1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN (CALBINDIN D9K)
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
1WRLA 3DVJA 1XFZO 1TCOB 1XYDA 2JZIA 3HX4A 3A8RA 1KFUL 2L51A 1PK0D 1SR6B 2NZ0A 2LMTA 3VGOA 4GBAA 1NCZA 2AUCA 1QX7A 5DKQA 1NP8A 2BCAA 4JWQA 2LMUA 2EHBA 2PMYA 5D7FA 1WDCB 1KSOA 4M2PA 4HREE 1SL8A 2KI4B 2KI6D 5HKWA 5KTYA 1VRKA 1SPYA 1ZOTB 2F33A 1NX2A 2Q91A 1CKKA 3OP0A 4ORBB 3O6BA 1MXLC 2LP3A 5ER4X 1QV1A 3FWBA 3TS5C 1CM4A 1UHKA 3CLNA 3WXAA 2GV5A 1G33A 2KBIA 3AKBA 2M8UA 1PULA 4GGFC 1HT9A 5CPVA 4WRIA 3BUMB 3BQ3A 5HKZA 1N2DA 2I18A 2KFGA 2OS8B 3PATA 4WQ3A 2KOTA 3I5IC 1B7TY 2L0PA 4D1EA 1EL4A 1BG1A 1MWNA 3MSEB 1BR4B 1MF8B 1K9PA 1SRAA 2PSRA 5AFPA 1LVCD 1QIVA 3NXAA 4CIDA 1TCFA 4PHKA 5I8NA 1QJTA 3CTNA 1AJ5A 1CFDA 1QATA 1B7TZ 2LVKA 3SG4A 4C0JA 5DKRA 2QPTA 5HYDA 1SKTA 2ZRTA 4TNCA 1TNPA 2ZN9A 2MRDA 1A29A 1UURA 1QX2A 1J7RA 2LVJA 1CFPA 5FYXA 3O2PA 2ZFDA 5TNCA 1BODA 2JT3A 1ZMZA 4HRHA 1GJYA 3AKAA 1YRUB 1EJ3A 1QTXA 4PHMA 1UHJA 2L50A 2ZNDA 1FBVA 1S3PA 3EK8A 3TZ1A 4Q04A 2H61C 3ZWHA 1M39A 2M0RA 4M2QA 3CS1A 3I5HC 1UWOA 2JTZA 4ZCVA 3PM8A 1BJFA 1SNLA 1L2OB 1K8UA 1IH0A 4DUQA 1LXFC 1ALVA 1WY9A 1NPQA 3VROA 1YX8A 1AJ4A 2JWWA 5KSZA 1PSRA 3PN7B 4MSPA 2HF5A 4GPLB 4MBEA 3C1VA 1YTZC 1A75B 4QJ5B 1TNWA 1CFFA 1KSMA 1KCYA 1EXRA 4R1EA 2K7OA 1XK4A 5AERA 5PALA 1YR5A 2F8PA 1QS7A 1GGWA 1SL7A 1BF5A 4BY4A 1Q80A 3SG5A 1JFKA 4PE7A 2K0JA 4MZKA 5ER5A 1KFUS 2F2OA 2AAOA 4I5LB 3EK7A 3GK1A 1OE9B 1S1EA 2JNXA 4FTGA 1FW4A 2M9GA 3EVVA 3EK4A 1DGUA 1YUUA 3LK1A 1C7VA 4OCIA 3F45A 1SMGA 3NSIA 1NSHA 1YUSA 1J7QA 1F8HA 1RJVA 3FWCA 1QV0A 1A75A 1JF2A 2BBMA 5B8IB 1F55A 3TS5B 1A2XA 1CMFA 1DJXA 1BOCA 1AUIB 1OZSA 1XA5A 2OTGC 1JF0A 2LHIA 1M63B 2LE9B 3JTDC 2JTTA 2Y4QA 5IBWA 2VRGA 1KQMB 1OOJA 3EKHA 1F4QA 1YUTA 2G9BA 1UUSA 3CR4X 1CMGA 1FI5A 3I5IB 1AK8A 2H2KA 1BLQA 1X02A 4OVNF 3NSKA 1N65A 2BE6A 1YURA 2ZNEA 3OB1B 4MLWA 1EG4A 3PFVA 3WHTB 2KQYA 2WORA 4NDCA 1XFXO 3PLFB 2QACA 1DVIA 1QVIZ 2KI6C 2M49B 2GGZA 4E68A 1J7OA 1SL9A 1WLZA 1Y0VH 2NXQA 3BUOB 3CWGA 3KEVA 3OB2B 2JPTA 1RFJA 2ISDA 1FF1A 2LUXA 1JUOA 4N1FA 1M31A 2K7CA 1IG5A 1IJ6A 4GGNA 2FCEA 1QXPA 3BUXB 1BMOA 3KO0A 5HLOA 2MHHA 5CSJA 3BUNB 3TDUA 1LKJA 2HQWA 1B8LA 1DJWA 1J7PA 1DJHA 1OMVA 1CLLA 1SCVA 2PRUA 3CR5X 4ORAB 1AHRA 1XVJA 1S36A 2K7DA 1K95A 1RROA 2GGMA 1KQMC 1SW8A 2KGBC 2KYCA 1IKUA 2KDHA 1B1GA 2HETA 1RWYA 4HRGA 2JXLA 2E30A 5JJGA 1CDLA 1QX5B 1NX0A 2EC6C 2FJUB 3I5HB 1NYAA 1Y1UA 1NUBA 5CSIA 2LV7A 2M7LA 1G8IA 2F2PA 1PSBA 3BUWB 5I2QA 1UHNA 1RECA 2M29A 1TTXA 1KWOC 3EKJA 3JVTB 3KHEA 4DIRA 4YGDB 1OQPA 1KQVA 4PE1A 1IJ5A 2L4HA 3EVRA 4OV2A 3OX5A 3DF0B 3VRRA 1L7ZA 4QJ3B 4XJKB 4MRXA 4CLNA 2AMIA 3I5FC 1ODBA 2KHNA 2EGDA 1S6JA 1G4YR 2OPOA 1SYMA 2LVVA 3BOWB 3IQQA 3A4UB 1DJGA 1M46A 2H61A 1MR8A 2KNEA 1NIWA 2LVIA 4IL1A 4JPZB 2K2FA 4CFQA 1JWDA 4AOMA 3SG6A 1NCYA 1NX3A 1B8RA 2I94A 4ORCB 4PALA 5DKNA 1CDPA 2CCMA 1SBJA 2F3YA 3SG3A 3WHUB 3TUYC 3BYAA 3DVMA 4CPVA 1BU3A 2L4IA 3CR2A 4USLA 3SG7A 2JULA 4GNKB 2M97A 2WCFA 3DVEA 3GK2A 1MUXA 2MLEC 4JQ0D 1DGVA 3CGAA 2LMVA 4MZJA 4C0LA 1YVLA 2BKIB 2LANA 2ZN8A 3FS7A 1F71A 1NX1A 3DF0A 1J1DA 3BXKA 4GAOA 1B8CA 2CT9A 2M7NA 1WLMA 1ZUZA 2LC5A 2LLUA 3LCPC 2OTGB 5AEQA 3JVTC 3JTDB 1IRJA 2COLB 4PCWA 2NCPA 4PHJA 1KFXL 4AQIA 1UHHA 1CNPA 1CLBA 1UHIA 1QLKA 1IWQA 3E3RA 4YGAA 2ZKMX 1J1EA 1V1GA 2KFFA 2L98A 2LM5A 1WRKA 1FPWA 2LLTA 3LK0A 2IS9A 2PVBA 3NSLA 1S26D 3NSOA 1DF0B 1S5GY 1DJZA 1ZFSA 2PALA 4MZLA 4N1GA 2BKHB 1S6CA 1K96A 2JNFA 2Y1MA 2BL0B 3O78A 3O4YA 1TOPA 1MQ1A 2P6BB 5I2OA 1XO5A 5G08A 5KU1A 4WQ2A 4F0ZB 2PASA 5CSFA 3K21A 1YRTB 2WOSA 1F4OA 3VRPA 1SCMC 4C0KA 1K9KA 2I2RE 1QVIY 1PVBA 1S5GZ 2L2EA 2SCPA 1NCXA 2LLSA 4YRUA 1LA0A 4YGBB 1XFWO 2I7AA 4UPGA 2KFHA 1D1OA 1GQMA 1KK7Z 1XK4C 1CLMA 2Y1NA 2BE4A 2D8NA 3H4SE 5J3XA 4DCKA 2EC6B 2R2IA 1F70A 1OSAA 2BCBA 4NDDA 3M0WA 3AAKA 4OKHA 2K7BA 3OHMB 1BT6A 1KWOB 2JXCA 2M1KB 2BL0C 4OR9B 2K8MB 2WC8A 4M2OA 2L5XB 1K93D 1MXEA 4MVFA 2CBLA 2HQ8A 4GGFA 5D69A 3I5FB 3FIAA 1TN4A 4PE0A 1JFJA 1UP5A 2NLNA 3DD4A 2CXJA 5AXIA 4XYNA 4FQOA 1WRZA 3I5GC 5I2LA 2HPSA 1EG3A 3TUYB 2KAXA 4NQGA 2LCPA 4I5KA 4YBHB 1EH2A 2CNPA 4BY5A 3LL8B 1CDNA 4ZCUA 3VRNA 2RGIA 3TDZA 1B47A 3SJSA 1KK8C 2Q4UA 1YVHA 1CDMA 3PSRA 2O5GA 3SIAA 1XFUO 3OX6A 3KF9A 4MN0A 2TN4A 2DOQA 3IF7A 1K2HA 3RM1A 4NDBA 2JT8A 2JOJA 4P5OE 2JU0A 1K90D 1RK9A 1SK6D 2E6WA 2M1UA 3HCMA 2MBXA 1TNXA 2JQ6A 3D10A 1IGVA 3KPXA 3GOFA 4YI8A 1B4CA 1OMDA 1LINA 2KAVA 1TIZA 3ICBA 1DJIA 1V1FA 1LA3A 1SR6C 1KFXS 4N5XA 3SIBA 3AAJA 1QASA 2BECA 1CM1A 1SY9A 4DS7A 1N0YA 2CTNA 4YGEB 1WDCC 4L9MA 1TNQA 2BBNA 2FCDA 4A4BA 1C07A 1GGZA 2KI4C 2WCEA 4PHNA 2Y5IA 1W7JB 3EVUA 1CTRA 1YX7A 1ZACA 1W7IB 2NCOA 1NWDA 3QRXA 5HLVA 3SG2A 1AP4A 1H8BA 2WNDA 1MHOA 2KQ6A 2MA2A 3CZTX 3LLEA 1JBAA 2JC2A 4MRYA 4P2YB 4I5NB 1CFCA 1JC2A 1F54A 2JRFA 2LUCA 2ZRSA 4XJKA 1BR1B 1XFVO 4QJ4B 1OZOA 1SCMB 3TDIA 2WCBA 1DT7B 1ALWA 2KBMA 2O60A 1JSAA 3D0YB 1PVAA 3BOWA 2MLFC 4YI9A 2BCXA 5K89A 4YGCB 4GUKA 5F6TA 1IQ3A 2LAPA 1M45A 1DJYA 1S6IA 2OS8C 2JT0A 5AANA 2MAZA 2V53A 2LHLA 4DRWA 3IQOA 2K61A 1B9AA 4PE4A 3DVKA 5HKYA 2A4JA 4U8DA 1FI6A 1C7WA 2LNKA 1R6PA 3D0YA 4CFRA 5CSNA 1E8AA 1A4PA 1KK7Y 1HQVA 1U5IB 2G2BA 4ICBA 4GFTA 4HSZA 3GK4X 5JOLA 3ZNIA 1OMRA 1QLSA 3RLZA 2K2AA 3PALA 1XFYO 3I5GB 2SASA 1AVSA 1J55A 2KSPA 1CB1A 4I5JA 1R2UA 1QIWA 3VRQA 1DF0A 2KGRA 1Y6WA 1PALA 1H4BA 1K94A 4A4CA 4AQJA 4ETOA 1PRWA 2LP2A 5GQQC 1KK8B 1A03A 1RTP1 2MJWB 2FOTA 1TRFA 4MEWA 4PDZA 1U5IA 1DMOA 1L2OC 1DTLA 2M3WA 1Y1AA 5BPJA 2F3ZA 1IQ5A 2B1UA 1K9UA 2KAYA 3PN7C 1Y1XA 2KYFA 3WNXB
