3TUYC

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 46
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC02
2LCPA 1KFXS 3RLZA 5DKQA 2F2OA 2BECA 3TDZA 3IQQA 2K8MB 2L98A 2JRFA 3M0WA 3VRNA 1D1OA 2HQWA 1RK9A 5KSZA 1UURA 2QACA 2G2BA 1FF1A 2KAVA 4HRGA 3TUYC 1RECA 1IJ6A 2COLB 1NX2A 2KOTA 3JVTB 3LK1A 1G8IA 4WQ3A 5D7FA 2M7LA 4D1EA 2KI6C 1CDLA 2BE4A 1C7VA 4PHJA 4P5OE 3I5FB 2K7BA 4AOMA 2CNPA 2JQ6A 2PVBA 4MN0A 3IF7A 4MZLA 1EJ3A 5JOLA 1YUTA 1QTXA 2LC5A 1UHNA 4YGBB 3O78A 1CDNA 1MXEA 2Y1MA 1NYAA 4PE0A 3LLEA 1RJVA 1CLMA 2PASA 1OMDA 1AHRA 1BF5A 1PVBA 1S6JA 1ZOTB 2FOTA 1X02A 2HETA 2M1KB 2MBXA 3VROA 2Y4QA 3GOFA 2FJUB 4PHKA 3KHEA 2NCPA 2VRGA 1SK6D 2JT3A 1ALWA 2P6BB 4YGAA 1YVHA 1FW4A 3DD4A 2I94A 1Q80A 2KYFA 1LVCD 4A4BA 3NSOA 1YRUB 1CTRA 1CM1A 1YR5A 2SCPA 2WCBA 3DF0B 1BT6A 3A8RA 2KNEA 5AEQA 4YRUA 1XFUO 1LINA 4N5XA 1OZOA 2ZFDA 3D10A 2MAZA 1NWDA 1B8LA 3MSEB 2GGMA 1KK8C 2AMIA 5HLVA 4ZCVA 1BODA 3SG7A 1SMGA 4ETOA 2K2AA 2Y5IA 4MZJA 4PE4A 2BCXA 3EKJA 4GGFC 3BXKA 1OOJA 2LUXA 1V1FA 1BMOA 3I5HC 3PSRA 5HYDA 1K9KA 2WNDA 3GK2A 1YVLA 2SASA 2LE9B 1XFYO 2JPTA 1TNXA 2LMUA 1R6PA 1TNWA 2ZNDA 2WCFA 3CR4X 1L7ZA 2FCEA 2GV5A 1NUBA 4NDCA 2JXLA 1B8RA 4I5LB 3BUXB 1IKUA 5HKZA 1DF0B 1QV0A 1J1EA 4GUKA 4TNCA 4C0LA 2F3YA 2CTNA 1AJ5A 3SG6A 2AAOA 2KGRA 1DVIA 4ZCUA 1SL8A 1NPQA 1CFPA 4MRXA 1RFJA 4P2YB 2LMVA 1EG3A 2ZN9A 1QX7A 1MXLC 1PULA 3DF0A 5AANA 5I2OA 3WHTB 2GGZA 1LXFC 4ORCB 1DJHA 4WQ2A 2Q4UA 3TS5C 1ALVA 2KBMA 4GBAA 1BJFA 2ISDA 3BUNB 4JWQA 1SCMB 1A29A 1SY9A 5AXIA 1RROA 5B8IB 1GGWA 2EGDA 5IBWA 2F3ZA 1E8AA 2L2EA 1AJ4A 3EK7A 1NCXA 1TRFA 1Y0VH 2EC6B 2LVJA 3ZNIA 1KWOB 1NP8A 2WOSA 2LHLA 4AQIA 1F4OA 1Y1UA 4I5KA 3SIBA 1U5IB 1TNPA 1QIVA 3I5GB 1S26D 1A03A 1BR4B 1QXPA 2CT9A 3C1VA 2JWWA 1B1GA 1H4BA 1K9PA 5CSIA 1FI5A 2JTTA 3AKAA 2BL0B 1JF0A 4DRWA 4HREE 2LUCA 