1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords PROTEIN (CALBINDIN D9K)
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
1OMDA 1TRFA 3CZTX 3IF7A 1JC2A 1DTLA 2QACA 4NDDA 4AQIA 3OB1B 3GOFA 1YX8A 1K93D 2KOTA 2OTGB 3EVRA 1Y1XA 1NYAA 3TS5C 3GK4X 1AUIB 3SIBA 1J7QA 1VRKA 3OHMB 1AK8A 2KQYA 2QPTA 2KI6D 2ZN9A 3BYAA 5F6TA 1BG1A 4GGFC 1OSAA 1M45A 2D8NA 1KCYA 3CR2A 5IBWA 3OX6A 4A4CA 2ZRSA 2JULA 4E68A 3IQQA 4MRYA 1RECA 1ZOTB 2ZN8A 1MWNA 2LV7A 3SG5A 1QVIY 2LMVA 1E8AA 2JWWA 3JTDB 1DJIA 1S6IA 3CR5X 1M46A 3PALA 3WNXB 1N65A 1YVHA 1S5GZ 3A4UB 4XJKB 2Q4UA 3CGAA 1YVLA 4F0ZB 2H61A 3LLEA 2KBMA 1SCMC 4QJ4B 1RJVA 3C1VA 4MZKA 3I5FC 4OVNF 2LCPA 1L2OC 2L51A 4MN0A 4QJ3B 2LMTA 1XFVO 1AVSA 1BJFA 1FW4A 5I2QA 1OZSA 1SPYA 3KEVA 2BKIB 4U8DA 2F3ZA 1EH2A 2LLUA 5TNCA 2OTGC 4MZJA 1B47A 1CDMA 1ALVA 1S5GY 4GNKB 5JOLA 1GQMA 3CS1A 3VROA 2KNEA 5DKNA 2M7LA 2Y4QA 4HSZA 2M97A 1CNPA 4ORAB 2HPSA 1K90D 1KQVA 2GGMA 3NSLA 2LE9B 2WOSA 2FCDA 2FOTA 1L2OB 4YGAA 5B8IB 1SW8A 1WRZA 4MLWA 2O5GA 2F3YA 1XK4A 1NCZA 1YRTB 2FCEA 2KFHA 1BOCA 4M2OA 1SL8A 5DKRA 1RFJA 1G33A 1UHJA 2M3WA 1OE9B 1B9AA 3DD4A 2JXLA 1FF1A 2EC6C 1PVAA 2CT9A 2IS9A 3SG3A 1ZFSA 4Q04A 3AKBA 3FS7A 2I2RE 2PASA 1SR6C 1KSMA 4I5NB 2KHNA 1R2UA 1S1EA 1XFZO 3CLNA 3EKHA 1DGUA 1DF0B 1XO5A 4BY5A 3I5IC 1CFFA 4PHNA 1YUTA 1F4OA 1WDCC 4QJ5B 5CSFA 3KO0A 1TNWA 1V1FA 3MSEB 3O78A 4P5OE 2CCMA 1WRLA 2JQ6A 3EK8A 2OPOA 2BCAA 3EVUA 3FWCA 4I5KA 1KFXL 1GGZA 1CLMA 3PN7B 3ZWHA 1U5IB 3CWGA 1L7ZA 4HRGA 2KYCA 1PRWA 1LVCD 3BUXB 2VRGA 2PSRA 3BUOB 1H4BA 5PALA 1CDLA 2JNXA 1J7OA 1B1GA 1IWQA 1NWDA 5AEQA 1MUXA 1Y1UA 1BMOA 1NX1A 1TIZA 2K61A 3I5GB 2I18A 3JVTB 4YGEB 5ER5A 3I5IB 1KWOB 1XFUO 2E30A 1FI6A 4N5XA 2JTTA 3NSIA 1FBVA 3FIAA 2G2BA 2P6BB 3DVJA 4HRHA 4MBEA 2JT0A 2COLB 1UUSA 1ZACA 4PHJA 1K2HA 2BL0B 1K95A 3PN7C 1K9UA 3PFVA 2F8PA 1SCMB 1Q80A 1TNQA 1CB1A 2K7BA 1SL7A 2KFGA 4DS7A 1B8LA 2LUXA 3VGOA 1B4CA 1EG4A 4IL1A 2JT8A 3WHTB 1DVIA 1QX5B 2LHIA 1YUUA 2KAYA 3TDIA 3TDZA 1CFPA 2K7CA 3SG2A 2KBIA 5HKZA 1XYDA 1Y1AA 4R1EA 4GBAA 4WQ3A 1QS7A 1RROA 4XYNA 3D0YB 3EVVA 2PRUA 1R6PA 3BUMB 1V1GA 1YURA 3JVTC 1AJ4A 2HF5A 1KWOC 4OKHA 1J1DA 2I7AA 4PDZA 2G9BA 1QX2A 1BR4B 4WQ2A 2MBXA 2M1KB 5BPJA 3DVKA 2KI4B 3AKAA 3AAJA 2Y1MA 1BODA 1CM4A 1JFJA 1ZUZA 1W7IB 1S6CA 1J7RA 3PATA 2BL0C 1TCFA 3TZ1A 5D7FA 4CPVA 1XK4C 4M2PA 4FQOA 4GFTA 4N1FA 1FI5A 1B7TZ 1CKKA 2LVVA 4NQGA 2Y1NA 3BXKA 2K8MB 1DJHA 1JWDA 2WC8A 3VRPA 2ZFDA 3I5HB 1CLLA 4GUKA 5HLVA 2L2EA 1EJ3A 2M9GA 2MLEC 2PVBA 1UWOA 1DJXA 5HYDA 2LP2A 1OQPA 4PE7A 2JZIA 4CIDA 5AXIA 1RTP1 1JFKA 1QIWA 1N0YA 1A75B 2L50A 4ZCVA 1X02A 2LVIA 1IQ3A 1F54A 3TDUA 1PK0D 1RWYA 3EKJA 1UHIA 3SG4A 1F70A 2H61C 5I2LA 1KQMC 2WCBA 1KK8B 1TCOB 3IQOA 2L4HA 2L0PA 1ODBA 3NSKA 1SKTA 3D0YA 4PHKA 2GGZA 1S6JA 1C7WA 1F55A 1LA3A 4L9MA 5ER4X 1OMRA 2OS8B 1B8RA 2MRDA 1XA5A 2WCFA 3NXAA 3HCMA 2MA2A 3RLZA 1C7VA 1JSAA 3LK0A 1MXEA 3VRNA 1SRAA 2LM5A 2ZRTA 1UHKA 3DVEA 4JWQA 3PSRA 2I94A 1QX7A 1QASA 3TUYB 2LAPA 1PSBA 1QTXA 5HLOA 5FYXA 1NCXA 1PVBA 3PLFB 4HREE 1KQMB 1IH0A 5G08A 2BCBA 1YR5A 2HETA 1MR8A 4GAOA 4M2QA 2LVKA 2KDHA 2Q91A 4C0LA 3O2PA 4PCWA 4CLNA 1SMGA 5JJGA 2AAOA 1SK6D 3GK1A 3OB2B 4ZCUA 2JC2A 1MF8B 2JXCA 2O60A 1KFUL 3QRXA 2JU0A 3FWBA 1SR6B 1G8IA 2ISDA 1LINA 2HQ8A 3RM1A 2M8UA 1J7PA 4BY4A 2KI4C 4ORBB 2WNDA 4TNCA 2GV5A 1G4YR 4USLA 1F4QA 2K7OA 1HQVA 1M31A 1FPWA 2OS8C 1S3PA 1K96A 4AQJA 1NSHA 1TTXA 1LA0A 2M1UA 1NP8A 5I2OA 2H2KA 1IJ6A 1K94A 4OV2A 5CSIA 4A4BA 1EL4A 4OR9B 4WRIA 1UP5A 2SCPA 4JPZB 2JT3A 1DJWA 3BUNB 2L98A 1DJYA 1M39A 1M63B 1Y0VH 1QJTA 4JQ0D 1SCVA 2BCXA 3BOWA 1QLKA 3O4YA 4MSPA 3DVMA 3LCPC 4PHMA 3VRRA 3JTDC 1A2XA 3OP0A 2K7DA 1HT9A 4DUQA 2AMIA 1AJ5A 1NX3A 1KFUS 2EHBA 2WORA 1OOJA 1CFCA 1KSOA 4C0KA 1A75A 4ORCB 1TNXA 4DCKA 1BR1B 2JRFA 2NLNA 3I5FB 3SIAA 1TNPA 2EGDA 1C07A 4PE4A 3O6BA 3M0WA 2BE4A 1TOPA 1QV1A 1UHNA 3KF9A 2NCPA 4YI9A 2JPTA 1RK9A 2LMUA 2KFFA 5CSNA 1WRKA 5HKWA 1CLBA 1MHOA 4AOMA 4NDCA 2BECA 1AHRA 1EG3A 1NCYA 1B7TY 1S36A 2Y5IA 2MHHA 2LUCA 3GK2A 4D1EA 1OMVA 1F71A 1IQ5A 1DT7B 2JTZA 4FTGA 4GGFA 1TN4A 2CTNA 2L5XB 3ZNIA 3BQ3A 1QIVA 1SYMA 1QATA 1A03A 2KQ6A 3KHEA 3BOWB 1KK7Z 1NIWA 2HQWA 2R2IA 1XVJA 1DJGA 2BBMA 1IRJA 3LL8B 3LK1A 1UHHA 2LLTA 5KSZA 5DKQA 1QVIZ 1XFWO 4OCIA 5CPVA 2ZNEA 1XFXO 1DGVA 1U5IA 1QXPA 1K8UA 1J55A 3F45A 4N1GA 2DOQA 2NCOA 2ZNDA 1LXFC 1NPQA 2LP3A 2JOJA 4PALA 1IJ5A 1J1EA 2BKHB 1B8CA 2V53A 4XJKA 2M29A 2M49B 1XFYO 1CFDA 3TS5B 1GJYA 1DF0A 3BUWB 2PALA 1OZOA 2A4JA 4C0JA 2WCEA 2BE6A 3DF0A 4UPGA 1CDNA 3WHUB 3TUYC 1JF2A 2NZ0A 2K2AA 2NXQA 3SG6A 2F33A 1BT6A 5CSJA 3AAKA 3E3RA 4DRWA 4YGBB 1YX7A 1IG5A 2MLFC 2LHLA 2E6WA 1LKJA 4MVFA 4P2YB 1NX2A 2LVJA 1GGWA 1WLZA 3VRQA 3CTNA 5J3XA 5KTYA 2F2PA 2F2OA 2MJWB 5AERA 2K2FA 3EK7A 2LANA 4I5LB 4PE1A 2B1UA 2KYFA 4GGNA 1SNLA 2KGRA 1WLMA 4YBHB 1JBAA 1A29A 3EK4A 4YI8A 1SY9A 1A4PA 1CMFA 3H4SE 1Y6WA 1MXLC 2L4IA 2JNFA 1QV0A 1KK7Y 1MQ1A 2PMYA 5AANA 1KK8C 1JUOA 1EXRA 1WY9A 2CBLA 2KI6C 1IGVA 3A8RA 2EC6B 1JF0A 1CMGA 2ZKMX 1CM1A 1N2DA 2KAVA 2M0RA 1BU3A 4I5JA 1DJZA 1PALA 1K9PA 2K0JA 3SJSA 4CFQA 3HX4A 4YGCB 1PULA 4CFRA 5HKYA 1IKUA 5GQQC 5I8NA 4MEWA 2CXJA 4ETOA 2LC5A 1NX0A 1ALWA 1SBJA 2KAXA 2LNKA 4MRXA 2RGIA 1W7JB 3SG7A 3NSOA 3WXAA 1YTZC 1K9KA 1WDCB 3K21A 1F8HA 1S26D 2FJUB 5AFPA 1QLSA 2TN4A 2MAZA 1BLQA 1DMOA 1PSRA 4MZLA 1CTRA 1YRUB 1ZMZA 2LLSA 2CNPA 5KU1A 2KGBC 1CDPA 3OX5A 3D10A 4GPLB 5D69A 3DF0B 1SL9A 2BBNA 2M7NA 2SASA 3I5GC 4PE0A 5K89A 1NUBA 3PM8A 3ICBA 1AP4A 1H8BA 1BF5A 2AUCA 2KSPA 4YRUA 3CR4X 1YUSA 3I5HC 4YGDB 3KPXA 4DIRA 1KFXS 4ICBA 1D1OA 4NDBA 1UURA