chains in the Genus database with same CATH superfamily
1WRLA 3DVJA 1XFZO 1DQEA 3BJHA 1TCOB 1XYDA 2JZIA 3HX4A 3A8RA 1KFUL 2L51A 1PK0D 1SR6B 2NZ0A 2LMTA 5FI2A 3FE9A 3VGOA 4GBAA 3D73A 1NCZA 2AUCA 1QX7A 5DKQA 1NP8A 2BCAA 4JWQA 2LMUA 2EHBA 4INWA 2PMYA 5D7FA 3L4AA 1WDCB 1KSOA 4M2PA 4HREE 1SL8A 2KI4B 2KI6D 3R1VA 5HKWA 1XFRA 5KTYA 1VRKA 1SPYA 1ZOTB 2F33A 1NX2A 2Q91A 2L2CA 1CKKA 3OP0A 4ORBB 3O6BA 1MXLC 2LP3A 5ER4X 1QV1A 1SSEB 3FWBA 3TS5C 2KLDA 3PM2A 1CM4A 3UNWA 1UHKA 2WCLA 3CLNA 3WXAA 2GV5A 1G33A 2KBIA 3AKBA 2M8UA 1PULA 4GGFC 1HT9A 5CPVA 4WRIA 3BUMB 3BQ3A 5HKZA 1N2DA 2I18A 2KFGA 2OS8B 3PATA 4WQ3A 2KOTA 3I5IC 1B7TY 2L0PA 4D1EA 2K60A 1EL4A 3CABA 1BG1A 1MWNA 3BFAA 3MSEB 2JPOA 1BR4B 1ORGA 1MF8B 1K9PA 1SRAA 4INXA 2PSRA 4JD9A 5AFPA 1LVCD 3R1PA 1QIVA 3NXAA 1W9ZA 4CIDA 1TCFA 4PHKA 2PQLA 5I8NA 1QJTA 3CTNA 1AJ5A 1CFDA 1QATA 1B7TZ 2LVKA 2YGUA 3SG4A 3EG5B 5DICA 4C0JA 5DKRA 2QPTA 5HYDA 2WC6A 1SKTA 2ZRTA 4TNCA 1TNPA 2ZN9A 2MRDA 1A29A 1UURA 2QEOA 2ERBA 1QX2A 1J7RA 2LVJA 1CFPA 5FYXA 3O2PA 2ZFDA 5TNCA 1BODA 2JT3A 1ZMZA 4HRHA 3UO9A 1GJYA 3AKAA 1YRUB 1EJ3A 1QTXA 2WCKA 4PHMA 1UHJA 2L50A 2ZNDA 1FBVA 1S3PA 3EK8A 3TZ1A 4Q04A 2H61C 3ZWHA 3B7AA 1M39A 2M0RA 4M2QA 3CS1A 3I5HC 1UWOA 2JTZA 4ZCVA 3PM8A 1BJFA 3D77A 1SNLA 1L2OB 1K8UA 1IH0A 4DUQA 1LXFC 1ALVA 4PT1A 1WY9A 3K1EA 4JKTA 3NHTA 4AOMA 1NPQA 3VROA 1YX8A 1AJ4A 2JWWA 5KSZA 1PSRA 3PN7B 4MSPA 2HF5A 4GPLB 4MBEA 3C1VA 1YTZC 1A75B 4QJ5B 3O4XA 1TNWA 1CFFA 1KSMA 1KCYA 1EXRA 4R1EA 2K7OA 1XK4A 5AERA 3CDNA 5PALA 3B86A 1YR5A 2F8PA 1QS7A 1GGWA 1SL7A 1BF5A 4BY4A 1Q80A 3SG5A 1JFKA 4PE7A 2K0JA 3CZ1A 4MZKA 5ER5A 1KFUS 2F2OA 2AAOA 4I5LB 3EK7A 3GK1A 1OE9B 1S1EA 2JNXA 4FTGA 1FW4A 2M9GA 3EVVA 3EK4A 1DGUA 1YUUA 3DY9A 3LK1A 1C7VA 4OCIA 3F45A 1SMGA 3NSIA 1NSHA 1YUSA 1J7QA 1F8HA 1RJVA 3FWCA 1QV0A 1A75A 1JF2A 2BBMA 5B8IB 1F55A 3TS5B 1A2XA 1CMFA 1DJXA 1BOCA 1AUIB 1OZSA 1XA5A 2OTGC 1JF0A 2LHIA 1M63B 2LE9B 3JTDC 3NHIA 2JTTA 2Y4QA 5IBWA 2VRGA 1KQMB 1OOJA 3EKHA 1F4QA 1YUTA 2G9BA 1UUSA 3CR4X 1CMGA 1FI5A 3I5IB 1AK8A 2H2KA 1BLQA 1C3YA 1X02A 4OVNF 3NSKA 5HL1A 1N65A 2BE6A 1YURA 2ZNEA 3OB1B 4KYNA 1EG4A 3PFVA 2BNXA 4MLWA 3SS4A 2KQYA 2PYQA 2WORA 4NDCA 1XFXO 3WHTB 3PLFB 2QACA 1DVIA 1QVIZ 2KI6C 2L5YA 2GGZA 2M49B 4E68A 1J7OA 1SL9A 2H8VA 1WLZA 1Y0VH 2NXQA 3BUOB 3CWGA 2FJYA 3KEVA 2JPTA 1RFJA 3OB2B 2ISDA 1FF1A 2LUXA 1JUOA 4N1FA 1M31A 2K7CA 1IG5A 1IJ6A 2BAPA 4GGNA 3PJIA 2FCEA 1QXPA 3BUXB 1BMOA 3KO0A 5HLOA 2MHHA 5CSJA 3BUNB 3TDUA 1LKJA 2HQWA 1B8LA 1DJWA 1J7PA 1DJHA 1OOHA 1OMVA 1CLLA 1SCVA 2PRUA 3CR5X 4ORAB 1AHRA 1XVJA 1S36A 2K7DA 1K95A 1RROA 2GGMA 1KQMC 1SW8A 2KGBC 2KYCA 1IKUA 2KDHA 1B1GA 2HETA 5D3OA 1RWYA 4HRGA 2JXLA 2E30A 5JJGA 1CDLA 1QX5B 1NX0A 2EC6C 2FJUB 3I5HB 1NYAA 1Y1UA 1NUBA 5CSIA 2LV7A 2M7LA 1G8IA 3S0FA 2F2PA 1PSBA 3BUWB 5I2QA 1UHNA 1RECA 2M29A 1TTXA 1KWOC 3S0AA 3EKJA 3JVTB 3KHEA 4DIRA 4YGDB 1OQPA 1KQVA 4PE1A 1IJ5A 2L4HA 3EVRA 4OV2A 2KPHA 3DF0B 3OX5A 3VRRA 1L7ZA 4QJ3B 4XJKB 4MRXA 4CLNA 2AMIA 3I5FC 1ODBA 2KHNA 2EGDA 1S6JA 1G4YR 2OPOA 1SYMA 2LVVA 3BOWB 3IQQA 3A4UB 1DJGA 1M46A 2H61A 1MR8A 2KNEA 1NIWA 2LVIA 4IL1A 4IJ7A 3CYZA 2K2FA 4JPZB 4CFQA 1JWDA 1OOGA 1DEKA 3SG6A 1NCYA 1NX3A 1B8RA 2I94A 4ORCB 4PALA 5DKNA 1CDPA 2CCMA 1SBJA 2F3YA 2QEVA 3SG3A 3WHUB 3TUYC 3BYAA 3DVMA 4CPVA 1BU3A 2L4IA 3CR2A 2WCHA 4USLA 3SG7A 2JULA 3BFBA 4F7FA 4GNKB 2M97A 2WCFA 3DVEA 3GK2A 1MUXA 2MLEC 4JQ0D 1DGVA 3CGAA 2LMVA 4MZJA 4C0LA 1YVLA 2BKIB 2LANA 2ZN8A 3DZTA 3FS7A 1F71A 1NX1A 3DF0A 3D78A 1J1DA 3BXKA 4GAOA 1B8CA 2CT9A 2M7NA 1WLMA 1ZUZA 2LC5A 2LLUA 3LCPC 2OTGB 5AEQA 2QEHA 3JVTC 3JTDB 1IRJA 2COLB 4PCWA 2NCPA 4PHJA 1KFXL 4AQIA 1UHHA 1CNPA 1CLBA 1UHIA 1QLKA 1IWQA 3E3RA 4YGAA 3NGVA 2ZKMX 1J1EA 1V1GA 2KFFA 2L98A 2LM5A 1WRKA 3S0GA 1FPWA 2LLTA 2KLEA 3LK0A 2IS9A 2PVBA 3NSLA 1S26D 3NSOA 1DF0B 1S5GY 1DJZA 1ZFSA 2PALA 4FQTA 4MZLA 4N1GA 2BKHB 1S6CA 1K96A 2JNFA 2Y1MA 3D74A 2BL0B 3VB1A 3O78A 3O4YA 1TOPA 1MQ1A 2P6BB 5I2OA 1XO5A 5G08A 5KU1A 4WQ2A 3CZ0A 2PASA 3DXLA 4F0ZB 5CSFA 3K21A 1YRTB 2WOSA 1F4OA 3VRPA 1SCMC 4C0KA 1K9KA 2I2RE 1QVIY 3D75A 1PVBA 1S5GZ 2L2EA 2SCPA 1NCXA 2LLSA 3B87A 4YRUA 1LA0A 4YGBB 1XFWO 2I7AA 4UPGA 2KFHA 1D1OA 1GQMA 1KK7Z 1XK4C 1CLMA 2Y1NA 2BE4A 2D8NA 3H4SE 5J3XA 4DCKA 2EC6B 2R2IA 1F70A 1OSAA 2BCBA 4NDDA 3M0WA 3FE6A 3AAKA 4OKHA 2K7BA 3OHMB 1BT6A 1KWOB 2JXCA 2M1KB 2BL0C 4OR9B 2K8MB 2WC8A 4M2OA 3BFHA 2L5XB 1K93D 1MXEA 4MVFA 2CBLA 2HQ8A 4GGFA 5D69A 3I5FB 3V2LA 3FIAA 1TN4A 5I94A 4PE0A 1JFJA 1UP5A 2NLNA 3DD4A 2CXJA 1TUJA 5AXIA 4XYNA 4FQOA 1TUZA 1WRZA 3I5GC 5I2LA 2HPSA 1EG3A 1P28A 3TUYB 3SS5A 2KAXA 4NQGA 2LCPA 4I5KA 4YBHB 1EH2A 3S0DA 2CNPA 2WCMA 4BY5A 3LL8B 1DC1A 1CDNA 4ZCUA 3VRNA 1Z2CB 2RGIA 3TDZA 1B47A 3SJSA 1KK8C 2Q4UA 1YVHA 1CDMA 2WC5A 1C3ZA 3IVTA 3PSRA 2O5GA 3SIAA 1XFUO 3OX6A 3KF9A 2WCJA 1IIOA 4MN0A 2TN4A 3RZSA 2DOQA 3IF7A 1K2HA 3RM1A 4NDBA 2JT8A 2JOJA 4P5OE 2JU0A 1K90D 1RK9A 3OGNA 1SK6D 2E6WA 2M1UA 1OOIX 3HCMA 2MBXA 1TNXA 2JQ6A 3D10A 2P71A 1IGVA 3KPXA 3GOFA 4YI8A 1B4CA 1OMDA 1LINA 2KAVA 1TIZA 3ICBA 1DJIA 1V1FA 1LA3A 1SR6C 1KFXS 4N5XA 2P70A 3AAJA 3SIBA 1QASA 2BECA 1CM1A 1SY9A 4DS7A 1N0YA 2CTNA 3DYEA 4YGEB 1WDCC 3L4LA 4L9MA 3SS3A 1TNQA 2BBNA 2FCDA 4A4BA 1C07A 1GGZA 2KI4C 2WCEA 4PHNA 2Y5IA 1W7JB 3EVUA 1CTRA 1YX7A 1ZACA 