1DF0A 5CSJA 1KCYA 4BY5A 1PVAA 1UUSA 1DJXA 1Y1AA 3SG2A 3AKBA 4L9MA 4OVNF 3OX5A 1KFUL 1K94A 4YGDB 4E68A 2PALA 3BUOB 5FYXA 2K61A 4DS7A 5TNCA 1F71A 4ORAB 1UP5A 2BKHB 3RM1A 4FQOA 5GQQC 3JVTC 2I2RE 2R2IA 1XVJA 5KTYA 1M31A 4AQJA 3DVEA 1K95A 3I5FC 4PDZA 1G4YR 1S3PA 2KBIA 1TTXA 2L0PA 4PHNA 4UPGA 1NX3A 1QATA 1WRLA 1FPWA 1M46A 1MF8B 1EG4A 4DUQA 2NZ0A 4ORBB 1WRKA 4N1FA 1K8UA 1U5IA 1ZMZA 1SR6B 1H8BA 2I7AA 2H2KA 2L50A 2LP2A 1S5GZ 4OV2A 2OS8B 3K21A 3PATA 1J7QA 2BBMA 5CSFA 1QLKA 3CLNA 2KI4B 2FCDA 5BPJA 2JNXA 2WC8A 1YX8A 1KQMB 3FWBA 1KSOA 1SYMA 1WY9A 2BCAA 3KO0A 4CFQA 1GGZA 1NCZA 1CNPA 1V1GA 1DJZA 1MR8A 1YURA 3SG3A 4I5NB 1QVIZ 2F8PA 4PCWA 2PSRA 1S6CA 1SKTA 1F8HA 1K2HA 3OB1B 4XJKB 1A4PA 2JXCA 5AFPA 1NX1A 1TCOB 3KPXA 2K7CA 2NXQA 5HKWA 1NSHA 2BE6A 2M49B 2ZN8A 1CLLA 2OTGB 5J3XA 2MHHA 4USLA 1AK8A 2F33A 4IL1A 1QX2A 3OB2B 4R1EA 1C7WA 2LV7A 2G9BA 4YBHB 3AAJA 5I2QA 2OPOA 2KAXA 4OR9B 3I5IB 1S1EA 3NSKA 4A4CA 4YGCB 2K7DA 4OKHA 4BY4A 1F70A 2LLTA 1QS7A 3LK0A 1C07A 4MZKA 1XFWO 1KSMA 1XO5A 4MLWA 1XK4A 1DGVA 1J55A 2M9GA 1BU3A 1IH0A 2LAPA 4XYNA 1CFCA 3JTDB 4YGEB 1K96A 4PALA 3WNXB 2LLSA 1SBJA 3EVUA 1XFVO 2HQ8A 2JT0A 4YI8A 2BBNA 3O4YA 4PHMA 4C0KA 1QASA 1L2OB 2PMYA 4PE7A 4JPZB 3VRPA 1SPYA 1XFZO 3NSIA 2KDHA 2LP3A 4GNKB 2KYCA 5D69A 5DKRA 1PSRA 1JC2A 1J7RA 3VRQA 1W7JB 1QIWA 2M8UA 2LLUA 3E3RA 1CFDA 1M63B 4XJKA 2KQYA 2L51A 2A4JA 2O60A 1YUSA 1MHOA 2M1UA 1SCMC 1DTLA 2Q91A 1AUIB 1SW8A 3SG5A 4QJ5B 1GJYA 2JNFA 2KAYA 2L4IA 3H4SE 1IJ5A 4F0ZB 1HQVA 1J7PA 3BUMB 1BLQA 2EC6C 2MJWB 1KWOC 1S5GY 2AUCA 1OMRA 1FBVA 1UHIA 1OQPA 1PALA 2WORA 1CFFA 3I5GC 1OSAA 1PSBA 3FS7A 2M97A 3QRXA 3CR5X 3CZTX 1B7TZ 3PALA 1LA3A 2KSPA 2BL0C 1UHHA 3NSLA 3NXAA 3O6BA 4JQ0D 4QJ3B 1JBAA 1XYDA 1DJWA 1B9AA 4I5JA 1DMOA 1B47A 1K9UA 2D8NA 3SG4A 1G33A 3PN7B 1QVIY 2JZIA 4GFTA 2LVVA 3PLFB 1W7IB 