chains in the Genus database with same CATH superfamily
1OMDA 5D3OA 4JD9A 1TRFA 3CZTX 3R72A 3IF7A 1JC2A 1DTLA 2QACA 4NDDA 3PM2A 4AQIA 3OB1B 3GOFA 1YX8A 1K93D 2KOTA 2OTGB 3EVRA 1Y1XA 1NYAA 1Z2CB 2BNXA 3GK4X 3TS5C 1AUIB 1W9ZA 1OOIX 3SIBA 1J7QA 1VRKA 3OHMB 1AK8A 5EL2A 2KQYA 2QPTA 2KI6D 2ZN9A 3BYAA 3B88A 5F6TA 4GGFC 1BG1A 1OSAA 1M45A 2L2CA 2D8NA 1KCYA 3CR2A 5IBWA 3L4AA 3OX6A 4A4CA 2ZRSA 2JULA 4E68A 3IQQA 4MRYA 1RECA 1ZOTB 2ZN8A 3DZTA 1MWNA 2LV7A 3BFHA 3SG5A 1QVIY 2LMVA 1E8AA 2JWWA 3JTDB 1DJIA 1S6IA 3CR5X 3SS3A 1M46A 3PALA 3WNXB 1N65A 1YVHA 4INXA 1S5GZ 3A4UB 4XJKB 5I94A 2Q4UA 3CGAA 1YVLA 4F0ZB 2H61A 3LLEA 3O4XA 3CABA 2KBMA 1SCMC 3NGVA 4QJ4B 1RJVA 3C1VA 4MZKA 5FI2A 3I5FC 3D74A 4OVNF 2LCPA 1L2OC 2QEBA 2L51A 4MN0A 4QJ3B 2LMTA 1XFVO 1AVSA 1BJFA 1FW4A 5I2QA 1OZSA 1SPYA 3KEVA 2FJYA 2BKIB 4U8DA 2F3ZA 2QEHA 1EH2A 2LLUA 5TNCA 2OTGC 4F7FA 4MZJA 1B47A 1CDMA 1ALVA 1S5GY 4GNKB 5JOLA 1DQEA 1GQMA 1DELA 3CS1A 3VROA 2KNEA 5DKNA 2M7LA 2Y4QA 4HSZA 2M97A 1CNPA 4ORAB 2HPSA 1K90D 2KLEA 4KYNA 1KQVA 2GGMA 3NHIA 3NSLA 2LE9B 2WOSA 2FCDA 2FOTA 1L2OB 4YGAA 5B8IB 1SW8A 1WRZA 4MLWA 2O5GA 2F3YA 1XK4A 1NCZA 1YRTB 2FCEA 2KFHA 1BOCA 4M2OA 1SL8A 5DKRA 1RFJA 1G33A 1UHJA 2M3WA 3D76A 1OE9B 1B9AA 2KLDA 3DD4A 2JXLA 1FF1A 2EC6C 5HL1A 1PVAA 3S0AA 2CT9A 3B7AA 2IS9A 3SG3A 1ZFSA 4Q04A 3AKBA 3FS7A 2I2RE 2PASA 1SR6C 1KSMA 4I5NB 1DC1A 2KHNA 1R2UA 1S1EA 1XFZO 3CLNA 3EKHA 1DGUA 1DF0B 1XO5A 4BY5A 3I5IC 2WCKA 1CFFA 4PHNA 1YUTA 1F4OA 1WDCC 5FI6A 1TWOA 3KO0A 5CSFA 4QJ5B 1TNWA 1V1FA 1QWVA 3MSEB 3O78A 3B87A 2CCMA 4P5OE 1WRLA 2JQ6A 3EK8A 2OPOA 2BCAA 3EVUA 3FWCA 4I5KA 1KFXL 1GGZA 1CLMA 3PN7B 3ZWHA 1U5IB 3CWGA 1L7ZA 4HRGA 2KYCA 1PRWA 1LVCD 3BUXB 2VRGA 2PSRA 3BUOB 1H4BA 5PALA 1CDLA 2JNXA 1J7OA 1B1GA 1IWQA 1NWDA 5AEQA 1MUXA 1Y1UA 1BMOA 1NX1A 1TIZA 2K61A 3I5GB 2I18A 3JVTB 3N7HA 4YGEB 5ER5A 3I5IB 1KWOB 1XFUO 2E30A 1C3ZA 4N5XA 1FI6A 2GTEA 2JTTA 3NSIA 1FBVA 3FIAA 2G2BA 2P6BB 3DVJA 4HRHA 4MBEA 2JT0A 2COLB 1UUSA 1ZACA 4PHJA 1K2HA 3R1PA 2BL0B 1K95A 3PN7C 1K9UA 3PFVA 2F8PA 1SCMB 1Q80A 1TNQA 1LS8A 4OZDA 1CB1A 2K7BA 1SL7A 2KFGA 2WCMA 4DS7A 1B8LA 2LUXA 3VGOA 1B4CA 1EG4A 4IL1A 2JT8A 1T14A 2WCJA 3D75A 1DVIA 1QX5B 3WHTB 2LHIA 1YUUA 2KAYA 3TDIA 3TDZA 1CFPA 2K7CA 3SG2A 2KBIA 5HKZA 1XYDA 1Y1AA 1Z4HA 4R1EA 4GBAA 4WQ3A 3FE8A 1QS7A 1RROA 4XYNA 3D0YB 3EVVA 2QEVA 4JKTA 3Q8IA 2PRUA 1R6PA 3BUMB 3FE6A 3CZ1A 1IIOA 1V1GA 1YURA 2KPHA 3JVTC 1AJ4A 2HF5A 1KWOC 3DY9A 4OKHA 1J1DA 2H8VA 2I7AA 4PDZA 2G9BA 1QX2A 1BR4B 4WQ2A 2MBXA 2M1KB 3BJHA 3DVKA 5BPJA 2KI4B 3AKAA 3S0GA 3AAJA 2Y1MA 1BODA 1CM4A 1JFJA 1ZUZA 1W7IB 1S6CA 1J7RA 3PATA 2BL0C 1TCFA 3TZ1A 5D7FA 4CPVA 1TUJA 1XK4C 4M2PA 4FQOA 3R1OA 4GFTA 4N1FA 1FI5A 5DICA 4PT1A 1B7TZ 2BAPA 1CKKA 2LVVA 4NQGA 2Y1NA 3BXKA 2K8MB 1DJHA 1JWDA 2WC8A 3VRPA 2ZFDA 3I5HB 1CLLA 4GUKA 5HLVA 3BFAA 2L2EA 1EJ3A 2M9GA 2YGUA 2MLEC 2PVBA 1UWOA 1DJXA 4INWA 2LP2A 1OQPA 4PE7A 5HYDA 2JZIA 4CIDA 1OOFA 1P28A 5AXIA 1RTP1 1JFKA 3D78A 3L4LA 3UO9A 1QIWA 1N0YA 1A75B 2L50A 4ZCVA 1X02A 3DXLA 2LVIA 1IQ3A 1ORGA 3OBVA 1F54A 3TDUA 1PK0D 1RWYA 3EKJA 1OOHA 1UHIA 3SG4A 1F70A 2H61C 5I2LA 1KQMC 2WCBA 1KK8B 1TCOB 3IQOA 2L4HA 2L0PA 1ODBA 3NSKA 1SKTA 3D0YA 4PHKA 3S0BA 2GGZA 1S6JA 3CZ2A 1C7WA 1F55A 1LA3A 4L9MA 5ER4X 1OMRA 2OS8B 1B8RA 2MRDA 1XA5A 3CYZA 2WCFA 3NXAA 3HCMA 2MA2A 3RLZA 3FE9A 1C7VA 3SS5A 3LK0A 1MXEA 3R1VA 3VRNA 1JSAA 1SRAA 2LM5A 2ZRTA 1UHKA 3CDNA 3DVEA 4JWQA 2WCHA 3PSRA 2I94A 1QX7A 1QASA 3TUYB 2LAPA 1PSBA 1QTXA 1TUZA 5HLOA 5FYXA 1NCXA 1PVBA 1SSEB 3PLFB 4HREE 3BFBA 1KQMB 1IH0A 5G08A 2BCBA 1YR5A 2HETA 1MR8A 2QDIA 4GAOA 4M2QA 2LVKA 2KDHA 2Q91A 4C0LA 3O2PA 4PCWA 4CLNA 1SMGA 5JJGA 2AAOA 1SK6D 3GK1A 3OB2B 3D77A 4ZCUA 2JC2A 1MF8B 2JXCA 2O60A 1KFUL 3QRXA 2JU0A 3FWBA 1SR6B 1G8IA 2ISDA 3V2LA 1LINA 2HQ8A 3RM1A 2M8UA 1J7PA 4BY4A 2KI4C 4ORBB 3OGNA 2WNDA 4TNCA 2GV5A 1G4YR 4USLA 1F4QA 2K7OA 1HQVA 1M31A 3L47A 1FPWA 3D73A 2OS8C 1S3PA 1K96A 3UNWA 1NSHA 4AQJA 1TTXA 1LA0A 2M1UA 1NP8A 5I2OA 2H2KA 2L5YA 1IJ6A 1K94A 4OV2A 1DEKA 5CSIA 4A4BA 1EL4A 4OR9B 4WRIA 1UP5A 2SCPA 4JPZB 2JT3A 1DJWA 3BUNB 2L98A 1DJYA 1M39A 1M63B 1Y0VH 1QJTA 4JQ0D 1SCVA 2BCXA 3BOWA 1QLKA 3O4YA 4MSPA 3DVMA 2P70A 3LCPC 4PHMA 3VRRA 1GM0A 3JTDC 1A2XA 3OP0A 2K7DA 1HT9A 4DUQA 2AMIA 1OW4A 1AJ5A 1NX3A 1KFUS 2EHBA 2WORA 1OOJA 1CFCA 1KSOA 4C0KA 1A75A 2PYQA 1TNXA 4ORCB 4DCKA 1BR1B 2JRFA 2NLNA 3I5FB 3SIAA 1TNPA 2EGDA 1XFRA 4PE4A 3O6BA 1C07A 3M0WA 2BE4A 1TOPA 1QV1A 1UHNA 3KF9A 2NCPA 4YI9A 2JPTA 1RK9A 2LMUA 2P71A 2KFFA 3VB1A 5CSNA 1WRKA 5HKWA 1CLBA 1MHOA 4AOMA 4NDCA 2BECA 1AHRA 1EG3A 1NCYA 1B7TY 1S36A 2Y5IA 2MHHA 2LUCA 3B86A 3GK2A 1OMVA 4D1EA 1F71A 1IQ5A 2QEOA 1DT7B 2JTZA 4FTGA 4GGFA 1TN4A 2CTNA 2L5XB 3ZNIA 3BQ3A 1QIVA 1SYMA 1QATA 1A03A 2KQ6A 3KHEA 3BOWB 1KK7Z 1NIWA 2HQWA 2R2IA 1XVJA 1DJGA 2BBMA 1IRJA 3LL8B 1OOGA 3LK1A 1UHHA 2LLTA 3QMEA 5KSZA 5DKQA 1QVIZ 1XFWO 4OCIA 5CPVA 2ZNEA 1XFXO 1DGVA 3CZ0A 1U5IA 1QXPA 1K8UA 1J55A 3F45A 4N1GA 2DOQA 2NCOA 2ZNDA 1LXFC 1NPQA 2LP3A 2JOJA 4PALA 1IJ5A 1J1EA 2BKHB 2ERBA 1B8CA 2V53A 3EG5B 2JPOA 4XJKA 2M29A 2M49B 3B6XA 1XFYO 1CFDA 3TS5B 1GJYA 1DF0A 3BUWB 2K60A 2PALA 1OZOA 2A4JA 4C0JA 2WCEA 2BE6A 3DF0A 4UPGA 1CDNA 3WHUB 4IJ7A 1JF2A 3S0DA 2NZ0A 3TUYC 2K2AA 2NXQA 3SG6A 2F33A 1BT6A 5CSJA 