1W7IB 2NCOA 1NWDA 3N7HA 3QRXA 5HLVA 3SG2A 1AP4A 2WNDA 1H8BA 1MHOA 2KQ6A 2MA2A 3CZTX 3LLEA 1JBAA 2JC2A 4MRYA 4P2YB 4I5NB 1CFCA 1JC2A 1F54A 2JRFA 2LUCA 2ZRSA 3D76A 4XJKA 1BR1B 1XFVO 4QJ4B 1OZOA 1OOFA 1SCMB 2WCBA 3TDIA 1QWVA 1ALWA 2KBMA 2O60A 1DT7B 5FI6A 3D0YB 1JSAA 1PVAA 3BOWA 3S0BA 2MLFC 4YI9A 2BCXA 5K89A 3QMEA 2QEBA 4GUKA 4YGCB 5F6TA 1IQ3A 2LAPA 1M45A 1DJYA 1S6IA 2OS8C 3S0EA 2JT0A 3B6XA 5AANA 2MAZA 2V53A 2LHLA 4DRWA 1Z4HA 3IQOA 3L47A 2K61A 3CZ2A 1B9AA 4PE4A 3DVKA 3R72A 5HKYA 2A4JA 4U8DA 1FI6A 1TWOA 1C7WA 2LNKA 1R6PA 3FE8A 3D0YA 4CFRA 5CSNA 1E8AA 1A4PA 1KK7Y 1HQVA 1U5IB 2G2BA 4ICBA 4GFTA 4HSZA 3GK4X 5JOLA 3OBVA 3ZNIA 1OMRA 1QLSA 3RLZA 1GM0A 2K2AA 3PALA 1XFYO 3I5GB 2SASA 1AVSA 1J55A 2KSPA 1T14A 1CB1A 4I5JA 3B88A 3R1OA 1R2UA 1QIWA 1LS8A 3VRQA 1DF0A 2KGRA 1Y6WA 1PALA 1H4BA 1K94A 4A4CA 4AQJA 4ETOA 1OW4A 1PRWA 2LP2A 5GQQC 1KK8B 1A03A 1RTP1 2MJWB 4OZDA 5FI7A 2FOTA 1TRFA 4MEWA 4PDZA 1DELA 1U5IA 1DMOA 1L2OC 1DTLA 2M3WA 1Y1AA 5BPJA 2F3ZA 1IQ5A 2GTEA 2B1UA 1K9UA 2KAYA 3PN7C 1Y1XA 3Q8IA 2KYFA 2QDIA 3WNXB 5EL2A
chains in the Genus database with same CATH topology
1WRLA 3DVJA 1XFZO 1TCOB 1XYDA 2JZIA 3HX4A 3A8RA 1KFUL 2L51A 1PK0D 1SR6B 2NZ0A 2LMTA 3VGOA 4GBAA 1NCZA 2AUCA 1QX7A 5DKQA 1NP8A 2BCAA 4JWQA 2LMUA 2EHBA 2PMYA 5D7FA 1WDCB 1KSOA 4M2PA 4HREE 1SL8A 2KI4B 2KI6D 5HKWA 5KTYA 1VRKA 1SPYA 1ZOTB 2F33A 1NX2A 2Q91A 1CKKA 3OP0A 4ORBB 3O6BA 1MXLC 2LP3A 5ER4X 1QV1A 3FWBA 3TS5C 1CM4A 1UHKA 3CLNA 3WXAA 2GV5A 1G33A 2KBIA 3AKBA 2M8UA 1PULA 4GGFC 1HT9A 5CPVA 4WRIA 3BUMB 3BQ3A 5HKZA 1N2DA 2I18A 2KFGA 2OS8B 3PATA 4WQ3A 2KOTA 3I5IC 1B7TY 2L0PA 4D1EA 1EL4A 1BG1A 1MWNA 3MSEB 1BR4B 1MF8B 1K9PA 1SRAA 2PSRA 5AFPA 1LVCD 1QIVA 3NXAA 4CIDA 1TCFA 4PHKA 5I8NA 1QJTA 3CTNA 1AJ5A 1CFDA 1QATA 1B7TZ 2LVKA 3SG4A 4C0JA 5DKRA 2QPTA 5HYDA 1SKTA 2ZRTA 4TNCA 1TNPA 2ZN9A 2MRDA 1A29A 1UURA 1QX2A 1J7RA 2LVJA 1CFPA 5FYXA 3O2PA 2ZFDA 5TNCA 1BODA 2JT3A 1ZMZA 4HRHA 1GJYA 3AKAA 1YRUB 1EJ3A 1QTXA 4PHMA 1UHJA 2L50A 2ZNDA 1FBVA 1S3PA 3EK8A 3TZ1A 4Q04A 2H61C 3ZWHA 1M39A 2M0RA 4M2QA 3CS1A 3I5HC 1UWOA 2JTZA 4ZCVA 3PM8A 1BJFA 1SNLA 1L2OB 1K8UA 1IH0A 4DUQA 1LXFC 1ALVA 1WY9A 1NPQA 3VROA 1YX8A 1AJ4A 2JWWA 5KSZA 1PSRA 3PN7B 4MSPA 2HF5A 4GPLB 4MBEA 3C1VA 1YTZC 1A75B 4QJ5B 1TNWA 1CFFA 1KSMA 1KCYA 1EXRA 4R1EA 2K7OA 1XK4A 5AERA 5PALA 1YR5A 2F8PA 1QS7A 1GGWA 1SL7A 1BF5A 4BY4A 1Q80A 3SG5A 1JFKA 4PE7A 2K0JA 4MZKA 5ER5A 1KFUS 2F2OA 2AAOA 4I5LB 3EK7A 3GK1A 1OE9B 1S1EA 2JNXA 4FTGA 1FW4A 2M9GA 3EVVA 3EK4A 1DGUA 1YUUA 3LK1A 1C7VA 4OCIA 3F45A 1SMGA 3NSIA 1NSHA 1YUSA 1J7QA 1F8HA 1RJVA 3FWCA 1QV0A 1A75A 1JF2A 2BBMA 5B8IB 1F55A 3TS5B 1A2XA 1CMFA 1DJXA 1BOCA 1AUIB 1OZSA 1XA5A 2OTGC 1JF0A 2LHIA 1M63B 2LE9B 3JTDC 2JTTA 2Y4QA 5IBWA 2VRGA 1KQMB 1OOJA 3EKHA 1F4QA 1YUTA 2G9BA 1UUSA 3CR4X 1CMGA 1FI5A 3I5IB 1AK8A 2H2KA 1BLQA 1X02A 4OVNF 3NSKA 1N65A 2BE6A 1YURA 2ZNEA 3OB1B 4MLWA 1EG4A 3PFVA 3WHTB 2KQYA 2WORA 4NDCA 1XFXO 3PLFB 2QACA 1DVIA 1QVIZ 2KI6C 2M49B 2GGZA 4E68A 1J7OA 1SL9A 1WLZA 1Y0VH 2NXQA 3BUOB 3CWGA 3KEVA 3OB2B 2JPTA 1RFJA 2ISDA 1FF1A 2LUXA 1JUOA 4N1FA 1M31A 2K7CA 1IG5A 1IJ6A 4GGNA 2FCEA 1QXPA 3BUXB 1BMOA 3KO0A 5HLOA 2MHHA 5CSJA 3BUNB 3TDUA 1LKJA 2HQWA 1B8LA 1DJWA 1J7PA 1DJHA 1OMVA 1CLLA 1SCVA 2PRUA 3CR5X 4ORAB 1AHRA 1XVJA 1S36A 2K7DA 1K95A 1RROA 2GGMA 1KQMC 1SW8A 2KGBC 2KYCA 1IKUA 2KDHA 1B1GA 2HETA 1RWYA 4HRGA 2JXLA 2E30A 5JJGA 1CDLA 1QX5B 1NX0A 2EC6C 2FJUB 3I5HB 1NYAA 1Y1UA 1NUBA 5CSIA 2LV7A 2M7LA 1G8IA 2F2PA 1PSBA 3BUWB 5I2QA 1UHNA 1RECA 2M29A 1TTXA 1KWOC 3EKJA 3JVTB 3KHEA 4DIRA 4YGDB 1OQPA 1KQVA 4PE1A 1IJ5A 2L4HA 3EVRA 4OV2A 3OX5A 3DF0B 3VRRA 1L7ZA 4QJ3B 4XJKB 4MRXA 4CLNA 2AMIA 3I5FC 1ODBA 2KHNA 2EGDA 1S6JA 1G4YR 2OPOA 1SYMA 2LVVA 3BOWB 3IQQA 3A4UB 1DJGA 1M46A 2H61A 1MR8A 2KNEA 1NIWA 2LVIA 4IL1A 4JPZB 2K2FA 4CFQA 1JWDA 4AOMA 3SG6A 1NCYA 1NX3A 1B8RA 2I94A 4ORCB 4PALA 5DKNA 1CDPA 2CCMA 1SBJA 2F3YA 3SG3A 3WHUB 3TUYC 3BYAA 3DVMA 4CPVA 1BU3A 2L4IA 3CR2A 4USLA 3SG7A 2JULA 4GNKB 2M97A 2WCFA 3DVEA 3GK2A 1MUXA 2MLEC 4JQ0D 1DGVA 3CGAA 2LMVA 4MZJA 4C0LA 1YVLA 2BKIB 2LANA 2ZN8A 3FS7A 1F71A 1NX1A 3DF0A 1J1DA 3BXKA 4GAOA 1B8CA 2CT9A 2M7NA 1WLMA 1ZUZA 2LC5A 2LLUA 3LCPC 2OTGB 5AEQA 3JVTC 3JTDB 1IRJA 2COLB 4PCWA 2NCPA 4PHJA 1KFXL 4AQIA 1UHHA 1CNPA 1CLBA 1UHIA 1QLKA 1IWQA 3E3RA 4YGAA 2ZKMX 1J1EA 1V1GA 2KFFA 2L98A 2LM5A 1WRKA 1FPWA 2LLTA 3LK0A 2IS9A 2PVBA 3NSLA 1S26D 3NSOA 1DF0B 1S5GY 1DJZA 1ZFSA 2PALA 4MZLA 4N1GA 2BKHB 1S6CA 1K96A 2JNFA 2Y1MA 2BL0B 3O78A 3O4YA 1TOPA 1MQ1A 2P6BB 5I2OA 1XO5A 5G08A 5KU1A 4WQ2A 4F0ZB 2PASA 5CSFA 3K21A 1YRTB 2WOSA 1F4OA 3VRPA 1SCMC 4C0KA 1K9KA 2I2RE 1QVIY 1PVBA 1S5GZ 2L2EA 2SCPA 1NCXA 2LLSA 4YRUA 1LA0A 4YGBB 1XFWO 2I7AA 4UPGA 2KFHA 1D1OA 1GQMA 1KK7Z 1XK4C 1CLMA 2Y1NA 2BE4A 2D8NA 3H4SE 5J3XA 4DCKA 2EC6B 2R2IA 1F70A 1OSAA 2BCBA 4NDDA 3M0WA 3AAKA 4OKHA 2K7BA 3OHMB 1BT6A 1KWOB 2JXCA 2M1KB 2BL0C 4OR9B 2K8MB 2WC8A 4M2OA 2L5XB 1K93D 1MXEA 4MVFA 2CBLA 2HQ8A 4GGFA 5D69A 3I5FB 3FIAA 1TN4A 4PE0A 1JFJA 1UP5A 2NLNA 3DD4A 2CXJA 5AXIA 4XYNA 4FQOA 1WRZA 3I5GC 5I2LA 2HPSA 1EG3A 3TUYB 2KAXA 4NQGA 2LCPA 4I5KA 4YBHB 1EH2A 2CNPA 4BY5A 3LL8B 1CDNA 4ZCUA 3VRNA 2RGIA 3TDZA 1B47A 3SJSA 1KK8C 2Q4UA 1YVHA 1CDMA 3PSRA 2O5GA 3SIAA 1XFUO 3OX6A 3KF9A 4MN0A 2TN4A 2DOQA 3IF7A 1K2HA 3RM1A 4NDBA 2JT8A 2JOJA 4P5OE 2JU0A 1K90D 1RK9A 1SK6D 2E6WA 2M1UA 3HCMA 2MBXA 1TNXA 2JQ6A 3D10A 1IGVA 3KPXA 3GOFA 