JA 1DJYA 1M39A 1QV0A 2O5GA 4PHKA 1KSOA 2LC5A 4DCKA 4FTGA 4A4CA 4QJ4B 3CLNA 1QVIZ 5AXIA 1F54A 1QLSA 2BBMA 1EL4A 2A4JA 2WOSA 3EVUA 3VRNA 2BE4A 4DS7A 2F8PA 2I7AA 1OOJA 2WNDA 1IJ5A 2NZ0A 1QX7A 3KF9A 1SK6D 1QX5B 5TNCA 4WRIA 2L4HA 3JVTC 4I5KA 1EJ3A 1IH0A 1MHOA 1JFKA 1KQMC 1S26D 1Y1AA 5K89A 3PSRA 4MZKA 4DIRA 4F0ZB 1NIWA 1J1DA 2K2AA 3OX5A 1QS7A 2LVVA 1XK4C 4C0LA 1MWNA 2JNFA 3IQQA 4M2PA 1YUTA 2CNPA 1M45A 2NCOA 3LCPC 1GQMA 3GOFA 2JXCA 1A2XA 1TTXA 1WLZA 1PVBA 1A75A 2QACA 4YGCB 1SR6C 2O60A 1K94A 4OCIA 1RWYA 3BOWB 4HREE 4D1EA 4PALA 1R6PA 2L50A 1LVCD 2Y1NA 1DJZA 1PRWA 1QIWA 1CNPA 1OSAA 3WNXB 2JRFA 5HKWA 1XYDA 1ZOTB 3E3RA 5F6TA 4AQIA 3DF0A 1KK8C 3GK1A 2K7BA 3ICBA 1OE9B 1R2UA 3I5IB 1HT9A 1DJIA 3WHUB 2MRDA 2PALA 2JTZA 1QV1A 2LP3A 2L51A 3BUXB 4CFQA 3DVKA 1SMGA 3FWCA 4XJKA 2M7LA 1A75B 1PK0D 2ZNDA 2HQ8A 1YX8A 4XYNA 1QATA 1V1FA 1G33A 2OPOA 4ETOA 2CXJA 1TCFA 3EVRA 1RTP1 4M2QA 1NCYA 1PSRA 2L98A 1IJ6A 2M0RA 3BUWB 1FI6A 2EGDA 1JSAA 2H61A 2CCMA 4MEWA 2JXLA 2L0PA 2MJWB 2KAXA 1UHNA 1WY9A 2HPSA 1F55A 1SCMC 1CFPA 2L4IA 3HCMA 1KQVA 1PULA 3FIAA 2P6BB 1LA3A 1QVIY 1UURA 5CSIA 2LMUA 2LVKA 5KU1A 5PALA 1TNXA 2M9GA 3CR4X 3BYAA 1L2OB 1ZUZA 2BKHB 1F8HA 5J3XA 1SPYA 1C7VA 2KSPA 3A8RA 1DT7B 3QRXA 2BKIB 2KI4C 5ER5A 3TS5C 1OZOA 4PHNA 3JVTB 1XFZO 3CGAA 1WRZA 1KQMB 3K21A 1AHRA 1NWDA 4CLNA 1WLMA 4N1GA 4DRWA 2I2RE 1DF0B 2K0JA 4GUKA 4MZLA 2KHNA 1EXRA 3KPXA 2K7CA 2BE6A 1SNLA 1XFVO 2M29A 5JJGA 1QTXA 4PHMA 2ZN8A 2JT3A 1YVLA 2SCPA 1G4YR 1SR6B 3KO0A 3EVVA 1TN4A 2AAOA 1ZACA 3BUNB 1J7RA 1BR1B 2KBIA 1SKTA 2NCPA 4L9MA 2PMYA 2COLB 1VRKA 3OP0A 3ZWHA 4MVFA 3OX6A 2GV5A 2PASA 5D7FA 4CFRA 5CSJA 5HLOA 2F2OA 3JTDC 4GNKB 4M2OA 3SJSA 5JOLA 4ICBA 1CDPA 1MR8A 2BECA 2G2BA 2PVBA 1RFJA 2WCBA 1IQ5A 4N5XA 1NX1A 4U8DA 2HQWA 2LE9B 5DKQA 4MRXA 2FJUB 4GGFC 2KFFA 4YI8A 2V53A 3A4UB 2JT0A 2LMTA 1WRKA 1JUOA 1WDCC 2WCFA 3BOWA 2WCEA 4PE1A 1H4BA 1AK8A 4R1EA 1QIVA 1NX3A 1JC2A 1S6CA 3KHEA 2FCEA 5DKNA 1F71A 2R2IA 1BT6A 1IG5A 1CDNA 1A4PA 2JQ6A 4YBHB 4ZCUA 4BY4A 1YURA 1SL7A 1K96A 1BF5A 1SCMB 2KQYA 4N1FA 1BG1A 1KCYA 3CTNA 1B8RA 2E30A 1YRUB 2OS8B 2GGMA 1CFFA 1QXPA 2BL0B 1W7IB 1C07A 3D0YB 5I2OA 1Y6WA 3VROA 4P2YB 1J7PA 2CBLA 1UHHA 2G9BA 1F4QA 2M1UA 1XO5A 1S3PA 3VRRA 1BU3A 2KI4B 3I5FC 4GBAA 2KGRA 4YI9A 1AJ4A 5CPVA 2LUCA 1CDLA 2KQ6A 1N0YA 1UHJA 5IBWA 3IF7A 4I5LB 1CB1A 1UHKA 2K8MB 3KEVA 3TDIA 1MF8B 3NSLA 1YX7A 4NDCA 1NSHA 1S5GZ 2VRGA 1FBVA 3LLEA 1WRLA 4MBEA 1K93D 3I5GB 2K61A 3WXAA 2HF5A 1S36A 4PE7A 1CFCA 2KFGA 1UWOA 1M46A 3BUMB 4ORCB 1GGZA 2F3YA 3CR5X 5BPJA 3TDUA 1DGVA 4YGDB 1IGVA 1S6IA 1B8CA 1FI5A 5HKZA 2I18A 3NSKA 1IWQA 3VRQA 4PCWA 2PRUA 3CR2A 1BJFA 2H2KA 2KYCA 1DJWA 1NUBA 1TRFA 2MAZA 1CTRA 2JWWA 1MQ1A 1N65A 3F45A 2IS9A 1GJYA 2NXQA 1XFWO 1J1EA 1B9AA 1CFDA 2Y1MA 4YGBB 1TNQA 1KWOC 1DF0A 1W7JB 4AQJA 3DVJA 3JTDB 3PN7C 4BY5A 1XK4A 3O2PA 1NCXA 1YVHA 2MHHA 1B8LA 1YRTB 5G08A 2HETA 2JC2A 2JT8A 4USLA 1SL9A 1KSMA 3DD4A 2JOJA 1J7QA 3CWGA 1GGWA 4GPLB
chains in the Genus database with same CATH superfamily
1B7TY 1PVAA 2LNKA 4Q04A 3I5HC 4NDDA 1WDCB 1YR5A 2LP2A 3SG3A 1B1GA 3GK2A 3OB1B 1UP5A 1C7WA 3ZNIA 1K2HA 1N2DA 1YTZC 2FOTA 5AERA 1SSEB 1LXFC 1ZMZA 1Z4HA 4ORAB 2EC6C 1JFJA 3O4XA 3OBVA 4AOMA 1RROA 1TIZA 4HSZA 3MSEB 1OMVA 1XA5A 3GK4X 1NCZA 3O6BA 1JWDA 1M31A 1MXLC 1NYAA 2KI6D 3SG5A 1IQ3A 1K9UA 4MZJA 2MBXA 3I5FB 2FCDA 1UHIA 1U5IB 2K60A 1A03A 3CYZA 1MUXA 2GGZA 1CLBA 3H4SE 4NQGA 1KK8B 3NSIA 2QEBA 1TCOB 1LINA 2JULA 4PHJA 4C0KA 1QLKA 1AP4A 3Q8IA 2AUCA 2LHIA 1K8UA 1S5GY 1PSBA 2WORA 2ZKMX 4OZDA 1H8BA 1BR4B 3D10A 1TUZA 4I5NB 3WHTB 4QJ3B 2TN4A 1SY9A 4PDZA 1DQEA 4I5JA 3TUYC 1B47A 3D0YA 2BCBA 4ZCVA 1EG4A 4GAOA 1AVSA 2K7OA 3DVMA 3EK4A 1B7TZ 3FE6A 5I8NA 2JNXA 2KNEA 2LCPA 1HQVA 3TZ1A 4PE4A 1X02A 2KGBC 4CPVA 3AKBA 1YUUA 3EK8A 2WC6A 2H8VA 2D8NA 1SYMA 2Y4QA 3BJHA 5AEQA 2KYFA 1SRAA 2M7NA 3OB2B 2JPTA 5EL2A 1SBJA 1OMRA 3SS4A 3BFBA 2LLUA 2KAYA 3VRPA 1CLMA 1TNPA 5HLVA 1L2OC 1KWOB 1DJHA 1NX2A 1ALVA 2M49B 3PN7B 1OMDA 4OVNF 1CMFA 2BCXA 4JWQA 1AJ5A 1P28A 4OR9B 2CT9A 5B8IB 1TNWA 2OTGC 2H61C 2LLTA 1L7ZA 1Y0VH 1IRJA 1PALA 3O78A 4MN0A 3D76A 1EG3A 5D3OA 4DUQA 2EHBA 1E8AA 3I5HB 1K9PA 3TS5B 4CIDA 4HRGA 3FE8A 1QX2A 2LAPA 4TNCA 3SG4A 5KSZA 1BODA 2PYQA 4YGEB 3AAKA 1ALWA 3SG2A 2WCMA 1BLQA 5HYDA 4MRYA 1OOHA 1DTLA 1EH2A 2WCLA 5FI6A 2ZRTA 1NP8A 1DJGA 1KFXS 2F33A 2QPTA 2KBMA 3M0WA 3CZ0A 2ISDA 1TOPA 2LANA 2EC6B 3VGOA 1UUSA 3R1VA 2M3WA 1CDMA 1LS8A 1JF2A 2LHLA 3PALA 1XFYO 2JU0A 5I2QA 1KFUS 1J55A 3C1VA 2NLNA 3CZTX 4UPGA 1JBAA 2CTNA 1RK9A 2AMIA 1F70A 2SASA 3RM1A 4GFTA 4GGFA 1B4CA 1FW4A 2LUXA 2PQLA 5AANA 1MXEA 1AUIB 3DVEA 1JF0A 3NHIA 4ORBB 4HRHA 1BMOA 3AAJA 2L5YA 4WQ3A 2KI6C 3LK0A 1RECA 2L2EA 4JPZB 2WC8A 1FPWA 1XFRA 1FF1A 3FWBA 1XFXO 2BNXA 2ZRSA 5GQQC 4IL1A 3BUOB 2M97A 3RLZA 2MLFC 1LA0A 3PFVA 3TUYB 1D1OA 3LL8B 2Q4UA 3IVTA 1G8IA 5ER4X 2LLSA 3DF0B 1DJXA 2KAVA 3NXAA 3FS7A 2JZIA 5DKRA 1V1GA 3TDZA 5KTYA 1K95A 4C0JA 1KK7Y 3IQOA 1KFXL 3PLFB 1DMOA 4MLWA 1CMGA 3EKJA 1U5IA 1QJTA 2MLEC 3PATA 1ODBA 2PSRA 2KOTA 1BOCA 4XJKB 2OS8C 2BL0C 3UO9A 2LVIA 1Y1UA 4NDBA 2LVJA 1KFUL 