3O2PA 1KFXL 2JULA 2ZNEA 2E30A 1TCFA 1B8CA 1WDCB 1A2XA 1AVSA 1JF2A 1FI6A 3WHUB 1MWNA 1PK0D 4HSZA 2H61A 2LVKA 1KFUS 3CGAA 3DVKA 1TN4A 1GQMA 1B4CA 3D0YB 1CMGA 1JWDA 1KQVA 2LM5A 1TIZA 1XFXO 2TN4A 5CSNA 2B1UA 1N2DA 1QV1A 4FTGA 2JU0A 1UHJA 4DCKA 2NCOA 2JOJA 1IWQA 1SNLA 4HRHA 2WCEA 3AAKA 3TUYB 3GK1A 2RGIA 2JTZA 1DJGA 1SR6C 5F6TA 4N1GA 1LKJA 4OCIA 1YRTB 4M2PA 1DJIA 3A4UB 1OMVA 1XK4C 1EXRA 4GAOA 2OS8C 3KEVA 3WXAA 2KFHA 4MBEA 1SL9A 1K93D 3HX4A 5PALA 1EH2A 2KI4C 2MLFC 3DVJA 1JFKA 1A75B 2E6WA 1KQMC 3BYAA 2M0RA 3VRRA 2BCBA 4CFRA 1EL4A 1M39A 3CR2A 1J7OA 1F4QA 4WRIA 3TDIA 2LANA 3EK4A 1DT7B 1IRJA 4NQGA 2JC2A 1BG1A 1YX7A 3BQ3A 4CPVA 2K0JA 2QPTA 3DVMA 2CXJA 1KK7Z 1RWYA 1YTZC 3D0YA 5I8NA 1HT9A 1CKKA 3CS1A 3ZWHA 4U8DA 1NIWA 2CCMA 1S6IA 2LHIA 3TDUA 5HLOA 4C0JA 5KU1A 3FWCA 1MUXA 2OTGC 3VGOA 1MQ1A 1JFJA 1DJYA 1SRAA 1XA5A 2ZKMX 5ER5A 2HPSA 1SL7A 1S36A 1JSAA 1ODBA 3I5IC 2M3WA 2O5GA 4MSPA 5G08A 1B7TY 3LL8B 1CB1A 2KQ6A 2I18A 2KFGA 4MRYA 1TNQA 1K90D 3SIAA 1LA0A 3LCPC 4M2OA 1CLBA 1KK8B 1ZFSA 3PFVA 5CPVA 3JTDC 3SJSA 1WLZA 2F2PA 2HF5A 3BOWB 4MEWA 3IQOA 1BOCA 1YUUA 4NDDA 1A75A 3OP0A 3I5HB 1CM4A 2V53A 2ZRTA 5I2LA 1BR1B 4M2QA 4Q04A 5K89A 1L2OC 3TZ1A 1OE9B 3CWGA 1UWOA 1NCYA 1F54A 2MA2A 4NDBA 1JUOA 3BUWB 1VRKA 4MVFA 1ZUZA 3GK4X 1TOPA 5DKNA 5AERA 2L4HA 3PM8A 1IQ3A 1Y1XA 2H61C 2KI6D 3CTNA 1AP4A 3EKHA 1IG5A 3ICBA 1NX0A 1IQ5A 1N0YA 4GGNA 1WLMA 2EHBA 4DIRA 4PE1A 3FIAA 3KF9A 1QX5B 2Y1NA 2M7NA 3TS5B 1CDMA 1CDPA 4CIDA 1PRWA 5ER4X 4GPLB 1Y6WA 1WRZA 1CMFA 3OX6A 2LNKA 5HKYA 2DOQA 2KFFA 1DGUA 2NLNA 1SCVA 4CLNA 1OZSA 3BOWA 2JT8A 3EVRA 2L5XB 4GGFA 1N65A 3EVVA 2IS9A 2KGBC 3F45A 2K2FA 2KHNA 1QLSA 1UHKA 1ZACA 3PN7C 1QJTA 1F55A 1J1DA 2LMTA 4ICBA 2MLEC 1IGVA 4QJ4B 1KK7Y 3HCMA 1RTP1 2CBLA 2PRUA 3EK8A 1WDCC 1M45A 2MRDA 4YI9A 2LVIA 1R2UA 2ZRSA 2BKIB 3OHMB 2M29A 5JJGA 2K7OA
