1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CALBINDIN D9K)
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
4GNKB 2JC2A 1CB1A 2MLEC 2LMUA 2KQYA 2EC6C 3JTDB 4PCWA 1M45A 4PHJA 3EK7A 1TN4A 1CFPA 1OMRA 4WQ3A 1C07A 1ZACA 3KHEA 3ICBA 2H61A 1DGUA 2BBMA 1B8LA 1RWYA 1KFUS 2LP2A 2OS8B 4PE1A 2CXJA 2KAVA 5I8NA 1X02A 1NPQA 1L2OB 1KFUL 1PVAA 2L4HA 2KI4C 2JULA 2L98A 1QVIZ 1OOJA 4GFTA 4U8DA 3VROA 1CDNA 2JT0A 1QIWA 1RROA 1B1GA 1FBVA 1KSMA 3O78A 5DKQA 1J7QA 1K94A 3RM1A 2I2RE 2LAPA 1UHKA 1SL8A 4YGDB 1KK8C 1QX5B 1LVCD 4HSZA 1QATA 2FOTA 4OR9B 4YGBB 4QJ4B 1CMFA 4MBEA 2GV5A 1QLSA 2M49B 1G33A 3AAKA 3KF9A 1DJXA 1DF0A 4NDDA 3TS5B 1N65A 1UWOA 1XVJA 3EKHA 2MA2A 2COLB 2SCPA 3EKJA 3HX4A 5I2OA 1IQ3A 1BLQA 5DKNA 3OX6A 3TDIA 2KBIA 4WRIA 5AXIA 4MSPA 4YGEB 5BPJA 3IF7A 1BJFA 1NYAA 1YTZC 1SBJA 1JUOA 1JFKA 3GK4X 3SIBA 2CNPA 3FWBA 1NIWA 4P2YB 2NZ0A 1FPWA 1FW4A 2FCDA 3OP0A 1F70A 1EXRA 3SG7A 1ALWA 1PALA 1TNPA 1V1FA 2E6WA 2OTGB 2WOSA 1NCXA 1YUTA 3I5HC 3NSLA 1CLBA 1MQ1A 3GK2A 2LMVA 3AKAA 2LVJA 3BXKA 1CLLA 3D0YB 4TNCA 5HLOA 5ER4X 1BOCA 1Y1AA 1A4PA 3E3RA 3I5IB 4PHNA 2JXCA 1UHHA 4AOMA 1S36A 1CM1A 2BL0C 1G4YR 1AP4A 3HCMA 4MVFA 4CFRA 2F8PA 1QV0A 4E68A 4GUKA 1BMOA 1QIVA 2M29A 3EVUA 3CR5X 5CSNA 4N1GA 5HLVA 1LXFC 1YVLA 2M3WA 2KI6D 2GGZA 2ZRSA 3WNXB 3TUYC 3EVVA 2KOTA 2MBXA 5AERA 3F45A 1EG4A 1CMGA 1XFVO 4FTGA 1RK9A 4AQJA 2F3ZA 1K9KA 1QV1A 2JTTA 1IG5A 1D1OA 4ZCVA 3PALA 1B4CA 1K96A 1V1GA 2JU0A 1AVSA 1TIZA 1QS7A 4QJ5B 4DCKA 5D7FA 1TNXA 2Y5IA 5I2QA 2KAXA 3CLNA 2K7DA 1J1EA 3CS1A 4PDZA 3I5GC 1SR6B 4PE0A 1UUSA 1DJWA 5DKRA 1AJ5A 4YI9A 2R2IA 1QVIY 2Q4UA 2WORA 2GGMA 1JF2A 3PN7C 2LVIA 1K9UA 1N2DA 2G2BA 1HT9A 1DJYA 1RECA 2L5XB 1G8IA 3SIAA 3VRPA 1NCYA 1XFUO 3I5FB 1JC2A 3KPXA 4D1EA 4JWQA 3SJSA 1QX7A 4MEWA 5JJGA 2PASA 2LUCA 3LK1A 2F3YA 4MLWA 2NCOA 1J7OA 2H61C 3OB2B 4WQ2A 3WHTB 1ZFSA 2BKHB 2LCPA 1PSRA 3OX5A 3PFVA 4CFQA 4JPZB 1H8BA 1S6IA 2SASA 3SG5A 1NP8A 4DIRA 4AQIA 4USLA 4A4BA 1XFWO 2ISDA 1WDCB 4GGFA 1XA5A 3GOFA 1QXPA 2LNKA 4M2PA 3NSOA 2L0PA 1F55A 2KFHA 1AJ4A 3GK1A 2ZRTA 2E30A 1GQMA 3BUWB 2H2KA 1XK4A 2I94A 5AANA 1KFXS 1J1DA 1M31A 1XFYO 1PSBA 3SG3A 1QLKA 1KWOB 4JQ0D 3SG2A 1KFXL 1KSOA 2LHIA 2M9GA 1A03A 2M97A 1GJYA 2IS9A 4YGAA 3SG6A 4OVNF 2PVBA 3TDUA 3D0YA 1MXEA 4DRWA 5IBWA 1W7JB 2ZNEA 3D10A 1RTP1 3M0WA 5I2LA 1KCYA 3JVTC 2MAZA 4I5KA 1TNQA 1A29A 1B7TZ 5HKWA 1CNPA 2M8UA 2ZKMX 4OV2A 1SCMB 4MZJA 2BE4A 3ZWHA 2V53A 1TTXA 2CCMA 1IJ5A 1UHJA 2QACA 2F33A 2NXQA 1HQVA 1S5GZ 2EHBA 4M2QA 5ER5A 3A8RA 1JF0A 1CFCA 3WXAA 4MRXA 2K0JA 3CR4X 4BY4A 1WY9A 2KGBC 4N1FA 3PLFB 2JTZA 1F4QA 3PATA 1SKTA 3TDZA 4NDCA 3QRXA 3LLEA 1NSHA 2MHHA 3FS7A 1F4OA 1BT6A 1NUBA 1PRWA 2Y1MA 5KU1A 1JWDA 2KHNA 2MJWB 2JPTA 2WC8A 1J7RA 1OSAA 1QASA 1A75A 4GPLB 3O6BA 5CSJA 1YRUB 1MUXA 1S6JA 1WLMA 2JWWA 1YX8A 1LA0A 4A4CA 2F2PA 4C0KA 1CTRA 1SL7A 2KI4B 2JT3A 4FQOA 2LVVA 2PALA 3EVRA 4CLNA 3NXAA 2HQWA 4ZCUA 2ZNDA 2HPSA 2Q91A 2Y4QA 2PSRA 3JTDC 5JOLA 1UP5A 3IQOA 1KK8B 1LA3A 1DMOA 1E8AA 3DF0B 2JT8A 2Y1NA 1OZOA 1WLZA 4ORCB 3LL8B 4ORAB 1NWDA 2D8NA 1MHOA 4MZKA 1CFFA 2L2EA 2WNDA 2OS8C 1S26D 4QJ3B 3VRRA 1L2OC 2RGIA 2KI6C 3RLZA 1SMGA 5G08A 4PE7A 4UPGA 1SK6D 1FF1A 2MRDA 1FI5A 3LCPC 1IWQA 5HYDA 3H4SE 3BQ3A 1SCVA 1NX2A 1A75B 1RJVA 1K90D 1VRKA 1TNWA 5HKZA 2LP3A 2K61A 2AAOA 2HF5A 2JQ6A 1B9AA 1DGVA 4GGNA 4YGCB 2K2FA 1KQMB 2P6BB 2CT9A 5KTYA 2LANA 1C7VA 1SW8A 5TNCA 1UHIA 5AFPA 2KAYA 1U5IB 2KYCA 3C1VA 1ALVA 1S3PA 1RFJA 2JNFA 3TS5C 1C7WA 4MZLA 3FIAA 4PHKA 1SY9A 1K2HA 1IJ6A 2ZN9A 4CIDA 1B8CA 1XO5A 2PMYA 4CPVA 1SL9A 3I5HB 3CTNA 2JRFA 2K2AA 2MLFC 2A4JA 4GGFC 1K93D 2I7AA 2BKIB 4F0ZB 2F2OA 2KBMA 1CFDA 1IGVA 4HREE 2ZN8A 2TN4A 1BF5A 4HRHA 1KK7Z 2BL0B 2K8MB 1Y6WA 1IH0A 1LINA 3KEVA 1S5GY 4Q04A 1M63B 1EL4A 3DVKA 1XK4C 1UHNA 2K7OA 3BOWB 4IL1A 1M39A 1BR4B 1DJZA 1W7IB 1YRTB 4C0LA 2OTGC 1A2XA 3VRNA 1PK0D 1EG3A 5FYXA 2CTNA 5KSZA 1BR1B 4MRYA 1QX2A 2WCFA 1AUIB 5CSFA 1R6PA 3TUYB 1FI6A 4DUQA 1DJIA 1YVHA 2BECA 2KSPA 1TCOB 1MXLC 2LMTA 1F71A 3I5IC 4R1EA 3DD4A 1Q80A 2JNXA 1SPYA 2LLTA 3KO0A 5J3XA 2JZIA 1GGZA 1SYMA 1S1EA 1SRAA 1IQ5A 1YURA 4XJKA 3MSEB 4XYNA 1SNLA 3ZNIA 1CDMA 3IQQA 2HETA 3AAJA 3NSIA 2HQ8A 2K7BA 2NLNA 3DVMA 5PALA 4NDBA 5F6TA 2KGRA 1DJGA 2BCAA 3CGAA 1WRKA 2M0RA 2BBNA 3I5GB 3PM8A 1CLMA 2ZFDA 1F54A 4OCIA 3CZTX 1S6CA 1CM4A 2O60A 5B8IB 2LLSA 2B1UA 2JXLA 1YR5A 1DVIA 3O4YA 2I18A 2BE6A 3BUNB 1DT7B 3PN7B 1OE9B 1ZOTB 1ZUZA 2LLUA 1CKKA 3DF0A 1AHRA 2K7CA 2M1KB 1KQVA 1Y1UA 1IRJA 1LKJA 5K89A 1Y1XA 1WRZA 3FWCA 3AKBA 1TRFA 4ORBB 1EJ3A 4PHMA 2AUCA 4BY5A 1AK8A 3DVEA 3A4UB 1J55A 3BYAA 2OPOA 1ZMZA 2LM5A 2EC6B 1SR6C 4C0JA 1B8RA 3OB1B 1WRLA 1YUSA 3VRQA 1KQMC 2WCEA 4XJKB 1CDPA 1PULA 2M1UA 4I5JA 4ETOA 3I5FC 1PVBA 1QJTA 1TOPA 1MR8A 1N0YA 1XFZO 1IKUA 2EGDA 2NCPA 1L7ZA 3VGOA 2M7NA 2M7LA 1K95A 1U5IA 4N5XA 3LK0A 5CSIA 4YI8A 2LE9B 5HKYA 1OMDA 2BCBA 1M46A 2AMIA 4I5NB 3PSRA 2LVKA 2KYFA 2L4IA 2KNEA 1K8UA 1BG1A 1H4BA 1JBAA 3TZ1A 2O5GA 1DF0B 2LUXA 2G9BA 1OQPA 5GQQC 1WDCC 1B47A 2QPTA 3CR2A 1YUUA 3CWGA 3JVTB 3WHUB 1UURA 4M2OA 2PRUA 1XFXO 3EK8A 4GBAA 3K21A 3BUXB 3BUOB 4YRUA 1JFJA 1KK7Y 3DVJA 5CPVA 1DTLA 3BOWA 2VRGA 2LV7A 1EH2A 2KFFA 2FJUB 2WCBA 1KWOC 4I5LB 2JOJA 1OZSA 1DJHA 1NX1A 2FCEA 2LHLA 4MN0A 1GGWA 2KFGA 1Y0VH 3SG4A 2L51A 2BCXA 1JSAA 4PE4A 2CBLA 1J7PA 1K9PA 4HRGA 1R2UA 3O2PA 4YBHB 1TCFA 1BU3A 1CDLA 1MWNA 1SCMC 5AEQA 1QTXA 2KDHA 1F8HA 4GAOA 4OKHA 4NQGA 1NX3A 4PALA 1ODBA 2L50A 3NSKA 3EK4A 1BODA 1YX7A 1B7TY 1MF8B 4ICBA 3OHMB 1OMVA 1XYDA 2KQ6A 2LC5A 1NX0A 5D69A 1NCZA 4P5OE 4L9MA 4DS7A 3BUMB 2DOQA