4YI8A 1B4CA 1OMDA 1LINA 2KAVA 1TIZA 3ICBA 1DJIA 1V1FA 1LA3A 1SR6C 1KFXS 4N5XA 3SIBA 3AAJA 1QASA 2BECA 1CM1A 1SY9A 4DS7A 1N0YA 2CTNA 4YGEB 1WDCC 4L9MA 1TNQA 2BBNA 2FCDA 4A4BA 1C07A 1GGZA 2KI4C 2WCEA 4PHNA 2Y5IA 1W7JB 3EVUA 1CTRA 1YX7A 1ZACA 1W7IB 2NCOA 1NWDA 3QRXA 5HLVA 3SG2A 1AP4A 1H8BA 2WNDA 1MHOA 2KQ6A 2MA2A 3CZTX 3LLEA 1JBAA 2JC2A 4MRYA 4P2YB 4I5NB 1CFCA 1JC2A 1F54A 2JRFA 2LUCA 2ZRSA 4XJKA 1BR1B 1XFVO 4QJ4B 1OZOA 1SCMB 3TDIA 2WCBA 1DT7B 1ALWA 2KBMA 2O60A 1JSAA 3D0YB 1PVAA 3BOWA 2MLFC 4YI9A 2BCXA 5K89A 4YGCB 4GUKA 5F6TA 1IQ3A 2LAPA 1M45A 1DJYA 1S6IA 2OS8C 2JT0A 5AANA 2MAZA 2V53A 2LHLA 4DRWA 3IQOA 2K61A 1B9AA 4PE4A 3DVKA 5HKYA 2A4JA 4U8DA 1FI6A 1C7WA 2LNKA 1R6PA 3D0YA 4CFRA 5CSNA 1E8AA 1A4PA 1KK7Y 1HQVA 1U5IB 2G2BA 4ICBA 4GFTA 4HSZA 3GK4X 5JOLA 3ZNIA 1OMRA 1QLSA 3RLZA 2K2AA 3PALA 1XFYO 3I5GB 2SASA 1AVSA 1J55A 2KSPA 1CB1A 4I5JA 1R2UA 1QIWA 3VRQA 1DF0A 2KGRA 1Y6WA 1PALA 1H4BA 1K94A 4A4CA 4AQJA 4ETOA 1PRWA 2LP2A 5GQQC 1KK8B 1A03A 1RTP1 2MJWB 2FOTA 1TRFA 4MEWA 4PDZA 1U5IA 1DMOA 1L2OC 1DTLA 2M3WA 1Y1AA 5BPJA 2F3ZA 1IQ5A 2B1UA 1K9UA 2KAYA 3PN7C 1Y1XA 2KYFA 3WNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRL A;  3DVJ A;  1XFZ O;  1TCO B;  1XYD A;  2JZI A;  3HX4 A;  3A8R A;  1KFU L;  2L51 A;  1PK0 D;  1SR6 B;  2NZ0 A;  2LMT A;  3VGO A;  4GBA A;  1NCZ A;  2AUC A;  1QX7 A;  5DKQ A;  1NP8 A;  2BCA A;  4JWQ A;  2LMU A;  2EHB A;  2PMY A;  5D7F A;  1WDC B;  1KSO A;  4M2P A;  4HRE E;  1SL8 A;  2KI4 B;  2KI6 D;  5HKW A;  5KTY A;  1VRK A;  1SPY A;  1ZOT B;  2F33 A;  1NX2 A;  2Q91 A;  1CKK A;  3OP0 A;  4ORB B;  3O6B A;  1MXL C;  2LP3 A;  5ER4 X;  1QV1 A;  3FWB A;  3TS5 C;  1CM4 A;  1UHK A;  3CLN A;  3WXA A;  2GV5 A;  1G33 A;  2KBI A;  3AKB A;  2M8U A;  1PUL A;  4GGF C;  1HT9 A;  5CPV A;  4WRI A;  3BUM B;  3BQ3 A;  5HKZ A;  1N2D A;  2I18 A;  2KFG A;  2OS8 B;  3PAT A;  4WQ3 A;  2KOT A;  3I5I C;  1B7T Y;  2L0P A;  4D1E A;  1EL4 A;  1BG1 A;  1MWN A;  3MSE B;  1BR4 B;  1MF8 B;  1K9P A;  1SRA A;  2PSR A;  5AFP A;  1LVC D;  1QIV A;  3NXA A;  4CID A;  1TCF A;  4PHK A;  5I8N A;  1QJT A;  3CTN A;  1AJ5 A;  1CFD A;  1QAT A;  1B7T Z;  2LVK A;  3SG4 A;  4C0J A;  5DKR A;  2QPT A;  5HYD A;  1SKT A;  2ZRT A;  4TNC A;  1TNP A;  2ZN9 A;  2MRD A;  1A29 A;  1UUR A;  1QX2 A;  1J7R A;  2LVJ A;  1CFP A;  5FYX A;  3O2P A;  2ZFD A;  5TNC A;  1BOD A;  2JT3 A;  1ZMZ A;  4HRH A;  1GJY A;  3AKA A;  1YRU B;  1EJ3 A;  1QTX A;  4PHM A;  1UHJ A;  2L50 A;  2ZND A;  1FBV A;  1S3P A;  3EK8 A;  3TZ1 A;  4Q04 A;  2H61 C;  3ZWH A;  1M39 A;  2M0R A;  4M2Q A;  3CS1 A;  3I5H C;  1UWO A;  2JTZ A;  4ZCV A;  3PM8 A;  1BJF A;  1SNL A;  1L2O B;  1K8U A;  1IH0 A;  4DUQ A;  1LXF C;  1ALV A;  1WY9 A;  1NPQ A;  3VRO A;  1YX8 A;  1AJ4 A;  2JWW A;  5KSZ A;  1PSR A;  3PN7 B;  4MSP A;  2HF5 A;  4GPL B;  4MBE A;  3C1V A;  1YTZ C;  1A75 B;  4QJ5 B;  1TNW A;  1CFF A;  1KSM A;  1KCY A;  1EXR A;  4R1E A;  2K7O A;  1XK4 A;  5AER A;  5PAL A;  1YR5 A;  2F8P A;  1QS7 A;  1GGW A;  1SL7 A;  1BF5 A;  4BY4 A;  1Q80 A;  3SG5 A;  1JFK A;  4PE7 A;  2K0J A;  4MZK A;  5ER5 A;  1KFU S;  2F2O A;  2AAO A;  4I5L B;  3EK7 A;  3GK1 A;  1OE9 B;  1S1E A;  2JNX A;  4FTG A;  1FW4 A;  2M9G A;  3EVV A;  3EK4 A;  1DGU A;  1YUU A;  3LK1 A;  1C7V A;  4OCI A;  3F45 A;  1SMG A;  3NSI A;  1NSH A;  1YUS A;  1J7Q A;  1F8H A;  1RJV A;  3FWC A;  1QV0 A;  1A75 A;  1JF2 A;  2BBM A;  5B8I B;  1F55 A;  3TS5 B;  1A2X A;  1CMF A;  1DJX A;  1BOC A;  1AUI B;  1OZS A;  1XA5 A;  2OTG C;  1JF0 A;  2LHI A;  1M63 B;  2LE9 B;  3JTD C;  2JTT A;  2Y4Q A;  5IBW A;  2VRG A;  1KQM B;  1OOJ A;  3EKH A;  1F4Q A;  1YUT A;  2G9B A;  1UUS A;  3CR4 X;  1CMG A;  1FI5 A;  3I5I B;  1AK8 A;  2H2K A;  1BLQ A;  1X02 A;  4OVN F;  3NSK A;  1N65 A;  2BE6 A;  1YUR A;  2ZNE A;  3OB1 B;  4MLW A;  1EG4 A;  3PFV A;  3WHT B;  2KQY A;  2WOR A;  4NDC A;  1XFX O;  3PLF B;  2QAC A;  1DVI A;  1QVI Z;  2KI6 C;  2M49 B;  2GGZ A;  4E68 A;  1J7O A;  1SL9 A;  1WLZ A;  1Y0V H;  2NXQ A;  3BUO B;  3CWG A;  3KEV A;  3OB2 B;  2JPT A;  1RFJ A;  2ISD A;  1FF1 A;  2LUX A;  1JUO A;  4N1F A;  1M31 A;  2K7C A;  1IG5 A;  1IJ6 A;  4GGN A;  2FCE A;  1QXP A;  3BUX B;  1BMO A;  3KO0 A;  5HLO A;  2MHH A;  5CSJ A;  3BUN B;  3TDU A;  1LKJ A;  2HQW A;  1B8L A;  1DJW A;  1J7P A;  1DJH A;  1OMV A;  1CLL A;  1SCV A;  2PRU A;  3CR5 X;  4ORA B;  1AHR A;  1XVJ A;  1S36 A;  2K7D A;  1K95 A;  1RRO A;  2GGM A;  1KQM C;  1SW8 A;  2KGB C;  2KYC A;  1IKU A;  2KDH A;  1B1G A;  2HET A;  1RWY A;  4HRG A;  2JXL A;  2E30 A;  5JJG A;  1CDL A;  1QX5 B;  1NX0 A;  2EC6 C;  2FJU B;  3I5H B;  1NYA A;  1Y1U A;  1NUB A;  5CSI A;  2LV7 A;  2M7L A;  1G8I A;  2F2P A;  1PSB A;  3BUW B;  5I2Q A;  1UHN A;  1REC A;  2M29 A;  1TTX A;  1KWO C;  3EKJ A;  3JVT B;  3KHE A;  4DIR A;  4YGD B;  1OQP A;  1KQV A;  4PE1 A;  1IJ5 A;  2L4H A;  3EVR A;  4OV2 A;  3OX5 A;  3DF0 B;  3VRR A;  1L7Z A;  4QJ3 B;  4XJK B;  4MRX A;  4CLN A;  2AMI A;  3I5F C;  1ODB A;  2KHN A;  2EGD A;  1S6J A;  1G4Y R;  2OPO A;  1SYM A;  2LVV A;  3BOW B;  3IQQ A;  3A4U B;  1DJG A;  1M46 A;  2H61 A;  1MR8 A;  2KNE A;  1NIW A;  2LVI A;  4IL1 A;  4JPZ B;  2K2F A;  4CFQ A;  1JWD A;  4AOM A;  3SG6 A;  1NCY A;  1NX3 A;  1B8R A;  2I94 A;  4ORC B;  4PAL A;  5DKN A;  1CDP A;  2CCM A;  1SBJ A;  2F3Y A;  3SG3 A;  3WHU B;  3TUY C;  3BYA A;  3DVM