3AAKA 3S0EA 3E3RA 4DRWA 4YGBB 1YX7A 1IG5A 2MLFC 2LHLA 2E6WA 1LKJA 4MVFA 2WC5A 1NX2A 2LVJA 2WC6A 1WLZA 4P2YB 3VRQA 1GGWA 3CTNA 5J3XA 5KTYA 2F2PA 2F2OA 2MJWB 3SS4A 5AERA 2K2FA 3EK7A 2LANA 4I5LB 4PE1A 2B1UA 2KYFA 4FQTA 4GGNA 1SNLA 2KGRA 1WLMA 4YBHB 1JBAA 1A29A 3EK4A 4YI8A 1SY9A 1A4PA 1CMFA 3H4SE 1Y6WA 1MXLC 2L4IA 2JNFA 1QV0A 1KK7Y 1MQ1A 2PMYA 5AANA 3K1EA 1KK8C 1JUOA 1EXRA 1WY9A 2CBLA 2KI6C 1IGVA 3PJIA 3A8RA 2EC6B 3DYEA 1JF0A 1CMGA 2ZKMX 1CM1A 1N2DA 2KAVA 2M0RA 1BU3A 4I5JA 1DJZA 1PALA 3S0FA 1K9PA 1C3YA 2K0JA 3SJSA 4CFQA 3HX4A 4YGCB 1PULA 4CFRA 5HKYA 1IKUA 5GQQC 5I8NA 4MEWA 2CXJA 4ETOA 2LC5A 3IVTA 1NX0A 1ALWA 1SBJA 2KAXA 2LNKA 4MRXA 2RGIA 1W7JB 3SG7A 3NSOA 3WXAA 1YTZC 1K9KA 1WDCB 3K21A 1F8HA 1S26D 2FJUB 5AFPA 1QLSA 2TN4A 2MAZA 1BLQA 1DMOA 1PSRA 3NHTA 4MZLA 1CTRA 5FI7A 1YRUB 1ZMZA 2LLSA 3RZSA 2CNPA 5KU1A 2KGBC 1CDPA 3OX5A 3D10A 4GPLB 5D69A 3DF0B 1SL9A 2BBNA 2M7NA 2SASA 3I5GC 4PE0A 5K89A 1NUBA 3PM8A 3ICBA 1AP4A 1H8BA 1BF5A 2AUCA 2KSPA 4YRUA 2PQLA 2WCLA 3CR4X 1YUSA 3I5HC 4YGDB 3KPXA 4DIRA 1KFXS 4ICBA 1D1OA 4NDBA 1UURA
chains in the Genus database with same CATH topology
1OMDA 1TRFA 3CZTX 3IF7A 1JC2A 1DTLA 2QACA 4NDDA 4AQIA 3OB1B 3GOFA 1YX8A 1K93D 2KOTA 2OTGB 3EVRA 1Y1XA 1NYAA 3TS5C 3GK4X 1AUIB 3SIBA 1J7QA 1VRKA 3OHMB 1AK8A 2KQYA 2QPTA 2KI6D 2ZN9A 3BYAA 5F6TA 1BG1A 4GGFC 1OSAA 1M45A 2D8NA 1KCYA 3CR2A 5IBWA 3OX6A 4A4CA 2ZRSA 2JULA 4E68A 3IQQA 4MRYA 1RECA 1ZOTB 2ZN8A 1MWNA 2LV7A 3SG5A 1QVIY 2LMVA 1E8AA 2JWWA 3JTDB 1DJIA 1S6IA 3CR5X 1M46A 3PALA 3WNXB 1N65A 1YVHA 1S5GZ 3A4UB 4XJKB 2Q4UA 3CGAA 1YVLA 4F0ZB 2H61A 3LLEA 2KBMA 1SCMC 4QJ4B 1RJVA 3C1VA 4MZKA 3I5FC 4OVNF 2LCPA 1L2OC 2L51A 4MN0A 4QJ3B 2LMTA 1XFVO 1AVSA 1BJFA 1FW4A 5I2QA 1OZSA 1SPYA 3KEVA 2BKIB 4U8DA 2F3ZA 1EH2A 2LLUA 5TNCA 2OTGC 4MZJA 1B47A 1CDMA 1ALVA 1S5GY 4GNKB 5JOLA 1GQMA 3CS1A 3VROA 2KNEA 5DKNA 2M7LA 2Y4QA 4HSZA 2M97A 1CNPA 4ORAB 2HPSA 1K90D 1KQVA 2GGMA 3NSLA 2LE9B 2WOSA 2FCDA 2FOTA 1L2OB 4YGAA 5B8IB 1SW8A 1WRZA 4MLWA 2O5GA 2F3YA 1XK4A 1NCZA 1YRTB 2FCEA 2KFHA 1BOCA 4M2OA 1SL8A 5DKRA 1RFJA 1G33A 1UHJA 2M3WA 1OE9B 1B9AA 3DD4A 2JXLA 1FF1A 2EC6C 1PVAA 2CT9A 2IS9A 3SG3A 1ZFSA 4Q04A 3AKBA 3FS7A 2I2RE 2PASA 1SR6C 1KSMA 4I5NB 2KHNA 1R2UA 1S1EA 1XFZO 3CLNA 3EKHA 1DGUA 1DF0B 1XO5A 4BY5A 3I5IC 1CFFA 4PHNA 1YUTA 1F4OA 1WDCC 4QJ5B 5CSFA 3KO0A 1TNWA 1V1FA 3MSEB 3O78A 4P5OE 2CCMA 1WRLA 2JQ6A 3EK8A 2OPOA 2BCAA 3EVUA 3FWCA 4I5KA 1KFXL 1GGZA 1CLMA 3PN7B 3ZWHA 1U5IB 3CWGA 1L7ZA 4HRGA 2KYCA 1PRWA 1LVCD 3BUXB 2VRGA 2PSRA 3BUOB 1H4BA 5PALA 1CDLA 2JNXA 1J7OA 1B1GA 1IWQA 1NWDA 5AEQA 1MUXA 1Y1UA 1BMOA 1NX1A 1TIZA 2K61A 3I5GB 2I18A 3JVTB 4YGEB 5ER5A 3I5IB 1KWOB 1XFUO 2E30A 1FI6A 4N5XA 2JTTA 3NSIA 1FBVA 3FIAA 2G2BA 2P6BB 3DVJA 4HRHA 4MBEA 2JT0A 2COLB 1UUSA 1ZACA 4PHJA 1K2HA 2BL0B 1K95A 3PN7C 1K9UA 3PFVA 2F8PA 1SCMB 1Q80A 1TNQA 1CB1A 2K7BA 1SL7A 2KFGA 4DS7A 1B8LA 2LUXA 3VGOA 1B4CA 1EG4A 4IL1A 2JT8A 3WHTB 1DVIA 1QX5B 2LHIA 1YUUA 2KAYA 3TDIA 3TDZA 1CFPA 2K7CA 3SG2A 2KBIA 5HKZA 1XYDA 1Y1AA 4R1EA 4GBAA 4WQ3A 1QS7A 1RROA 4XYNA 3D0YB 3EVVA 2PRUA 1R6PA 3BUMB 1V1GA 1YURA 3JVTC 1AJ4A 2HF5A 1KWOC 4OKHA 1J1DA 2I7AA 4PDZA 2G9BA 1QX2A 1BR4B 4WQ2A 2MBXA 2M1KB 5BPJA 3DVKA 2KI4B 3AKAA 3AAJA 2Y1MA 1BODA 1CM4A 1JFJA 1ZUZA 1W7IB 1S6CA 1J7RA 3PATA 2BL0C 1TCFA 3TZ1A 5D7FA 4CPVA 1XK4C 4M2PA 4FQOA 4GFTA 4N1FA 1FI5A 1B7TZ 1CKKA 2LVVA 4NQGA 2Y1NA 3BXKA 2K8MB 1DJHA 1JWDA 2WC8A 3VRPA 2ZFDA 3I5HB 1CLLA 4GUKA 5HLVA 2L2EA 1EJ3A 2M9GA 2MLEC 2PVBA 1UWOA 1DJXA 5HYDA 2LP2A 1OQPA 4PE7A 2JZIA 4CIDA 5AXIA 1RTP1 1JFKA 1QIWA 1N0YA 1A75B 2L50A 4ZCVA 1X02A 2LVIA 1IQ3A 1F54A 3TDUA 1PK0D 1RWYA 3EKJA 1UHIA 3SG4A 1F70A 2H61C 5I2LA 1KQMC 2WCBA 1KK8B 1TCOB 3IQOA 2L4HA 2L0PA 1ODBA 3NSKA 1SKTA 3D0YA 4PHKA 2GGZA 1S6JA 1C7WA 1F55A 1LA3A 4L9MA 5ER4X 1OMRA 2OS8B 1B8RA 2MRDA 1XA5A 2WCFA 3NXAA 3HCMA 2MA2A 3RLZA 1C7VA 1JSAA 3LK0A 1MXEA 3VRNA 1SRAA 2LM5A 2ZRTA 1UHKA 3DVEA 4JWQA 3PSRA 2I94A 1QX7A 1QASA 3TUYB 2LAPA 1PSBA 1QTXA 5HLOA 5FYXA 1NCXA 1PVBA 3PLFB 4HREE 1KQMB 1IH0A 5G08A 2BCBA 1YR5A 2HETA 1MR8A 4GAOA 4M2QA 2LVKA 2KDHA 2Q91A 4C0LA 3O2PA 4PCWA 4CLNA 1SMGA 5JJGA 2AAOA 1SK6D 3GK1A 3OB2B 4ZCUA 2JC2A 1MF8B 2JXCA 2O60A 1KFUL 3QRXA 2JU0A 3FWBA 1SR6B 1G8IA 2ISDA 1LINA 2HQ8A 3RM1A 2M8UA 1J7PA 4BY4A 2KI4C 4ORBB 2WNDA 4TNCA 2GV5A 1G4YR 4USLA 1F4QA 2K7OA 1HQVA 1M31A 1FPWA 2OS8C 1S3PA 1K96A 4AQJA 1NSHA 1TTXA 1LA0A 2M1UA 1NP8A 5I2OA 2H2KA 1IJ6A 1K94A 4OV2A 5CSIA 4A4BA 1EL4A 4OR9B 4WRIA 1UP5A 2SCPA 4JPZB 2JT3A 1DJWA 3BUNB 2L98A 1DJYA 1M39A 1M63B 1Y0VH 1QJTA 4JQ0D 1SCVA 2BCXA 3BOWA 1QLKA 3O4YA 4MSPA 3DVMA 3LCPC 4PHMA 3VRRA 3JTDC 1A2XA 3OP0A 2K7DA 1HT9A 4DUQA 2AMIA 1AJ5A 1NX3A 1KFUS 2EHBA 2WORA 1OOJA 1CFCA 1KSOA 4C0KA 1A75A 4ORCB 1TNXA 4DCKA 1BR1B 2JRFA 2NLNA 3I5FB 3SIAA 1TNPA 2EGDA 1C07A 4PE4A 3O6BA 3M0WA 2BE4A 1TOPA 1QV1A 1UHNA 3KF9A 2NCPA 4YI9A 2JPTA 1RK9A 2LMUA 2KFFA 5CSNA 1WRKA 5HKWA 1CLBA 1MHOA 4AOMA 4NDCA 2BECA 1AHRA 1EG3A 1NCYA 1B7TY 1S36A 2Y5IA 2MHHA 2LUCA 3GK2A 4D1EA 1OMVA 1F71A 1IQ5A 1DT7B 2JTZA 4FTGA 4GGFA 1TN4A 2CTNA 2L5XB 3ZNIA 3BQ3A 1QIVA 1SYMA 1QATA 1A03A 2KQ6A 3KHEA 3BOWB 1KK7Z 1NIWA 2HQWA 2R2IA 1XVJA 1DJGA 2BBMA 1IRJA 3LL8B 3LK1A 1UHHA 2LLTA 5KSZA 5DKQA 1QVIZ 1XFWO 4OCIA 5CPVA 2ZNEA 1XFXO 1DGVA 1U5IA 1QXPA 1K8UA 1J55A 3F45A 4N1GA 2DOQA 2NCOA 2ZNDA 1LXFC 1NPQA 2LP3A 2JOJA 4PALA 1IJ5A 1J1EA 2BKHB 1B8CA 2V53A 4XJKA 2M29A 2M49B 