chains in the Genus database with same CATH superfamily
4GNKB 2JC2A 1TUZA 1CB1A 2MLEC 3SS5A 1OOHA 2LMUA 2KQYA 2EC6C 3JTDB 4PCWA 1M45A 4PHJA 3EK7A 1TN4A 1CFPA 1OMRA 4WQ3A 1C07A 1ZACA 3KHEA 5D3OA 3RZSA 3ICBA 2H61A 1DGUA 2BBMA 1B8LA 1RWYA 1KFUS 2LP2A 2OS8B 4PE1A 2WCLA 2CXJA 3S0FA 2KAVA 5I8NA 1X02A 1NPQA 1L2OB 1KFUL 1PVAA 2L4HA 2KI4C 2JULA 2L98A 1QVIZ 1OOJA 4GFTA 4U8DA 3VROA 2KLDA 1CDNA 2JT0A 1QIWA 1RROA 1B1GA 2L2CA 1FBVA 1KSMA 3O78A 5DKQA 1J7QA 1K94A 3K1EA 3RM1A 2I2RE 1W9ZA 2LAPA 1DC1A 1UHKA 1SL8A 4YGDB 1KK8C 2WC6A 1QX5B 1LVCD 4HSZA 1QATA 2FOTA 4OR9B 4YGBB 4QJ4B 1CMFA 4MBEA 2GV5A 1QLSA 3BFAA 2M49B 1G33A 3AAKA 3KF9A 1DJXA 1DF0A 3NHIA 4NDDA 3TS5B 1N65A 1UWOA 3D75A 1XVJA 3EKHA 2BNXA 2MA2A 2COLB 2SCPA 3EKJA 3HX4A 5I2OA 1IQ3A 1BLQA 5DKNA 3OX6A 3TDIA 2KBIA 4WRIA 5AXIA 4MSPA 4YGEB 5BPJA 1DQEA 3IF7A 1BJFA 1NYAA 1YTZC 1SBJA 1JUOA 3UNWA 3DZTA 1JFKA 3GK4X 3SIBA 2CNPA 3FWBA 1NIWA 4P2YB 2NZ0A 3FE9A 1FPWA 1FW4A 2FCDA 2P71A 3OP0A 3EG5B 1F70A 1EXRA 3SG7A 1ALWA 1PALA 1TNPA 1V1FA 2E6WA 2OTGB 2WOSA 1NCXA 1YUTA 3I5HC 3NSLA 3R1PA 1CLBA 1MQ1A 3GK2A 2LMVA 3AKAA 2LVJA 3BXKA 1CLLA 3D0YB 4TNCA 5HLOA 3OBVA 5ER4X 1BOCA 1Y1AA 1A4PA 3E3RA 3I5IB 4PHNA 2JXCA 3DYEA 1UHHA 4AOMA 3FE6A 1S36A 1CM1A 2BL0C 1G4YR 1AP4A 3HCMA 4MVFA 3DXLA 4CFRA 2F8PA 1QV0A 4JD9A 4E68A 1OOIX 4GUKA 1BMOA 1QIVA 2M29A 3EVUA 3CR5X 5CSNA 4N1GA 5HLVA 1LXFC 1YVLA 2M3WA 2KI6D 2GGZA 2ZRSA 3WNXB 3TUYC 3B6XA 3EVVA 2KOTA 2MBXA 5AERA 3F45A 1EG4A 1CMGA 1XFVO 3DY9A 4FTGA 3CZ1A 4FQTA 1RK9A 3D78A 4AQJA 2F3ZA 1OOGA 4IJ7A 1K9KA 1QV1A 2JTTA 1IG5A 1D1OA 4ZCVA 3PALA 1B4CA 1K96A 1V1GA 1C3YA 2JU0A 1AVSA 1TIZA 1QS7A 4QJ5B 4DCKA 2P70A 3D74A 5D7FA 1LS8A 1TNXA 2Y5IA 5I2QA 2KAXA 3CLNA 2K7DA 1J1EA 3CS1A 4PDZA 3I5GC 1SR6B 4PE0A 1UUSA 1DJWA 5DKRA 1AJ5A 4YI9A 3S0GA 1ORGA 2JPOA 1QVIY 2R2IA 2Q4UA 2WORA 2GGMA 1JF2A 3PN7C 2LVIA 1K9UA 1N2DA 2G2BA 1HT9A 1DJYA 1RECA 2L5XB 1G8IA 3SIAA 3R1OA 3VRPA 1NCYA 1XFUO 3I5FB 1JC2A 3KPXA 4D1EA 4JWQA 3SJSA 1QX7A 4MEWA 5JJGA 2H8VA 2PASA 2LUCA 3LK1A 2F3YA 4MLWA 2NCOA 1J7OA 2H61C 3OB2B 4WQ2A 3WHTB 1ZFSA 2BKHB 2LCPA 1OW4A 1PSRA 3OX5A 3PFVA 4CFQA 4JPZB 5EL2A 1S6IA 2SASA 1H8BA 3SG5A 1NP8A 4DIRA 3PM2A 4AQIA 4USLA 4A4BA 1XFWO 2ISDA 1WDCB 4GGFA 1XA5A 2QEOA 3GOFA 5DICA 1QXPA 2LNKA 4M2PA 3NSOA 2L0PA 1DELA 1F55A 2KFHA 1AJ4A 3GK1A 2ZRTA 3BJHA 2E30A 1GQMA 3BUWB 2H2KA 1XK4A 2I94A 5AANA 1KFXS 3O4XA 1J1DA 1M31A 1XFYO 1PSBA 3SG3A 1QLKA 1KWOB 1TUJA 4JQ0D 1KFXL 3QMEA 3SG2A 1KSOA 2LHIA 2M9GA 3SS4A 3B87A 3S0BA 2PQLA 1A03A 2M97A 1GJYA 2IS9A 4YGAA 3SG6A 4OVNF 2PVBA 3TDUA 3D0YA 1MXEA 4DRWA 5IBWA 3B88A 1W7JB 2ZNEA 3D10A 1RTP1 3M0WA 5I2LA 5FI6A 3D73A 1KCYA 3N7HA 3JVTC 2MAZA 4I5KA 1TNQA 4JKTA 1A29A 1B7TZ 5HKWA 3B86A 1CNPA 2M8UA 2ZKMX 4OV2A 3FE8A 5I94A 1SCMB 4MZJA 2BE4A 3ZWHA 2V53A 1TTXA 2CCMA 1IJ5A 1UHJA 2QACA 2F33A 3NHTA 2NXQA 1HQVA 1S5GZ 2EHBA 4M2QA 5ER5A 3A8RA 1JF0A 1CFCA 3WXAA 4MRXA 2K0JA 3CR4X 3OGNA 4BY4A 1WY9A 2KGBC 4N1FA 3PLFB 2JTZA 1F4QA 3PATA 1SKTA 3TDZA 4NDCA 3QRXA 3LLEA 1NSHA 2MHHA 3FS7A 1F4OA 1BT6A 1NUBA 1PRWA 2Y1MA 5KU1A 1JWDA 2KHNA 2MJWB 5FI2A 2JPTA 2WC8A 1J7RA 1OSAA 1QASA 1A75A 3L4LA 1IIOA 4GPLB 3O6BA 5CSJA 1YRUB 1MUXA 1S6JA 1WLMA 2JWWA 1YX8A 1LA0A 4A4CA 2F2PA 4C0KA 1CTRA 1SL7A 3UO9A 2KI4B 2JT3A 3NGVA 4FQOA 2LVVA 2PALA 3EVRA 4CLNA 3NXAA 2HQWA 4PT1A 4ZCUA 2ZNDA 2HPSA 2Q91A 2Y4QA 2PSRA 3JTDC 5JOLA 1UP5A 3IQOA 1KK8B 1LA3A 1DMOA 1E8AA 3DF0B 2JT8A 2Y1NA 1OZOA 1WLZA 4ORCB 3LL8B 4ORAB 1NWDA 2D8NA 3R72A 1MHOA 4MZKA 1CFFA 2L2EA 2WNDA 2OS8C 1S26D 4QJ3B 3VRRA 1L2OC 2RGIA 2KI6C 3RLZA 1SMGA 5G08A 4PE7A 2WC5A 3BFBA 1SK6D 4UPGA 2MRDA 1FF1A 3LCPC 1IWQA 2WCKA 1FI5A 5HYDA 3H4SE 3BQ3A 5HL1A 1SCVA 1NX2A 1A75B 1RJVA 1K90D 1VRKA 1TNWA 4OZDA 2LP3A 2K61A 5HKZA 2AAOA 2HF5A 2JQ6A 1B9AA 1DGVA 4GGNA 4YGCB 2K2FA 1KQMB 2P6BB 2CT9A 5KTYA 2LANA 1C7VA 1SW8A 5TNCA 1UHIA 5AFPA 2KAYA 1U5IB 2KYCA 3C1VA 1ALVA 1S3PA 1RFJA 2JNFA 2KLEA 3TS5C 1Z4HA 1C7WA 4MZLA 3FIAA 4PHKA 1SY9A 1Z2CB 1K2HA 1IJ6A 2ZN9A 4CIDA 1B8CA 1XO5A 2PMYA 4CPVA 1SL9A 1GM0A 3I5HB 3CTNA 2JRFA 2K2AA 2MLFC 2QDIA 2A4JA 4GGFC 1K93D 2I7AA 2BKIB 4F0ZB 2WCJA 2F2OA 2KBMA 1CFDA 1IGVA 4HREE 2ZN8A 2TN4A 1BF5A 4HRHA 1KK7Z 2BL0B 2K8MB 1Y6WA 1IH0A 1LINA 3KEVA 1S5GY 4Q04A 1M63B 1EL4A 3DVKA 1XK4C 1UHNA 2K7OA 3BOWB 4IL1A 1M39A 1BR4B 1DJZA 1W7IB 1YRTB 2L5YA 2OTGC 4KYNA 4C0LA 1A2XA 1OOFA 3VRNA 1PK0D 1EG3A 5FYXA 2CTNA 5KSZA 3L4AA 1BR1B 4MRYA 1QX2A 2WCFA 1AUIB 5CSFA 1R6PA 3TUYB 1FI6A 4DUQA 1DJIA 1YVHA 2BECA 2KSPA 4INXA 1TCOB 1MXLC 2LMTA 1F71A 3CZ2A 3I5IC 4R1EA 3DD4A 1Q80A 2JNXA 1SPYA 2LLTA 3KO0A 5J3XA 2JZIA 1GGZA 1SYMA 1S1EA 1SRAA 1IQ5A 1YURA 4XJKA 3MSEB 4XYNA 1SNLA 3ZNIA 1CDMA 1SSEB 3IQQA 2HETA 3AAJA 3NSIA 2HQ8A 2K7BA 2NLNA 3DVMA 5PALA 4NDBA 3D76A 2KGRA 5F6TA 1DJGA 2BCAA 3CGAA 1WRKA 2M0RA 2BBNA 3CABA 3I5GB 3PM8A 1CLMA 2ZFDA 1F54A 4OCIA 3CZTX 1S6CA 1CM4A 2O60A 5B8IB 2LLSA 2B1UA 2JXLA 1YR5A 1DVIA 3O4YA 2I18A 2BE6A 3BUNB 3V2LA 1DT7B 3PN7B 1OE9B 1ZOTB 1ZUZA 2LLUA 1CKKA 3DF0A 1AHRA 2K7CA 2M1KB 1KQVA 1Y1UA 1IRJA 2GTEA 1LKJA 3CZ0A 5K89A 1Y1XA 1WRZA 3CDNA 3FWCA 3AKBA 1TRFA 4ORBB 1EJ3A 4F7FA 4PHMA 2AUCA 2QEVA 4BY5A 1AK8A 3DVEA 3A4UB 1J55A 3BYAA 2OPOA 1ZMZA 2YGUA 2LM5A 2EC6B 1SR6C 4C0JA 2WCMA 1B8RA 3OB1B 1QWVA 1WRLA 1YUSA 1KQMC 2KPHA 3Q8IA 3VRQA 