A;  4CPV A;  1BU3 A;  2L4I A;  3CR2 A;  4USL A;  3SG7 A;  2JUL A;  4GNK B;  2M97 A;  2WCF A;  3DVE A;  3GK2 A;  1MUX A;  2MLE C;  4JQ0 D;  1DGV A;  3CGA A;  2LMV A;  4MZJ A;  4C0L A;  1YVL A;  2BKI B;  2LAN A;  2ZN8 A;  3FS7 A;  1F71 A;  1NX1 A;  3DF0 A;  1J1D A;  3BXK A;  4GAO A;  1B8C A;  2CT9 A;  2M7N A;  1WLM A;  1ZUZ A;  2LC5 A;  2LLU A;  3LCP C;  2OTG B;  5AEQ A;  3JVT C;  3JTD B;  1IRJ A;  2COL B;  4PCW A;  2NCP A;  4PHJ A;  1KFX L;  4AQI A;  1UHH A;  1CNP A;  1CLB A;  1UHI A;  1QLK A;  1IWQ A;  3E3R A;  4YGA A;  2ZKM X;  1J1E A;  1V1G A;  2KFF A;  2L98 A;  2LM5 A;  1WRK A;  1FPW A;  2LLT A;  3LK0 A;  2IS9 A;  2PVB A;  3NSL A;  1S26 D;  3NSO A;  1DF0 B;  1S5G Y;  1DJZ A;  1ZFS A;  2PAL A;  4MZL A;  4N1G A;  2BKH B;  1S6C A;  1K96 A;  2JNF A;  2Y1M A;  2BL0 B;  3O78 A;  3O4Y A;  1TOP A;  1MQ1 A;  2P6B B;  5I2O A;  1XO5 A;  5G08 A;  5KU1 A;  4WQ2 A;  4F0Z B;  2PAS A;  5CSF A;  3K21 A;  1YRT B;  2WOS A;  1F4O A;  3VRP A;  1SCM C;  4C0K A;  1K9K A;  2I2R E;  1QVI Y;  1PVB A;  1S5G Z;  2L2E A;  2SCP A;  1NCX A;  2LLS A;  4YRU A;  1LA0 A;  4YGB B;  1XFW O;  2I7A A;  4UPG A;  2KFH A;  1D1O A;  1GQM A;  1KK7 Z;  1XK4 C;  1CLM A;  2Y1N A;  2BE4 A;  2D8N A;  3H4S E;  5J3X A;  4DCK A;  2EC6 B;  2R2I A;  1F70 A;  1OSA A;  2BCB A;  4NDD A;  3M0W A;  3AAK A;  4OKH A;  2K7B A;  3OHM B;  1BT6 A;  1KWO B;  2JXC A;  2M1K B;  2BL0 C;  4OR9 B;  2K8M B;  2WC8 A;  4M2O A;  2L5X B;  1K93 D;  1MXE A;  4MVF A;  2CBL A;  2HQ8 A;  4GGF A;  5D69 A;  3I5F B;  3FIA A;  1TN4 A;  4PE0 A;  1JFJ A;  1UP5 A;  2NLN A;  3DD4 A;  2CXJ A;  5AXI A;  4XYN A;  4FQO A;  1WRZ A;  3I5G C;  5I2L A;  2HPS A;  1EG3 A;  3TUY B;  2KAX A;  4NQG A;  2LCP A;  4I5K A;  4YBH B;  1EH2 A;  2CNP A;  4BY5 A;  3LL8 B;  1CDN A;  4ZCU A;  3VRN A;  2RGI A;  3TDZ A;  1B47 A;  3SJS A;  1KK8 C;  2Q4U A;  1YVH A;  1CDM A;  3PSR A;  2O5G A;  3SIA A;  1XFU O;  3OX6 A;  3KF9 A;  4MN0 A;  2TN4 A;  2DOQ A;  3IF7 A;  1K2H A;  3RM1 A;  4NDB A;  2JT8 A;  2JOJ A;  4P5O E;  2JU0 A;  1K90 D;  1RK9 A;  1SK6 D;  2E6W A;  2M1U A;  3HCM A;  2MBX A;  1TNX A;  2JQ6 A;  3D10 A;  1IGV A;  3KPX A;  3GOF A;  4YI8 A;  1B4C A;  1OMD A;  1LIN A;  2KAV A;  1TIZ A;  3ICB A;  1DJI A;  1V1F A;  1LA3 A;  1SR6 C;  1KFX S;  4N5X A;  3SIB A;  3AAJ A;  1QAS A;  2BEC A;  1CM1 A;  1SY9 A;  4DS7 A;  1N0Y A;  2CTN A;  4YGE B;  1WDC C;  4L9M A;  1TNQ A;  2BBN A;  2FCD A;  4A4B A;  1C07 A;  1GGZ A;  2KI4 C;  2WCE A;  4PHN A;  2Y5I A;  1W7J B;  3EVU A;  1CTR A;  1YX7 A;  1ZAC A;  1W7I B;  2NCO A;  1NWD A;  3QRX A;  5HLV A;  3SG2 A;  1AP4 A;  1H8B A;  2WND A;  1MHO A;  2KQ6 A;  2MA2 A;  3CZT X;  3LLE A;  1JBA A;  2JC2 A;  4MRY A;  4P2Y B;  4I5N B;  1CFC A;  1JC2 A;  1F54 A;  2JRF A;  2LUC A;  2ZRS A;  4XJK A;  1BR1 B;  1XFV O;  4QJ4 B;  1OZO A;  1SCM B;  3TDI A;  2WCB A;  1DT7 B;  1ALW A;  2KBM A;  2O60 A;  1JSA A;  3D0Y B;  1PVA A;  3BOW A;  2MLF C;  4YI9 A;  2BCX A;  5K89 A;  4YGC B;  4GUK A;  5F6T A;  1IQ3 A;  2LAP A;  1M45 A;  1DJY A;  1S6I A;  2OS8 C;  2JT0 A;  5AAN A;  2MAZ A;  2V53 A;  2LHL A;  4DRW A;  3IQO A;  2K61 A;  1B9A A;  4PE4 A;  3DVK A;  5HKY A;  2A4J A;  4U8D A;  1FI6 A;  1C7W A;  2LNK A;  1R6P A;  3D0Y A;  4CFR A;  5CSN A;  1E8A A;  1A4P A;  1KK7 Y;  1HQV A;  1U5I B;  2G2B A;  4ICB A;  4GFT A;  4HSZ A;  3GK4 X;  5JOL A;  3ZNI A;  1OMR A;  1QLS A;  3RLZ A;  2K2A A;  3PAL A;  1XFY O;  3I5G B;  2SAS A;  1AVS A;  1J55 A;  2KSP A;  1CB1 A;  4I5J A;  1R2U A;  1QIW A;  3VRQ A;  1DF0 A;  2KGR A;  1Y6W A;  1PAL A;  1H4B A;  1K94 A;  4A4C A;  4AQJ A;  4ETO A;  1PRW A;  2LP2 A;  5GQQ C;  1KK8 B;  1A03 A;  1RTP 1;  2MJW B;  2FOT A;  1TRF A;  4MEW A;  4PDZ A;  1U5I A;  1DMO A;  1L2O C;  1DTL A;  2M3W A;  1Y1A A;  5BPJ A;  2F3Z A;  1IQ5 A;  2B1U A;  1K9U A;  2KAY A;  3PN7 C;  1Y1X A;  2KYF A;  3WNX B; 
#chains in the Genus database with same CATH topology
 1WRL A;  3DVJ A;  1XFZ O;  1DQE A;  3BJH A;  1TCO B;  1XYD A;  2JZI A;  3HX4 A;  3A8R A;  1KFU L;  2L51 A;  1PK0 D;  1SR6 B;  2NZ0 A;  2LMT A;  5FI2 A;  3FE9 A;  3VGO A;  4GBA A;  3D73 A;  1NCZ A;  2AUC A;  1QX7 A;  5DKQ A;  1NP8 A;  2BCA A;  4JWQ A;  2LMU A;  2EHB A;  4INW A;  2PMY A;  5D7F A;  3L4A A;  1WDC B;  1KSO A;  4M2P A;  4HRE E;  1SL8 A;  2KI4 B;  2KI6 D;  3R1V A;  5HKW A;  1XFR A;  5KTY A;  1VRK A;  1SPY A;  1ZOT B;  2F33 A;  1NX2 A;  2Q91 A;  2L2C A;  1CKK A;  3OP0 A;  4ORB B;  3O6B A;  1MXL C;  2LP3 A;  5ER4 X;  1QV1 A;  1SSE B;  3FWB A;  3TS5 C;  2KLD A;  3PM2 A;  1CM4 A;  3UNW A;  1UHK A;  2WCL A;  3CLN A;  3WXA A;  2GV5 A;  1G33 A;  2KBI A;  3AKB A;  2M8U A;  1PUL A;  4GGF C;  1HT9 A;  5CPV A;  4WRI A;  3BUM B;  3BQ3 A;  5HKZ A;  1N2D A;  2I18 A;  2KFG A;  2OS8 B;  3PAT A;  4WQ3 A;  2KOT A;  3I5I C;  1B7T Y;  2L0P A;  4D1E A;  2K60 A;  1EL4 A;  3CAB A;  1BG1 A;  1MWN A;  3BFA A;  3MSE B;  2JPO A;  1BR4 B;  1ORG A;  1MF8 B;  1K9P A;  1SRA A;  4INX A;  2PSR A;  4JD9 A;  5AFP A;  1LVC D;  3R1P A;  1QIV A;  3NXA A;  1W9Z A;  4CID A;  1TCF A;  4PHK A;  2PQL A;  5I8N A;  1QJT A;  3CTN A;  1AJ5 A;  1CFD A;  1QAT A;  1B7T Z;  2LVK A;  2YGU A;  3SG4 A;  3EG5 B;  5DIC A;  4C0J A;  5DKR A;  2QPT A;  5HYD A;  2WC6 A;  1SKT A;  2ZRT A;  4TNC A;  1TNP A;  2ZN9 A;  2MRD A;  1A29 A;  1UUR A;  2QEO A;  2ERB A;  1QX2 A;  1J7R A;  2LVJ A;  1CFP A;  5FYX A;  3O2P A;  2ZFD A;  5TNC A;  1BOD A;  2JT3 A;  1ZMZ A;  4HRH A;  3UO9 A;  1GJY A;  3AKA A;  1YRU B;  1EJ3 A;  1QTX A;  2WCK A;  4PHM A;  1UHJ A;  2L50 A;  2ZND A;  1FBV A;  1S3P A;  3EK8 A;  3TZ1 A;  4Q04 A;  2H61 C;  3ZWH A;  3B7A A;  1M39 A;  2M0R A;  4M2Q A;  3CS1 A;  3I5H C;  1UWO A;  2JTZ A;  4ZCV A;  3PM8 A;  1BJF A;  3D77 A;  1SNL A;  1L2O B;  1K8U A;  1IH0 A;  4DUQ A;  1LXF C;  1ALV A;  4PT1 A;  1WY9 A;  3K1E A;  4JKT A;  3NHT A;  4AOM A;  1NPQ A;  3VRO A;  1YX8 A;  1AJ4 A;  2JWW A;  5KSZ A;  1PSR A;  3PN7 B;  4MSP A;  2HF5 A;  4GPL B;  4MBE A;  3C1V A;  1YTZ C;  1A75 B;  4QJ5 B;  3O4X A;  1TNW A;  1CFF A;  1KSM A;  1KCY A;  1EXR A;  4R1E A;  2K7O A;  1XK4 A;  5AER A;  3CDN A;  5PAL A;  3B86 A;  1YR5 A;  2F8P A;  1QS7 A;  1GGW A;  1SL7 A;  1BF5 A;  4BY4 A;  1Q80 A;  3SG5 A;  1JFK A;  4PE7 A;  2K0J A;  3CZ1 A;  4MZK A;  5ER5 A;  1KFU S;  2F2O A;  2AAO A;  4I5L B;  3EK7 A;  3GK1 A;  1OE9 B;  1S1E A;  2JNX A;  4FTG A;  1FW4 A;  2M9G A;  3EVV A;  3EK4 A;  1DGU A;  1YUU A;  3DY9 A;  3LK1 A;  1C7V A;  4OCI A;  3F45 A;  1SMG A;  3NSI A;  1NSH A;  1YUS A;  1J7Q A;  1F8H A;  1RJV A;  3FWC A;  1QV0 A;  1A75 A;  1JF2 A;  2BBM A;  5B8I B;  1F55 A;  3TS5 B;  1A2X A;  1CMF A;  1DJX A;  1BOC A;  1AUI B;  1OZS A;  1XA5 A;  2OTG C;  1JF0 A;  2LHI A;  1M63 B;  2LE9 B;  3JTD C;  3NHI A;  2JTT A;  2Y4Q A;  5IBW A;  2VRG A;  1KQM B;  1OOJ A;  3EKH A;  1F4Q A;  1YUT A;  2G9B A;  1UUS A;  3CR4 X;  1CMG A;  1FI5 A;  3I5I B;  1AK8 A;  2H2K A;  1BLQ A;  1C3Y A;  1X02 A;  4OVN F;  3NSK A;  5HL1 A;  1N65 A;  2BE6 A;  1YUR A;  2ZNE A;  3OB1 B;  4KYN A;  1EG4 A;  3PFV A;  2BNX A;  4MLW A;  3SS4 A;  2KQY A;  2PYQ A;  2WOR A;  4NDC A;  1XFX O;  3WHT B;  3PLF B;  2QAC A;  1DVI A;  1QVI Z;  2KI6 C;  2L5Y A;  2GGZ A;  2M49 B;  4E68 A;  1J7O A;  1SL9 A;  2H8V A;  1WLZ A;  1Y0V H;  2NXQ A;  3BUO B;  3CWG A;  2FJY A;  3KEV A;  2JPT A;  1RFJ A;  3OB2 B;  2ISD A;  1FF1 A;  2LUX A;  1JUO A;  4N1F A;  1M31 A;  2K7C A;  1IG5 A;  1IJ6 A;  2BAP A;  4GGN A;  3PJI A;  2FCE A;  1QXP A;  3BUX B;  1BMO A;  3KO0 A;  5HLO A;  2MHH A;  5CSJ A;  3BUN B;  3TDU A;  1LKJ A;  2HQW A;  1B8L A;  1DJW A;  1J7P A;  1DJH A;  1OOH A;  1OMV A;  1CLL A;  1SCV A;  2PRU A;  3CR5 X;  4ORA B;  1AHR A;  1XVJ A;  1S36 A;  2K7D A;  1K95 A;  1RRO A;  2GGM A;  1KQM C;  1SW8 A;  2KGB C;  2KYC A;  1IKU A;  2KDH A;  1B1G A;  2HET A;  5D3O A;  1RWY A;  4HRG A;  2JXL A;  2E30 A;  5JJG A;  1CDL A;  1QX5 B;  1NX0 A;  2EC6 C;  2FJU B;  3I5H B;  1NYA A;  1Y1U A;  1NUB A;  5CSI A;  2LV7 A;  2M7L A;  1G8I A;  3S0F A;  2F2P A;  1PSB A;  3BUW B;  5I2Q A;  1UHN A;  1REC A;  2M29 A;  1TTX A;  1KWO C;  3S0A A;  3EKJ A;  3JVT B;  3KHE A;  4DIR A;  4YGD B;  1OQP A;  1KQV A;  4PE1 A;  1IJ5 A;  2L4H A;  3EVR A;  4OV2 A;  2KPH A;  3DF0 B;  3OX5 A;  3VRR A;  1L7Z A;  4QJ3 B;  4XJK B;  4MRX A;  4CLN A;  2AMI A;  3I5F C;  1ODB A;  2KHN A;  2EGD A;  1S6J A;  1G4Y R;  2OPO A;  1SYM A;  2LVV A;  3BOW B;  3IQQ A;  3A4U B;  1DJG A;  1M46 A;  2H61 A;  1MR8 A;  2KNE A;  1NIW A;  2LVI A;  4IL1 A;  4IJ7 A;  3CYZ A;  2K2F A;  4JPZ B;  4CFQ A;  1JWD A;  1OOG A;  1DEK A;  3SG6 A;  1NCY A;  1NX3 A;  1B8R A;  2I94 A;  4ORC B;  4PAL A;  5DKN A;  1CDP A;  2CCM A;  1SBJ A;  2F3Y A;  2QEV A;  3SG3 A;  3WHU B;  3TUY C;  3BYA A;  3DVM A;  4CPV A;  1BU3 A;  2L4I A;  3CR2 A;  2WCH A;  4USL A;  3SG7 A;  2JUL A;  3BFB A;  4F7F A;  4GNK B;  2M97 A;  2WCF A;  3DVE A;  3GK2 A;  1MUX A;  2MLE C;  4JQ0 D;  1DGV A;  3CGA A;  2LMV A;  4MZJ A;  4C0L A;  1YVL A;  2BKI B;  2LAN A;  2ZN8 A;  3DZT A;  3FS7 A;  1F71 A;  1NX1 A;  3DF0 A;  3D78 A;  1J1D A;  3BXK A;  4GAO A;  1B8C A;  2CT9 A;  2M7N A;  1WLM A;  1ZUZ A;  2LC5 A;  2LLU A;  3LCP C;  2OTG B;  5AEQ A;  2QEH A;  3JVT C;  3JTD B;  1IRJ A;  2COL B;  4PCW A;  2NCP A;  4PHJ A;  1KFX L;  4AQI A;  1UHH A;  1CNP A;  1CLB A;  1UHI A;  1QLK A;  1IWQ A;  3E3R A;  4YGA A;  3NGV A;  2ZKM X;  1J1E A;  1V1G A;  2KFF A;  2L98 A;  2LM5 A;  1WRK A;  3S0G A;  1FPW A;  2LLT A;  2KLE A;  3LK0 A;  2IS9 A;  2PVB A;  3NSL A;  1S26 D;  3NSO A;  1DF0 B;  1S5G Y;  1DJZ A;  1ZFS A;  2PAL A;  4FQT A;  4MZL A;  4N1G A;  2BKH B;  1S6C A;  1K96 A;  2JNF A;  2Y1M A;  3D74 A;  2BL0 B;  3VB1 A;  3O78 A;  3O4Y A;  1TOP A;  1MQ1 A;  2P6B B;  5I2O A;  1XO5 A;  5G08 A;  5KU1 A;  4WQ2 A;  3CZ0 A;  2PAS A;  3DXL A;  4F0Z B;  5CSF A;  3K21 A;  1YRT B;  2WOS A;  1F4O A;  3VRP A;  1SCM C;  4C0K A;  1K9K A;  2I2R E;  1QVI Y;  3D75 A;  1PVB A;  1S5G Z;  2L2E A;  2SCP A;  1NCX A;  2LLS A;  3B87 A;  4YRU A;  1LA0 A;  4YGB B;  1XFW O;  2I7A A;  4UPG A;  2KFH A;  1D1O A;  1GQM A;  1KK7 Z;  1XK4 C;  1CLM A;  2Y1N A;  2BE4 A;  2D8N A;  3H4S E;  5J3X A;  4DCK A;  2EC6 B;  2R2I A;  1F70 A;  1OSA A;  2BCB A;  4NDD A;  3M0W A;  3FE6 A;  3AAK A;  4OKH A;  2K7B A;  3OHM B;  1BT6 A;  1KWO B;  2JXC A;  2M1K B;  2BL0 C;  4OR9 B;  2K8M B;  2WC8 A;  4M2O A;  3BFH A;  2L5X B;  1K93 D;  1MXE A;  4MVF A;  2CBL A;  2HQ8 A;  4GGF A;  5D69 A;  3I5F B;  3V2L A;  3FIA A;  1TN4 A;  5I94 A;  4PE0 A;  1JFJ A;  1UP5 A;  2NLN A;  3DD4 A;  2CXJ A;  1TUJ A;  5AXI A;  4XYN A;  4FQO A;  1TUZ A;  1WRZ A;  3I5G C;  5I2L A;  2HPS A;  1EG3 A;  1P28 A;  3TUY B;  3SS5 A;  2KAX A;  4NQG A;  2LCP A;  4I5K A;  4YBH B;  1EH2 A;  