1XVJA 1RJVA 1F4OA 1XFUO 2KDHA 3LK1A 1ORGA 1Q80A 3R72A 4FQOA 1SW8A 3SG6A 1DGUA 2K7DA 1S1EA 5CSNA 4P5OE 1IKUA 4WQ2A 1K9KA 2F3ZA 3PM8A 2JTTA 1NX0A 3BFHA 2OTGB 1OZSA 1A29A 1CLLA 3CS1A 4PE0A 1YUSA 1M63B 2LV7A 4E68A 3DY9A 1Y1XA 1CM4A 2Q91A 3OGNA 1OQPA 4GGNA 5HKYA 3AKAA 3BXKA 3I5IC 5D69A 1ZFSA 3SIAA 1K90D 2M1KB 5FYXA 1CM1A 5FI2A 3V2LA 5I2LA 2K2FA 3RZSA 2BBNA 1LKJA 1SCVA 3I5GC 2QEVA 2ZFDA 4OV2A 3EK7A 1CKKA 2ZN9A 2M8UA 1SL8A 1NPQA 1J7OA 3L4LA 4QJ5B 3BQ3A 1OOGA 3O4YA 4JKTA 1DVIA 5AFPA 5HL1A 3SIBA 2B1UA 2BCAA 2ZNEA 4MSPA 2RGIA 3OHMB 3EKHA 4JD9A 5FI7A 5CSFA 2DOQA 2L5XB 3NSOA 4A4BA 3HX4A 4JQ0D 2LMVA 4YRUA 2E6WA 2I94A 3CABA 3SG7A 1KK7Z 2KFHA 4YGAA 2Y5IA 2F2PA 2MA2A 1QASA 4OKHA 2LM5A 1S6JA 2P71A 1DJYA 1M39A 1QV0A 4IJ7A 2O5GA 3PJIA 1KSOA 2LC5A 3B86A 2L2CA 4PHKA 4DCKA 4FTGA 4A4CA 4QJ4B 3CLNA 1QVIZ 5AXIA 1OOIX 3FE9A 1F54A 1QLSA 2BBMA 3CZ1A 2KPHA 1EL4A 2A4JA 3S0AA 2WOSA 3EVUA 3VRNA 2BE4A 2ERBA 4DS7A 2F8PA 2I7AA 1OOJA 2WNDA 3S0EA 2P70A 1IJ5A 3B6XA 2NZ0A 1QX7A 3KF9A 1SK6D 1QX5B 5TNCA 4WRIA 2L4HA 3JVTC 4I5KA 1EJ3A 1IH0A 1MHOA 1JFKA 1KQMC 1S26D 1Y1AA 5K89A 3PSRA 4MZKA 4DIRA 4F0ZB 4F7FA 1NIWA 1J1DA 1Z2CB 2K2AA 1QS7A 3N7HA 2FJYA 2LVVA 3NHTA 3OX5A 1XK4C 4C0LA 1MWNA 2JNFA 3IQQA 4M2PA 1YUTA 2CNPA 1M45A 2NCOA 3LCPC 1GQMA 3GOFA 2JXCA 1A2XA 1TTXA 1WLZA 1PVBA 1A75A 2QACA 4YGCB 1SR6C 2O60A 1K94A 4OCIA 1RWYA 3BOWB 4HREE 4D1EA 4PALA 3CZ2A 1R6PA 2L50A 1LVCD 3NGVA 2Y1NA 1DELA 1DEKA 1DJZA 1PRWA 1QIWA 1CNPA 1OSAA 3WNXB 2JRFA 5HKWA 1XYDA 1ZOTB 3E3RA 5F6TA 4AQIA 3DF0A 1KK8C 3GK1A 2K7BA 3ICBA 1OE9B 1R2UA 3I5IB 1C3ZA 1HT9A 3D75A 1DJIA 3WHUB 5DICA 2MRDA 2PALA 2JTZA 1QV1A 2LP3A 3VB1A 2L51A 3BUXB 4CFQA 3DVKA 1SMGA 3FWCA 4XJKA 2QDIA 2M7LA 1A75B 1PK0D 2ZNDA 2HQ8A 1YX8A 4XYNA 1QATA 1V1FA 1G33A 2OPOA 4ETOA 1W9ZA 2CXJA 1TCFA 3EVRA 1RTP1 4M2QA 1NCYA 1PSRA 4PT1A 2L98A 3S0BA 1IJ6A 2M0RA 3BUWB 1FI6A 2EGDA 1C3YA 1JSAA 2H61A 2CCMA 4MEWA 2JXLA 4FQTA 2L0PA 2MJWB 2KAXA 1UHNA 1WY9A 2HPSA 1F55A 1SCMC 1CFPA 2L4IA 3HCMA 1KQVA 1PULA 3D74A 3FIAA 2P6BB 1LA3A 3L4AA 1OOFA 1QVIY 1UURA 5CSIA 2LMUA 2LVKA 5KU1A 5PALA 1TNXA 2M9GA 3CR4X 3BYAA 1L2OB 1ZUZA 2BKHB 3QMEA 1F8HA 5J3XA 1SPYA 1C7VA 2KSPA 3A8RA 1DT7B 3QRXA 2BKIB 2KI4C 3DZTA 5ER5A 3TS5C 3BFAA 1OZOA 4PHNA 3K1EA 3JVTB 1XFZO 3CGAA 1WRZA 1KQMB 2KLEA 3K21A 1AHRA 1NWDA 4CLNA 1WLMA 4N1GA 4DRWA 2I2RE 1DF0B 2K0JA 4GUKA 4MZLA 2KHNA 1EXRA 3KPXA 3R1OA 2K7CA 3B7AA 1SNLA 1XFVO 2BE6A 2M29A 5JJGA 1QTXA 4PHMA 2ZN8A 2JT3A 1YVLA 2SCPA 1G4YR 1SR6B 3S0FA 3KO0A 3EVVA 1TN4A 2JPOA 2AAOA 1ZACA 3BUNB 1J7RA 1BR1B 2KBIA 1SKTA 2NCPA 4L9MA 2PMYA 2COLB 2WCJA 1VRKA 3OP0A 3ZWHA 4MVFA 3OX6A 2GV5A 2PASA 5D7FA 4CFRA 5CSJA 5HLOA 1IIOA 3SS3A 2QEOA 2F2OA 3JTDC 4GNKB 4M2OA 3SJSA 5JOLA 4ICBA 3CDNA 1CDPA 2WCKA 1GM0A 1MR8A 2BECA 2G2BA 2PVBA 1RFJA 2WCBA 1IQ5A 4N5XA 1NX1A 4U8DA 2HQWA 2LE9B 5DKQA 4MRXA 2FJUB 3L47A 4GGFC 2KFFA 4YI8A 2V53A 3A4UB 1TWOA 2JT0A 2LMTA 1WRKA 1JUOA 1WDCC 2KLDA 2WCFA 2WCEA 3BOWA 3D77A 3EG5B 4PE1A 1AK8A 1H4BA 4R1EA 3UNWA 1QIVA 1NX3A 1TUJA 1JC2A 1S6CA 4AQJA 3KHEA 2FCEA 5DKNA 1F71A 2R2IA 1BT6A 2WCHA 1IG5A 1CDNA 1A4PA 2JQ6A 4YBHB 4ZCUA 4BY4A 1YURA 1SL7A 3SS5A 1K96A 1BF5A 1SCMB 2KQYA 4N1FA 1BG1A 1KCYA 3CTNA 3DXLA 1B8RA 2E30A 1YRUB 2OS8B 2GGMA 1CFFA 1QXPA 2BL0B 1W7IB 1C07A 3D0YB 4BY5A 1Y6WA 5I2OA 3VROA 4P2YB 2GTEA 1J7PA 2CBLA 1UHHA 2G9BA 1F4QA 2M1UA 5I94A 1XO5A 3B88A 1S3PA 3VRRA 2QEHA 1BU3A 2KI4B 3I5FC 4GBAA 2KGRA 3DYEA 1AJ4A 4YI9A 5CPVA 2LUCA 3D78A 1CDLA 2KQ6A 3D73A 1N0YA 1UHJA 5IBWA 3IF7A 4I5LB 1CB1A 1UHKA 2K8MB 3KEVA 3TDIA 1MF8B 3NSLA 1YX7A 4NDCA 1NSHA 1S5GZ 2VRGA 1FBVA 3LLEA 1WRLA 4MBEA 1K93D 3I5GB 2K61A 4INXA 2HF5A 1S36A 1OW4A 4PE7A 3WXAA 1CFCA 2BAPA 2KFGA 1UWOA 1M46A 3BUMB 4ORCB 1GGZA 2F3YA 3CR5X 5BPJA 3TDUA 1DGVA 4YGDB 1IGVA 1S6IA 1B8CA 1DC1A 1FI5A 5HKZA 2I18A 3NSKA 1IWQA 3VRQA 4PCWA 2PRUA 3CR2A 1BJFA 2H2KA 2KYCA 1DJWA 1QWVA 1NUBA 1TRFA 2MAZA 1CTRA 2JWWA 1MQ1A 1N65A 3F45A 4INWA 2IS9A 1GJYA 2NXQA 1XFWO 1J1EA 1B9AA 1CFDA 2Y1MA 3S0GA 4YGBB 1TNQA 1KWOC 1DF0A 1W7JB 3S0DA 3B87A 3DVJA 3JTDB 3PN7C 1XK4A 2WC5A 3O2PA 1NCXA 1YVHA 2MHHA 1B8LA 1T14A 1YRTB 5G08A 2HETA 2JC2A 3R1PA 2JT8A 4USLA 1SL9A 1KSMA 3DD4A 2JOJA 1J7QA 2YGUA 3CWGA 3PM2A 4KYNA 1GGWA 4GPLB
chains in the Genus database with same CATH topology
1B7TY 1PVAA 2LNKA 4Q04A 3I5HC 4NDDA 1WDCB 1YR5A 2LP2A 3SG3A 1B1GA 3GK2A 3OB1B 1UP5A 1C7WA 3ZNIA 1K2HA 1N2DA 1YTZC 2FOTA 5AERA 1LXFC 1ZMZA 4ORAB 2EC6C 1JFJA 4AOMA 1RROA 1TIZA 4HSZA 3MSEB 1OMVA 1XA5A 3GK4X 1NCZA 3O6BA 1JWDA 1M31A 1MXLC 1NYAA 2KI6D 3SG5A 1IQ3A 1K9UA 4MZJA 2MBXA 3I5FB 2FCDA 1UHIA 1U5IB 1A03A 1MUXA 2GGZA 1CLBA 3H4SE 4NQGA 1KK8B 3NSIA 1TCOB 1LINA 2JULA 4PHJA 4C0KA 1QLKA 1AP4A 2AUCA 2LHIA 1K8UA 1S5GY 1PSBA 2WORA 2ZKMX 1H8BA 1BR4B 3D10A 3WHTB 4I5NB 4QJ3B 2TN4A 1SY9A 4PDZA 4I5JA 3TUYC 1B47A 3D0YA 2BCBA 4ZCVA 1EG4A 4GAOA 1AVSA 2K7OA 3DVMA 3EK4A 1B7TZ 5I8NA 2JNXA 2KNEA 2LCPA 1HQVA 3TZ1A 4PE4A 1X02A 2KGBC 4CPVA 3AKBA 1YUUA 3EK8A 2D8NA 1SYMA 2Y4QA 5AEQA 2KYFA 1SRAA 2M7NA 3OB2B 2JPTA 1SBJA 1OMRA 3VRPA 2LLUA 2KAYA 1CLMA 1TNPA 5HLVA 1L2OC 