4INWA 2WCEA 4XJKB 1CDPA 1PULA 2M1UA 3VB1A 4I5JA 4ETOA 3I5FC 1PVBA 1QJTA 2BAPA 1DEKA 1TOPA 2WCHA 1MR8A 3S0AA 1N0YA 1XFZO 1IKUA 2EGDA 2NCPA 1L7ZA 2PYQA 2M7NA 3VGOA 2M7LA 1K95A 1U5IA 4N5XA 3LK0A 5CSIA 4YI8A 2LE9B 5HKYA 1OMDA 2BCBA 1M46A 2AMIA 4I5NB 3PSRA 2LVKA 2KYFA 2K60A 2L4IA 2KNEA 1K8UA 1BG1A 1H4BA 2ERBA 3TZ1A 2O5GA 1JBAA 1DF0B 2LUXA 2G9BA 1OQPA 1C3ZA 5GQQC 1WDCC 1B47A 1TWOA 2QPTA 3R1VA 3CR2A 1YUUA 3CWGA 3JVTB 3WHUB 1UURA 4M2OA 2PRUA 1XFXO 1P28A 3EK8A 4GBAA 3CYZA 3BUXB 3BUOB 3K21A 4YRUA 1JFJA 5FI7A 1KK7Y 3DVJA 5CPVA 1XFRA 1DTLA 3BOWA 2VRGA 2LV7A 1EH2A 2KFFA 1T14A 2QEHA 2FJUB 2WCBA 1KWOC 4I5LB 2JOJA 1OZSA 1DJHA 1NX1A 2FCEA 2LHLA 3IVTA 4MN0A 1GGWA 2KFGA 3PJIA 3SS3A 1Y0VH 3SG4A 2L51A 2QEBA 2BCXA 1JSAA 4PE4A 2CBLA 1J7PA 1K9PA 4HRGA 1R2UA 3O2PA 4YBHB 1TCFA 1BU3A 1CDLA 1MWNA 3D77A 1SCMC 3B7AA 5AEQA 1QTXA 2KDHA 1F8HA 4GAOA 4OKHA 4NQGA 1NX3A 4PALA 1ODBA 3BFHA 2L50A 3NSKA 3EK4A 1BODA 1YX7A 1B7TY 1MF8B 4ICBA 3OHMB 1OMVA 1XYDA 2KQ6A 2LC5A 2FJYA 3L47A 1NX0A 5D69A 1NCZA 4P5OE 4L9MA 4DS7A 3S0DA 3BUMB 3S0EA 2DOQA
chains in the Genus database with same CATH topology
4GNKB 2JC2A 1CB1A 2MLEC 2LMUA 2KQYA 2EC6C 3JTDB 4PCWA 1M45A 4PHJA 3EK7A 1TN4A 1CFPA 1OMRA 4WQ3A 1C07A 1ZACA 3KHEA 3ICBA 2H61A 1DGUA 2BBMA 1B8LA 1RWYA 1KFUS 2LP2A 2OS8B 4PE1A 2CXJA 2KAVA 5I8NA 1X02A 1NPQA 1L2OB 1KFUL 1PVAA 2L4HA 2KI4C 2JULA 2L98A 1QVIZ 1OOJA 4GFTA 4U8DA 3VROA 1CDNA 2JT0A 1QIWA 1RROA 1B1GA 1FBVA 1KSMA 3O78A 5DKQA 1J7QA 1K94A 3RM1A 2I2RE 2LAPA 1UHKA 1SL8A 4YGDB 1KK8C 1QX5B 1LVCD 4HSZA 1QATA 2FOTA 4OR9B 4YGBB 4QJ4B 1CMFA 4MBEA 2GV5A 1QLSA 2M49B 1G33A 3AAKA 3KF9A 1DJXA 1DF0A 4NDDA 3TS5B 1N65A 1UWOA 1XVJA 3EKHA 2MA2A 2COLB 2SCPA 3EKJA 3HX4A 5I2OA 1IQ3A 1BLQA 5DKNA 3OX6A 3TDIA 2KBIA 4WRIA 5AXIA 4MSPA 4YGEB 5BPJA 3IF7A 1BJFA 1NYAA 1YTZC 1SBJA 1JUOA 1JFKA 3GK4X 3SIBA 2CNPA 3FWBA 1NIWA 4P2YB 2NZ0A 1FPWA 1FW4A 2FCDA 3OP0A 1F70A 1EXRA 3SG7A 1ALWA 1PALA 1TNPA 1V1FA 2E6WA 2OTGB 2WOSA 1NCXA 1YUTA 3I5HC 3NSLA 1CLBA 1MQ1A 3GK2A 2LMVA 3AKAA 2LVJA 3BXKA 1CLLA 3D0YB 4TNCA 5HLOA 5ER4X 1BOCA 1Y1AA 1A4PA 3E3RA 3I5IB 4PHNA 2JXCA 1UHHA 4AOMA 1S36A 1CM1A 2BL0C 1G4YR 1AP4A 3HCMA 4MVFA 4CFRA 2F8PA 1QV0A 4E68A 4GUKA 1BMOA 1QIVA 2M29A 3EVUA 3CR5X 5CSNA 4N1GA 5HLVA 1LXFC 1YVLA 2M3WA 2KI6D 2GGZA 2ZRSA 3WNXB 3TUYC 3EVVA 2KOTA 2MBXA 5AERA 3F45A 1EG4A 1CMGA 1XFVO 4FTGA 1RK9A 4AQJA 2F3ZA 1K9KA 1QV1A 2JTTA 1IG5A 1D1OA 4ZCVA 3PALA 1B4CA 1K96A 1V1GA 2JU0A 1AVSA 1TIZA 1QS7A 4QJ5B 4DCKA 5D7FA 1TNXA 2Y5IA 5I2QA 2KAXA 3CLNA 2K7DA 1J1EA 3CS1A 4PDZA 3I5GC 1SR6B 4PE0A 1UUSA 1DJWA 5DKRA 1AJ5A 4YI9A 2R2IA 1QVIY 2Q4UA 2WORA 2GGMA 1JF2A 3PN7C 2LVIA 1K9UA 1N2DA 2G2BA 1HT9A 1DJYA 1RECA 2L5XB 1G8IA 3SIAA 3VRPA 1NCYA 1XFUO 3I5FB 1JC2A 3KPXA 4D1EA 4JWQA 3SJSA 1QX7A 4MEWA 5JJGA 2PASA 2LUCA 3LK1A 2F3YA 4MLWA 2NCOA 1J7OA 2H61C 3OB2B 4WQ2A 3WHTB 1ZFSA 2BKHB 2LCPA 1PSRA 3OX5A 3PFVA 4CFQA 4JPZB 1H8BA 1S6IA 2SASA 3SG5A 1NP8A 4DIRA 4AQIA 4USLA 4A4BA 1XFWO 2ISDA 1WDCB 4GGFA 1XA5A 3GOFA 1QXPA 2LNKA 4M2PA 3NSOA 2L0PA 1F55A 2KFHA 1AJ4A 3GK1A 2ZRTA 2E30A 1GQMA 3BUWB 2H2KA 1XK4A 2I94A 5AANA 1KFXS 1J1DA 1M31A 1XFYO 1PSBA 3SG3A 1QLKA 1KWOB 4JQ0D 3SG2A 1KFXL 1KSOA 2LHIA 2M9GA 1A03A 2M97A 1GJYA 2IS9A 4YGAA 3SG6A 4OVNF 2PVBA 3TDUA 3D0YA 1MXEA 4DRWA 5IBWA 1W7JB 2ZNEA 3D10A 1RTP1 3M0WA 5I2LA 1KCYA 3JVTC 2MAZA 4I5KA 1TNQA 1A29A 1B7TZ 5HKWA 1CNPA 2M8UA 2ZKMX 4OV2A 1SCMB 4MZJA 2BE4A 3ZWHA 2V53A 1TTXA 2CCMA 1IJ5A 1UHJA 2QACA 2F33A 2NXQA 1HQVA 1S5GZ 2EHBA 4M2QA 5ER5A 3A8RA 1JF0A 1CFCA 3WXAA 4MRXA 2K0JA 3CR4X 4BY4A 1WY9A 2KGBC 4N1FA 3PLFB 2JTZA 1F4QA 3PATA 1SKTA 3TDZA 4NDCA 3QRXA 3LLEA 1NSHA 2MHHA 3FS7A 1F4OA 1BT6A 1NUBA 1PRWA 2Y1MA 5KU1A 1JWDA 2KHNA 2MJWB 2JPTA 2WC8A 1J7RA 1OSAA 1QASA 1A75A 4GPLB 3O6BA 5CSJA 1YRUB 1MUXA 1S6JA 1WLMA 2JWWA 1YX8A 1LA0A 4A4CA 2F2PA 4C0KA 1CTRA 1SL7A 2KI4B 2JT3A 4FQOA 2LVVA 2PALA 3EVRA 4CLNA 3NXAA 2HQWA 4ZCUA 2ZNDA 2HPSA 2Q91A 2Y4QA 2PSRA 3JTDC 5JOLA 1UP5A 3IQOA 1KK8B 1LA3A 1DMOA 1E8AA 3DF0B 2JT8A 2Y1NA 1OZOA 1WLZA 4ORCB 3LL8B 4ORAB 1NWDA 2D8NA 1MHOA 4MZKA 1CFFA 2L2EA 2WNDA 2OS8C 1S26D 4QJ3B 3VRRA 1L2OC 2RGIA 2KI6C 3RLZA 1SMGA 5G08A 4PE7A 4UPGA 1SK6D 1FF1A 2MRDA 1FI5A 3LCPC 1IWQA 5HYDA 3H4SE 3BQ3A 1SCVA 1NX2A 1A75B 1RJVA 1K90D 1VRKA 1TNWA 5HKZA 2LP3A 2K61A 2AAOA 2HF5A 2JQ6A 1B9AA 1DGVA 4GGNA 4YGCB 2K2FA 1KQMB 2P6BB 2CT9A 5KTYA 2LANA 1C7VA 1SW8A 5TNCA 1UHIA 5AFPA 2KAYA 1U5IB 2KYCA 3C1VA 1ALVA 1S3PA 1RFJA 2JNFA 3TS5C 1C7WA 4MZLA 3FIAA 4PHKA 1SY9A 1K2HA 1IJ6A 2ZN9A 4CIDA 1B8CA 1XO5A 2PMYA 4CPVA 1SL9A 3I5HB 3CTNA 2JRFA 2K2AA 2MLFC 2A4JA 4GGFC 1K93D 2I7AA 2BKIB 4F0ZB 2F2OA 2KBMA 1CFDA 1IGVA 4HREE 2ZN8A 2TN4A 1BF5A 4HRHA 1KK7Z 2BL0B 2K8MB 1Y6WA 1IH0A 1LINA 3KEVA 1S5GY 4Q04A 1M63B 1EL4A 3DVKA 1XK4C 1UHNA 2K7OA 3BOWB 4IL1A 1M39A 1BR4B 1DJZA 1W7IB 1YRTB 4C0LA 2OTGC 1A2XA 3VRNA 1PK0D 1EG3A 5FYXA 2CTNA 5KSZA 1BR1B 4MRYA 1QX2A 2WCFA 1AUIB 5CSFA 1R6PA 3TUYB 1FI6A 4DUQA 1DJIA 1YVHA 2BECA 2KSPA 1TCOB 1MXLC 2LMTA 1F71A 3I5IC 4R1EA 3DD4A 1Q80A 2JNXA 1SPYA 2LLTA 3KO0A 5J3XA 2JZIA 1GGZA 1SYMA 1S1EA 1SRAA 1IQ5A 1YURA 4XJKA 3MSEB 4XYNA 1SNLA 3ZNIA 1CDMA 3IQQA 2HETA 3AAJA 3NSIA 2HQ8A 2K7BA 2NLNA 3DVMA 5PALA 4NDBA 5F6TA 2KGRA 1DJGA 2BCAA 3CGAA 1WRKA 2M0RA 2BBNA 3I5GB 3PM8A 1CLMA 2ZFDA 1F54A 4OCIA 3CZTX 1S6CA 1CM4A 2O60A 5B8IB 2LLSA 2B1UA 2JXLA 1YR5A 1DVIA 3O4YA 2I18A 2BE6A 3BUNB 1DT7B 3PN7B 1OE9B 1ZOTB 1ZUZA 2LLUA 1CKKA 3DF0A 1AHRA 2K7CA 2M1KB 1KQVA 1Y1UA 1IRJA 1LKJA 5K89A 1Y1XA 1WRZA 3FWCA 3AKBA 1TRFA 4ORBB 1EJ3A 4PHMA 2AUCA 4BY5A 1AK8A 3DVEA 3A4UB 1J55A 3BYAA 2OPOA 1ZMZA 2LM5A 2EC6B 1SR6C 4C0JA 1B8RA 3OB1B 1WRLA 1YUSA 3VRQA 1KQMC 2WCEA 4XJKB 1CDPA 1PULA 2M1UA 4I5JA 4ETOA 3I5FC 1PVBA 1QJTA 1TOPA 1MR8A 1N0YA 1XFZO 1IKUA 2EGDA 2NCPA 1L7ZA 3VGOA 2M7NA 2M7LA 1K95A 1U5IA 4N5XA 3LK0A 5CSIA 4YI8A 2LE9B 5HKYA 1OMDA 2BCBA 1M46A 2AMIA 4I5NB 3PSRA 2LVKA 2KYFA 2L4IA 2KNEA 1K8UA 1BG1A 1H4BA 1JBAA 3TZ1A 2O5GA 1DF0B 2LUXA 2G9BA 1OQPA 5GQQC 1WDCC 1B47A 2QPTA 3CR2A 1YUUA 3CWGA 3JVTB 3WHUB 1UURA 4M2OA 2PRUA 1XFXO 3EK8A 4GBAA 3K21A 3BUXB 3BUOB 4YRUA 1JFJA 1KK7Y 3DVJA 5CPVA 1DTLA 3BOWA 2VRGA 2LV7A 1EH2A 2KFFA 2FJUB 2WCBA 1KWOC 4I5LB 2JOJA 1OZSA 1DJHA 1NX1A 2FCEA 2LHLA 4MN0A 1GGWA 2KFGA 1Y0VH 3SG4A 2L51A 2BCXA 1JSAA 4PE4A 2CBLA 1J7PA 1K9PA 4HRGA 1R2UA 3O2PA 4YBHB 1TCFA 1BU3A 1CDLA 1MWNA 1SCMC 5AEQA 1QTXA 2KDHA 1F8HA 4GAOA 4OKHA 4NQGA 1NX3A 4PALA 1ODBA 2L50A 3NSKA 3EK4A 1BODA 1YX7A 1B7TY 1MF8B 4ICBA 3OHMB 1OMVA 1XYDA 2KQ6A 2LC5A 1NX0A 5D69A 1NCZA 4P5OE 4L9MA 4DS7A 3BUMB 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNK B;  2JC2 A;  1CB1 A;  2MLE C;  2LMU A;  2KQY A;  2EC6 C;  3JTD B;  4PCW A;  1M45 A;  4PHJ A;  3EK7 A;  1TN4 A;  1CFP A;  1OMR A;  4WQ3 A;  1C07 A;  1ZAC A;  3KHE A;  3ICB A;  2H61 A;  1DGU A;  2BBM A;  1B8L A;  1RWY A;  1KFU S;  2LP2 A;  2OS8 B;  4PE1 A;  2CXJ A;  2KAV A;  5I8N A;  1X02 A;  1NPQ A;  1L2O B;  1KFU L;  1PVA A;  2L4H A;  2KI4 C;  2JUL A;  2L98 A;  1QVI Z;  1OOJ A;  4GFT A;  4U8D A;  3VRO A;  1CDN A;  2JT0 A;  1QIW A;  1RRO A;  1B1G A;  1FBV A;  1KSM A;  3O78 A;  5DKQ A;  1J7Q A;  1K94 A;  3RM1 A;  2I2R E;  2LAP A;  1UHK A;  1SL8 A;  4YGD B;  1KK8 C;  1QX5 B;  1LVC D;  4HSZ A;  1QAT A;  2FOT A;  4OR9 B;  4YGB B;  4QJ4 B;  1CMF A;  4MBE A;  2GV5 A;  1QLS A;  2M49 B;  1G33 A;  3AAK A;  3KF9 A;  1DJX A;  1DF0 A;  4NDD A;  3TS5 B;  1N65 A;  1UWO A;  1XVJ A;  3EKH A;  2MA2 A;  2COL B;  2SCP A;  3EKJ A;  3HX4 A;  5I2O A;  1IQ3 A;  1BLQ A;  5DKN A;  3OX6 A;  3TDI A;  2KBI A;  4WRI A;  5AXI A;  4MSP A;  4YGE B;  5BPJ A;  3IF7 A;  1BJF A;  1NYA A;  1YTZ C;  1SBJ A;  1JUO A;  1JFK A;  3GK4 X;  3SIB A;  2CNP A;  3FWB A;  1NIW A;  4P2Y B;  2NZ0 A;  1FPW A;  1FW4 A;  2FCD A;  3OP0 A;  1F70 A;  1EXR A;  3SG7 A;  1ALW A;  1PAL A;  1TNP A;  1V1F A;  2E6W A;  2OTG B;  2WOS A;  1NCX A;  1YUT A;  3I5H C;  3NSL A;  1CLB A;  1MQ1 A;  3GK2 A;  2LMV A;  3AKA A;  2LVJ A;  3BXK A;  1CLL A;  3D0Y B;  4TNC A;  5HLO A;  5ER4 X;  1BOC A;  1Y1A A;  1A4P A;  3E3R A;  3I5I B;  4PHN A;  2JXC A;  1UHH A;  4AOM A;  1S36 A;  1CM1 A;  2BL0 C;  1G4Y R;  1AP4 A;  3HCM A;  4MVF A;  4CFR A;  2F8P A;  1QV0 A;  4E68 A;  4GUK A;  1BMO A;  1QIV A;  2M29 A;  3EVU A;  3CR5 X;  5CSN A;  4N1G A;  5HLV A;  1LXF C;  1YVL A;  2M3W A;  2KI6 D;  2GGZ A;  2ZRS A;  3WNX B;  3TUY C;  3EVV A;  2KOT A;  2MBX A;  5AER A;  3F45 A;  1EG4 A;  1CMG A;  1XFV O;  4FTG A;  1RK9 A;  4AQJ A;  2F3Z A;  1K9K A;  1QV1 A;  2JTT A;  1IG5 A;  1D1O A;  4ZCV A;  3PAL A;  1B4C A;  1K96 A;  1V1G A;  2JU0 A;  1AVS A;  1TIZ A;  1QS7 A;  4QJ5 B;  4DCK A;  5D7F A;  1TNX A;  2Y5I A;  5I2Q A;  2KAX A;  3CLN A;  2K7D A;  1J1E A;  3CS1 A;  4PDZ A;  3I5G C;  1SR6 B;  4PE0 A;  1UUS A;  1DJW A;  5DKR A;  1AJ5 A;  4YI9 A;  2R2I A;  1QVI Y;  2Q4U A;  2WOR A;  2GGM A;  1JF2 A;  3PN7 C;  2LVI A;  1K9U A;  1N2D A;  2G2B A;  1HT9 A;  1DJY A;  1REC A;  2L5X B;  1G8I A;  3SIA A;  3VRP A;  1NCY A;  1XFU O;  3I5F B;  1JC2 A;  3KPX A;  4D1E A;  4JWQ A;  3SJS A;  1QX7 A;  4MEW A;  5JJG A;  2PAS A;  2LUC A;  3LK1 A;  2F3Y A;  4MLW A;  2NCO A;  1J7O A;  2H61 C;  3OB2 B;  4WQ2 A;  3WHT B;  1ZFS A;  2BKH B;  2LCP A;  1PSR A;  3OX5 A;  3PFV A;  4CFQ A;  4JPZ B;  1H8B A;  1S6I A;  2SAS A;  3SG5 A;  1NP8 A;  4DIR A;  4AQI A;  4USL A;  4A4B A;  1XFW O;  2ISD A;  1WDC B;  4GGF A;  1XA5 A;  3GOF A;  1QXP A;  2LNK A;  4M2P A;  3NSO A;  2L0P A;  1F55 A;  2KFH A;  1AJ4 A;  3GK1 A;  2ZRT A;  2E30 A;  1GQM A;  3BUW B;  2H2K A;  1XK4 A;  2I94 A;  5AAN A;  1KFX S;  1J1D A;  1M31 A;  1XFY O;  1PSB A;  3SG3 A;  1QLK A;  1KWO B;  4JQ0 D;  3SG2 A;  1KFX L;  1KSO A;  2LHI A;  2M9G A;  1A03 A;  2M97 A;  1GJY A;  2IS9 A;  4YGA A;  3SG6 A;  4OVN F;  2PVB A;  3TDU A;  3D0Y A;  1MXE A;  4DRW A;  5IBW A;  1W7J B;  2ZNE A;  3D10 A;  1RTP 1;  3M0W A;  5I2L A;  1KCY A;  3JVT C;  2MAZ A;  4I5K A;  1TNQ A;  1A29 A;  1B7T Z;  5HKW A;  1CNP A;  2M8U A;  2ZKM X;  4OV2 A;  1SCM B;  4MZJ A;  2BE4 A;  3ZWH A;  2V53 A;  1TTX A;  2CCM A;  1IJ5 A;  1UHJ A;  2QAC A;  2F33 A;  2NXQ A;  1HQV A;  1S5G Z;  2EHB A;  4M2Q A;  5ER5 A;  3A8R A;  1JF0 A;  1CFC A;  3WXA A;  4MRX A;  2K0J A;  3CR4 X;  4BY4 A;  1WY9 A;  2KGB C;  4N1F A;  3PLF B;  2JTZ A;  1F4Q A;  3PAT A;  1SKT A;  3TDZ A;  4NDC A;  3QRX A;  3LLE A;  1NSH A;  2MHH A;  3FS7 A;  1F4O A;  1BT6 A;  1NUB A;  1PRW A;  2Y1M A;  5KU1 A;  1JWD A;  2KHN A;  2MJW B;  2JPT A;  2WC8 A;  1J7R A;  1OSA A;  1QAS A;  1A75 A;  4GPL B;  3O6B A;  5CSJ A;  1YRU B;  1MUX A;  1S6J A;  1WLM A;  2JWW A;  1YX8 A;  1LA0 A;  4A4C A;  2F2P A;  4C0K A;  1CTR A;  1SL7 A;  2KI4 B;  2JT3 A;  4FQO A;  2LVV A;  2PAL A;  3EVR A;  4CLN A;  3NXA A;  2HQW A;  4ZCU A;  2ZND A;  2HPS A;  2Q91 A;  2Y4Q