1XFYO 1CFDA 3TS5B 1GJYA 1DF0A 3BUWB 2PALA 1OZOA 2A4JA 4C0JA 2WCEA 2BE6A 3DF0A 4UPGA 1CDNA 3WHUB 3TUYC 1JF2A 2NZ0A 2K2AA 2NXQA 3SG6A 2F33A 1BT6A 5CSJA 3AAKA 3E3RA 4DRWA 4YGBB 1YX7A 1IG5A 2MLFC 2LHLA 2E6WA 1LKJA 4MVFA 4P2YB 1NX2A 2LVJA 1GGWA 1WLZA 3VRQA 3CTNA 5J3XA 5KTYA 2F2PA 2F2OA 2MJWB 5AERA 2K2FA 3EK7A 2LANA 4I5LB 4PE1A 2B1UA 2KYFA 4GGNA 1SNLA 2KGRA 1WLMA 4YBHB 1JBAA 1A29A 3EK4A 4YI8A 1SY9A 1A4PA 1CMFA 3H4SE 1Y6WA 1MXLC 2L4IA 2JNFA 1QV0A 1KK7Y 1MQ1A 2PMYA 5AANA 1KK8C 1JUOA 1EXRA 1WY9A 2CBLA 2KI6C 1IGVA 3A8RA 2EC6B 1JF0A 1CMGA 2ZKMX 1CM1A 1N2DA 2KAVA 2M0RA 1BU3A 4I5JA 1DJZA 1PALA 1K9PA 2K0JA 3SJSA 4CFQA 3HX4A 4YGCB 1PULA 4CFRA 5HKYA 1IKUA 5GQQC 5I8NA 4MEWA 2CXJA 4ETOA 2LC5A 1NX0A 1ALWA 1SBJA 2KAXA 2LNKA 4MRXA 2RGIA 1W7JB 3SG7A 3NSOA 3WXAA 1YTZC 1K9KA 1WDCB 3K21A 1F8HA 1S26D 2FJUB 5AFPA 1QLSA 2TN4A 2MAZA 1BLQA 1DMOA 1PSRA 4MZLA 1CTRA 1YRUB 1ZMZA 2LLSA 2CNPA 5KU1A 2KGBC 1CDPA 3OX5A 3D10A 4GPLB 5D69A 3DF0B 1SL9A 2BBNA 2M7NA 2SASA 3I5GC 4PE0A 5K89A 1NUBA 3PM8A 3ICBA 1AP4A 1H8BA 1BF5A 2AUCA 2KSPA 4YRUA 3CR4X 1YUSA 3I5HC 4YGDB 3KPXA 4DIRA 1KFXS 4ICBA 1D1OA 4NDBA 1UURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMD A;  1TRF A;  3CZT X;  3IF7 A;  1JC2 A;  1DTL A;  2QAC A;  4NDD A;  4AQI A;  3OB1 B;  3GOF A;  1YX8 A;  1K93 D;  2KOT A;  2OTG B;  3EVR A;  1Y1X A;  1NYA A;  3TS5 C;  3GK4 X;  1AUI B;  3SIB A;  1J7Q A;  1VRK A;  3OHM B;  1AK8 A;  2KQY A;  2QPT A;  2KI6 D;  2ZN9 A;  3BYA A;  5F6T A;  1BG1 A;  4GGF C;  1OSA A;  1M45 A;  2D8N A;  1KCY A;  3CR2 A;  5IBW A;  3OX6 A;  4A4C A;  2ZRS A;  2JUL A;  4E68 A;  3IQQ A;  4MRY A;  1REC A;  1ZOT B;  2ZN8 A;  1MWN A;  2LV7 A;  3SG5 A;  1QVI Y;  2LMV A;  1E8A A;  2JWW A;  3JTD B;  1DJI A;  1S6I A;  3CR5 X;  1M46 A;  3PAL A;  3WNX B;  1N65 A;  1YVH A;  1S5G Z;  3A4U B;  4XJK B;  2Q4U A;  3CGA A;  1YVL A;  4F0Z B;  2H61 A;  3LLE A;  2KBM A;  1SCM C;  4QJ4 B;  1RJV A;  3C1V A;  4MZK A;  3I5F C;  4OVN F;  2LCP A;  1L2O C;  2L51 A;  4MN0 A;  4QJ3 B;  2LMT A;  1XFV O;  1AVS A;  1BJF A;  1FW4 A;  5I2Q A;  1OZS A;  1SPY A;  3KEV A;  2BKI B;  4U8D A;  2F3Z A;  1EH2 A;  2LLU A;  5TNC A;  2OTG C;  4MZJ A;  1B47 A;  1CDM A;  1ALV A;  1S5G Y;  4GNK B;  5JOL A;  1GQM A;  3CS1 A;  3VRO A;  2KNE A;  5DKN A;  2M7L A;  2Y4Q A;  4HSZ A;  2M97 A;  1CNP A;  4ORA B;  2HPS A;  1K90 D;  1KQV A;  2GGM A;  3NSL A;  2LE9 B;  2WOS A;  2FCD A;  2FOT A;  1L2O B;  4YGA A;  5B8I B;  1SW8 A;  1WRZ A;  4MLW A;  2O5G A;  2F3Y A;  1XK4 A;  1NCZ A;  1YRT B;  2FCE A;  2KFH A;  1BOC A;  4M2O A;  1SL8 A;  5DKR A;  1RFJ A;  1G33 A;  1UHJ A;  2M3W A;  1OE9 B;  1B9A A;  3DD4 A;  2JXL A;  1FF1 A;  2EC6 C;  1PVA A;  2CT9 A;  2IS9 A;  3SG3 A;  1ZFS A;  4Q04 A;  3AKB A;  3FS7 A;  2I2R E;  2PAS A;  1SR6 C;  1KSM A;  4I5N B;  2KHN A;  1R2U A;  1S1E A;  1XFZ O;  3CLN A;  3EKH A;  1DGU A;  1DF0 B;  1XO5 A;  4BY5 A;  3I5I C;  1CFF A;  4PHN A;  1YUT A;  1F4O A;  1WDC C;  4QJ5 B;  5CSF A;  3KO0 A;  1TNW A;  1V1F A;  3MSE B;  3O78 A;  4P5O E;  2CCM A;  1WRL A;  2JQ6 A;  3EK8 A;  2OPO A;  2BCA A;  3EVU A;  3FWC A;  4I5K A;  1KFX L;  1GGZ A;  1CLM A;  3PN7 B;  3ZWH A;  1U5I B;  3CWG A;  1L7Z A;  4HRG A;  2KYC A;  1PRW A;  1LVC D;  3BUX B;  2VRG A;  2PSR A;  3BUO B;  1H4B A;  5PAL A;  1CDL A;  2JNX A;  1J7O A;  1B1G A;  1IWQ A;  1NWD A;  5AEQ A;  1MUX A;  1Y1U A;  1BMO A;  1NX1 A;  1TIZ A;  2K61 A;  3I5G B;  2I18 A;  3JVT B;  4YGE B;  5ER5 A;  3I5I B;  1KWO B;  1XFU O;  2E30 A;  1FI6 A;  4N5X A;  2JTT A;  3NSI A;  1FBV A;  3FIA A;  2G2B A;  2P6B B;  3DVJ A;  4HRH A;  4MBE A;  2JT0 A;  2COL B;  1UUS A;  1ZAC A;  4PHJ A;  1K2H A;  2BL0 B;  1K95 A;  3PN7 C;  1K9U A;  3PFV A;  2F8P A;  1SCM B;  1Q80 A;  1TNQ A;  1CB1 A;  2K7B A;  1SL7 A;  2KFG A;  4DS7 A;  1B8L A;  2LUX A;  3VGO A;  1B4C A;  1EG4 A;  4IL1 A;  2JT8 A;  3WHT B;  1DVI A;  1QX5 B;  2LHI A;  1YUU A;  2KAY A;  3TDI A;  3TDZ A;  1CFP A;  2K7C A;  3SG2 A;  2KBI A;  5HKZ A;  1XYD A;  1Y1A A;  4R1E A;  4GBA A;  4WQ3 A;  1QS7 A;  1RRO A;  4XYN A;  3D0Y B;  3EVV A;  2PRU A;  1R6P A;  3BUM B;  1V1G A;  1YUR A;  3JVT C;  1AJ4 A;  2HF5 A;  1KWO C;  4OKH A;  1J1D A;  2I7A A;  4PDZ A;  2G9B A;  1QX2 A;  1BR4 B;  4WQ2 A;  2MBX A;  2M1K B;  5BPJ A;  3DVK A;  2KI4 B;  3AKA A;  3AAJ A;  2Y1M A;  1BOD A;  1CM4 A;  1JFJ A;  1ZUZ A;  1W7I B;  1S6C A;  1J7R A;  3PAT A;  2BL0 C;  1TCF A;  3TZ1 A;  5D7F A;  4CPV A;  1XK4 C;  4M2P A;  4FQO A;  4GFT A;  4N1F A;  1FI5 A;  1B7T Z;  1CKK A;  2LVV A;  4NQG A;  2Y1N A;  3BXK A;  2K8M B;  1DJH A;  1JWD A;  2WC8 A;  3VRP A;  2ZFD A;  3I5H B;  1CLL A;  4GUK A;  5HLV A;  2L2E A;  1EJ3 A;  2M9G A;  2MLE C;  2PVB A;  1UWO A;  1DJX A;  5HYD A;  2LP2 A;  1OQP A;  4PE7 A;  2JZI A;  4CID A;  5AXI A;  1RTP 1;  1JFK A;  1QIW A;  1N0Y A;  1A75 B;  2L50 A;  4ZCV A;  1X02 A;  2LVI A;  1IQ3 A;  1F54 A;  3TDU A;  1PK0 D;  1RWY A;  3EKJ A;  1UHI A;  3SG4 A;  1F70 A;  2H61 C;  5I2L A;  1KQM C;  2WCB A;  1KK8 B;  1TCO B;  3IQO A;  2L4H A;  2L0P A;  1ODB A;  3NSK A;  1SKT A;  3D0Y A;  4PHK A;  2GGZ A;  1S6J A;  1C7W A;  1F55 A;  1LA3 A;  4L9M A;  5ER4 X;  1OMR A;  2OS8 B;  1B8R A;  2MRD A;  1XA5 A;  2WCF A;  3NXA A;  3HCM A;  2MA2 A;  3RLZ A;  1C7V A;  1JSA A;  3LK0 A;  1MXE A;  3VRN A;  1SRA A;  2LM5 A;  2ZRT A;  1UHK A;  3DVE A;  4JWQ A;  3PSR A;  