chains in the Genus database with same CATH superfamily
2LCPA 1KFXS 3RLZA 5DKQA 2F2OA 2BECA 3TDZA 3IQQA 2K8MB 2L98A 2JRFA 3M0WA 3VRNA 2KPHA 1D1OA 2HQWA 1RK9A 5KSZA 1UURA 2QACA 2G2BA 1FF1A 2KAVA 2QEVA 3QMEA 4HRGA 3CZ1A 3TUYC 1RECA 1IJ6A 2COLB 1NX2A 2KOTA 3JVTB 3LK1A 1G8IA 4WQ3A 5D7FA 2M7LA 4D1EA 2KI6C 2WCKA 1CDLA 2BE4A 1C7VA 4PHJA 4P5OE 3B7AA 3I5FB 2K7BA 4AOMA 2CNPA 2JQ6A 2PVBA 4MN0A 3IF7A 4MZLA 1EJ3A 5JOLA 3PJIA 1YUTA 1QTXA 2LC5A 1UHNA 5EL2A 3OBVA 4YGBB 3O78A 1CDNA 3S0FA 1MXEA 2Y1MA 1NYAA 2P71A 4PE0A 3LLEA 1RJVA 1CLMA 2PASA 1OMDA 1AHRA 1BF5A 1SSEB 1PVBA 1S6JA 1ZOTB 2FOTA 1X02A 2HETA 2M1KB 2MBXA 3VROA 2Y4QA 3GOFA 2FJUB 4PHKA 3KHEA 2NCPA 2VRGA 1SK6D 2JT3A 1ALWA 2P6BB 4YGAA 1YVHA 1FW4A 1TUZA 3DD4A 2I94A 1Q80A 2KYFA 1LVCD 3BJHA 4A4BA 3NSOA 1YRUB 1CTRA 2H8VA 1CM1A 2PQLA 3D76A 1YR5A 2SCPA 2WCBA 3DF0B 1BT6A 3A8RA 2KNEA 5AEQA 4YRUA 1XFUO 1LINA 4N5XA 1OZOA 2WCMA 2ZFDA 3D10A 2MAZA 1NWDA 1OOIX 2GTEA 1B8LA 2P70A 3MSEB 2GGMA 1KK8C 2KLDA 3S0GA 2AMIA 5HLVA 4ZCVA 1BODA 3OGNA 3SG7A 1SMGA 4ETOA 2K2AA 2Y5IA 4MZJA 4PE4A 2BCXA 3EKJA 4GGFC 3BXKA 1OOJA 2LUXA 1V1FA 1BMOA 3I5HC 3PSRA 5HYDA 1K9KA 2WNDA 3GK2A 1YVLA 2SASA 2LE9B 1XFYO 2JPTA 1TNXA 2LMUA 1R6PA 1TNWA 2ZNDA 2WCFA 3CR4X 1L7ZA 2FCEA 2GV5A 1NUBA 4NDCA 2JXLA 1B8RA 4I5LB 3BUXB 1IKUA 5HKZA 1DF0B 1QV0A 1J1EA 4GUKA 4TNCA 4C0LA 2F3YA 2CTNA 1AJ5A 3SG6A 2AAOA 2KGRA 1DVIA 3B6XA 4ZCUA 1SL8A 1NPQA 1CFPA 4MRXA 1DEKA 1OOFA 1RFJA 4P2YB 2LMVA 1EG3A 2ERBA 2ZN9A 1QX7A 1MXLC 1PULA 3DF0A 5AANA 5I2OA 3WHTB 2GGZA 1LXFC 4ORCB 1DJHA 4WQ2A 2Q4UA 3TS5C 1ALVA 2KBMA 4GBAA 1BJFA 2ISDA 3BUNB 1GM0A 4JWQA 1SCMB 1A29A 1SY9A 5AXIA 1Z4HA 1RROA 5B8IB 1GGWA 2EGDA 5IBWA 2F3ZA 1E8AA 2L2EA 1AJ4A 3CABA 3EK7A 1NCXA 1TRFA 1Y0VH 2EC6B 2LVJA 3ZNIA 1KWOB 1NP8A 3D78A 2WOSA 2LHLA 4AQIA 1F4OA 1Y1UA 4I5KA 3SIBA 