1KWOB 1DJHA 1NX2A 1ALVA 2M49B 3PN7B 1OMDA 4OVNF 1CMFA 2BCXA 4JWQA 1AJ5A 4OR9B 2CT9A 5B8IB 1TNWA 2OTGC 2H61C 2LLTA 1L7ZA 1Y0VH 1IRJA 1PALA 3O78A 4MN0A 1EG3A 4DUQA 2EHBA 1E8AA 3I5HB 1K9PA 3TS5B 4CIDA 4HRGA 1QX2A 2LAPA 4TNCA 3SG4A 5KSZA 1BODA 4YGEB 3AAKA 1ALWA 3SG2A 1BLQA 5HYDA 4MRYA 1DTLA 1EH2A 2ZRTA 1NP8A 1DJGA 1KFXS 2F33A 2QPTA 2KBMA 3M0WA 2ISDA 1TOPA 2LANA 2EC6B 3VGOA 1UUSA 2M3WA 1CDMA 1JF2A 2LHLA 3PALA 1XFYO 2JU0A 5I2QA 1KFUS 1J55A 3C1VA 2NLNA 3CZTX 4UPGA 1JBAA 2CTNA 1RK9A 2AMIA 1F70A 2SASA 3RM1A 4GFTA 4GGFA 1B4CA 1FW4A 2LUXA 5AANA 1MXEA 1AUIB 3DVEA 1JF0A 4ORBB 4HRHA 1BMOA 3AAJA 4WQ3A 2KI6C 3LK0A 1RECA 2L2EA 4JPZB 2WC8A 1FPWA 1FF1A 3FWBA 1XFXO 2ZRSA 5GQQC 4IL1A 3BUOB 2M97A 3RLZA 2MLFC 1LA0A 3PFVA 3TUYB 1D1OA 3LL8B 2Q4UA 1G8IA 5ER4X 2LLSA 3DF0B 1DJXA 2KAVA 3NXAA 3FS7A 2JZIA 5DKRA 1V1GA 3TDZA 5KTYA 1K95A 4C0JA 1KK7Y 3IQOA 1KFXL 3PLFB 1DMOA 4MLWA 1CMGA 3EKJA 1U5IA 1QJTA 2MLEC 3PATA 1ODBA 2PSRA 2KOTA 1BOCA 4XJKB 2OS8C 2BL0C 2LVIA 1Y1UA 4NDBA 2LVJA 1KFUL 1XVJA 1RJVA 1F4OA 1XFUO 2KDHA 3LK1A 1Q80A 4FQOA 1SW8A 3SG6A 1DGUA 2K7DA 1S1EA 5CSNA 4P5OE 1IKUA 4WQ2A 1K9KA 2F3ZA 3PM8A 2JTTA 1NX0A 2OTGB 1OZSA 1A29A 1CLLA 3CS1A 4PE0A 1YUSA 1M63B 2LV7A 4E68A 1Y1XA 1CM4A 2Q91A 1OQPA 4GGNA 5HKYA 3AKAA 3BXKA 3I5IC 5D69A 1ZFSA 3SIAA 1K90D 2M1KB 5FYXA 1CM1A 5I2LA 2K2FA 2BBNA 1LKJA 1SCVA 3I5GC 2ZFDA 4OV2A 3EK7A 1CKKA 2ZN9A 2M8UA 1SL8A 1NPQA 1J7OA 4QJ5B 3BQ3A 3O4YA 1DVIA 5AFPA 3SIBA 2B1UA 2BCAA 2ZNEA 4MSPA 2RGIA 3OHMB 3EKHA 5CSFA 2DOQA 2L5XB 3NSOA 4A4BA 3HX4A 4JQ0D 2LMVA 4YRUA 2E6WA 2I94A 3SG7A 1KK7Z 2KFHA 4YGAA 2Y5IA 2F2PA 2MA2A 1QASA 4OKHA 2LM5A 1S6JA 1DJYA 1M39A 1QV0A 2O5GA 4PHKA 1KSOA 2LC5A 4DCKA 4FTGA 4A4CA 4QJ4B 3CLNA 1QVIZ 5AXIA 1F54A 1QLSA 2BBMA 1EL4A 2A4JA 2WOSA 3EVUA 3VRNA 2BE4A 4DS7A 2F8PA 2I7AA 1OOJA 2WNDA 1IJ5A 2NZ0A 1QX7A 3KF9A 1SK6D 1QX5B 5TNCA 4WRIA 2L4HA 3JVTC 4I5KA 1EJ3A 1IH0A 1MHOA 1JFKA 1KQMC 1S26D 1Y1AA 5K89A 3PSRA 4MZKA 4DIRA 4F0ZB 1NIWA 1J1DA 2K2AA 3OX5A 1QS7A 2LVVA 1XK4C 4C0LA 1MWNA 2JNFA 3IQQA 4M2PA 1YUTA 2CNPA 1M45A 2NCOA 3LCPC 1GQMA 3GOFA 2JXCA 1A2XA 1TTXA 1WLZA 1PVBA 1A75A 2QACA 4YGCB 1SR6C 2O60A 1K94A 4OCIA 1RWYA 3BOWB 4HREE 4D1EA 4PALA 1R6PA 2L50A 1LVCD 2Y1NA 1DJZA 1PRWA 1QIWA 1CNPA 1OSAA 3WNXB 2JRFA 5HKWA 1XYDA 1ZOTB 3E3RA 5F6TA 4AQIA 3DF0A 1KK8C 3GK1A 2K7BA 3ICBA 1OE9B 1R2UA 3I5IB 1HT9A 1DJIA 3WHUB 2MRDA 2PALA 2JTZA 1QV1A 2LP3A 2L51A 3BUXB 4CFQA 3DVKA 1SMGA 3FWCA 4XJKA 2M7LA 1A75B 1PK0D 2ZNDA 2HQ8A 1YX8A 4XYNA 1QATA 1V1FA 1G33A 2OPOA 4ETOA 2CXJA 1TCFA 3EVRA 1RTP1 4M2QA 1NCYA 1PSRA 2L98A 1IJ6A 2M0RA 3BUWB 1FI6A 2EGDA 1JSAA 2H61A 2CCMA 4MEWA 2JXLA 2L0PA 2MJWB 2KAXA 1UHNA 1WY9A 2HPSA 1F55A 1SCMC 1CFPA 2L4IA 3HCMA 1KQVA 1PULA 3FIAA 2P6BB 1LA3A 1QVIY 1UURA 5CSIA 2LMUA 2LVKA 5KU1A 5PALA 1TNXA 2M9GA 3CR4X 3BYAA 1L2OB 1ZUZA 2BKHB 1F8HA 5J3XA 1SPYA 1C7VA 2KSPA 3A8RA 1DT7B 3QRXA 2BKIB 2KI4C 5ER5A 3TS5C 1OZOA 4PHNA 3JVTB 1XFZO 3CGAA 1WRZA 1KQMB 3K21A 1AHRA 1NWDA 4CLNA 1WLMA 4N1GA 4DRWA 2I2RE 1DF0B 2K0JA 4GUKA 4MZLA 2KHNA 1EXRA 3KPXA 2K7CA 2BE6A 1SNLA 1XFVO 2M29A 5JJGA 1QTXA 4PHMA 2ZN8A 2JT3A 1YVLA 2SCPA 1G4YR 1SR6B 3KO0A 3EVVA 1TN4A 2AAOA 1ZACA 3BUNB 1J7RA 1BR1B 2KBIA 1SKTA 2NCPA 4L9MA 2PMYA 2COLB 1VRKA 3OP0A 3ZWHA 4MVFA 3OX6A 2GV5A 2PASA 5D7FA 4CFRA 5CSJA 5HLOA 2F2OA 3JTDC 4GNKB 4M2OA 3SJSA 5JOLA 4ICBA 1CDPA 1MR8A 2BECA 2G2BA 2PVBA 1RFJA 2WCBA 1IQ5A 4N5XA 1NX1A 4U8DA 2HQWA 2LE9B 5DKQA 4MRXA 2FJUB 4GGFC 2KFFA 4YI8A 2V53A 3A4UB 2JT0A 2LMTA 1WRKA 1JUOA 1WDCC 2WCFA 3BOWA 2WCEA 4PE1A 1H4BA 1AK8A 4R1EA 1QIVA 1NX3A 1JC2A 1S6CA 3KHEA 2FCEA 5DKNA 1F71A 2R2IA 1BT6A 1IG5A 1CDNA 1A4PA 2JQ6A 4YBHB 4ZCUA 4BY4A 1YURA 1SL7A 1K96A 1BF5A 1SCMB 2KQYA 4N1FA 1BG1A 1KCYA 3CTNA 1B8RA 2E30A 1YRUB 2OS8B 2GGMA 1CFFA 1QXPA 2BL0B 1W7IB 1C07A 3D0YB 5I2OA 1Y6WA 3VROA 4P2YB 1J7PA 2CBLA 1UHHA 2G9BA 1F4QA 2M1UA 1XO5A 1S3PA 3VRRA 1BU3A 2KI4B 3I5FC 4GBAA 2KGRA 4YI9A 1AJ4A 5CPVA 2LUCA 1CDLA 2KQ6A 1N0YA 1UHJA 5IBWA 3IF7A 4I5LB 1CB1A 1UHKA 2K8MB 3KEVA 3TDIA 1MF8B 3NSLA 1YX7A 4NDCA 1NSHA 1S5GZ 2VRGA 1FBVA 3LLEA 1WRLA 4MBEA 1K93D 3I5GB 2K61A 3WXAA 2HF5A 1S36A 4PE7A 1CFCA 2KFGA 1UWOA 1M46A 3BUMB 4ORCB 1GGZA 2F3YA 3CR5X 5BPJA 3TDUA 1DGVA 4YGDB 1IGVA 1S6IA 1B8CA 1FI5A 5HKZA 2I18A 3NSKA 1IWQA 3VRQA 4PCWA 2PRUA 3CR2A 1BJFA 2H2KA 2KYCA 1DJWA 1NUBA 1TRFA 2MAZA 1CTRA 2JWWA 1MQ1A 1N65A 3F45A 2IS9A 1GJYA 2NXQA 1XFWO 1J1EA 1B9AA 1CFDA 2Y1MA 4YGBB 1TNQA 1KWOC 1DF0A 1W7JB 4AQJA 3DVJA 3JTDB 3PN7C 4BY5A 1XK4A 3O2PA 1NCXA 1YVHA 2MHHA 1B8LA 1YRTB 5G08A 2HETA 2JC2A 2JT8A 4USLA 1SL9A 1KSMA 3DD4A 2JOJA 1J7QA 3CWGA 1GGWA 4GPLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7T Y;  1PVA A;  2LNK A;  4Q04 A;  3I5H C;  4NDD A;  1WDC B;  1YR5 A;  2LP2 A;  3SG3 A;  1B1G A;  3GK2 A;  3OB1 B;  1UP5 A;  1C7W A;  3ZNI A;  1K2H A;  1N2D A;  1YTZ C;  2FOT A;  5AER A;  1LXF C;  1ZMZ A;  4ORA B;  2EC6 C;  1JFJ A;  4AOM A;  1RRO A;  1TIZ A;  4HSZ A;  3MSE B;  1OMV A;  1XA5 A;  3GK4 X;  1NCZ A;  3O6B A;  1JWD A;  1M31 A;  1MXL C;  1NYA A;  2KI6 D;  3SG5 A;  1IQ3 A;  1K9U