2I94 A;  1QX7 A;  1QAS A;  3TUY B;  2LAP A;  1PSB A;  1QTX A;  5HLO A;  5FYX A;  1NCX A;  1PVB A;  3PLF B;  4HRE E;  1KQM B;  1IH0 A;  5G08 A;  2BCB A;  1YR5 A;  2HET A;  1MR8 A;  4GAO A;  4M2Q A;  2LVK A;  2KDH A;  2Q91 A;  4C0L A;  3O2P A;  4PCW A;  4CLN A;  1SMG A;  5JJG A;  2AAO A;  1SK6 D;  3GK1 A;  3OB2 B;  4ZCU A;  2JC2 A;  1MF8 B;  2JXC A;  2O60 A;  1KFU L;  3QRX A;  2JU0 A;  3FWB A;  1SR6 B;  1G8I A;  2ISD A;  1LIN A;  2HQ8 A;  3RM1 A;  2M8U A;  1J7P A;  4BY4 A;  2KI4 C;  4ORB B;  2WND A;  4TNC A;  2GV5 A;  1G4Y R;  4USL A;  1F4Q A;  2K7O A;  1HQV A;  1M31 A;  1FPW A;  2OS8 C;  1S3P A;  1K96 A;  4AQJ A;  1NSH A;  1TTX A;  1LA0 A;  2M1U A;  1NP8 A;  5I2O A;  2H2K A;  1IJ6 A;  1K94 A;  4OV2 A;  5CSI A;  4A4B A;  1EL4 A;  4OR9 B;  4WRI A;  1UP5 A;  2SCP A;  4JPZ B;  2JT3 A;  1DJW A;  3BUN B;  2L98 A;  1DJY A;  1M39 A;  1M63 B;  1Y0V H;  1QJT A;  4JQ0 D;  1SCV A;  2BCX A;  3BOW A;  1QLK A;  3O4Y A;  4MSP A;  3DVM A;  3LCP C;  4PHM A;  3VRR A;  3JTD C;  1A2X A;  3OP0 A;  2K7D A;  1HT9 A;  4DUQ A;  2AMI A;  1AJ5 A;  1NX3 A;  1KFU S;  2EHB A;  2WOR A;  1OOJ A;  1CFC A;  1KSO A;  4C0K A;  1A75 A;  4ORC B;  1TNX A;  4DCK A;  1BR1 B;  2JRF A;  2NLN A;  3I5F B;  3SIA A;  1TNP A;  2EGD A;  1C07 A;  4PE4 A;  3O6B A;  3M0W A;  2BE4 A;  1TOP A;  1QV1 A;  1UHN A;  3KF9 A;  2NCP A;  4YI9 A;  2JPT A;  1RK9 A;  2LMU A;  2KFF A;  5CSN A;  1WRK A;  5HKW A;  1CLB A;  1MHO A;  4AOM A;  4NDC A;  2BEC A;  1AHR A;  1EG3 A;  1NCY A;  1B7T Y;  1S36 A;  2Y5I A;  2MHH A;  2LUC A;  3GK2 A;  4D1E A;  1OMV A;  1F71 A;  1IQ5 A;  1DT7 B;  2JTZ A;  4FTG A;  4GGF A;  1TN4 A;  2CTN A;  2L5X B;  3ZNI A;  3BQ3 A;  1QIV A;  1SYM A;  1QAT A;  1A03 A;  2KQ6 A;  3KHE A;  3BOW B;  1KK7 Z;  1NIW A;  2HQW A;  2R2I A;  1XVJ A;  1DJG A;  2BBM A;  1IRJ A;  3LL8 B;  3LK1 A;  1UHH A;  2LLT A;  5KSZ A;  5DKQ A;  1QVI Z;  1XFW O;  4OCI A;  5CPV A;  2ZNE A;  1XFX O;  1DGV A;  1U5I A;  1QXP A;  1K8U A;  1J55 A;  3F45 A;  4N1G A;  2DOQ A;  2NCO A;  2ZND A;  1LXF C;  1NPQ A;  2LP3 A;  2JOJ A;  4PAL A;  1IJ5 A;  1J1E A;  2BKH B;  1B8C A;  2V53 A;  4XJK A;  2M29 A;  2M49 B;  1XFY O;  1CFD A;  3TS5 B;  1GJY A;  1DF0 A;  3BUW B;  2PAL A;  1OZO A;  2A4J A;  4C0J A;  2WCE A;  2BE6 A;  3DF0 A;  4UPG A;  1CDN A;  3WHU B;  3TUY C;  1JF2 A;  2NZ0 A;  2K2A A;  2NXQ A;  3SG6 A;  2F33 A;  1BT6 A;  5CSJ A;  3AAK A;  3E3R A;  4DRW A;  4YGB B;  1YX7 A;  1IG5 A;  2MLF C;  2LHL A;  2E6W A;  1LKJ A;  4MVF A;  4P2Y B;  1NX2 A;  2LVJ A;  1GGW A;  1WLZ A;  3VRQ A;  3CTN A;  5J3X A;  5KTY A;  2F2P A;  2F2O A;  2MJW B;  5AER A;  2K2F A;  3EK7 A;  2LAN A;  4I5L B;  4PE1 A;  2B1U A;  2KYF A;  4GGN A;  1SNL A;  2KGR A;  1WLM A;  4YBH B;  1JBA A;  1A29 A;  3EK4 A;  4YI8 A;  1SY9 A;  1A4P A;  1CMF A;  3H4S E;  1Y6W A;  1MXL C;  2L4I A;  2JNF A;  1QV0 A;  1KK7 Y;  1MQ1 A;  2PMY A;  5AAN A;  1KK8 C;  1JUO A;  1EXR A;  1WY9 A;  2CBL A;  2KI6 C;  1IGV A;  3A8R A;  2EC6 B;  1JF0 A;  1CMG A;  2ZKM X;  1CM1 A;  1N2D A;  2KAV A;  2M0R A;  1BU3 A;  4I5J A;  1DJZ A;  1PAL A;  1K9P A;  2K0J A;  3SJS A;  4CFQ A;  3HX4 A;  4YGC B;  1PUL A;  4CFR A;  5HKY A;  1IKU A;  5GQQ C;  5I8N A;  4MEW A;  2CXJ A;  4ETO A;  2LC5 A;  1NX0 A;  1ALW A;  1SBJ A;  2KAX A;  2LNK A;  4MRX A;  2RGI A;  1W7J B;  3SG7 A;  3NSO A;  3WXA A;  1YTZ C;  1K9K A;  1WDC B;  3K21 A;  1F8H A;  1S26 D;  2FJU B;  5AFP A;  1QLS A;  2TN4 A;  2MAZ A;  1BLQ A;  1DMO A;  1PSR A;  4MZL A;  1CTR A;  1YRU B;  1ZMZ A;  2LLS A;  2CNP A;  5KU1 A;  2KGB C;  1CDP A;  3OX5 A;  3D10 A;  4GPL B;  5D69 A;  3DF0 B;  1SL9 A;  2BBN A;  2M7N A;  2SAS A;  3I5G C;  4PE0 A;  5K89 A;  1NUB A;  3PM8 A;  3ICB A;  1AP4 A;  1H8B A;  1BF5 A;  2AUC A;  2KSP A;  4YRU A;  3CR4 X;  1YUS A;  3I5H C;  4YGD B;  3KPX A;  4DIR A;  1KFX S;  4ICB A;  1D1O A;  4NDB A;  1UUR A; 
#chains in the Genus database with same CATH topology
 1OMD A;  5D3O A;  4JD9 A;  1TRF A;  3CZT X;  3R72 A;  3IF7 A;  1JC2 A;  1DTL A;  2QAC A;  4NDD A;  3PM2 A;  4AQI A;  3OB1 B;  3GOF A;  1YX8 A;  1K93 D;  2KOT A;  2OTG B;  3EVR A;  1Y1X A;  1NYA A;  1Z2C B;  2BNX A;  3GK4 X;  3TS5 C;  1AUI B;  1W9Z A;  1OOI X;  3SIB A;  1J7Q A;  1VRK A;  3OHM B;  1AK8 A;  5EL2 A;  2KQY A;  2QPT A;  2KI6 D;  2ZN9 A;  3BYA A;  3B88 A;  5F6T A;  4GGF C;  1BG1 A;  1OSA A;  1M45 A;  2L2C A;  2D8N A;  1KCY A;  3CR2 A;  5IBW A;  3L4A A;  3OX6 A;  4A4C A;  2ZRS A;  2JUL A;  4E68 A;  3IQQ A;  4MRY A;  1REC A;  1ZOT B;  2ZN8 A;  3DZT A;  1MWN A;  2LV7 A;  3BFH A;  3SG5 A;  1QVI Y;  2LMV A;  1E8A A;  2JWW A;  3JTD B;  1DJI A;  1S6I A;  3CR5 X;  3SS3 A;  1M46 A;  3PAL A;  3WNX B;  1N65 A;  1YVH A;  4INX A;  1S5G Z;  3A4U B;  4XJK B;  5I94 A;  2Q4U A;  3CGA A;  1YVL A;  4F0Z B;  2H61 A;  3LLE A;  3O4X A;  3CAB A;  2KBM A;  1SCM C;  3NGV A;  4QJ4 B;  1RJV A;  3C1V A;  4MZK A;  5FI2 A;  3I5F C;  3D74 A;  4OVN F;  2LCP A;  1L2O C;  2QEB A;  2L51 A;  4MN0 A;  4QJ3 B;  2LMT A;  1XFV O;  1AVS A;  1BJF A;  1FW4 A;  5I2Q A;  1OZS A;  1SPY A;  3KEV A;  2FJY A;  2BKI B;  4U8D A;  2F3Z A;  2QEH A;  1EH2 A;  2LLU A;  5TNC A;  2OTG C;  4F7F A;  4MZJ A;  1B47 A;  1CDM A;  1ALV A;  1S5G Y;  4GNK B;  5JOL A;  1DQE A;  1GQM A;  1DEL A;  3CS1 A;  3VRO A;  2KNE A;  5DKN A;  2M7L A;  2Y4Q A;  4HSZ A;  2M97 A;  1CNP A;  4ORA B;  