1U5IB 1TNPA 1QIVA 3I5GB 1S26D 5FI2A 1BR4B 3V2LA 1A03A 1QXPA 2CT9A 3C1VA 2JWWA 1B1GA 1H4BA 1K9PA 5CSIA 1FI5A 2JTTA 3AKAA 2BL0B 1JF0A 4DRWA 3R72A 2YGUA 4HREE 5FI7A 2LUCA 1DF0A 5CSJA 1KCYA 4BY5A 1PVAA 1UUSA 1DJXA 1Z2CB 1Y1AA 3SG2A 3AKBA 4L9MA 4OVNF 3L4LA 5I94A 3OX5A 1KFUL 1K94A 4YGDB 4E68A 2PALA 3BUOB 5FYXA 2K61A 4DS7A 1LS8A 5TNCA 1F71A 4ORAB 1UP5A 2BKHB 3RM1A 4FQOA 5GQQC 3JVTC 2I2RE 2R2IA 1XVJA 5KTYA 1M31A 4AQJA 4F7FA 3DVEA 1K95A 3I5FC 4PDZA 1G4YR 1S3PA 2KBIA 1TTXA 2L0PA 3K1EA 4PHNA 4UPGA 1NX3A 1QATA 1WRLA 1FPWA 1M46A 1MF8B 1EG4A 4DUQA 2NZ0A 1ORGA 1WRKA 4N1FA 4ORBB 3RZSA 1K8UA 1U5IA 1ZMZA 3NGVA 1SR6B 1H8BA 2I7AA 2H2KA 2L50A 2LP2A 1S5GZ 2KLEA 4OV2A 2OS8B 3K21A 3PATA 1J7QA 3PM2A 2BBMA 5CSFA 1XFRA 1QLKA 3CLNA 3N7HA 3D75A 2KI4B 2FCDA 5BPJA 2JNXA 2WC8A 1YX8A 1KQMB 3FWBA 1KSOA 1SYMA 3FE8A 3R1OA 3L47A 1WY9A 2BCAA 3KO0A 4CFQA 1GGZA 1NCZA 3B87A 1CNPA 1V1GA 1DJZA 1MR8A 1YURA 3SG3A 4I5NB 1QVIZ 2F8PA 4PCWA 3R1VA 2PSRA 1S6CA 1SKTA 1F8HA 1K2HA 3OB1B 4XJKB 1A4PA 2JXCA 3L4AA 5AFPA 1NX1A 1TCOB 3KPXA 2K7CA 2NXQA 5HKWA 1NSHA 2WC5A 2WCJA 3CZ0A 2BE6A 2M49B 2ZN8A 1CLLA 2OTGB 5J3XA 2MHHA 3FE9A 4USLA 1AK8A 2F33A 4IL1A 1QX2A 3OB2B 4R1EA 1C7WA 2LV7A 2G9BA 2QDIA 4YBHB 3AAJA 5I2QA 2OPOA 2KAXA 4OR9B 3SS4A 3I5IB 1S1EA 3NSKA 4A4CA 4YGCB 2K7DA 4OKHA 4BY4A 3NHTA 1F70A 2LLTA 1QS7A 2FJYA 2L2CA 3DYEA 3LK0A 4MZKA 3UO9A 1C07A 1XFWO 1KSMA 1XO5A 4JKTA 1XK4A 4MLWA 1DGVA 1J55A 2M9GA 1BU3A 1IH0A 2LAPA 4XYNA 1CFCA 3JTDB 4YGEB 1K96A 4PALA 3WNXB 2LLSA 1SBJA 3EVUA 1XFVO 2HQ8A 2JT0A 4YI8A 2BBNA 3O4YA 4PHMA 4C0KA 1QASA 1L2OB 2PMYA 4PE7A 4JPZB 3VRPA 1SPYA 1XFZO 3NSIA 2KDHA 2LP3A 4GNKB 2KYCA 5D69A 3BFBA 1PSRA 5DKRA 1JC2A 1J7RA 4JD9A 3VRQA 1W7JB 1QIWA 4IJ7A 2WCHA 2M8UA 2LLUA 1OW4A 3E3RA 1CFDA 1M63B 1OOHA 4XJKA 3S0BA 2KQYA 2L51A 2A4JA 1P28A 2O60A 1YUSA 1MHOA 