A;  2PSR A;  3JTD C;  5JOL A;  1UP5 A;  3IQO A;  1KK8 B;  1LA3 A;  1DMO A;  1E8A A;  3DF0 B;  2JT8 A;  2Y1N A;  1OZO A;  1WLZ A;  4ORC B;  3LL8 B;  4ORA B;  1NWD A;  2D8N A;  1MHO A;  4MZK A;  1CFF A;  2L2E A;  2WND A;  2OS8 C;  1S26 D;  4QJ3 B;  3VRR A;  1L2O C;  2RGI A;  2KI6 C;  3RLZ A;  1SMG A;  5G08 A;  4PE7 A;  4UPG A;  1SK6 D;  1FF1 A;  2MRD A;  1FI5 A;  3LCP C;  1IWQ A;  5HYD A;  3H4S E;  3BQ3 A;  1SCV A;  1NX2 A;  1A75 B;  1RJV A;  1K90 D;  1VRK A;  1TNW A;  5HKZ A;  2LP3 A;  2K61 A;  2AAO A;  2HF5 A;  2JQ6 A;  1B9A A;  1DGV A;  4GGN A;  4YGC B;  2K2F A;  1KQM B;  2P6B B;  2CT9 A;  5KTY A;  2LAN A;  1C7V A;  1SW8 A;  5TNC A;  1UHI A;  5AFP A;  2KAY A;  1U5I B;  2KYC A;  3C1V A;  1ALV A;  1S3P A;  1RFJ A;  2JNF A;  3TS5 C;  1C7W A;  4MZL A;  3FIA A;  4PHK A;  1SY9 A;  1K2H A;  1IJ6 A;  2ZN9 A;  4CID A;  1B8C A;  1XO5 A;  2PMY A;  4CPV A;  1SL9 A;  3I5H B;  3CTN A;  2JRF A;  2K2A A;  2MLF C;  2A4J A;  4GGF C;  1K93 D;  2I7A A;  2BKI B;  4F0Z B;  2F2O A;  2KBM A;  1CFD A;  1IGV A;  4HRE E;  2ZN8 A;  2TN4 A;  1BF5 A;  4HRH A;  1KK7 Z;  2BL0 B;  2K8M B;  1Y6W A;  1IH0 A;  1LIN A;  3KEV A;  1S5G Y;  4Q04 A;  1M63 B;  1EL4 A;  3DVK A;  1XK4 C;  1UHN A;  2K7O A;  3BOW B;  4IL1 A;  1M39 A;  1BR4 B;  1DJZ A;  1W7I B;  1YRT B;  4C0L A;  2OTG C;  1A2X A;  3VRN A;  1PK0 D;  1EG3 A;  5FYX A;  2CTN A;  5KSZ A;  1BR1 B;  4MRY A;  1QX2 A;  2WCF A;  1AUI B;  5CSF A;  1R6P A;  3TUY B;  1FI6 A;  4DUQ A;  1DJI A;  1YVH A;  2BEC A;  2KSP A;  1TCO B;  1MXL C;  2LMT A;  1F71 A;  3I5I C;  4R1E A;  3DD4 A;  1Q80 A;  2JNX A;  1SPY A;  2LLT A;  3KO0 A;  5J3X A;  2JZI A;  1GGZ A;  1SYM A;  1S1E A;  1SRA A;  1IQ5 A;  1YUR A;  4XJK A;  3MSE B;  4XYN A;  1SNL A;  3ZNI A;  1CDM A;  3IQQ A;  2HET A;  3AAJ A;  3NSI A;  2HQ8 A;  2K7B A;  2NLN A;  3DVM A;  5PAL A;  4NDB A;  5F6T A;  2KGR A;  1DJG A;  2BCA A;  3CGA A;  1WRK A;  2M0R A;  2BBN A;  3I5G B;  3PM8 A;  1CLM A;  2ZFD A;  1F54 A;  4OCI A;  3CZT X;  1S6C A;  1CM4 A;  2O60 A;  5B8I B;  2LLS A;  2B1U A;  2JXL A;  1YR5 A;  1DVI A;  3O4Y A;  2I18 A;  2BE6 A;  3BUN B;  1DT7 B;  3PN7 B;  1OE9 B;  1ZOT B;  1ZUZ A;  2LLU A;  1CKK A;  3DF0 A;  1AHR A;  2K7C A;  2M1K B;  1KQV A;  1Y1U A;  1IRJ A;  1LKJ A;  5K89 A;  1Y1X A;  1WRZ A;  3FWC A;  3AKB A;  1TRF A;  4ORB B;  1EJ3 A;  4PHM A;  2AUC A;  4BY5 A;  1AK8 A;  3DVE A;  3A4U B;  1J55 A;  3BYA A;  2OPO A;  1ZMZ A;  2LM5 A;  2EC6 B;  1SR6 C;  4C0J A;  1B8R A;  3OB1 B;  1WRL A;  1YUS A;  3VRQ A;  1KQM C;  2WCE A;  4XJK B;  1CDP A;  1PUL A;  2M1U A;  4I5J A;  4ETO A;  3I5F C;  1PVB A;  1QJT A;  1TOP A;  1MR8 A;  1N0Y A;  1XFZ O;  1IKU A;  2EGD A;  2NCP A;  1L7Z A;  3VGO A;  2M7N A;  2M7L A;  1K95 A;  1U5I A;  4N5X A;  3LK0 A;  5CSI A;  4YI8 A;  2LE9 B;  5HKY A;  1OMD A;  2BCB A;  1M46 A;  2AMI A;  4I5N B;  3PSR A;  2LVK A;  2KYF A;  2L4I A;  2KNE A;  1K8U A;  1BG1 A;  1H4B A;  1JBA A;  3TZ1 A;  2O5G A;  1DF0 B;  2LUX A;  2G9B A;  1OQP A;  5GQQ C;  1WDC C;  1B47 A;  2QPT A;  3CR2 A;  1YUU A;  3CWG A;  3JVT B;  3WHU B;  1UUR A;  4M2O A;  2PRU A;  1XFX O;  3EK8 A;  4GBA A;  3K21 A;  3BUX B;  3BUO B;  4YRU A;  1JFJ A;  1KK7 Y;  3DVJ A;  5CPV A;  1DTL A;  3BOW A;  2VRG A;  2LV7 A;  1EH2 A;  2KFF A;  2FJU B;  2WCB A;  1KWO C;  4I5L B;  2JOJ A;  1OZS A;  1DJH A;  1NX1 A;  2FCE A;  2LHL A;  4MN0 A;  1GGW A;  2KFG A;  1Y0V H;  3SG4 A;  2L51 A;  2BCX A;  1JSA A;  4PE4 A;  2CBL A;  1J7P A;  1K9P A;  4HRG A;  1R2U A;  3O2P A;  4YBH B;  1TCF A;  1BU3 A;  1CDL A;  1MWN A;  1SCM C;  5AEQ A;  1QTX A;  2KDH A;  1F8H A;  4GAO A;  4OKH A;  4NQG A;  1NX3 A;  4PAL A;  1ODB A;  2L50 A;  3NSK A;  3EK4 A;  1BOD A;  1YX7 A;  1B7T Y;  1MF8 B;  4ICB A;  3OHM B;  1OMV A;  1XYD A;  2KQ6 A;  2LC5 A;  1NX0 A;  5D69 A;  1NCZ A;  4P5O E;  4L9M A;  4DS7 A;  3BUM B;  2DOQ A; 
#chains in the Genus database with same CATH topology
 4GNK B;  2JC2 A;  1TUZ A;  1CB1 A;  2MLE C;  3SS5 A;  1OOH A;  2LMU A;  2KQY A;  2EC6 C;  3JTD B;  4PCW A;  1M45 A;  4PHJ A;  3EK7 A;  1TN4 A;  1CFP A;  1OMR A;  4WQ3 A;  1C07 A;  1ZAC A;  3KHE A;  5D3O A;  3RZS A;  3ICB A;  2H61 A;  1DGU A;  2BBM A;  1B8L A;  1RWY A;  1KFU S;  2LP2 A;  2OS8 B;  4PE1 A;  2WCL A;  2CXJ A;  3S0F A;  2KAV A;  5I8N A;  1X02 A;  1NPQ A;  1L2O B;  1KFU L;  1PVA A;  2L4H A;  2KI4 C;  2JUL A;  2L98 A;  1QVI Z;  1OOJ A;  4GFT A;  4U8D A;  3VRO A;  2KLD A;  1CDN A;  2JT0 A;  1QIW A;  1RRO A;  1B1G A;  2L2C A;  1FBV A;  1KSM A;  3O78 A;  5DKQ A;  1J7Q A;  1K94 A;  3K1E A;  3RM1 A;  2I2R E;  1W9Z A;  2LAP A;  1DC1 A;  1UHK A;  1SL8 A;  4YGD B;  1KK8 C;  2WC6 A;  1QX5 B;  1LVC D;  4HSZ A;  1QAT A;  2FOT A;  4OR9 B;  4YGB B;  4QJ4 B;  1CMF A;  4MBE A;  2GV5 A;  1QLS A;  3BFA A;  2M49 B;  1G33 A;  3AAK A;  3KF9 A;  1DJX A;  1DF0 A;  3NHI A;  4NDD A;  3TS5 B;  1N65 A;  1UWO A;  3D75 A;  1XVJ A;  3EKH A;  2BNX A;  2MA2 A;  2COL B;  2SCP A;  3EKJ A;  3HX4 A;  5I2O A;  1IQ3 A;  1BLQ A;  5DKN A;  3OX6 A;  3TDI A;  2KBI A;  4WRI A;  5AXI A;  4MSP A;  4YGE B;  5BPJ A;  1DQE A;  3IF7 A;  1BJF A;  1NYA A;  1YTZ C;  1SBJ A;  1JUO A;  3UNW A;  3DZT A;  1JFK A;  3GK4 X;  3SIB A;  2CNP A;  3FWB A;  1NIW A;  4P2Y B;  2NZ0 A;  3FE9 A;  1FPW A;  1FW4 A;  2FCD A;  2P71 A;  3OP0 A;  3EG5 B;  1F70 A;  1EXR A;  3SG7 A;  1ALW A;  1PAL