2HPS A;  1K90 D;  2KLE A;  4KYN A;  1KQV A;  2GGM A;  3NHI A;  3NSL A;  2LE9 B;  2WOS A;  2FCD A;  2FOT A;  1L2O B;  4YGA A;  5B8I B;  1SW8 A;  1WRZ A;  4MLW A;  2O5G A;  2F3Y A;  1XK4 A;  1NCZ A;  1YRT B;  2FCE A;  2KFH A;  1BOC A;  4M2O A;  1SL8 A;  5DKR A;  1RFJ A;  1G33 A;  1UHJ A;  2M3W A;  3D76 A;  1OE9 B;  1B9A A;  2KLD A;  3DD4 A;  2JXL A;  1FF1 A;  2EC6 C;  5HL1 A;  1PVA A;  3S0A A;  2CT9 A;  3B7A A;  2IS9 A;  3SG3 A;  1ZFS A;  4Q04 A;  3AKB A;  3FS7 A;  2I2R E;  2PAS A;  1SR6 C;  1KSM A;  4I5N B;  1DC1 A;  2KHN A;  1R2U A;  1S1E A;  1XFZ O;  3CLN A;  3EKH A;  1DGU A;  1DF0 B;  1XO5 A;  4BY5 A;  3I5I C;  2WCK A;  1CFF A;  4PHN A;  1YUT A;  1F4O A;  1WDC C;  5FI6 A;  1TWO A;  3KO0 A;  5CSF A;  4QJ5 B;  1TNW A;  1V1F A;  1QWV A;  3MSE B;  3O78 A;  3B87 A;  2CCM A;  4P5O E;  1WRL A;  2JQ6 A;  3EK8 A;  2OPO A;  2BCA A;  3EVU A;  3FWC A;  4I5K A;  1KFX L;  1GGZ A;  1CLM A;  3PN7 B;  3ZWH A;  1U5I B;  3CWG A;  1L7Z A;  4HRG A;  2KYC A;  1PRW A;  1LVC D;  3BUX B;  2VRG A;  2PSR A;  3BUO B;  1H4B A;  5PAL A;  1CDL A;  2JNX A;  1J7O A;  1B1G A;  1IWQ A;  1NWD A;  5AEQ A;  1MUX A;  1Y1U A;  1BMO A;  1NX1 A;  1TIZ A;  2K61 A;  3I5G B;  2I18 A;  3JVT B;  3N7H A;  4YGE B;  5ER5 A;  3I5I B;  1KWO B;  1XFU O;  2E30 A;  1C3Z A;  4N5X A;  1FI6 A;  2GTE A;  2JTT A;  3NSI A;  1FBV A;  3FIA A;  2G2B A;  2P6B B;  3DVJ A;  4HRH A;  4MBE A;  2JT0 A;  2COL B;  1UUS A;  1ZAC A;  4PHJ A;  1K2H A;  3R1P A;  2BL0 B;  1K95 A;  3PN7 C;  1K9U A;  3PFV A;  2F8P A;  1SCM B;  1Q80 A;  1TNQ A;  1LS8 A;  4OZD A;  1CB1 A;  2K7B A;  1SL7 A;  2KFG A;  2WCM A;  4DS7 A;  1B8L A;  2LUX A;  3VGO A;  1B4C A;  1EG4 A;  4IL1 A;  2JT8 A;  1T14 A;  2WCJ A;  3D75 A;  1DVI A;  1QX5 B;  3WHT B;  2LHI A;  1YUU A;  2KAY A;  3TDI A;  3TDZ A;  1CFP A;  2K7C A;  3SG2 A;  2KBI A;  5HKZ A;  1XYD A;  1Y1A A;  1Z4H A;  4R1E A;  4GBA A;  4WQ3 A;  3FE8 A;  1QS7 A;  1RRO A;  4XYN A;  3D0Y B;  3EVV A;  2QEV A;  4JKT A;  3Q8I A;  2PRU A;  1R6P A;  3BUM B;  3FE6 A;  3CZ1 A;  1IIO A;  1V1G A;  1YUR A;  2KPH A;  3JVT C;  1AJ4 A;  2HF5 A;  1KWO C;  3DY9 A;  4OKH A;  1J1D A;  2H8V A;  2I7A A;  4PDZ A;  2G9B A;  1QX2 A;  1BR4 B;  4WQ2 A;  2MBX A;  2M1K B;  3BJH A;  3DVK A;  5BPJ A;  2KI4 B;  3AKA A;  3S0G A;  3AAJ A;  2Y1M A;  1BOD A;  1CM4 A;  1JFJ A;  1ZUZ A;  1W7I B;  1S6C A;  1J7R A;  3PAT A;  2BL0 C;  1TCF A;  3TZ1 A;  5D7F A;  4CPV A;  1TUJ A;  1XK4 C;  4M2P A;  4FQO A;  3R1O A;  4GFT A;  4N1F A;  1FI5 A;  5DIC A;  4PT1 A;  1B7T Z;  2BAP A;  1CKK A;  2LVV A;  4NQG A;  2Y1N A;  3BXK A;  2K8M B;  1DJH A;  1JWD A;  2WC8 A;  3VRP A;  2ZFD A;  3I5H B;  1CLL A;  4GUK A;  5HLV A;  3BFA A;  2L2E A;  1EJ3 A;  2M9G A;  2YGU A;  2MLE C;  2PVB A;  1UWO A;  1DJX A;  4INW A;  2LP2 A;  1OQP A;  4PE7 A;  5HYD A;  2JZI A;  4CID A;  1OOF A;  1P28 A;  5AXI A;  1RTP 1;  1JFK A;  3D78 A;  3L4L A;  3UO9 A;  1QIW A;  1N0Y A;  1A75 B;  2L50 A;  4ZCV A;  1X02 A;  3DXL A;  2LVI A;  1IQ3 A;  1ORG A;  3OBV A;  1F54 A;  3TDU A;  1PK0 D;  1RWY A;  3EKJ A;  1OOH A;  1UHI A;  3SG4 A;  1F70 A;  2H61 C;  5I2L A;  1KQM C;  2WCB A;  1KK8 B;  1TCO B;  3IQO A;  2L4H A;  2L0P A;  1ODB A;  3NSK A;  1SKT A;  3D0Y A;  4PHK A;  3S0B A;  2GGZ A;  1S6J A;  3CZ2 A;  1C7W A;  1F55 A;  1LA3 A;  4L9M A;  5ER4 X;  1OMR A;  2OS8 B;  1B8R A;  2MRD A;  1XA5 A;  3CYZ A;  2WCF A;  3NXA A;  3HCM A;  2MA2 A;  3RLZ A;  3FE9 A;  1C7V A;  3SS5 A;  3LK0 A;  1MXE A;  3R1V A;  3VRN A;  1JSA A;  1SRA A;  2LM5 A;  2ZRT A;  1UHK A;  3CDN A;  3DVE A;  4JWQ A;  2WCH A;  3PSR A;  2I94 A;  1QX7 A;  1QAS A;  3TUY B;  2LAP A;  1PSB A;  1QTX A;  1TUZ A;  5HLO A;  5FYX A;  1NCX A;  1PVB A;  1SSE B;  3PLF B;  4HRE E;  3BFB A;  1KQM B;  1IH0 A;  5G08 A;  2BCB A;  1YR5 A;  2HET A;  1MR8 A;  2QDI A;  4GAO A;  4M2Q A;  2LVK A;  2KDH A;  2Q91 A;  4C0L A;  3O2P A;  4PCW A;  4CLN A;  1SMG A;  5JJG A;  2AAO A;  1SK6 D;  3GK1 A;  3OB2 B;  3D77 A;  4ZCU A;  2JC2 A;  1MF8 B;  2JXC A;  2O60 A;  1KFU L;  3QRX A;  2JU0 A;  3FWB A;  1SR6 B;  1G8I A;  2ISD A;  3V2L A;  1LIN A;  2HQ8 A;  3RM1 A;  2M8U A;  1J7P A;  4BY4 A;  2KI4 C;  4ORB B;  3OGN A;  2WND A;  4TNC A;  2GV5 A;  1G4Y R;  4USL A;  1F4Q A;  2K7O A;  1HQV A;  1M31 A;  3L47 A;  1FPW A;  3D73 A;  2OS8 C;  1S3P A;  1K96 A;  3UNW A;  1NSH A;  4AQJ A;  1TTX A;  1LA0 A;  2M1U A;  1NP8 A;  5I2O A;  2H2K A;  2L5Y A;  1IJ6 A;  1K94 A;  4OV2 A;  1DEK A;  5CSI A;  4A4B A;  1EL4 A;  4OR9 B;  4WRI A;  1UP5 A;  2SCP A;  4JPZ B;  2JT3 A;  1DJW A;  3BUN B;  2L98 A;  1DJY A;  1M39 A;  1M63 B;  1Y0V H;  1QJT A;  4JQ0 D;  1SCV A;  2BCX A;  3BOW A;  1QLK A;  3O4Y A;  4MSP A;  3DVM A;  2P70 A;  3LCP C;  4PHM A;  3VRR A;  1GM0 A;  3JTD C;  1A2X A;  3OP0 A;  2K7D A;  1HT9 A;  4DUQ A;  2AMI A;  1OW4 A;  1AJ5 A;  1NX3 A;  1KFU S;  2EHB A;  2WOR A;  1OOJ A;  1CFC A;  1KSO A;  4C0K A;  1A75 A;  2PYQ A;  1TNX A;  4ORC B;  4DCK A;  1BR1 B;  2JRF A;  2NLN A;  3I5F B;  3SIA A;  1TNP A;  2EGD A;  1XFR A;  4PE4 A;  3O6B A;  1C07 A;  3M0W A;  2BE4 A;  1TOP A;  1QV1 A;  1UHN A;  3KF9 A;  2NCP A;  4YI9 A;  2JPT A;  1RK9 A;  2LMU A;  2P71 A;  2KFF A;  3VB1 A;  5CSN A;  1WRK A;  5HKW A;  1CLB A;  1MHO A;  4AOM A;  4NDC A;  2BEC A;  1AHR A;  1EG3 A;  1NCY A;  1B7T Y;  1S36 A;  2Y5I A;  2MHH A;  2LUC A;  3B86 A;  3GK2 