2M1UA 1SCMC 1DTLA 2Q91A 1AUIB 1SW8A 3SG5A 3B86A 4QJ5B 1GJYA 2JNFA 2KAYA 2L4IA 3H4SE 1IJ5A 4F0ZB 3VB1A 1HQVA 1J7PA 3BUMB 1BLQA 3O4XA 2EC6C 4KYNA 2MJWB 1KWOC 1S5GY 2AUCA 1OMRA 1FBVA 1UHIA 2PYQA 1OQPA 1PALA 2WORA 1CFFA 3I5GC 1OSAA 1PSBA 3FS7A 2M97A 3QRXA 3CR5X 2QEBA 3CZTX 1B7TZ 3PALA 1LA3A 2KSPA 2BL0C 1UHHA 3NSLA 3NXAA 3O6BA 4JQ0D 4QJ3B 1JBAA 1XYDA 1DJWA 1B9AA 4I5JA 1DMOA 1B47A 1K9UA 2D8NA 3SG4A 1G33A 3PN7B 1QVIY 2JZIA 4GFTA 2LVVA 3PLFB 1W7IB 3DZTA 3O2PA 1KFXL 2JULA 2ZNEA 2E30A 1TCFA 1OOGA 1B8CA 1WDCB 1A2XA 5FI6A 1AVSA 1JF2A 1FI6A 3WHUB 1MWNA 1PK0D 2WC6A 4HSZA 2H61A 2LVKA 1KFUS 3CGAA 3DVKA 1TN4A 1GQMA 1B4CA 3D0YB 2BAPA 1CMGA 1JWDA 1KQVA 2LM5A 1TIZA 1XFXO 2TN4A 5CSNA 2B1UA 1N2DA 1QV1A 4FTGA 2JU0A 3SS5A 1UHJA 4DCKA 2NCOA 4INXA 2JOJA 1IWQA 1SNLA 4HRHA 2WCEA 3AAKA 3TUYB 3GK1A 2RGIA 2JTZA 1DJGA 1TWOA 1SR6C 3CZ2A 5F6TA 3S0EA 4N1GA 1LKJA 4OCIA 3B88A 1YRTB 4M2PA 1DJIA 3A4UB 3S0AA 1XK4C 1OMVA 1EXRA 4GAOA 1DQEA 1QWVA 2OS8C 3EG5B 3NHIA 3DXLA 3KEVA 3WXAA 3R1PA 2KFHA 4MBEA 1SL9A 1K93D 3HX4A 5PALA 3D73A 1EH2A 2JPOA 2KI4C 3CDNA 2MLFC 3DVJA 1JFKA 1A75B 2E6WA 1W9ZA 1KQMC 3BYAA 2M0RA 3VRRA 2BCBA 4CFRA 3S0DA 1EL4A 1M39A 3CR2A 1J7OA 1F4QA 4WRIA 2BNXA 2LANA 3EK4A 3TDIA 1DT7B 1IRJA 4NQGA 2JC2A 1BG1A 1YX7A 3BQ3A 4CPVA 2K0JA 2QEOA 2QPTA 3DVMA 2CXJA 1KK7Z 1RWYA 1YTZC 3D0YA 5I8NA 5DICA 1HT9A 1CKKA 3CS1A 3ZWHA 4U8DA 1NIWA 2CCMA 1S6IA 2LHIA 3TDUA 5HLOA 4C0JA 5KU1A 3FWCA 1MUXA 2OTGC 2L5YA 1MQ1A 3VGOA 1DJYA 1SRAA 1JFJA 1XA5A 2ZKMX 4FQTA 5ER5A 2HPSA 1SL7A 1S36A 1JSAA 1ODBA 3I5IC 2M3WA 2O5GA 2WCLA 4MSPA 2K60A 1B7TY 5G08A 3FE6A 3LL8B 1CB1A 2KQ6A 3CYZA 2I18A 2KFGA 4MRYA 5HL1A 1TNQA 1K90D 3SIAA 3BFAA 1LA0A 3LCPC 4M2OA 1CLBA 1KK8B 1ZFSA 3PFVA 5CPVA 3JTDC 3SJSA 1WLZA 2F2PA 2HF5A 4OZDA 3BOWB 4MEWA 3IQOA 1DC1A 1YUUA 1BOCA 4NDDA 1A75A 3OP0A 3I5HB 