A;  1TNP A;  1V1F A;  2E6W A;  2OTG B;  2WOS A;  1NCX A;  1YUT A;  3I5H C;  3NSL A;  3R1P A;  1CLB A;  1MQ1 A;  3GK2 A;  2LMV A;  3AKA A;  2LVJ A;  3BXK A;  1CLL A;  3D0Y B;  4TNC A;  5HLO A;  3OBV A;  5ER4 X;  1BOC A;  1Y1A A;  1A4P A;  3E3R A;  3I5I B;  4PHN A;  2JXC A;  3DYE A;  1UHH A;  4AOM A;  3FE6 A;  1S36 A;  1CM1 A;  2BL0 C;  1G4Y R;  1AP4 A;  3HCM A;  4MVF A;  3DXL A;  4CFR A;  2F8P A;  1QV0 A;  4JD9 A;  4E68 A;  1OOI X;  4GUK A;  1BMO A;  1QIV A;  2M29 A;  3EVU A;  3CR5 X;  5CSN A;  4N1G A;  5HLV A;  1LXF C;  1YVL A;  2M3W A;  2KI6 D;  2GGZ A;  2ZRS A;  3WNX B;  3TUY C;  3B6X A;  3EVV A;  2KOT A;  2MBX A;  5AER A;  3F45 A;  1EG4 A;  1CMG A;  1XFV O;  3DY9 A;  4FTG A;  3CZ1 A;  4FQT A;  1RK9 A;  3D78 A;  4AQJ A;  2F3Z A;  1OOG A;  4IJ7 A;  1K9K A;  1QV1 A;  2JTT A;  1IG5 A;  1D1O A;  4ZCV A;  3PAL A;  1B4C A;  1K96 A;  1V1G A;  1C3Y A;  2JU0 A;  1AVS A;  1TIZ A;  1QS7 A;  4QJ5 B;  4DCK A;  2P70 A;  3D74 A;  5D7F A;  1LS8 A;  1TNX A;  2Y5I A;  5I2Q A;  2KAX A;  3CLN A;  2K7D A;  1J1E A;  3CS1 A;  4PDZ A;  3I5G C;  1SR6 B;  4PE0 A;  1UUS A;  1DJW A;  5DKR A;  1AJ5 A;  4YI9 A;  3S0G A;  1ORG A;  2JPO A;  1QVI Y;  2R2I A;  2Q4U A;  2WOR A;  2GGM A;  1JF2 A;  3PN7 C;  2LVI A;  1K9U A;  1N2D A;  2G2B A;  1HT9 A;  1DJY A;  1REC A;  2L5X B;  1G8I A;  3SIA A;  3R1O A;  3VRP A;  1NCY A;  1XFU O;  3I5F B;  1JC2 A;  3KPX A;  4D1E A;  4JWQ A;  3SJS A;  1QX7 A;  4MEW A;  5JJG A;  2H8V A;  2PAS A;  2LUC A;  3LK1 A;  2F3Y A;  4MLW A;  2NCO A;  1J7O A;  2H61 C;  3OB2 B;  4WQ2 A;  3WHT B;  1ZFS A;  2BKH B;  2LCP A;  1OW4 A;  1PSR A;  3OX5 A;  3PFV A;  4CFQ A;  4JPZ B;  5EL2 A;  1S6I A;  2SAS A;  1H8B A;  3SG5 A;  1NP8 A;  4DIR A;  3PM2 A;  4AQI A;  4USL A;  4A4B A;  1XFW O;  2ISD A;  1WDC B;  4GGF A;  1XA5 A;  2QEO A;  3GOF A;  5DIC A;  1QXP A;  2LNK A;  4M2P A;  3NSO A;  2L0P A;  1DEL A;  1F55 A;  2KFH A;  1AJ4 A;  3GK1 A;  2ZRT A;  3BJH A;  2E30 A;  1GQM A;  3BUW B;  2H2K A;  1XK4 A;  2I94 A;  5AAN A;  1KFX S;  3O4X A;  1J1D A;  1M31 A;  1XFY O;  1PSB A;  3SG3 A;  1QLK A;  1KWO B;  1TUJ A;  4JQ0 D;  1KFX L;  3QME A;  3SG2 A;  1KSO A;  2LHI A;  2M9G A;  3SS4 A;  3B87 A;  3S0B A;  2PQL A;  1A03 A;  2M97 A;  1GJY A;  2IS9 A;  4YGA A;  3SG6 A;  4OVN F;  2PVB A;  3TDU A;  3D0Y A;  1MXE A;  4DRW A;  5IBW A;  3B88 A;  1W7J B;  2ZNE A;  3D10 A;  1RTP 1;  3M0W A;  5I2L A;  5FI6 A;  3D73 A;  1KCY A;  3N7H A;  3JVT C;  2MAZ A;  4I5K A;  1TNQ A;  4JKT A;  1A29 A;  1B7T Z;  5HKW A;  3B86 A;  1CNP A;  2M8U A;  2ZKM X;  4OV2 A;  3FE8 A;  5I94 A;  1SCM B;  4MZJ A;  2BE4 A;  3ZWH A;  2V53 A;  1TTX A;  2CCM A;  1IJ5 A;  1UHJ A;  2QAC A;  2F33 A;  3NHT A;  2NXQ A;  1HQV A;  1S5G Z;  2EHB A;  4M2Q A;  5ER5 A;  3A8R A;  1JF0 A;  1CFC A;  3WXA A;  4MRX A;  2K0J A;  3CR4 X;  3OGN A;  4BY4 A;  1WY9 A;  2KGB C;  4N1F A;  3PLF B;  2JTZ A;  1F4Q A;  3PAT A;  1SKT A;  3TDZ A;  4NDC A;  3QRX A;  3LLE A;  1NSH A;  2MHH A;  3FS7 A;  1F4O A;  1BT6 A;  1NUB A;  1PRW A;  2Y1M A;  5KU1 A;  1JWD A;  2KHN A;  2MJW B;  5FI2 A;  2JPT A;  2WC8 A;  1J7R A;  1OSA A;  1QAS A;  1A75 A;  3L4L A;  1IIO A;  4GPL B;  3O6B A;  5CSJ A;  1YRU B;  1MUX A;  1S6J A;  1WLM A;  2JWW A;  1YX8 A;  1LA0 A;  4A4C A;  2F2P A;  4C0K A;  1CTR A;  1SL7 A;  3UO9 A;  2KI4 B;  2JT3 A;  3NGV A;  4FQO A;  2LVV A;  2PAL A;  3EVR A;  4CLN A;  3NXA A;  2HQW A;  4PT1 A;  4ZCU A;  2ZND A;  2HPS A;  2Q91 A;  2Y4Q A;  2PSR A;  3JTD C;  5JOL A;  1UP5 A;  3IQO A;  1KK8 B;  1LA3 A;  1DMO A;  1E8A A;  3DF0 B;  2JT8 A;  2Y1N A;  1OZO A;  1WLZ A;  4ORC B;  3LL8 B;  4ORA B;  1NWD A;  2D8N A;  3R72 A;  1MHO A;  4MZK A;  1CFF A;  2L2E A;  2WND A;  2OS8 C;  1S26 D;  4QJ3 B;  3VRR A;  1L2O C;  2RGI A;  2KI6 C;  3RLZ A;  1SMG A;  5G08 A;  4PE7 A;  2WC5 A;  3BFB A;  1SK6 D;  4UPG A;  2MRD A;  1FF1 A;  3LCP C;  1IWQ A;  2WCK A;  1FI5 A;  5HYD A;  3H4S E;  3BQ3 A;  5HL1 A;  1SCV A;  1NX2 A;  1A75 B;  1RJV A;  1K90 D;  1VRK A;  1TNW A;  4OZD A;  2LP3 A;  2K61 A;  5HKZ A;  2AAO A;  2HF5 A;  2JQ6 A;  1B9A A;  1DGV A;  4GGN A;  4YGC B;  2K2F A;  1KQM B;  2P6B B;  2CT9 A;  5KTY A;  2LAN A;  1C7V A;  1SW8 A;  5TNC A;  1UHI A;  5AFP A;  2KAY A;  1U5I B;  2KYC A;  3C1V A;  1ALV A;  1S3P A;  1RFJ A;  2JNF A;  2KLE A;  3TS5 C;  1Z4H A;  1C7W A;  4MZL A;  3FIA A;  4PHK A;  1SY9 A;  1Z2C B;  1K2H A;  1IJ6 A;  2ZN9 A;  4CID A;  1B8C A;  1XO5 A;  2PMY A;  4CPV A;  1SL9 A;  1GM0 A;  3I5H B;  3CTN A;  2JRF A;  2K2A A;  2MLF C;  2QDI A;  2A4J A;  4GGF C;  1K93 D;  2I7A A;  2BKI B;  4F0Z B;  2WCJ A;  2F2O A;  2KBM A;  1CFD A;  1IGV A;  4HRE E;  2ZN8 A;  2TN4 A;  1BF5 A;  4HRH A;  1KK7 Z;  2BL0 B;  2K8M B;  1Y6W A;  1IH0 A;  1LIN A;  3KEV A;  1S5G Y;  4Q04 A;  1M63 B;  1EL4 A;  3DVK A;  1XK4 C;  1UHN A;  2K7O A;  3BOW B;  4IL1 A;  1M39 A;  1BR4 B;  1DJZ A;  1W7I B;  1YRT B;  2L5Y A;  2OTG C;  4KYN A;  4C0L A;  1A2X A;  1OOF A;  3VRN A;  1PK0 D;  1EG3 A;  5FYX A;  2CTN A;  5KSZ A;  3L4A A;  1BR1 B;  4MRY A;  1QX2 A;  2WCF A;  1AUI B;  5CSF A;  1R6P A;  3TUY B;  1FI6 A;  4DUQ A;  1DJI A;  1YVH A;  2BEC A;  2KSP A;  4INX A;  1TCO B;  1MXL C;  2LMT A;  1F71 A;  3CZ2 A;  3I5I C;  4R1E A;  3DD4 A;  1Q80 A;  2JNX A;  1SPY A;  2LLT A;  3KO0 A;  5J3X A;  2JZI A;  1GGZ A;  1SYM A;  1S1E A;  1SRA A;  1IQ5 A;  1YUR