A;  4MZJ A;  2MBX A;  3I5F B;  2FCD A;  1UHI A;  1U5I B;  1A03 A;  1MUX A;  2GGZ A;  1CLB A;  3H4S E;  4NQG A;  1KK8 B;  3NSI A;  1TCO B;  1LIN A;  2JUL A;  4PHJ A;  4C0K A;  1QLK A;  1AP4 A;  2AUC A;  2LHI A;  1K8U A;  1S5G Y;  1PSB A;  2WOR A;  2ZKM X;  1H8B A;  1BR4 B;  3D10 A;  3WHT B;  4I5N B;  4QJ3 B;  2TN4 A;  1SY9 A;  4PDZ A;  4I5J A;  3TUY C;  1B47 A;  3D0Y A;  2BCB A;  4ZCV A;  1EG4 A;  4GAO A;  1AVS A;  2K7O A;  3DVM A;  3EK4 A;  1B7T Z;  5I8N A;  2JNX A;  2KNE A;  2LCP A;  1HQV A;  3TZ1 A;  4PE4 A;  1X02 A;  2KGB C;  4CPV A;  3AKB A;  1YUU A;  3EK8 A;  2D8N A;  1SYM A;  2Y4Q A;  5AEQ A;  2KYF A;  1SRA A;  2M7N A;  3OB2 B;  2JPT A;  1SBJ A;  1OMR A;  3VRP A;  2LLU A;  2KAY A;  1CLM A;  1TNP A;  5HLV A;  1L2O C;  1KWO B;  1DJH A;  1NX2 A;  1ALV A;  2M49 B;  3PN7 B;  1OMD A;  4OVN F;  1CMF A;  2BCX A;  4JWQ A;  1AJ5 A;  4OR9 B;  2CT9 A;  5B8I B;  1TNW A;  2OTG C;  2H61 C;  2LLT A;  1L7Z A;  1Y0V H;  1IRJ A;  1PAL A;  3O78 A;  4MN0 A;  1EG3 A;  4DUQ A;  2EHB A;  1E8A A;  3I5H B;  1K9P A;  3TS5 B;  4CID A;  4HRG A;  1QX2 A;  2LAP A;  4TNC A;  3SG4 A;  5KSZ A;  1BOD A;  4YGE B;  3AAK A;  1ALW A;  3SG2 A;  1BLQ A;  5HYD A;  4MRY A;  1DTL A;  1EH2 A;  2ZRT A;  1NP8 A;  1DJG A;  1KFX S;  2F33 A;  2QPT A;  2KBM A;  3M0W A;  2ISD A;  1TOP A;  2LAN A;  2EC6 B;  3VGO A;  1UUS A;  2M3W A;  1CDM A;  1JF2 A;  2LHL A;  3PAL A;  1XFY O;  2JU0 A;  5I2Q A;  1KFU S;  1J55 A;  3C1V A;  2NLN A;  3CZT X;  4UPG A;  1JBA A;  2CTN A;  1RK9 A;  2AMI A;  1F70 A;  2SAS A;  3RM1 A;  4GFT A;  4GGF A;  1B4C A;  1FW4 A;  2LUX A;  5AAN A;  1MXE A;  1AUI B;  3DVE A;  1JF0 A;  4ORB B;  4HRH A;  1BMO A;  3AAJ A;  4WQ3 A;  2KI6 C;  3LK0 A;  1REC A;  2L2E A;  4JPZ B;  2WC8 A;  1FPW A;  1FF1 A;  3FWB A;  1XFX O;  2ZRS A;  5GQQ C;  4IL1 A;  3BUO B;  2M97 A;  3RLZ A;  2MLF C;  1LA0 A;  3PFV A;  3TUY B;  1D1O A;  3LL8 B;  2Q4U A;  1G8I A;  5ER4 X;  2LLS A;  3DF0 B;  1DJX A;  2KAV A;  3NXA A;  3FS7 A;  2JZI A;  5DKR A;  1V1G A;  3TDZ A;  5KTY A;  1K95 A;  4C0J A;  1KK7 Y;  3IQO A;  1KFX L;  3PLF B;  1DMO A;  4MLW A;  1CMG A;  3EKJ A;  1U5I A;  1QJT A;  2MLE C;  3PAT A;  1ODB A;  2PSR A;  2KOT A;  1BOC A;  4XJK B;  2OS8 C;  2BL0 C;  2LVI A;  1Y1U A;  4NDB A;  2LVJ A;  1KFU L;  1XVJ A;  1RJV A;  1F4O A;  1XFU O;  2KDH A;  3LK1 A;  1Q80 A;  4FQO A;  1SW8 A;  3SG6 A;  1DGU A;  2K7D A;  1S1E A;  5CSN A;  4P5O E;  1IKU A;  4WQ2 A;  1K9K A;  2F3Z A;  3PM8 A;  2JTT A;  1NX0 A;  2OTG B;  1OZS A;  1A29 A;  1CLL A;  3CS1 A;  4PE0 A;  1YUS A;  1M63 B;  2LV7 A;  4E68 A;  1Y1X A;  1CM4 A;  2Q91 A;  1OQP A;  4GGN A;  5HKY A;  3AKA A;  3BXK A;  3I5I C;  5D69 A;  1ZFS A;  3SIA A;  1K90 D;  2M1K B;  5FYX A;  1CM1 A;  5I2L A;  2K2F A;  2BBN A;  1LKJ A;  1SCV A;  3I5G C;  2ZFD A;  4OV2 A;  3EK7 A;  1CKK A;  2ZN9 A;  2M8U A;  1SL8 A;  1NPQ A;  1J7O A;  4QJ5 B;  3BQ3 A;  3O4Y A;  1DVI A;  5AFP A;  3SIB A;  2B1U A;  2BCA A;  2ZNE A;  4MSP A;  2RGI A;  3OHM B;  3EKH A;  5CSF A;  2DOQ A;  2L5X B;  3NSO A;  4A4B A;  3HX4 A;  4JQ0 D;  2LMV A;  4YRU A;  2E6W A;  2I94 A;  3SG7 A;  1KK7 Z;  2KFH A;  4YGA A;  2Y5I A;  2F2P A;  2MA2 A;  1QAS A;  4OKH A;  2LM5 A;  1S6J A;  1DJY A;  1M39 A;  1QV0 A;  2O5G A;  4PHK A;  1KSO A;  2LC5 A;  4DCK A;  4FTG A;  4A4C A;  4QJ4 B;  3CLN A;  1QVI Z;  5AXI A;  1F54 A;  1QLS A;  2BBM A;  1EL4 A;  2A4J A;  2WOS A;  3EVU A;  3VRN A;  2BE4 A;  4DS7 A;  2F8P A;  2I7A A;  1OOJ A;  2WND A;  1IJ5 A;  2NZ0 A;  1QX7 A;  3KF9 A;  1SK6 D;  1QX5 B;  5TNC A;  4WRI A;  2L4H A;  3JVT C;  4I5K A;  1EJ3 A;  1IH0 A;  1MHO A;  1JFK A;  1KQM C;  1S26 D;  1Y1A A;  5K89 A;  3PSR A;  4MZK A;  4DIR A;  4F0Z B;  1NIW A;  1J1D A;  2K2A A;  3OX5 A;  1QS7 A;  2LVV A;  1XK4 C;  4C0L A;  1MWN A;  2JNF A;  3IQQ A;  4M2P A;  1YUT A;  2CNP A;  1M45 A;  2NCO A;  3LCP C;  1GQM A;  3GOF A;  2JXC A;  1A2X A;  1TTX A;  1WLZ A;  1PVB A;  1A75 A;  2QAC A;  4YGC B;  1SR6 C;  2O60 A;  1K94 A;  4OCI A;  1RWY A;  3BOW B;  4HRE E;  4D1E A;  4PAL A;  1R6P A;  2L50 A;  1LVC D;  2Y1N A;  1DJZ A;  1PRW A;  1QIW A;  1CNP A;  1OSA A;  3WNX B;  2JRF A;  5HKW A;  1XYD A;  1ZOT B;  3E3R A;  5F6T A;  4AQI A;  3DF0 A;  1KK8 C;  3GK1 A;  2K7B A;  3ICB A;  1OE9 B;  1R2U A;  3I5I B;  1HT9 A;  1DJI A;  3WHU B;  2MRD A;  2PAL A;  2JTZ A;  1QV1 A;  2LP3 A;  2L51 A;  3BUX B;  4CFQ A;  3DVK A;  1SMG A;  3FWC A;  4XJK A;  2M7L A;  1A75 B;  1PK0 D;  2ZND A;  2HQ8 A;  1YX8 A;  4XYN A;  1QAT A;  1V1F A;  1G33 A;  2OPO A;  4ETO A;  2CXJ A;  1TCF A;  3EVR A;  1RTP 1;  4M2Q A;  1NCY A;  1PSR A;  2L98 A;  1IJ6 A;  2M0R A;  3BUW B;  1FI6 A;  2EGD A;  1JSA A;  2H61 A;  2CCM A;  4MEW A;  2JXL A;  2L0P A;  2MJW B;  2KAX A;  1UHN A;  1WY9 A;  2HPS A;  1F55 A;  1SCM C;  1CFP A;  2L4I A;  3HCM A;  1KQV A;  1PUL A;  3FIA A;  2P6B B;  1LA3 A;  1QVI Y;  1UUR A;  5CSI A;  2LMU A;  2LVK A;  5KU1 A;  5PAL A;  1TNX A;  2M9G A;  3CR4 X;  3BYA A;  1L2O B;  1ZUZ A;  2BKH B;  1F8H A;  5J3X A;  1SPY A;  1C7V A;  2KSP