1CM4A 2V53A 2ZRTA 3D77A 5I2LA 1BR1B 4M2QA 4Q04A 5K89A 1L2OC 3TZ1A 1OE9B 3CWGA 3BFHA 1UWOA 1NCYA 1F54A 2MA2A 4NDBA 1JUOA 3BUWB 1VRKA 4MVFA 1ZUZA 3GK4X 1TOPA 5DKNA 5AERA 2L4HA 3PM8A 1IQ3A 3D74A 1Y1XA 2H61C 2KI6D 3CTNA 1AP4A 3EKHA 1IG5A 3ICBA 1NX0A 1IQ5A 1N0YA 4GGNA 1WLMA 2EHBA 1IIOA 4DIRA 4PE1A 1C3ZA 3FIAA 3KF9A 1QX5B 2Y1NA 2M7NA 5D3OA 3Q8IA 2QEHA 3IVTA 3TS5B 3UNWA 1CDMA 1CDPA 4CIDA 1PRWA 5ER4X 4GPLB 1DELA 1Y6WA 1WRZA 1CMFA 3OX6A 2LNKA 5HKYA 2DOQA 2KFFA 1DGUA 2NLNA 1SCVA 4CLNA 1OZSA 3BOWA 2JT8A 3EVRA 4INWA 2L5XB 4GGFA 1N65A 3EVVA 2IS9A 1TUJA 2KGBC 3F45A 2K2FA 2KHNA 1C3YA 1QLSA 1UHKA 3DY9A 4PT1A 1ZACA 3PN7C 1QJTA 1F55A 1J1DA 2LMTA 4ICBA 2MLEC 1IGVA 4QJ4B 1KK7Y 3HCMA 1RTP1 2CBLA 2PRUA 3EK8A 1WDCC 1M45A 2MRDA 4YI9A 2LVIA 1R2UA 2ZRSA 1T14A 3SS3A 2BKIB 3OHMB 2M29A 5JJGA 2K7OA
chains in the Genus database with same CATH topology
2LCPA 1KFXS 3RLZA 5DKQA 2F2OA 2BECA 3TDZA 3IQQA 2K8MB 2L98A 2JRFA 3M0WA 3VRNA 1D1OA 2HQWA 1RK9A 5KSZA 1UURA 2QACA 2G2BA 1FF1A 2KAVA 4HRGA 3TUYC 1RECA 1IJ6A 2COLB 1NX2A 2KOTA 3JVTB 3LK1A 1G8IA 4WQ3A 5D7FA 2M7LA 4D1EA 2KI6C 1CDLA 2BE4A 1C7VA 4PHJA 4P5OE 3I5FB 2K7BA 4AOMA 2CNPA 2JQ6A 2PVBA 4MN0A 3IF7A 4MZLA 1EJ3A 5JOLA 1YUTA 1QTXA 2LC5A 1UHNA 4YGBB 3O78A 1CDNA 1MXEA 2Y1MA 1NYAA 4PE0A 3LLEA 1RJVA 1CLMA 2PASA 1OMDA 1AHRA 1BF5A 1PVBA 1S6JA 1ZOTB 2FOTA 1X02A 2HETA 2M1KB 2MBXA 3VROA 2Y4QA 3GOFA 2FJUB 4PHKA 3KHEA 2NCPA 2VRGA 1SK6D 2JT3A 1ALWA 2P6BB 4YGAA 1YVHA 1FW4A 3DD4A 2I94A 1Q80A 2KYFA 1LVCD 4A4BA 3NSOA 1YRUB 1CTRA 1CM1A 1YR5A 2SCPA 2WCBA 3DF0B 1BT6A 3A8RA 2KNEA 5AEQA 4YRUA 1XFUO 1LINA 4N5XA 1OZOA 2ZFDA 3D10A 2MAZA 1NWDA 1B8LA 3MSEB 2GGMA 1KK8C 2AMIA 5HLVA 4ZCVA 1BODA 3SG7A 1SMGA 4ETOA 2K2AA 2Y5IA 4MZJA 4PE4A 2BCXA 3EKJA 4GGFC 3BXKA 1OOJA 2LUXA 1V1FA 1BMOA 3I5HC 3PSRA 5HYDA 1K9KA 2WNDA 3GK2A 