A;  1OMV A;  4D1E A;  1F71 A;  1IQ5 A;  2QEO A;  1DT7 B;  2JTZ A;  4FTG A;  4GGF A;  1TN4 A;  2CTN A;  2L5X B;  3ZNI A;  3BQ3 A;  1QIV A;  1SYM A;  1QAT A;  1A03 A;  2KQ6 A;  3KHE A;  3BOW B;  1KK7 Z;  1NIW A;  2HQW A;  2R2I A;  1XVJ A;  1DJG A;  2BBM A;  1IRJ A;  3LL8 B;  1OOG A;  3LK1 A;  1UHH A;  2LLT A;  3QME A;  5KSZ A;  5DKQ A;  1QVI Z;  1XFW O;  4OCI A;  5CPV A;  2ZNE A;  1XFX O;  1DGV A;  3CZ0 A;  1U5I A;  1QXP A;  1K8U A;  1J55 A;  3F45 A;  4N1G A;  2DOQ A;  2NCO A;  2ZND A;  1LXF C;  1NPQ A;  2LP3 A;  2JOJ A;  4PAL A;  1IJ5 A;  1J1E A;  2BKH B;  2ERB A;  1B8C A;  2V53 A;  3EG5 B;  2JPO A;  4XJK A;  2M29 A;  2M49 B;  3B6X A;  1XFY O;  1CFD A;  3TS5 B;  1GJY A;  1DF0 A;  3BUW B;  2K60 A;  2PAL A;  1OZO A;  2A4J A;  4C0J A;  2WCE A;  2BE6 A;  3DF0 A;  4UPG A;  1CDN A;  3WHU B;  4IJ7 A;  1JF2 A;  3S0D A;  2NZ0 A;  3TUY C;  2K2A A;  2NXQ A;  3SG6 A;  2F33 A;  1BT6 A;  5CSJ A;  3AAK A;  3S0E A;  3E3R A;  4DRW A;  4YGB B;  1YX7 A;  1IG5 A;  2MLF C;  2LHL A;  2E6W A;  1LKJ A;  4MVF A;  2WC5 A;  1NX2 A;  2LVJ A;  2WC6 A;  1WLZ A;  4P2Y B;  3VRQ A;  1GGW A;  3CTN A;  5J3X A;  5KTY A;  2F2P A;  2F2O A;  2MJW B;  3SS4 A;  5AER A;  2K2F A;  3EK7 A;  2LAN A;  4I5L B;  4PE1 A;  2B1U A;  2KYF A;  4FQT A;  4GGN A;  1SNL A;  2KGR A;  1WLM A;  4YBH B;  1JBA A;  1A29 A;  3EK4 A;  4YI8 A;  1SY9 A;  1A4P A;  1CMF A;  3H4S E;  1Y6W A;  1MXL C;  2L4I A;  2JNF A;  1QV0 A;  1KK7 Y;  1MQ1 A;  2PMY A;  5AAN A;  3K1E A;  1KK8 C;  1JUO A;  1EXR A;  1WY9 A;  2CBL A;  2KI6 C;  1IGV A;  3PJI A;  3A8R A;  2EC6 B;  3DYE A;  1JF0 A;  1CMG A;  2ZKM X;  1CM1 A;  1N2D A;  2KAV A;  2M0R A;  1BU3 A;  4I5J A;  1DJZ A;  1PAL A;  3S0F A;  1K9P A;  1C3Y A;  2K0J A;  3SJS A;  4CFQ A;  3HX4 A;  4YGC B;  1PUL A;  4CFR A;  5HKY A;  1IKU A;  5GQQ C;  5I8N A;  4MEW A;  2CXJ A;  4ETO A;  2LC5 A;  3IVT A;  1NX0 A;  1ALW A;  1SBJ A;  2KAX A;  2LNK A;  4MRX A;  2RGI A;  1W7J B;  3SG7 A;  3NSO A;  3WXA A;  1YTZ C;  1K9K A;  1WDC B;  3K21 A;  1F8H A;  1S26 D;  2FJU B;  5AFP A;  1QLS A;  2TN4 A;  2MAZ A;  1BLQ A;  1DMO A;  1PSR A;  3NHT A;  4MZL A;  1CTR A;  5FI7 A;  1YRU B;  1ZMZ A;  2LLS A;  3RZS A;  2CNP A;  5KU1 A;  2KGB C;  1CDP A;  3OX5 A;  3D10 A;  4GPL B;  5D69 A;  3DF0 B;  1SL9 A;  2BBN A;  2M7N A;  2SAS A;  3I5G C;  4PE0 A;  5K89 A;  1NUB A;  3PM8 A;  3ICB A;  1AP4 A;  1H8B A;  1BF5 A;  2AUC A;  2KSP A;  4YRU A;  2PQL A;  2WCL A;  3CR4 X;  1YUS A;  3I5H C;  4YGD B;  3KPX A;  4DIR A;  1KFX S;  4ICB A;  1D1O A;  4NDB A;  1UUR A; 
#chains in the Genus database with same CATH homology
 1OMD A;  1TRF A;  3CZT X;  3IF7 A;  1JC2 A;  1DTL A;  2QAC A;  4NDD A;  4AQI A;  3OB1 B;  3GOF A;  1YX8 A;  1K93 D;  2KOT A;  2OTG B;  3EVR A;  1Y1X A;  1NYA A;  3TS5 C;  3GK4 X;  1AUI B;  3SIB A;  1J7Q A;  1VRK A;  3OHM B;  1AK8 A;  2KQY A;  2QPT A;  2KI6 D;  2ZN9 A;  3BYA A;  5F6T A;  1BG1 A;  4GGF C;  1OSA A;  1M45 A;  2D8N A;  1KCY A;  3CR2 A;  5IBW A;  3OX6 A;  4A4C A;  2ZRS A;  2JUL A;  4E68 A;  3IQQ A;  4MRY A;  1REC A;  1ZOT B;  2ZN8 A;  1MWN A;  2LV7 A;  3SG5 A;  1QVI Y;  2LMV A;  1E8A A;  2JWW A;  3JTD B;  1DJI A;  1S6I A;  3CR5 X;  1M46 A;  3PAL A;  3WNX B;  1N65 A;  1YVH A;  1S5G Z;  3A4U B;  4XJK B;  2Q4U A;  3CGA A;  1YVL A;  4F0Z B;  2H61 A;  3LLE A;  2KBM A;  1SCM C;  4QJ4 B;  1RJV A;  3C1V A;  4MZK A;  3I5F C;  4OVN F;  2LCP A;  1L2O C;  2L51 A;  4MN0 A;  4QJ3 B;  2LMT A;  1XFV O;  1AVS A;  1BJF A;  1FW4 A;  5I2Q A;  1OZS A;  1SPY A;  3KEV A;  2BKI B;  4U8D A;  2F3Z A;  1EH2 A;  2LLU A;  5TNC A;  2OTG C;  4MZJ A;  1B47 A;  1CDM A;  1ALV A;  1S5G Y;  4GNK B;  5JOL A;  1GQM A;  3CS1 A;  3VRO A;  2KNE A;  5DKN A;  2M7L A;  2Y4Q A;  4HSZ A;  2M97 A;  1CNP A;  4ORA B;  2HPS A;  1K90 D;  1KQV A;  2GGM A;  3NSL A;  2LE9 B;  2WOS A;  2FCD A;  2FOT A;  1L2O B;  4YGA A;  5B8I B;  1SW8 A;  1WRZ A;  4MLW A;  2O5G A;  2F3Y A;  1XK4 A;  1NCZ A;  1YRT B;  2FCE A;  2KFH A;  1BOC A;  4M2O A;  1SL8 A;  5DKR A;  1RFJ A;  1G33 A;  1UHJ A;  2M3W A;  1OE9 B;  1B9A A;  3DD4 A;  2JXL A;  1FF1 A;  2EC6 C;  1PVA A;  2CT9 A;  2IS9 A;  3SG3 A;  1ZFS A;  4Q04 A;  3AKB A;  3FS7 A;  2I2R E;  2PAS A;  1SR6 C;  1KSM A;  4I5N B;  2KHN A;  1R2U A;  1S1E A;  1XFZ O;  3CLN A;  3EKH A;  1DGU A;  1DF0 B;  1XO5 A;  4BY5 A;  3I5I C;  1CFF A;  4PHN A;  1YUT A;  1F4O A;  1WDC C;  4QJ5 B;  5CSF A;  3KO0 A;  1TNW A;  1V1F A;  3MSE B;  3O78 A;  4P5O E;  2CCM A;  1WRL A;  2JQ6 A;  3EK8 A;  2OPO A;  2BCA A;  3EVU A;  3FWC A;  4I5K A;  1KFX L;  1GGZ A;  1CLM A;  3PN7 B;  3ZWH A;  1U5I B;  3CWG A;  1L7Z A;  4HRG A;  2KYC A;  1PRW A;  1LVC D;  3BUX B;  2VRG A;  2PSR A;  3BUO B;  1H4B A;  5PAL A;  1CDL A;  2JNX A;  1J7O A;  1B1G A;  1IWQ A;  1NWD A;  5AEQ A;  1MUX A;  1Y1U A;  1BMO A;  1NX1 A;  1TIZ A;  2K61 A;  3I5G B;  2I18 A;  3JVT B;  4YGE B;  5ER5 A;  3I5I B;  1KWO B;  1XFU O;  2E30 A;  1FI6 A;  4N5X A;  2JTT A;  3NSI A;  1FBV A;  3FIA A;  2G2B A;  2P6B B;  3DVJ A;  4HRH A;  4MBE A;  2JT0 A;  2COL B;  1UUS A;  1ZAC A;  4PHJ A;  1K2H A;  2BL0 B;  1K95 A;  3PN7 C;  1K9U A;  3PFV A;  2F8P A;  1SCM B;  1Q80 A;  1TNQ A;  1CB1 A;  2K7B A;  1SL7 A;  2KFG A;  4DS7 A;  1B8L A;  2LUX A;  3VGO A;  1B4C A;  1EG4 A;  4IL1 A;  2JT8 A;  3WHT B;  1DVI A;  1QX5 B;  2LHI A;  1YUU A;  2KAY A;  3TDI A;  