A;  3A8R A;  1DT7 B;  3QRX A;  2BKI B;  2KI4 C;  5ER5 A;  3TS5 C;  1OZO A;  4PHN A;  3JVT B;  1XFZ O;  3CGA A;  1WRZ A;  1KQM B;  3K21 A;  1AHR A;  1NWD A;  4CLN A;  1WLM A;  4N1G A;  4DRW A;  2I2R E;  1DF0 B;  2K0J A;  4GUK A;  4MZL A;  2KHN A;  1EXR A;  3KPX A;  2K7C A;  2BE6 A;  1SNL A;  1XFV O;  2M29 A;  5JJG A;  1QTX A;  4PHM A;  2ZN8 A;  2JT3 A;  1YVL A;  2SCP A;  1G4Y R;  1SR6 B;  3KO0 A;  3EVV A;  1TN4 A;  2AAO A;  1ZAC A;  3BUN B;  1J7R A;  1BR1 B;  2KBI A;  1SKT A;  2NCP A;  4L9M A;  2PMY A;  2COL B;  1VRK A;  3OP0 A;  3ZWH A;  4MVF A;  3OX6 A;  2GV5 A;  2PAS A;  5D7F A;  4CFR A;  5CSJ A;  5HLO A;  2F2O A;  3JTD C;  4GNK B;  4M2O A;  3SJS A;  5JOL A;  4ICB A;  1CDP A;  1MR8 A;  2BEC A;  2G2B A;  2PVB A;  1RFJ A;  2WCB A;  1IQ5 A;  4N5X A;  1NX1 A;  4U8D A;  2HQW A;  2LE9 B;  5DKQ A;  4MRX A;  2FJU B;  4GGF C;  2KFF A;  4YI8 A;  2V53 A;  3A4U B;  2JT0 A;  2LMT A;  1WRK A;  1JUO A;  1WDC C;  2WCF A;  3BOW A;  2WCE A;  4PE1 A;  1H4B A;  1AK8 A;  4R1E A;  1QIV A;  1NX3 A;  1JC2 A;  1S6C A;  3KHE A;  2FCE A;  5DKN A;  1F71 A;  2R2I A;  1BT6 A;  1IG5 A;  1CDN A;  1A4P A;  2JQ6 A;  4YBH B;  4ZCU A;  4BY4 A;  1YUR A;  1SL7 A;  1K96 A;  1BF5 A;  1SCM B;  2KQY A;  4N1F A;  1BG1 A;  1KCY A;  3CTN A;  1B8R A;  2E30 A;  1YRU B;  2OS8 B;  2GGM A;  1CFF A;  1QXP A;  2BL0 B;  1W7I B;  1C07 A;  3D0Y B;  5I2O A;  1Y6W A;  3VRO A;  4P2Y B;  1J7P A;  2CBL A;  1UHH A;  2G9B A;  1F4Q A;  2M1U A;  1XO5 A;  1S3P A;  3VRR A;  1BU3 A;  2KI4 B;  3I5F C;  4GBA A;  2KGR A;  4YI9 A;  1AJ4 A;  5CPV A;  2LUC A;  1CDL A;  2KQ6 A;  1N0Y A;  1UHJ A;  5IBW A;  3IF7 A;  4I5L B;  1CB1 A;  1UHK A;  2K8M B;  3KEV A;  3TDI A;  1MF8 B;  3NSL A;  1YX7 A;  4NDC A;  1NSH A;  1S5G Z;  2VRG A;  1FBV A;  3LLE A;  1WRL A;  4MBE A;  1K93 D;  3I5G B;  2K61 A;  3WXA A;  2HF5 A;  1S36 A;  4PE7 A;  1CFC A;  2KFG A;  1UWO A;  1M46 A;  3BUM B;  4ORC B;  1GGZ A;  2F3Y A;  3CR5 X;  5BPJ A;  3TDU A;  1DGV A;  4YGD B;  1IGV A;  1S6I A;  1B8C A;  1FI5 A;  5HKZ A;  2I18 A;  3NSK A;  1IWQ A;  3VRQ A;  4PCW A;  2PRU A;  3CR2 A;  1BJF A;  2H2K A;  2KYC A;  1DJW A;  1NUB A;  1TRF A;  2MAZ A;  1CTR A;  2JWW A;  1MQ1 A;  1N65 A;  3F45 A;  2IS9 A;  1GJY A;  2NXQ A;  1XFW O;  1J1E A;  1B9A A;  1CFD A;  2Y1M A;  4YGB B;  1TNQ A;  1KWO C;  1DF0 A;  1W7J B;  4AQJ A;  3DVJ A;  3JTD B;  3PN7 C;  4BY5 A;  1XK4 A;  3O2P A;  1NCX A;  1YVH A;  2MHH A;  1B8L A;  1YRT B;  5G08 A;  2HET A;  2JC2 A;  2JT8 A;  4USL A;  1SL9 A;  1KSM A;  3DD4 A;  2JOJ A;  1J7Q A;  3CWG A;  1GGW A;  4GPL B; 
#chains in the Genus database with same CATH topology
 1B7T Y;  1PVA A;  2LNK A;  4Q04 A;  3I5H C;  4NDD A;  1WDC B;  1YR5 A;  2LP2 A;  3SG3 A;  1B1G A;  3GK2 A;  3OB1 B;  1UP5 A;  1C7W A;  3ZNI A;  1K2H A;  1N2D A;  1YTZ C;  2FOT A;  5AER A;  1SSE B;  1LXF C;  1ZMZ A;  1Z4H A;  4ORA B;  2EC6 C;  1JFJ A;  3O4X A;  3OBV A;  4AOM A;  1RRO A;  1TIZ A;  4HSZ A;  3MSE B;  1OMV A;  1XA5 A;  3GK4 X;  1NCZ A;  3O6B A;  1JWD A;  1M31 A;  1MXL C;  1NYA A;  2KI6 D;  3SG5 A;  1IQ3 A;  1K9U A;  4MZJ A;  2MBX A;  3I5F B;  2FCD A;  1UHI A;  1U5I B;  2K60 A;  1A03 A;  3CYZ A;  1MUX A;  2GGZ A;  1CLB A;  3H4S E;  4NQG A;  1KK8 B;  3NSI A;  2QEB A;  1TCO B;  1LIN A;  2JUL A;  4PHJ A;  4C0K A;  1QLK A;  1AP4 A;  3Q8I A;  2AUC A;  2LHI A;  1K8U A;  1S5G Y;  1PSB A;  2WOR A;  2ZKM X;  4OZD A;  1H8B A;  1BR4 B;  3D10 A;  1TUZ A;  4I5N B;  3WHT B;  4QJ3 B;  2TN4 A;  1SY9 A;  4PDZ A;  1DQE A;  4I5J A;  3TUY C;  1B47 A;  3D0Y A;  2BCB A;  4ZCV A;  1EG4 A;  4GAO A;  1AVS A;  2K7O A;  3DVM A;  3EK4 A;  1B7T Z;  3FE6 A;  5I8N A;  2JNX A;  2KNE A;  2LCP A;  1HQV A;  3TZ1 A;  4PE4 A;  1X02 A;  2KGB C;  4CPV A;  3AKB A;  1YUU A;  3EK8 A;  2WC6 A;  2H8V A;  2D8N A;  1SYM A;  2Y4Q A;  3BJH A;  5AEQ A;  2KYF A;  1SRA A;  2M7N A;  3OB2 B;  2JPT A;  5EL2 A;  1SBJ A;  1OMR A;  3SS4 A;  3BFB A;  2LLU A;  2KAY A;  3VRP A;  1CLM A;  1TNP A;  5HLV A;  1L2O C;  1KWO B;  1DJH A;  1NX2 A;  1ALV A;  2M49 B;  3PN7 B;  1OMD A;  4OVN F;  1CMF A;  2BCX A;  4JWQ A;  1AJ5 A;  1P28 A;  4OR9 B;  2CT9 A;  5B8I B;  1TNW A;  2OTG C;  2H61 C;  2LLT A;  1L7Z A;  1Y0V H;  1IRJ A;  1PAL A;  3O78 A;  4MN0 A;  3D76 A;  1EG3 A;  5D3O A;  4DUQ A;  2EHB A;  1E8A A;  3I5H B;  1K9P A;  3TS5 B;  4CID A;  4HRG A;  3FE8 A;  1QX2 A;  2LAP A;  4TNC A;  3SG4 A;  5KSZ A;  1BOD A;  2PYQ A;  4YGE B;  3AAK A;  1ALW A;  3SG2 A;  2WCM A;  1BLQ A;  5HYD A;  4MRY A;  1OOH A;  1DTL A;  1EH2 A;  2WCL A;  5FI6 A;  2ZRT A;  1NP8 A;  1DJG A;  1KFX S;  2F33 A;  2QPT A;  2KBM A;  3M0W A;  3CZ0 A;  2ISD A;  1TOP A;  2LAN A;  2EC6 B;  3VGO A;  1UUS A;  3R1V A;  2M3W A;  1CDM A;  1LS8 A;  1JF2 A;  2LHL A;  3PAL A;  1XFY O;  2JU0 A;  5I2Q A;  1KFU S;  1J55 A;  3C1V A;  2NLN A;  3CZT X;  4UPG A;  1JBA A;  2CTN A;  1RK9 A;  2AMI A;  1F70 A;  2SAS A;  3RM1 A;  4GFT A;  4GGF A;  1B4C A;  1FW4 A;  2LUX A;  2PQL A;  5AAN A;  1MXE A;  1AUI B;  3DVE A;  1JF0 A;  3NHI A;  4ORB B;  