3S0D A;  2CNP A;  2WCM A;  4BY5 A;  3LL8 B;  1DC1 A;  1CDN A;  4ZCU A;  3VRN A;  1Z2C B;  2RGI A;  3TDZ A;  1B47 A;  3SJS A;  1KK8 C;  2Q4U A;  1YVH A;  1CDM A;  2WC5 A;  1C3Z A;  3IVT A;  3PSR A;  2O5G A;  3SIA A;  1XFU O;  3OX6 A;  3KF9 A;  2WCJ A;  1IIO A;  4MN0 A;  2TN4 A;  3RZS A;  2DOQ A;  3IF7 A;  1K2H A;  3RM1 A;  4NDB A;  2JT8 A;  2JOJ A;  4P5O E;  2JU0 A;  1K90 D;  1RK9 A;  3OGN A;  1SK6 D;  2E6W A;  2M1U A;  1OOI X;  3HCM A;  2MBX A;  1TNX A;  2JQ6 A;  3D10 A;  2P71 A;  1IGV A;  3KPX A;  3GOF A;  4YI8 A;  1B4C A;  1OMD A;  1LIN A;  2KAV A;  1TIZ A;  3ICB A;  1DJI A;  1V1F A;  1LA3 A;  1SR6 C;  1KFX S;  4N5X A;  2P70 A;  3AAJ A;  3SIB A;  1QAS A;  2BEC A;  1CM1 A;  1SY9 A;  4DS7 A;  1N0Y A;  2CTN A;  3DYE A;  4YGE B;  1WDC C;  3L4L A;  4L9M A;  3SS3 A;  1TNQ A;  2BBN A;  2FCD A;  4A4B A;  1C07 A;  1GGZ A;  2KI4 C;  2WCE A;  4PHN A;  2Y5I A;  1W7J B;  3EVU A;  1CTR A;  1YX7 A;  1ZAC A;  1W7I B;  2NCO A;  1NWD A;  3N7H A;  3QRX A;  5HLV A;  3SG2 A;  1AP4 A;  2WND A;  1H8B A;  1MHO A;  2KQ6 A;  2MA2 A;  3CZT X;  3LLE A;  1JBA A;  2JC2 A;  4MRY A;  4P2Y B;  4I5N B;  1CFC A;  1JC2 A;  1F54 A;  2JRF A;  2LUC A;  2ZRS A;  3D76 A;  4XJK A;  1BR1 B;  1XFV O;  4QJ4 B;  1OZO A;  1OOF A;  1SCM B;  2WCB A;  3TDI A;  1QWV A;  1ALW A;  2KBM A;  2O60 A;  1DT7 B;  5FI6 A;  3D0Y B;  1JSA A;  1PVA A;  3BOW A;  3S0B A;  2MLF C;  4YI9 A;  2BCX A;  5K89 A;  3QME A;  2QEB A;  4GUK A;  4YGC B;  5F6T A;  1IQ3 A;  2LAP A;  1M45 A;  1DJY A;  1S6I A;  2OS8 C;  3S0E A;  2JT0 A;  3B6X A;  5AAN A;  2MAZ A;  2V53 A;  2LHL A;  4DRW A;  1Z4H A;  3IQO A;  3L47 A;  2K61 A;  3CZ2 A;  1B9A A;  4PE4 A;  3DVK A;  3R72 A;  5HKY A;  2A4J A;  4U8D A;  1FI6 A;  1TWO A;  1C7W A;  2LNK A;  1R6P A;  3FE8 A;  3D0Y A;  4CFR A;  5CSN A;  1E8A A;  1A4P A;  1KK7 Y;  1HQV A;  1U5I B;  2G2B A;  4ICB A;  4GFT A;  4HSZ A;  3GK4 X;  5JOL A;  3OBV A;  3ZNI A;  1OMR A;  1QLS A;  3RLZ A;  1GM0 A;  2K2A A;  3PAL A;  1XFY O;  3I5G B;  2SAS A;  1AVS A;  1J55 A;  2KSP A;  1T14 A;  1CB1 A;  4I5J A;  3B88 A;  3R1O A;  1R2U A;  1QIW A;  1LS8 A;  3VRQ A;  1DF0 A;  2KGR A;  1Y6W A;  1PAL A;  1H4B A;  1K94 A;  4A4C A;  4AQJ A;  4ETO A;  1OW4 A;  1PRW A;  2LP2 A;  5GQQ C;  1KK8 B;  1A03 A;  1RTP 1;  2MJW B;  4OZD A;  5FI7 A;  2FOT A;  1TRF A;  4MEW A;  4PDZ A;  1DEL A;  1U5I A;  1DMO A;  1L2O C;  1DTL A;  2M3W A;  1Y1A A;  5BPJ A;  2F3Z A;  1IQ5 A;  2GTE A;  2B1U A;  1K9U A;  2KAY A;  3PN7 C;  1Y1X A;  3Q8I A;  2KYF A;  2QDI A;  3WNX B;  5EL2 A; 
#chains in the Genus database with same CATH homology
 1WRL A;  3DVJ A;  1XFZ O;  1TCO B;  1XYD A;  2JZI A;  3HX4 A;  3A8R A;  1KFU L;  2L51 A;  1PK0 D;  1SR6 B;  2NZ0 A;  2LMT A;  3VGO A;  4GBA A;  1NCZ A;  2AUC A;  1QX7 A;  5DKQ A;  1NP8 A;  2BCA A;  4JWQ A;  2LMU A;  2EHB A;  2PMY A;  5D7F A;  1WDC B;  1KSO A;  4M2P A;  4HRE E;  1SL8 A;  2KI4 B;  2KI6 D;  5HKW A;  5KTY A;  1VRK A;  1SPY A;  1ZOT B;  2F33 A;  1NX2 A;  2Q91 A;  1CKK A;  3OP0 A;  4ORB B;  3O6B A;  1MXL C;  2LP3 A;  5ER4 X;  1QV1 A;  3FWB A;  3TS5 C;  1CM4 A;  1UHK A;  3CLN A;  3WXA A;  2GV5 A;  1G33 A;  2KBI A;  3AKB A;  2M8U A;  1PUL A;  4GGF C;  1HT9 A;  5CPV A;  4WRI A;  3BUM B;  3BQ3 A;  5HKZ A;  1N2D A;  2I18 A;  2KFG A;  2OS8 B;  3PAT A;  4WQ3 A;  2KOT A;  3I5I C;  1B7T Y;  2L0P A;  4D1E A;  1EL4 A;  1BG1 A;  1MWN A;  3MSE B;  1BR4 B;  1MF8 B;  1K9P A;  1SRA A;  2PSR A;  5AFP A;  1LVC D;  1QIV A;  3NXA A;  4CID A;  1TCF A;  4PHK A;  5I8N A;  1QJT A;  3CTN A;  1AJ5 A;  1CFD A;  1QAT A;  1B7T Z;  2LVK A;  3SG4 A;  4C0J A;  5DKR A;  2QPT A;  5HYD A;  1SKT A;  2ZRT A;  4TNC A;  1TNP A;  2ZN9 A;  2MRD A;  1A29 A;  1UUR A;  1QX2 A;  1J7R A;  2LVJ A;  1CFP A;  5FYX A;  3O2P A;  2ZFD A;  5TNC A;  1BOD A;  2JT3 A;  1ZMZ A;  4HRH A;  1GJY A;  3AKA A;  1YRU B;  1EJ3 A;  1QTX A;  4PHM A;  1UHJ A;  2L50 A;  2ZND A;  1FBV A;  1S3P A;  3EK8 A;  3TZ1 A;  4Q04 A;  2H61 C;  3ZWH A;  1M39 A;  2M0R A;  4M2Q A;  3CS1 A;  3I5H C;  1UWO A;  2JTZ A;  4ZCV A;  3PM8 A;  1BJF A;  1SNL A;  1L2O B;  1K8U A;  1IH0 A;  4DUQ A;  1LXF C;  1ALV A;  1WY9 A;  1NPQ A;  3VRO A;  1YX8 A;  1AJ4 A;  2JWW A;  5KSZ A;  1PSR A;  3PN7 B;  4MSP A;  2HF5 A;  4GPL B;  4MBE A;  3C1V A;  1YTZ C;  1A75 B;  4QJ5 B;  1TNW A;  1CFF A;  1KSM A;  1KCY A;  1EXR A;  4R1E A;  2K7O A;  1XK4 A;  5AER A;  5PAL A;  1YR5 A;  2F8P A;  1QS7 A;  1GGW A;  1SL7 A;  1BF5 A;  4BY4 A;  1Q80 A;  3SG5 A;  1JFK A;  4PE7 A;  2K0J A;  4MZK A;  5ER5 A;  1KFU S;  2F2O A;  2AAO A;  4I5L B;  3EK7 A;  3GK1 A;  1OE9 B;  1S1E A;  2JNX A;  4FTG A;  1FW4 A;  2M9G A;  3EVV A;  3EK4 A;  1DGU A;  1YUU A;  3LK1 A;  1C7V A;  4OCI A;  3F45 A;  1SMG A;  3NSI A;  1NSH A;  1YUS A;  1J7Q A;  1F8H A;  1RJV A;  3FWC A;  1QV0 A;  1A75 A;  1JF2 A;  2BBM A;  5B8I B;  1F55 A;  3TS5 B;  1A2X A;  1CMF A;  1DJX A;  1BOC A;  1AUI B;  1OZS A;  1XA5 A;  2OTG C;  1JF0 A;  2LHI A;  1M63 B;  2LE9 B;  3JTD C;  2JTT A;  2Y4Q A;  5IBW A;  2VRG A;  1KQM B;  1OOJ A;  3EKH A;  1F4Q A;  1YUT A;  2G9B A;  1UUS A;  3CR4 X;  1CMG A;  1FI5 A;  3I5I B;  1AK8 A;  2H2K A;  1BLQ A;  1X02 A;  4OVN F;  3NSK A;  1N65 A;  2BE6 A;  1YUR A;  2ZNE A;  3OB1 B;  4MLW A;  1EG4 A;  3PFV A;  3WHT B;  2KQY A;  2WOR A;  4NDC A;  1XFX O;  3PLF B;  2QAC A;  1DVI A;  1QVI Z;  