A;  4XJK A;  3MSE B;  4XYN A;  1SNL A;  3ZNI A;  1CDM A;  1SSE B;  3IQQ A;  2HET A;  3AAJ A;  3NSI A;  2HQ8 A;  2K7B A;  2NLN A;  3DVM A;  5PAL A;  4NDB A;  3D76 A;  2KGR A;  5F6T A;  1DJG A;  2BCA A;  3CGA A;  1WRK A;  2M0R A;  2BBN A;  3CAB A;  3I5G B;  3PM8 A;  1CLM A;  2ZFD A;  1F54 A;  4OCI A;  3CZT X;  1S6C A;  1CM4 A;  2O60 A;  5B8I B;  2LLS A;  2B1U A;  2JXL A;  1YR5 A;  1DVI A;  3O4Y A;  2I18 A;  2BE6 A;  3BUN B;  3V2L A;  1DT7 B;  3PN7 B;  1OE9 B;  1ZOT B;  1ZUZ A;  2LLU A;  1CKK A;  3DF0 A;  1AHR A;  2K7C A;  2M1K B;  1KQV A;  1Y1U A;  1IRJ A;  2GTE A;  1LKJ A;  3CZ0 A;  5K89 A;  1Y1X A;  1WRZ A;  3CDN A;  3FWC A;  3AKB A;  1TRF A;  4ORB B;  1EJ3 A;  4F7F A;  4PHM A;  2AUC A;  2QEV A;  4BY5 A;  1AK8 A;  3DVE A;  3A4U B;  1J55 A;  3BYA A;  2OPO A;  1ZMZ A;  2YGU A;  2LM5 A;  2EC6 B;  1SR6 C;  4C0J A;  2WCM A;  1B8R A;  3OB1 B;  1QWV A;  1WRL A;  1YUS A;  1KQM C;  2KPH A;  3Q8I A;  3VRQ A;  4INW A;  2WCE A;  4XJK B;  1CDP A;  1PUL A;  2M1U A;  3VB1 A;  4I5J A;  4ETO A;  3I5F C;  1PVB A;  1QJT A;  2BAP A;  1DEK A;  1TOP A;  2WCH A;  1MR8 A;  3S0A A;  1N0Y A;  1XFZ O;  1IKU A;  2EGD A;  2NCP A;  1L7Z A;  2PYQ A;  2M7N A;  3VGO A;  2M7L A;  1K95 A;  1U5I A;  4N5X A;  3LK0 A;  5CSI A;  4YI8 A;  2LE9 B;  5HKY A;  1OMD A;  2BCB A;  1M46 A;  2AMI A;  4I5N B;  3PSR A;  2LVK A;  2KYF A;  2K60 A;  2L4I A;  2KNE A;  1K8U A;  1BG1 A;  1H4B A;  2ERB A;  3TZ1 A;  2O5G A;  1JBA A;  1DF0 B;  2LUX A;  2G9B A;  1OQP A;  1C3Z A;  5GQQ C;  1WDC C;  1B47 A;  1TWO A;  2QPT A;  3R1V A;  3CR2 A;  1YUU A;  3CWG A;  3JVT B;  3WHU B;  1UUR A;  4M2O A;  2PRU A;  1XFX O;  1P28 A;  3EK8 A;  4GBA A;  3CYZ A;  3BUX B;  3BUO B;  3K21 A;  4YRU A;  1JFJ A;  5FI7 A;  1KK7 Y;  3DVJ A;  5CPV A;  1XFR A;  1DTL A;  3BOW A;  2VRG A;  2LV7 A;  1EH2 A;  2KFF A;  1T14 A;  2QEH A;  2FJU B;  2WCB A;  1KWO C;  4I5L B;  2JOJ A;  1OZS A;  1DJH A;  1NX1 A;  2FCE A;  2LHL A;  3IVT A;  4MN0 A;  1GGW A;  2KFG A;  3PJI A;  3SS3 A;  1Y0V H;  3SG4 A;  2L51 A;  2QEB A;  2BCX A;  1JSA A;  4PE4 A;  2CBL A;  1J7P A;  1K9P A;  4HRG A;  1R2U A;  3O2P A;  4YBH B;  1TCF A;  1BU3 A;  1CDL A;  1MWN A;  3D77 A;  1SCM C;  3B7A A;  5AEQ A;  1QTX A;  2KDH A;  1F8H A;  4GAO A;  4OKH A;  4NQG A;  1NX3 A;  4PAL A;  1ODB A;  3BFH A;  2L50 A;  3NSK A;  3EK4 A;  1BOD A;  1YX7 A;  1B7T Y;  1MF8 B;  4ICB A;  3OHM B;  1OMV A;  1XYD A;  2KQ6 A;  2LC5 A;  2FJY A;  3L47 A;  1NX0 A;  5D69 A;  1NCZ A;  4P5O E;  4L9M A;  4DS7 A;  3S0D A;  3BUM B;  3S0E A;  2DOQ A; 
#chains in the Genus database with same CATH homology
 4GNK B;  2JC2 A;  1CB1 A;  2MLE C;  2LMU A;  2KQY A;  2EC6 C;  3JTD B;  4PCW A;  1M45 A;  4PHJ A;  3EK7 A;  1TN4 A;  1CFP A;  1OMR A;  4WQ3 A;  1C07 A;  1ZAC A;  3KHE A;  3ICB A;  2H61 A;  1DGU A;  2BBM A;  1B8L A;  1RWY A;  1KFU S;  2LP2 A;  2OS8 B;  4PE1 A;  2CXJ A;  2KAV A;  5I8N A;  1X02 A;  1NPQ A;  1L2O B;  1KFU L;  1PVA A;  2L4H A;  2KI4 C;  2JUL A;  2L98 A;  1QVI Z;  1OOJ A;  4GFT A;  4U8D A;  3VRO A;  1CDN A;  2JT0 A;  1QIW A;  1RRO A;  1B1G A;  1FBV A;  1KSM A;  3O78 A;  5DKQ A;  1J7Q A;  1K94 A;  3RM1 A;  2I2R E;  2LAP A;  1UHK A;  1SL8 A;  4YGD B;  1KK8 C;  1QX5 B;  1LVC D;  4HSZ A;  1QAT A;  2FOT A;  4OR9 B;  4YGB B;  4QJ4 B;  1CMF A;  4MBE A;  2GV5 A;  1QLS A;  2M49 B;  1G33 A;  3AAK A;  3KF9 A;  1DJX A;  1DF0 A;  4NDD A;  3TS5 B;  1N65 A;  1UWO A;  1XVJ A;  3EKH A;  2MA2 A;  2COL B;  2SCP A;  3EKJ A;  3HX4 A;  5I2O A;  1IQ3 A;  1BLQ A;  5DKN A;  3OX6 A;  3TDI A;  2KBI A;  4WRI A;  5AXI A;  4MSP A;  4YGE B;  5BPJ A;  3IF7 A;  1BJF A;  1NYA A;  1YTZ C;  1SBJ A;  1JUO A;  1JFK A;  3GK4 X;  3SIB A;  2CNP A;  3FWB A;  1NIW A;  4P2Y B;  2NZ0 A;  1FPW A;  1FW4 A;  2FCD A;  3OP0 A;  1F70 A;  1EXR A;  3SG7 A;  1ALW A;  1PAL A;  1TNP A;  1V1F A;  2E6W A;  2OTG B;  2WOS A;  1NCX A;  1YUT A;  3I5H C;  3NSL A;  1CLB A;  1MQ1 A;  3GK2 A;  2LMV A;  3AKA A;  2LVJ A;  3BXK A;  1CLL A;  3D0Y B;  4TNC A;  5HLO A;  5ER4 X;  1BOC A;  1Y1A A;  1A4P A;  3E3R A;  3I5I B;  4PHN A;  2JXC A;  1UHH A;  4AOM A;  1S36 A;  1CM1 A;  2BL0 C;  1G4Y R;  1AP4 A;  3HCM A;  4MVF A;  4CFR A;  2F8P A;  1QV0 A;  4E68 A;  4GUK A;  1BMO A;  1QIV A;  2M29 A;  3EVU A;  3CR5 X;  5CSN A;  4N1G A;  5HLV A;  1LXF C;  1YVL A;  2M3W A;  2KI6 D;  2GGZ A;  2ZRS A;  3WNX B;  3TUY C;  3EVV A;  2KOT A;  2MBX A;  5AER A;  3F45 A;  1EG4 A;  1CMG A;  1XFV O;  4FTG A;  1RK9 A;  4AQJ A;  2F3Z A;  1K9K A;  1QV1 A;  2JTT A;  1IG5 A;  1D1O A;  4ZCV A;  3PAL A;  1B4C A;  1K96 A;  1V1G A;  2JU0 A;  1AVS A;  1TIZ A;  1QS7 A;  4QJ5 B;  4DCK A;  5D7F A;  1TNX A;  2Y5I A;  5I2Q A;  2KAX A;  3CLN A;  2K7D A;  1J1E A;  3CS1 A;  4PDZ A;  3I5G C;  1SR6 B;  4PE0 A;  1UUS A;  1DJW A;  5DKR A;  1AJ5 A;  4YI9 A;  2R2I A;  1QVI Y;  2Q4U A;  2WOR A;  2GGM A;  1JF2 A;  3PN7 C;  2LVI A;  1K9U A;  1N2D A;  2G2B A;  1HT9 A;  1DJY A;  1REC A;  2L5X B;  1G8I A;  3SIA A;  3VRP A;  1NCY A;  1XFU O;  3I5F B;  1JC2 A;  3KPX A;  4D1E A;  4JWQ A;  3SJS A;  1QX7 A;  4MEW A;  5JJG A;  2PAS A;  2LUC A;  3LK1 A;  2F3Y A;  4MLW A;  2NCO A;  1J7O A;  2H61 C;  3OB2 B;  4WQ2 A;  3WHT B;  1ZFS A;  2BKH B;  2LCP A;  1PSR A;  3OX5 A;  3PFV A;  4CFQ A;  4JPZ B;  1H8B A;  1S6I A;  2SAS A;  3SG5 A;  1NP8 A;  4DIR A;  4AQI A;  4USL A;  4A4B A;  