4HRH A;  1BMO A;  3AAJ A;  2L5Y A;  4WQ3 A;  2KI6 C;  3LK0 A;  1REC A;  2L2E A;  4JPZ B;  2WC8 A;  1FPW A;  1XFR A;  1FF1 A;  3FWB A;  1XFX O;  2BNX A;  2ZRS A;  5GQQ C;  4IL1 A;  3BUO B;  2M97 A;  3RLZ A;  2MLF C;  1LA0 A;  3PFV A;  3TUY B;  1D1O A;  3LL8 B;  2Q4U A;  3IVT A;  1G8I A;  5ER4 X;  2LLS A;  3DF0 B;  1DJX A;  2KAV A;  3NXA A;  3FS7 A;  2JZI A;  5DKR A;  1V1G A;  3TDZ A;  5KTY A;  1K95 A;  4C0J A;  1KK7 Y;  3IQO A;  1KFX L;  3PLF B;  1DMO A;  4MLW A;  1CMG A;  3EKJ A;  1U5I A;  1QJT A;  2MLE C;  3PAT A;  1ODB A;  2PSR A;  2KOT A;  1BOC A;  4XJK B;  2OS8 C;  2BL0 C;  3UO9 A;  2LVI A;  1Y1U A;  4NDB A;  2LVJ A;  1KFU L;  1XVJ A;  1RJV A;  1F4O A;  1XFU O;  2KDH A;  3LK1 A;  1ORG A;  1Q80 A;  3R72 A;  4FQO A;  1SW8 A;  3SG6 A;  1DGU A;  2K7D A;  1S1E A;  5CSN A;  4P5O E;  1IKU A;  4WQ2 A;  1K9K A;  2F3Z A;  3PM8 A;  2JTT A;  1NX0 A;  3BFH A;  2OTG B;  1OZS A;  1A29 A;  1CLL A;  3CS1 A;  4PE0 A;  1YUS A;  1M63 B;  2LV7 A;  4E68 A;  3DY9 A;  1Y1X A;  1CM4 A;  2Q91 A;  3OGN A;  1OQP A;  4GGN A;  5HKY A;  3AKA A;  3BXK A;  3I5I C;  5D69 A;  1ZFS A;  3SIA A;  1K90 D;  2M1K B;  5FYX A;  1CM1 A;  5FI2 A;  3V2L A;  5I2L A;  2K2F A;  3RZS A;  2BBN A;  1LKJ A;  1SCV A;  3I5G C;  2QEV A;  2ZFD A;  4OV2 A;  3EK7 A;  1CKK A;  2ZN9 A;  2M8U A;  1SL8 A;  1NPQ A;  1J7O A;  3L4L A;  4QJ5 B;  3BQ3 A;  1OOG A;  3O4Y A;  4JKT A;  1DVI A;  5AFP A;  5HL1 A;  3SIB A;  2B1U A;  2BCA A;  2ZNE A;  4MSP A;  2RGI A;  3OHM B;  3EKH A;  4JD9 A;  5FI7 A;  5CSF A;  2DOQ A;  2L5X B;  3NSO A;  4A4B A;  3HX4 A;  4JQ0 D;  2LMV A;  4YRU A;  2E6W A;  2I94 A;  3CAB A;  3SG7 A;  1KK7 Z;  2KFH A;  4YGA A;  2Y5I A;  2F2P A;  2MA2 A;  1QAS A;  4OKH A;  2LM5 A;  1S6J A;  2P71 A;  1DJY A;  1M39 A;  1QV0 A;  4IJ7 A;  2O5G A;  3PJI A;  1KSO A;  2LC5 A;  3B86 A;  2L2C A;  4PHK A;  4DCK A;  4FTG A;  4A4C A;  4QJ4 B;  3CLN A;  1QVI Z;  5AXI A;  1OOI X;  3FE9 A;  1F54 A;  1QLS A;  2BBM A;  3CZ1 A;  2KPH A;  1EL4 A;  2A4J A;  3S0A A;  2WOS A;  3EVU A;  3VRN A;  2BE4 A;  2ERB A;  4DS7 A;  2F8P A;  2I7A A;  1OOJ A;  2WND A;  3S0E A;  2P70 A;  1IJ5 A;  3B6X A;  2NZ0 A;  1QX7 A;  3KF9 A;  1SK6 D;  1QX5 B;  5TNC A;  4WRI A;  2L4H A;  3JVT C;  4I5K A;  1EJ3 A;  1IH0 A;  1MHO A;  1JFK A;  1KQM C;  1S26 D;  1Y1A A;  5K89 A;  3PSR A;  4MZK A;  4DIR A;  4F0Z B;  4F7F A;  1NIW A;  1J1D A;  1Z2C B;  2K2A A;  1QS7 A;  3N7H A;  2FJY A;  2LVV A;  3NHT A;  3OX5 A;  1XK4 C;  4C0L A;  1MWN A;  2JNF A;  3IQQ A;  4M2P A;  1YUT A;  2CNP A;  1M45 A;  2NCO A;  3LCP C;  1GQM A;  3GOF A;  2JXC A;  1A2X A;  1TTX A;  1WLZ A;  1PVB A;  1A75 A;  2QAC A;  4YGC B;  1SR6 C;  2O60 A;  1K94 A;  4OCI A;  1RWY A;  3BOW B;  4HRE E;  4D1E A;  4PAL A;  3CZ2 A;  1R6P A;  2L50 A;  1LVC D;  3NGV A;  2Y1N A;  1DEL A;  1DEK A;  1DJZ A;  1PRW A;  1QIW A;  1CNP A;  1OSA A;  3WNX B;  2JRF A;  5HKW A;  1XYD A;  1ZOT B;  3E3R A;  5F6T A;  4AQI A;  3DF0 A;  1KK8 C;  3GK1 A;  2K7B A;  3ICB A;  1OE9 B;  1R2U A;  3I5I B;  1C3Z A;  1HT9 A;  3D75 A;  1DJI A;  3WHU B;  5DIC A;  2MRD A;  2PAL A;  2JTZ A;  1QV1 A;  2LP3 A;  3VB1 A;  2L51 A;  3BUX B;  4CFQ A;  3DVK A;  1SMG A;  3FWC A;  4XJK A;  2QDI A;  2M7L A;  1A75 B;  1PK0 D;  2ZND A;  2HQ8 A;  1YX8 A;  4XYN A;  1QAT A;  1V1F A;  1G33 A;  2OPO A;  4ETO A;  1W9Z A;  2CXJ A;  1TCF A;  3EVR A;  1RTP 1;  4M2Q A;  1NCY A;  1PSR A;  4PT1 A;  2L98 A;  3S0B A;  1IJ6 A;  2M0R A;  3BUW B;  1FI6 A;  2EGD A;  1C3Y A;  1JSA A;  2H61 A;  2CCM A;  4MEW A;  2JXL A;  4FQT A;  2L0P A;  2MJW B;  2KAX A;  1UHN A;  1WY9 A;  2HPS A;  1F55 A;  1SCM C;  1CFP A;  2L4I A;  3HCM A;  1KQV A;  1PUL A;  3D74 A;  3FIA A;  2P6B B;  1LA3 A;  3L4A A;  1OOF A;  1QVI Y;  1UUR A;  5CSI A;  2LMU A;  2LVK A;  5KU1 A;  5PAL A;  1TNX A;  2M9G A;  3CR4 X;  3BYA A;  1L2O B;  1ZUZ A;  2BKH B;  3QME A;  1F8H A;  5J3X A;  1SPY A;  1C7V A;  2KSP A;  3A8R A;  1DT7 B;  3QRX A;  2BKI B;  2KI4 C;  3DZT A;  5ER5 A;  3TS5 C;  3BFA A;  1OZO A;  4PHN A;  3K1E A;  3JVT B;  1XFZ O;  3CGA A;  1WRZ A;  1KQM B;  2KLE A;  3K21 A;  1AHR A;  1NWD A;  4CLN A;  1WLM A;  4N1G A;  4DRW A;  2I2R E;  1DF0 B;  2K0J A;  4GUK A;  4MZL A;  2KHN A;  1EXR A;  3KPX A;  3R1O A;  2K7C A;  3B7A A;  1SNL A;  1XFV O;  2BE6 A;  2M29 A;  5JJG A;  1QTX A;  4PHM A;  2ZN8 A;  2JT3 A;  1YVL A;  2SCP A;  1G4Y R;  1SR6 B;  3S0F A;  3KO0 A;  3EVV A;  1TN4 A;  2JPO A;  2AAO A;  1ZAC A;  3BUN B;  1J7R A;  1BR1 B;  2KBI A;  1SKT A;  2NCP A;  4L9M A;  2PMY A;  2COL B;  2WCJ A;  1VRK A;  3OP0 A;  3ZWH A;  4MVF A;  3OX6 A;  2GV5 A;  2PAS A;  5D7F A;  4CFR A;  5CSJ A;  5HLO A;  1IIO A;  3SS3 A;  2QEO A;  2F2O A;  3JTD C;  4GNK B;  4M2O A;  3SJS A;  5JOL A;  4ICB A;  3CDN A;  1CDP A;  2WCK A;  1GM0 A;  1MR8 A;  2BEC A;  2G2B A;  2PVB A;  1RFJ A;  2WCB A;  1IQ5 A;  4N5X A;  1NX1 A;  4U8D A;  2HQW A;  2LE9 B;  5DKQ A;  4MRX A;  2FJU B;  3L47 A;  4GGF C;  2KFF A;  4YI8 A;  2V53 A;  3A4U B;  1TWO A;  2JT0 A;  2LMT A;  1WRK A;  1JUO A;  1WDC