2KI6 C;  2M49 B;  2GGZ A;  4E68 A;  1J7O A;  1SL9 A;  1WLZ A;  1Y0V H;  2NXQ A;  3BUO B;  3CWG A;  3KEV A;  3OB2 B;  2JPT A;  1RFJ A;  2ISD A;  1FF1 A;  2LUX A;  1JUO A;  4N1F A;  1M31 A;  2K7C A;  1IG5 A;  1IJ6 A;  4GGN A;  2FCE A;  1QXP A;  3BUX B;  1BMO A;  3KO0 A;  5HLO A;  2MHH A;  5CSJ A;  3BUN B;  3TDU A;  1LKJ A;  2HQW A;  1B8L A;  1DJW A;  1J7P A;  1DJH A;  1OMV A;  1CLL A;  1SCV A;  2PRU A;  3CR5 X;  4ORA B;  1AHR A;  1XVJ A;  1S36 A;  2K7D A;  1K95 A;  1RRO A;  2GGM A;  1KQM C;  1SW8 A;  2KGB C;  2KYC A;  1IKU A;  2KDH A;  1B1G A;  2HET A;  1RWY A;  4HRG A;  2JXL A;  2E30 A;  5JJG A;  1CDL A;  1QX5 B;  1NX0 A;  2EC6 C;  2FJU B;  3I5H B;  1NYA A;  1Y1U A;  1NUB A;  5CSI A;  2LV7 A;  2M7L A;  1G8I A;  2F2P A;  1PSB A;  3BUW B;  5I2Q A;  1UHN A;  1REC A;  2M29 A;  1TTX A;  1KWO C;  3EKJ A;  3JVT B;  3KHE A;  4DIR A;  4YGD B;  1OQP A;  1KQV A;  4PE1 A;  1IJ5 A;  2L4H A;  3EVR A;  4OV2 A;  3OX5 A;  3DF0 B;  3VRR A;  1L7Z A;  4QJ3 B;  4XJK B;  4MRX A;  4CLN A;  2AMI A;  3I5F C;  1ODB A;  2KHN A;  2EGD A;  1S6J A;  1G4Y R;  2OPO A;  1SYM A;  2LVV A;  3BOW B;  3IQQ A;  3A4U B;  1DJG A;  1M46 A;  2H61 A;  1MR8 A;  2KNE A;  1NIW A;  2LVI A;  4IL1 A;  4JPZ B;  2K2F A;  4CFQ A;  1JWD A;  4AOM A;  3SG6 A;  1NCY A;  1NX3 A;  1B8R A;  2I94 A;  4ORC B;  4PAL A;  5DKN A;  1CDP A;  2CCM A;  1SBJ A;  2F3Y A;  3SG3 A;  3WHU B;  3TUY C;  3BYA A;  3DVM A;  4CPV A;  1BU3 A;  2L4I A;  3CR2 A;  4USL A;  3SG7 A;  2JUL A;  4GNK B;  2M97 A;  2WCF A;  3DVE A;  3GK2 A;  1MUX A;  2MLE C;  4JQ0 D;  1DGV A;  3CGA A;  2LMV A;  4MZJ A;  4C0L A;  1YVL A;  2BKI B;  2LAN A;  2ZN8 A;  3FS7 A;  1F71 A;  1NX1 A;  3DF0 A;  1J1D A;  3BXK A;  4GAO A;  1B8C A;  2CT9 A;  2M7N A;  1WLM A;  1ZUZ A;  2LC5 A;  2LLU A;  3LCP C;  2OTG B;  5AEQ A;  3JVT C;  3JTD B;  1IRJ A;  2COL B;  4PCW A;  2NCP A;  4PHJ A;  1KFX L;  4AQI A;  1UHH A;  1CNP A;  1CLB A;  1UHI A;  1QLK A;  1IWQ A;  3E3R A;  4YGA A;  2ZKM X;  1J1E A;  1V1G A;  2KFF A;  2L98 A;  2LM5 A;  1WRK A;  1FPW A;  2LLT A;  3LK0 A;  2IS9 A;  2PVB A;  3NSL A;  1S26 D;  3NSO A;  1DF0 B;  1S5G Y;  1DJZ A;  1ZFS A;  2PAL A;  4MZL A;  4N1G A;  2BKH B;  1S6C A;  1K96 A;  2JNF A;  2Y1M A;  2BL0 B;  3O78 A;  3O4Y A;  1TOP A;  1MQ1 A;  2P6B B;  5I2O A;  1XO5 A;  5G08 A;  5KU1 A;  4WQ2 A;  4F0Z B;  2PAS A;  5CSF A;  3K21 A;  1YRT B;  2WOS A;  1F4O A;  3VRP A;  1SCM C;  4C0K A;  1K9K A;  2I2R E;  1QVI Y;  1PVB A;  1S5G Z;  2L2E A;  2SCP A;  1NCX A;  2LLS A;  4YRU A;  1LA0 A;  4YGB B;  1XFW O;  2I7A A;  4UPG A;  2KFH A;  1D1O A;  1GQM A;  1KK7 Z;  1XK4 C;  1CLM A;  2Y1N A;  2BE4 A;  2D8N A;  3H4S E;  5J3X A;  4DCK A;  2EC6 B;  2R2I A;  1F70 A;  1OSA A;  2BCB A;  4NDD A;  3M0W A;  3AAK A;  4OKH A;  2K7B A;  3OHM B;  1BT6 A;  1KWO B;  2JXC A;  2M1K B;  2BL0 C;  4OR9 B;  2K8M B;  2WC8 A;  4M2O A;  2L5X B;  1K93 D;  1MXE A;  4MVF A;  2CBL A;  2HQ8 A;  4GGF A;  5D69 A;  3I5F B;  3FIA A;  1TN4 A;  4PE0 A;  1JFJ A;  1UP5 A;  2NLN A;  3DD4 A;  2CXJ A;  5AXI A;  4XYN A;  4FQO A;  1WRZ A;  3I5G C;  5I2L A;  2HPS A;  1EG3 A;  3TUY B;  2KAX A;  4NQG A;  2LCP A;  4I5K A;  4YBH B;  1EH2 A;  2CNP A;  4BY5 A;  3LL8 B;  1CDN A;  4ZCU A;  3VRN A;  2RGI A;  3TDZ A;  1B47 A;  3SJS A;  1KK8 C;  2Q4U A;  1YVH A;  1CDM A;  3PSR A;  2O5G A;  3SIA A;  1XFU O;  3OX6 A;  3KF9 A;  4MN0 A;  2TN4 A;  2DOQ A;  3IF7 A;  1K2H A;  3RM1 A;  4NDB A;  2JT8 A;  2JOJ A;  4P5O E;  2JU0 A;  1K90 D;  1RK9 A;  1SK6 D;  2E6W A;  2M1U A;  3HCM A;  2MBX A;  1TNX A;  2JQ6 A;  3D10 A;  1IGV A;  3KPX A;  3GOF A;  4YI8 A;  1B4C A;  1OMD A;  1LIN A;  2KAV A;  1TIZ A;  3ICB A;  1DJI A;  1V1F A;  1LA3 A;  1SR6 C;  1KFX S;  4N5X A;  3SIB A;  3AAJ A;  1QAS A;  2BEC A;  1CM1 A;  1SY9 A;  4DS7 A;  1N0Y A;  2CTN A;  4YGE B;  1WDC C;  4L9M A;  1TNQ A;  2BBN A;  2FCD A;  4A4B A;  1C07 A;  1GGZ A;  2KI4 C;  2WCE A;  4PHN A;  2Y5I A;  1W7J B;  3EVU A;  1CTR A;  1YX7 A;  1ZAC A;  1W7I B;  2NCO A;  1NWD A;  3QRX A;  5HLV A;  3SG2 A;  1AP4 A;  1H8B A;  2WND A;  1MHO A;  2KQ6 A;  2MA2 A;  3CZT X;  3LLE A;  1JBA A;  2JC2 A;  4MRY A;  4P2Y B;  4I5N B;  1CFC A;  1JC2 A;  1F54 A;  2JRF A;  2LUC A;  2ZRS A;  4XJK A;  1BR1 B;  1XFV O;  4QJ4 B;  1OZO A;  1SCM B;  3TDI A;  2WCB A;  1DT7 B;  1ALW A;  2KBM A;  2O60 A;  1JSA A;  3D0Y B;  1PVA A;  3BOW A;  2MLF C;  4YI9 A;  2BCX A;  5K89 A;  4YGC B;  4GUK A;  5F6T A;  1IQ3 A;  2LAP A;  1M45 A;  1DJY A;  1S6I A;  2OS8 C;  2JT0 A;  5AAN A;  2MAZ A;  2V53 A;  2LHL A;  4DRW A;  3IQO A;  2K61 A;  1B9A A;  4PE4 A;  3DVK A;  5HKY A;  2A4J A;  4U8D A;  1FI6 A;  1C7W A;  2LNK A;  1R6P A;  3D0Y A;  4CFR A;  5CSN A;  1E8A A;  1A4P A;  1KK7 Y;  1HQV A;  1U5I B;  2G2B A;  4ICB A;  4GFT A;  4HSZ A;  3GK4 X;  5JOL A;  3ZNI A;  1OMR A;  1QLS A;  3RLZ A;  2K2A A;  3PAL A;  1XFY O;  3I5G B;  2SAS A;  1AVS A;  1J55 A;  2KSP A;  1CB1 A;  4I5J A;  1R2U A;  1QIW A;  3VRQ A;  1DF0 A;  2KGR A;  1Y6W A;  1PAL A;  1H4B A;  1K94 A;  4A4C A;  4AQJ A;  4ETO A;  1PRW A;  2LP2 A;  5GQQ C;  1KK8 B;  1A03 A;  1RTP 1;  2MJW B;  2FOT A;  1TRF A;  4MEW A;  4PDZ A;  1U5I A;  1DMO A;  1L2O C;  1DTL A;  2M3W A;  1Y1A A;  5BPJ A;  2F3Z A;  1IQ5 A;  2B1U A;  1K9U A;  2KAY A;  3PN7 C;  1Y1X A;  2KYF A;  3WNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...