3TDZ A;  1CFP A;  2K7C A;  3SG2 A;  2KBI A;  5HKZ A;  1XYD A;  1Y1A A;  4R1E A;  4GBA A;  4WQ3 A;  1QS7 A;  1RRO A;  4XYN A;  3D0Y B;  3EVV A;  2PRU A;  1R6P A;  3BUM B;  1V1G A;  1YUR A;  3JVT C;  1AJ4 A;  2HF5 A;  1KWO C;  4OKH A;  1J1D A;  2I7A A;  4PDZ A;  2G9B A;  1QX2 A;  1BR4 B;  4WQ2 A;  2MBX A;  2M1K B;  5BPJ A;  3DVK A;  2KI4 B;  3AKA A;  3AAJ A;  2Y1M A;  1BOD A;  1CM4 A;  1JFJ A;  1ZUZ A;  1W7I B;  1S6C A;  1J7R A;  3PAT A;  2BL0 C;  1TCF A;  3TZ1 A;  5D7F A;  4CPV A;  1XK4 C;  4M2P A;  4FQO A;  4GFT A;  4N1F A;  1FI5 A;  1B7T Z;  1CKK A;  2LVV A;  4NQG A;  2Y1N A;  3BXK A;  2K8M B;  1DJH A;  1JWD A;  2WC8 A;  3VRP A;  2ZFD A;  3I5H B;  1CLL A;  4GUK A;  5HLV A;  2L2E A;  1EJ3 A;  2M9G A;  2MLE C;  2PVB A;  1UWO A;  1DJX A;  5HYD A;  2LP2 A;  1OQP A;  4PE7 A;  2JZI A;  4CID A;  5AXI A;  1RTP 1;  1JFK A;  1QIW A;  1N0Y A;  1A75 B;  2L50 A;  4ZCV A;  1X02 A;  2LVI A;  1IQ3 A;  1F54 A;  3TDU A;  1PK0 D;  1RWY A;  3EKJ A;  1UHI A;  3SG4 A;  1F70 A;  2H61 C;  5I2L A;  1KQM C;  2WCB A;  1KK8 B;  1TCO B;  3IQO A;  2L4H A;  2L0P A;  1ODB A;  3NSK A;  1SKT A;  3D0Y A;  4PHK A;  2GGZ A;  1S6J A;  1C7W A;  1F55 A;  1LA3 A;  4L9M A;  5ER4 X;  1OMR A;  2OS8 B;  1B8R A;  2MRD A;  1XA5 A;  2WCF A;  3NXA A;  3HCM A;  2MA2 A;  3RLZ A;  1C7V A;  1JSA A;  3LK0 A;  1MXE A;  3VRN A;  1SRA A;  2LM5 A;  2ZRT A;  1UHK A;  3DVE A;  4JWQ A;  3PSR A;  2I94 A;  1QX7 A;  1QAS A;  3TUY B;  2LAP A;  1PSB A;  1QTX A;  5HLO A;  5FYX A;  1NCX A;  1PVB A;  3PLF B;  4HRE E;  1KQM B;  1IH0 A;  5G08 A;  2BCB A;  1YR5 A;  2HET A;  1MR8 A;  4GAO A;  4M2Q A;  2LVK A;  2KDH A;  2Q91 A;  4C0L A;  3O2P A;  4PCW A;  4CLN A;  1SMG A;  5JJG A;  2AAO A;  1SK6 D;  3GK1 A;  3OB2 B;  4ZCU A;  2JC2 A;  1MF8 B;  2JXC A;  2O60 A;  1KFU L;  3QRX A;  2JU0 A;  3FWB A;  1SR6 B;  1G8I A;  2ISD A;  1LIN A;  2HQ8 A;  3RM1 A;  2M8U A;  1J7P A;  4BY4 A;  2KI4 C;  4ORB B;  2WND A;  4TNC A;  2GV5 A;  1G4Y R;  4USL A;  1F4Q A;  2K7O A;  1HQV A;  1M31 A;  1FPW A;  2OS8 C;  1S3P A;  1K96 A;  4AQJ A;  1NSH A;  1TTX A;  1LA0 A;  2M1U A;  1NP8 A;  5I2O A;  2H2K A;  1IJ6 A;  1K94 A;  4OV2 A;  5CSI A;  4A4B A;  1EL4 A;  4OR9 B;  4WRI A;  1UP5 A;  2SCP A;  4JPZ B;  2JT3 A;  1DJW A;  3BUN B;  2L98 A;  1DJY A;  1M39 A;  1M63 B;  1Y0V H;  1QJT A;  4JQ0 D;  1SCV A;  2BCX A;  3BOW A;  1QLK A;  3O4Y A;  4MSP A;  3DVM A;  3LCP C;  4PHM A;  3VRR A;  3JTD C;  1A2X A;  3OP0 A;  2K7D A;  1HT9 A;  4DUQ A;  2AMI A;  1AJ5 A;  1NX3 A;  1KFU S;  2EHB A;  2WOR A;  1OOJ A;  1CFC A;  1KSO A;  4C0K A;  1A75 A;  4ORC B;  1TNX A;  4DCK A;  1BR1 B;  2JRF A;  2NLN A;  3I5F B;  3SIA A;  1TNP A;  2EGD A;  1C07 A;  4PE4 A;  3O6B A;  3M0W A;  2BE4 A;  1TOP A;  1QV1 A;  1UHN A;  3KF9 A;  2NCP A;  4YI9 A;  2JPT A;  1RK9 A;  2LMU A;  2KFF A;  5CSN A;  1WRK A;  5HKW A;  1CLB A;  1MHO A;  4AOM A;  4NDC A;  2BEC A;  1AHR A;  1EG3 A;  1NCY A;  1B7T Y;  1S36 A;  2Y5I A;  2MHH A;  2LUC A;  3GK2 A;  4D1E A;  1OMV A;  1F71 A;  1IQ5 A;  1DT7 B;  2JTZ A;  4FTG A;  4GGF A;  1TN4 A;  2CTN A;  2L5X B;  3ZNI A;  3BQ3 A;  1QIV A;  1SYM A;  1QAT A;  1A03 A;  2KQ6 A;  3KHE A;  3BOW B;  1KK7 Z;  1NIW A;  2HQW A;  2R2I A;  1XVJ A;  1DJG A;  2BBM A;  1IRJ A;  3LL8 B;  3LK1 A;  1UHH A;  2LLT A;  5KSZ A;  5DKQ A;  1QVI Z;  1XFW O;  4OCI A;  5CPV A;  2ZNE A;  1XFX O;  1DGV A;  1U5I A;  1QXP A;  1K8U A;  1J55 A;  3F45 A;  4N1G A;  2DOQ A;  2NCO A;  2ZND A;  1LXF C;  1NPQ A;  2LP3 A;  2JOJ A;  4PAL A;  1IJ5 A;  1J1E A;  2BKH B;  1B8C A;  2V53 A;  4XJK A;  2M29 A;  2M49 B;  1XFY O;  1CFD A;  3TS5 B;  1GJY A;  1DF0 A;  3BUW B;  2PAL A;  1OZO A;  2A4J A;  4C0J A;  2WCE A;  2BE6 A;  3DF0 A;  4UPG A;  1CDN A;  3WHU B;  3TUY C;  1JF2 A;  2NZ0 A;  2K2A A;  2NXQ A;  3SG6 A;  2F33 A;  1BT6 A;  5CSJ A;  3AAK A;  3E3R A;  4DRW A;  4YGB B;  1YX7 A;  1IG5 A;  2MLF C;  2LHL A;  2E6W A;  1LKJ A;  4MVF A;  4P2Y B;  1NX2 A;  2LVJ A;  1GGW A;  1WLZ A;  3VRQ A;  3CTN A;  5J3X A;  5KTY A;  2F2P A;  2F2O A;  2MJW B;  5AER A;  2K2F A;  3EK7 A;  2LAN A;  4I5L B;  4PE1 A;  2B1U A;  2KYF A;  4GGN A;  1SNL A;  2KGR A;  1WLM A;  4YBH B;  1JBA A;  1A29 A;  3EK4 A;  4YI8 A;  1SY9 A;  1A4P A;  1CMF A;  3H4S E;  1Y6W A;  1MXL C;  2L4I A;  2JNF A;  1QV0 A;  1KK7 Y;  1MQ1 A;  2PMY A;  5AAN A;  1KK8 C;  1JUO A;  1EXR A;  1WY9 A;  2CBL A;  2KI6 C;  1IGV A;  3A8R A;  2EC6 B;  1JF0 A;  1CMG A;  2ZKM X;  1CM1 A;  1N2D A;  2KAV A;  2M0R A;  1BU3 A;  4I5J A;  1DJZ A;  1PAL A;  1K9P A;  2K0J A;  3SJS A;  4CFQ A;  3HX4 A;  4YGC B;  1PUL A;  4CFR A;  5HKY A;  1IKU A;  5GQQ C;  5I8N A;  4MEW A;  2CXJ A;  4ETO A;  2LC5 A;  1NX0 A;  1ALW A;  1SBJ A;  2KAX A;  2LNK A;  4MRX A;  2RGI A;  1W7J B;  3SG7 A;  3NSO A;  3WXA A;  1YTZ C;  1K9K A;  1WDC B;  3K21 A;  1F8H A;  1S26 D;  2FJU B;  5AFP A;  1QLS A;  2TN4 A;  2MAZ A;  1BLQ A;  1DMO A;  1PSR A;  4MZL A;  1CTR A;  1YRU B;  1ZMZ A;  2LLS A;  2CNP A;  5KU1 A;  2KGB C;  1CDP A;  3OX5 A;  3D10 A;  4GPL B;  5D69 A;  3DF0 B;  1SL9 A;  2BBN A;  2M7N A;  2SAS A;  3I5G C;  4PE0 A;  5K89 A;  1NUB A;  3PM8 A;  3ICB A;  1AP4 A;  1H8B A;  1BF5 A;  2AUC A;  2KSP A;  4YRU A;  3CR4 X;  1YUS A;  3I5H C;  4YGD B;  3KPX A;  4DIR A;  1KFX S;  4ICB A;  1D1O A;  4NDB A;  1UUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...