1XFW O;  2ISD A;  1WDC B;  4GGF A;  1XA5 A;  3GOF A;  1QXP A;  2LNK A;  4M2P A;  3NSO A;  2L0P A;  1F55 A;  2KFH A;  1AJ4 A;  3GK1 A;  2ZRT A;  2E30 A;  1GQM A;  3BUW B;  2H2K A;  1XK4 A;  2I94 A;  5AAN A;  1KFX S;  1J1D A;  1M31 A;  1XFY O;  1PSB A;  3SG3 A;  1QLK A;  1KWO B;  4JQ0 D;  3SG2 A;  1KFX L;  1KSO A;  2LHI A;  2M9G A;  1A03 A;  2M97 A;  1GJY A;  2IS9 A;  4YGA A;  3SG6 A;  4OVN F;  2PVB A;  3TDU A;  3D0Y A;  1MXE A;  4DRW A;  5IBW A;  1W7J B;  2ZNE A;  3D10 A;  1RTP 1;  3M0W A;  5I2L A;  1KCY A;  3JVT C;  2MAZ A;  4I5K A;  1TNQ A;  1A29 A;  1B7T Z;  5HKW A;  1CNP A;  2M8U A;  2ZKM X;  4OV2 A;  1SCM B;  4MZJ A;  2BE4 A;  3ZWH A;  2V53 A;  1TTX A;  2CCM A;  1IJ5 A;  1UHJ A;  2QAC A;  2F33 A;  2NXQ A;  1HQV A;  1S5G Z;  2EHB A;  4M2Q A;  5ER5 A;  3A8R A;  1JF0 A;  1CFC A;  3WXA A;  4MRX A;  2K0J A;  3CR4 X;  4BY4 A;  1WY9 A;  2KGB C;  4N1F A;  3PLF B;  2JTZ A;  1F4Q A;  3PAT A;  1SKT A;  3TDZ A;  4NDC A;  3QRX A;  3LLE A;  1NSH A;  2MHH A;  3FS7 A;  1F4O A;  1BT6 A;  1NUB A;  1PRW A;  2Y1M A;  5KU1 A;  1JWD A;  2KHN A;  2MJW B;  2JPT A;  2WC8 A;  1J7R A;  1OSA A;  1QAS A;  1A75 A;  4GPL B;  3O6B A;  5CSJ A;  1YRU B;  1MUX A;  1S6J A;  1WLM A;  2JWW A;  1YX8 A;  1LA0 A;  4A4C A;  2F2P A;  4C0K A;  1CTR A;  1SL7 A;  2KI4 B;  2JT3 A;  4FQO A;  2LVV A;  2PAL A;  3EVR A;  4CLN A;  3NXA A;  2HQW A;  4ZCU A;  2ZND A;  2HPS A;  2Q91 A;  2Y4Q A;  2PSR A;  3JTD C;  5JOL A;  1UP5 A;  3IQO A;  1KK8 B;  1LA3 A;  1DMO A;  1E8A A;  3DF0 B;  2JT8 A;  2Y1N A;  1OZO A;  1WLZ A;  4ORC B;  3LL8 B;  4ORA B;  1NWD A;  2D8N A;  1MHO A;  4MZK A;  1CFF A;  2L2E A;  2WND A;  2OS8 C;  1S26 D;  4QJ3 B;  3VRR A;  1L2O C;  2RGI A;  2KI6 C;  3RLZ A;  1SMG A;  5G08 A;  4PE7 A;  4UPG A;  1SK6 D;  1FF1 A;  2MRD A;  1FI5 A;  3LCP C;  1IWQ A;  5HYD A;  3H4S E;  3BQ3 A;  1SCV A;  1NX2 A;  1A75 B;  1RJV A;  1K90 D;  1VRK A;  1TNW A;  5HKZ A;  2LP3 A;  2K61 A;  2AAO A;  2HF5 A;  2JQ6 A;  1B9A A;  1DGV A;  4GGN A;  4YGC B;  2K2F A;  1KQM B;  2P6B B;  2CT9 A;  5KTY A;  2LAN A;  1C7V A;  1SW8 A;  5TNC A;  1UHI A;  5AFP A;  2KAY A;  1U5I B;  2KYC A;  3C1V A;  1ALV A;  1S3P A;  1RFJ A;  2JNF A;  3TS5 C;  1C7W A;  4MZL A;  3FIA A;  4PHK A;  1SY9 A;  1K2H A;  1IJ6 A;  2ZN9 A;  4CID A;  1B8C A;  1XO5 A;  2PMY A;  4CPV A;  1SL9 A;  3I5H B;  3CTN A;  2JRF A;  2K2A A;  2MLF C;  2A4J A;  4GGF C;  1K93 D;  2I7A A;  2BKI B;  4F0Z B;  2F2O A;  2KBM A;  1CFD A;  1IGV A;  4HRE E;  2ZN8 A;  2TN4 A;  1BF5 A;  4HRH A;  1KK7 Z;  2BL0 B;  2K8M B;  1Y6W A;  1IH0 A;  1LIN A;  3KEV A;  1S5G Y;  4Q04 A;  1M63 B;  1EL4 A;  3DVK A;  1XK4 C;  1UHN A;  2K7O A;  3BOW B;  4IL1 A;  1M39 A;  1BR4 B;  1DJZ A;  1W7I B;  1YRT B;  4C0L A;  2OTG C;  1A2X A;  3VRN A;  1PK0 D;  1EG3 A;  5FYX A;  2CTN A;  5KSZ A;  1BR1 B;  4MRY A;  1QX2 A;  2WCF A;  1AUI B;  5CSF A;  1R6P A;  3TUY B;  1FI6 A;  4DUQ A;  1DJI A;  1YVH A;  2BEC A;  2KSP A;  1TCO B;  1MXL C;  2LMT A;  1F71 A;  3I5I C;  4R1E A;  3DD4 A;  1Q80 A;  2JNX A;  1SPY A;  2LLT A;  3KO0 A;  5J3X A;  2JZI A;  1GGZ A;  1SYM A;  1S1E A;  1SRA A;  1IQ5 A;  1YUR A;  4XJK A;  3MSE B;  4XYN A;  1SNL A;  3ZNI A;  1CDM A;  3IQQ A;  2HET A;  3AAJ A;  3NSI A;  2HQ8 A;  2K7B A;  2NLN A;  3DVM A;  5PAL A;  4NDB A;  5F6T A;  2KGR A;  1DJG A;  2BCA A;  3CGA A;  1WRK A;  2M0R A;  2BBN A;  3I5G B;  3PM8 A;  1CLM A;  2ZFD A;  1F54 A;  4OCI A;  3CZT X;  1S6C A;  1CM4 A;  2O60 A;  5B8I B;  2LLS A;  2B1U A;  2JXL A;  1YR5 A;  1DVI A;  3O4Y A;  2I18 A;  2BE6 A;  3BUN B;  1DT7 B;  3PN7 B;  1OE9 B;  1ZOT B;  1ZUZ A;  2LLU A;  1CKK A;  3DF0 A;  1AHR A;  2K7C A;  2M1K B;  1KQV A;  1Y1U A;  1IRJ A;  1LKJ A;  5K89 A;  1Y1X A;  1WRZ A;  3FWC A;  3AKB A;  1TRF A;  4ORB B;  1EJ3 A;  4PHM A;  2AUC A;  4BY5 A;  1AK8 A;  3DVE A;  3A4U B;  1J55 A;  3BYA A;  2OPO A;  1ZMZ A;  2LM5 A;  2EC6 B;  1SR6 C;  4C0J A;  1B8R A;  3OB1 B;  1WRL A;  1YUS A;  3VRQ A;  1KQM C;  2WCE A;  4XJK B;  1CDP A;  1PUL A;  2M1U A;  4I5J A;  4ETO A;  3I5F C;  1PVB A;  1QJT A;  1TOP A;  1MR8 A;  1N0Y A;  1XFZ O;  1IKU A;  2EGD A;  2NCP A;  1L7Z A;  3VGO A;  2M7N A;  2M7L A;  1K95 A;  1U5I A;  4N5X A;  3LK0 A;  5CSI A;  4YI8 A;  2LE9 B;  5HKY A;  1OMD A;  2BCB A;  1M46 A;  2AMI A;  4I5N B;  3PSR A;  2LVK A;  2KYF A;  2L4I A;  2KNE A;  1K8U A;  1BG1 A;  1H4B A;  1JBA A;  3TZ1 A;  2O5G A;  1DF0 B;  2LUX A;  2G9B A;  1OQP A;  5GQQ C;  1WDC C;  1B47 A;  2QPT A;  3CR2 A;  1YUU A;  3CWG A;  3JVT B;  3WHU B;  1UUR A;  4M2O A;  2PRU A;  1XFX O;  3EK8 A;  4GBA A;  3K21 A;  3BUX B;  3BUO B;  4YRU A;  1JFJ A;  1KK7 Y;  3DVJ A;  5CPV A;  1DTL A;  3BOW A;  2VRG A;  2LV7 A;  1EH2 A;  2KFF A;  2FJU B;  2WCB A;  1KWO C;  4I5L B;  2JOJ A;  1OZS A;  1DJH A;  1NX1 A;  2FCE A;  2LHL A;  4MN0 A;  1GGW A;  2KFG A;  1Y0V H;  3SG4 A;  2L51 A;  2BCX A;  1JSA A;  4PE4 A;  2CBL A;  1J7P A;  1K9P A;  4HRG A;  1R2U A;  3O2P A;  4YBH B;  1TCF A;  1BU3 A;  1CDL A;  1MWN A;  1SCM C;  5AEQ A;  1QTX A;  2KDH A;  1F8H A;  4GAO A;  4OKH A;  4NQG A;  1NX3 A;  4PAL A;  1ODB A;  2L50 A;  3NSK A;  3EK4 A;  1BOD A;  1YX7 A;  1B7T Y;  1MF8 B;  4ICB A;  3OHM B;  1OMV A;  1XYD A;  2KQ6 A;  2LC5 A;  1NX0 A;  5D69 A;  1NCZ A;  4P5O E;  4L9M A;  4DS7 A;  3BUM B;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...