C;  2KLD A;  2WCF A;  2WCE A;  3BOW A;  3D77 A;  3EG5 B;  4PE1 A;  1AK8 A;  1H4B A;  4R1E A;  3UNW A;  1QIV A;  1NX3 A;  1TUJ A;  1JC2 A;  1S6C A;  4AQJ A;  3KHE A;  2FCE A;  5DKN A;  1F71 A;  2R2I A;  1BT6 A;  2WCH A;  1IG5 A;  1CDN A;  1A4P A;  2JQ6 A;  4YBH B;  4ZCU A;  4BY4 A;  1YUR A;  1SL7 A;  3SS5 A;  1K96 A;  1BF5 A;  1SCM B;  2KQY A;  4N1F A;  1BG1 A;  1KCY A;  3CTN A;  3DXL A;  1B8R A;  2E30 A;  1YRU B;  2OS8 B;  2GGM A;  1CFF A;  1QXP A;  2BL0 B;  1W7I B;  1C07 A;  3D0Y B;  4BY5 A;  1Y6W A;  5I2O A;  3VRO A;  4P2Y B;  2GTE A;  1J7P A;  2CBL A;  1UHH A;  2G9B A;  1F4Q A;  2M1U A;  5I94 A;  1XO5 A;  3B88 A;  1S3P A;  3VRR A;  2QEH A;  1BU3 A;  2KI4 B;  3I5F C;  4GBA A;  2KGR A;  3DYE A;  1AJ4 A;  4YI9 A;  5CPV A;  2LUC A;  3D78 A;  1CDL A;  2KQ6 A;  3D73 A;  1N0Y A;  1UHJ A;  5IBW A;  3IF7 A;  4I5L B;  1CB1 A;  1UHK A;  2K8M B;  3KEV A;  3TDI A;  1MF8 B;  3NSL A;  1YX7 A;  4NDC A;  1NSH A;  1S5G Z;  2VRG A;  1FBV A;  3LLE A;  1WRL A;  4MBE A;  1K93 D;  3I5G B;  2K61 A;  4INX A;  2HF5 A;  1S36 A;  1OW4 A;  4PE7 A;  3WXA A;  1CFC A;  2BAP A;  2KFG A;  1UWO A;  1M46 A;  3BUM B;  4ORC B;  1GGZ A;  2F3Y A;  3CR5 X;  5BPJ A;  3TDU A;  1DGV A;  4YGD B;  1IGV A;  1S6I A;  1B8C A;  1DC1 A;  1FI5 A;  5HKZ A;  2I18 A;  3NSK A;  1IWQ A;  3VRQ A;  4PCW A;  2PRU A;  3CR2 A;  1BJF A;  2H2K A;  2KYC A;  1DJW A;  1QWV A;  1NUB A;  1TRF A;  2MAZ A;  1CTR A;  2JWW A;  1MQ1 A;  1N65 A;  3F45 A;  4INW A;  2IS9 A;  1GJY A;  2NXQ A;  1XFW O;  1J1E A;  1B9A A;  1CFD A;  2Y1M A;  3S0G A;  4YGB B;  1TNQ A;  1KWO C;  1DF0 A;  1W7J B;  3S0D A;  3B87 A;  3DVJ A;  3JTD B;  3PN7 C;  1XK4 A;  2WC5 A;  3O2P A;  1NCX A;  1YVH A;  2MHH A;  1B8L A;  1T14 A;  1YRT B;  5G08 A;  2HET A;  2JC2 A;  3R1P A;  2JT8 A;  4USL A;  1SL9 A;  1KSM A;  3DD4 A;  2JOJ A;  1J7Q A;  2YGU A;  3CWG A;  3PM2 A;  4KYN A;  1GGW A;  4GPL B; 
#chains in the Genus database with same CATH homology
 1B7T Y;  1PVA A;  2LNK A;  4Q04 A;  3I5H C;  4NDD A;  1WDC B;  1YR5 A;  2LP2 A;  3SG3 A;  1B1G A;  3GK2 A;  3OB1 B;  1UP5 A;  1C7W A;  3ZNI A;  1K2H A;  1N2D A;  1YTZ C;  2FOT A;  5AER A;  1LXF C;  1ZMZ A;  4ORA B;  2EC6 C;  1JFJ A;  4AOM A;  1RRO A;  1TIZ A;  4HSZ A;  3MSE B;  1OMV A;  1XA5 A;  3GK4 X;  1NCZ A;  3O6B A;  1JWD A;  1M31 A;  1MXL C;  1NYA A;  2KI6 D;  3SG5 A;  1IQ3 A;  1K9U A;  4MZJ A;  2MBX A;  3I5F B;  2FCD A;  1UHI A;  1U5I B;  1A03 A;  1MUX A;  2GGZ A;  1CLB A;  3H4S E;  4NQG A;  1KK8 B;  3NSI A;  1TCO B;  1LIN A;  2JUL A;  4PHJ A;  4C0K A;  1QLK A;  1AP4 A;  2AUC A;  2LHI A;  1K8U A;  1S5G Y;  1PSB A;  2WOR A;  2ZKM X;  1H8B A;  1BR4 B;  3D10 A;  3WHT B;  4I5N B;  4QJ3 B;  2TN4 A;  1SY9 A;  4PDZ A;  4I5J A;  3TUY C;  1B47 A;  3D0Y A;  2BCB A;  4ZCV A;  1EG4 A;  4GAO A;  1AVS A;  2K7O A;  3DVM A;  3EK4 A;  1B7T Z;  5I8N A;  2JNX A;  2KNE A;  2LCP A;  1HQV A;  3TZ1 A;  4PE4 A;  1X02 A;  2KGB C;  4CPV A;  3AKB A;  1YUU A;  3EK8 A;  2D8N A;  1SYM A;  2Y4Q A;  5AEQ A;  2KYF A;  1SRA A;  2M7N A;  3OB2 B;  2JPT A;  1SBJ A;  1OMR A;  3VRP A;  2LLU A;  2KAY A;  1CLM A;  1TNP A;  5HLV A;  1L2O C;  1KWO B;  1DJH A;  1NX2 A;  1ALV A;  2M49 B;  3PN7 B;  1OMD A;  4OVN F;  1CMF A;  2BCX A;  4JWQ A;  1AJ5 A;  4OR9 B;  2CT9 A;  5B8I B;  1TNW A;  2OTG C;  2H61 C;  2LLT A;  1L7Z A;  1Y0V H;  1IRJ A;  1PAL A;  3O78 A;  4MN0 A;  1EG3 A;  4DUQ A;  2EHB A;  1E8A A;  3I5H B;  1K9P A;  3TS5 B;  4CID A;  4HRG A;  1QX2 A;  2LAP A;  4TNC A;  3SG4 A;  5KSZ A;  1BOD A;  4YGE B;  3AAK A;  1ALW A;  3SG2 A;  1BLQ A;  5HYD A;  4MRY A;  1DTL A;  1EH2 A;  2ZRT A;  1NP8 A;  1DJG A;  1KFX S;  2F33 A;  2QPT A;  2KBM A;  3M0W A;  2ISD A;  1TOP A;  2LAN A;  2EC6 B;  3VGO A;  1UUS A;  2M3W A;  1CDM A;  1JF2 A;  2LHL A;  3PAL A;  1XFY O;  2JU0 A;  5I2Q A;  1KFU S;  1J55 A;  3C1V A;  2NLN A;  3CZT X;  4UPG A;  1JBA A;  2CTN A;  1RK9 A;  2AMI A;  1F70 A;  2SAS A;  3RM1 A;  4GFT A;  4GGF A;  1B4C A;  1FW4 A;  2LUX A;  5AAN A;  1MXE A;  1AUI B;  3DVE A;  1JF0 A;  4ORB B;  4HRH A;  1BMO A;  3AAJ A;  4WQ3 A;  2KI6 C;  3LK0 A;  1REC A;  2L2E A;  4JPZ B;  2WC8 A;  1FPW A;  1FF1 A;  3FWB A;  1XFX O;  2ZRS A;  5GQQ C;  4IL1 A;  3BUO B;  2M97 A;  3RLZ A;  2MLF C;  1LA0 A;  3PFV A;  3TUY B;  1D1O A;  3LL8 B;  2Q4U A;  1G8I A;  5ER4 X;  2LLS A;  3DF0 B;  1DJX A;  2KAV A;  3NXA A;  3FS7 A;  2JZI A;  5DKR A;  1V1G A;  3TDZ A;  5KTY A;  1K95 A;  4C0J A;  1KK7 Y;  3IQO A;  1KFX L;  3PLF B;  1DMO A;  4MLW A;  1CMG A;  3EKJ A;  1U5I A;  1QJT A;  2MLE C;  3PAT A;  1ODB A;  2PSR A;  2KOT A;  1BOC A;  4XJK B;  2OS8 C;  2BL0 C;  2LVI A;  1Y1U A;  4NDB A;  2LVJ A;  1KFU L;  1XVJ A;  1RJV A;  1F4O A;  1XFU O;  2KDH A;  3LK1 A;  1Q80 A;  4FQO A;  1SW8 A;  3SG6 A;  1DGU A;  2K7D A;  1S1E A;  5CSN A;  4P5O E;  1IKU A;  4WQ2 A;  1K9K A;  2F3Z A;  3PM8 A;  2JTT A;  1NX0 A;  2OTG B;  1OZS A;  1A29 A;  1CLL A;  3CS1 A;  4PE0 A;  1YUS A;  1M63 B;  2LV7 A;  4E68 A;  1Y1X A;  1CM4 A;  2Q91 A;  1OQP A;  4GGN A;  5HKY A;  3AKA A;  3BXK A;  3I5I C;  5D69 A;  1ZFS A;  3SIA A;  1K90 D;  2M1K B;  5FYX A;  1CM1 A;  5I2L A;  2K2F A;  2BBN A;  1LKJ A;  1SCV A;  3I5G C;  2ZFD A;  4OV2 A;  3EK7 A;  1CKK A;  2ZN9 A;  2M8U A;  1SL8 A;  1NPQ A;  1J7O A;  4QJ5 B;  3BQ3 A;  3O4Y A;  1DVI A;  5AFP A;  3SIB A;  2B1U A;  2BCA A;  2ZNE A;  4MSP A;  2RGI A;  3OHM B;  3EKH A;  5CSF A;  2DOQ A;  2L5X B;  3NSO A;  4A4B A;  3HX4 A;  4JQ0 D;  2LMV A;  4YRU A;  2E6W A;  2I94 A;  3SG7 A;  1KK7 Z;  2KFH A;  4YGA A;  2Y5I A;  2F2P A;  2MA2 A;  1QAS A;  4OKH A;  2LM5 A;  1S6J A;  1DJY A;  1M39 A;  1QV0 A;  2O5G A;  4PHK A;  1KSO A;  2LC5 A;  4DCK A;  4FTG A;  4A4C A;  4QJ4 B;  3CLN A;  1QVI Z;  5AXI A;  1F54 A;  1QLS A;  2BBM A;  1EL4 A;  2A4J A;  2WOS A;  3EVU A;  3VRN A;  2BE4 A;  4DS7 A;  2F8P A;  2I7A A;  1OOJ A;  2WND A;  1IJ5 A;  2NZ0 A;  1QX7 A;  3KF9 A;  1SK6 D;  1QX5 B;  5TNC A;  4WRI A;  2L4H A;  3JVT C;  4I5K A;  1EJ3 A;  1IH0 A;  1MHO A;  1JFK A;  1KQM C;  1S26 D;  1Y1A A;  5K89 A;  3PSR A;  4MZK A;  4DIR A;  4F0Z B;  1NIW A;  1J1D A;  2K2A A;  3OX5 A;  1QS7 A;  2LVV A;  1XK4 C;  4C0L A;  1MWN A;  2JNF A;  3IQQ A;  4M2P A;  1YUT A;  2CNP A;  1M45 A;  2NCO A;  3LCP C;  1GQM A;  3GOF A;  2JXC A;  1A2X A;  1TTX A;  1WLZ A;  1PVB A;  1A75 A;  2QAC A;  4YGC B;  1SR6 C;  2O60 A;  1K94 A;  4OCI A;  1RWY A;  3BOW B;  4HRE E;  4D1E A;  4PAL A;  1R6P A;  2L50 A;  1LVC D;  2Y1N A;  1DJZ A;  1PRW A;  1QIW A;  1CNP A;  1OSA A;  3WNX B;  2JRF A;  5HKW A;  1XYD A;  1ZOT B;  3E3R A;  5F6T A;  4AQI A;  3DF0 A;  1KK8 C;  3GK1 A;  2K7B A;  3ICB A;  1OE9 B;  1R2U A;  3I5I B;  1HT9 A;  1DJI A;  3WHU B;  2MRD A;  2PAL A;  2JTZ A;  1QV1 A;  2LP3 A;  2L51 A;  3BUX B;  4CFQ A;  3DVK A;  1SMG A;  3FWC A;  4XJK A;  2M7L A;  1A75 B;  1PK0 D;  2ZND A;  2HQ8 A;  1YX8 A;  4XYN A;  1QAT A;  1V1F A;  1G33 A;  2OPO A;  4ETO A;  2CXJ A;  1TCF A;  3EVR A;  1RTP 1;  4M2Q A;  1NCY A;  1PSR A;  2L98 A;  1IJ6 A;  2M0R A;  3BUW B;  1FI6 A;  2EGD A;  1JSA A;  2H61 A;  2CCM A;  4MEW A;  2JXL A;  2L0P A;  2MJW B;  2KAX A;  1UHN A;  1WY9 A;  2HPS A;  1F55 A;  1SCM C;  1CFP A;  2L4I A;  3HCM A;  1KQV A;  1PUL A;  3FIA A;  2P6B B;  1LA3 A;  1QVI Y;  1UUR A;  5CSI A;  2LMU A;  2LVK A;  5KU1 A;  5PAL A;  1TNX A;  2M9G A;  3CR4 X;  3BYA A;  1L2O B;  1ZUZ A;  2BKH B;  1F8H A;  5J3X A;  1SPY A;  1C7V A;  2KSP A;  3A8R A;  1DT7 B;  3QRX A;  2BKI B;  2KI4 C;  5ER5 A;  3TS5 C;  1OZO A;  4PHN A;  3JVT B;  1XFZ O;  3CGA A;  1WRZ A;  1KQM B;  3K21 A;  1AHR A;  1NWD A;  4CLN A;  1WLM A;  4N1G A;  4DRW A;  2I2R E;  1DF0 B;  2K0J A;  4GUK A;  4MZL A;  2KHN A;  1EXR A;  3KPX A;  2K7C A;  2BE6 A;  1SNL A;  1XFV O;  2M29 A;  5JJG A;  1QTX A;  4PHM A;  2ZN8 A;  2JT3 A;  1YVL A;  2SCP A;  1G4Y R;  1SR6 B;  3KO0 A;  3EVV A;  1TN4 A;  2AAO A;  1ZAC A;  3BUN B;  1J7R A;  1BR1 B;  2KBI A;  1SKT A;  2NCP A;  4L9M A;  2PMY A;  2COL B;  1VRK A;  3OP0 A;  3ZWH A;  4MVF A;  3OX6 A;  2GV5 A;  2PAS A;  5D7F A;  4CFR A;  5CSJ A;  5HLO A;  2F2O A;  3JTD C;  4GNK B;  4M2O A;  3SJS A;  5JOL A;  4ICB A;  1CDP A;  1MR8 A;  2BEC A;  2G2B A;  2PVB A;  1RFJ A;  2WCB A;  1IQ5 A;  4N5X A;  1NX1 A;  4U8D A;  2HQW A;  2LE9 B;  5DKQ A;  4MRX A;  2FJU B;  4GGF C;  2KFF A;  4YI8 A;  2V53 A;  3A4U B;  2JT0 A;  2LMT A;  1WRK A;  1JUO A;  1WDC C;  2WCF A;  3BOW A;  2WCE A;  4PE1 A;  1H4B A;  1AK8 A;  4R1E A;  1QIV A;  1NX3 A;  1JC2 A;  1S6C A;  3KHE A;  2FCE A;  5DKN A;  1F71 A;  2R2I A;  1BT6 A;  1IG5 A;  1CDN A;  1A4P A;  2JQ6 A;  4YBH B;  4ZCU A;  4BY4 A;  1YUR A;  1SL7 A;  1K96 A;  1BF5 A;  1SCM B;  2KQY A;  4N1F A;  1BG1 A;  1KCY A;  3CTN A;  1B8R A;  2E30 A;  1YRU B;  2OS8 B;  2GGM A;  1CFF A;  1QXP A;  2BL0 B;  1W7I B;  1C07 A;  3D0Y B;  5I2O A;  1Y6W A;  3VRO A;  4P2Y B;  1J7P A;  2CBL A;  1UHH A;  2G9B A;  1F4Q A;  2M1U A;  1XO5 A;  1S3P A;  3VRR A;  1BU3 A;  2KI4 B;  3I5F C;  4GBA A;  2KGR A;  4YI9 A;  1AJ4 A;  5CPV A;  2LUC A;  1CDL A;  2KQ6 A;  1N0Y A;  1UHJ A;  5IBW A;  3IF7 A;  4I5L B;  1CB1 A;  1UHK A;  2K8M B;  3KEV A;  3TDI A;  1MF8 B;  3NSL A;  1YX7 A;  4NDC A;  1NSH A;  1S5G Z;  2VRG A;  1FBV A;  3LLE A;  1WRL A;  4MBE A;  1K93 D;  3I5G B;  2K61 A;  3WXA A;  2HF5 A;  1S36 A;  4PE7 A;  1CFC A;  2KFG A;  1UWO A;  1M46 A;  3BUM B;  4ORC B;  1GGZ A;  2F3Y A;  3CR5 X;  5BPJ A;  3TDU A;  1DGV A;  4YGD B;  1IGV A;  1S6I A;  1B8C A;  1FI5 A;  5HKZ A;  2I18 A;  3NSK A;  1IWQ A;  3VRQ A;  4PCW A;  2PRU A;  3CR2 A;  1BJF A;  2H2K A;  2KYC A;  1DJW A;  1NUB A;  1TRF A;  2MAZ A;  1CTR A;  2JWW A;  1MQ1 A;  1N65 A;  3F45 A;  2IS9 A;  1GJY A;  2NXQ A;  1XFW O;  1J1E A;  1B9A A;  1CFD A;  2Y1M A;  4YGB B;  1TNQ A;  1KWO C;  1DF0 A;  1W7J B;  4AQJ A;  3DVJ A;  3JTD B;  3PN7 C;  4BY5 A;  1XK4 A;  3O2P A;  1NCX A;  1YVH A;  2MHH A;  1B8L A;  1YRT B;  5G08 A;  2HET A;  2JC2 A;  2JT8 A;  4USL A;  1SL9 A;  1KSM A;  3DD4 A;  2JOJ A;  1J7Q A;  3CWG A;  1GGW A;  4GPL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...