1YVLA 2SASA 2LE9B 1XFYO 2JPTA 1TNXA 2LMUA 1R6PA 1TNWA 2ZNDA 2WCFA 3CR4X 1L7ZA 2FCEA 2GV5A 1NUBA 4NDCA 2JXLA 1B8RA 4I5LB 3BUXB 1IKUA 5HKZA 1DF0B 1QV0A 1J1EA 4GUKA 4TNCA 4C0LA 2F3YA 2CTNA 1AJ5A 3SG6A 2AAOA 2KGRA 1DVIA 4ZCUA 1SL8A 1NPQA 1CFPA 4MRXA 1RFJA 4P2YB 2LMVA 1EG3A 2ZN9A 1QX7A 1MXLC 1PULA 3DF0A 5AANA 5I2OA 3WHTB 2GGZA 1LXFC 4ORCB 1DJHA 4WQ2A 2Q4UA 3TS5C 1ALVA 2KBMA 4GBAA 1BJFA 2ISDA 3BUNB 4JWQA 1SCMB 1A29A 1SY9A 5AXIA 1RROA 5B8IB 1GGWA 2EGDA 5IBWA 2F3ZA 1E8AA 2L2EA 1AJ4A 3EK7A 1NCXA 1TRFA 1Y0VH 2EC6B 2LVJA 3ZNIA 1KWOB 1NP8A 2WOSA 2LHLA 4AQIA 1F4OA 1Y1UA 4I5KA 3SIBA 1U5IB 1TNPA 1QIVA 3I5GB 1S26D 1A03A 1BR4B 1QXPA 2CT9A 3C1VA 2JWWA 1B1GA 1H4BA 1K9PA 5CSIA 1FI5A 2JTTA 3AKAA 2BL0B 1JF0A 4DRWA 4HREE 2LUCA 1DF0A 5CSJA 1KCYA 4BY5A 1PVAA 1UUSA 1DJXA 1Y1AA 3SG2A 3AKBA 4L9MA 4OVNF 3OX5A 1KFUL 1K94A 4YGDB 4E68A 2PALA 3BUOB 5FYXA 2K61A 4DS7A 5TNCA 1F71A 4ORAB 1UP5A 2BKHB 3RM1A 4FQOA 5GQQC 3JVTC 2I2RE 2R2IA 1XVJA 5KTYA 1M31A 4AQJA 3DVEA 1K95A 3I5FC 4PDZA 1G4YR 1S3PA 2KBIA 1TTXA 2L0PA 4PHNA 4UPGA 1NX3A 1QATA 1WRLA 1FPWA 1M46A 1MF8B 1EG4A 4DUQA 2NZ0A 4ORBB 1WRKA 4N1FA 1K8UA 1U5IA 1ZMZA 1SR6B 1H8BA 2I7AA 2H2KA 2L50A 2LP2A 1S5GZ 4OV2A 2OS8B 3K21A 3PATA 1J7QA 2BBMA 5CSFA 1QLKA 3CLNA 2KI4B 2FCDA 5BPJA 2JNXA 2WC8A 1YX8A 1KQMB 3FWBA 1KSOA 1SYMA 1WY9A 2BCAA 3KO0A 4CFQA 1GGZA 1NCZA 1CNPA 1V1GA 1DJZA 1MR8A 1YURA 3SG3A 4I5NB 1QVIZ 2F8PA 4PCWA 2PSRA 1S6CA 1SKTA 1F8HA 1K2HA 3OB1B 4XJKB 1A4PA 2JXCA 5AFPA 1NX1A 1TCOB 3KPXA 2K7CA 2NXQA 5HKWA 1NSHA 2BE6A 2M49B 2ZN8A 1CLLA 2OTGB 5J3XA 2MHHA 4USLA 1AK8A 2F33A 4IL1A 1QX2A 3OB2B 4R1EA 1C7WA 2LV7A 2G9BA 4YBHB 3AAJA 5I2QA 2OPOA 2KAXA 4OR9B 3I5IB 1S1EA 3NSKA 4A4CA 4YGCB 2K7DA 4OKHA 4BY4A 1F70A 2LLTA 1QS7A 3LK0A 1C07A 4MZKA 1XFWO 1KSMA 1XO5A 4MLWA 1XK4A 1DGVA 1J55A 2M9GA 1BU3A 1IH0A 2LAPA 4XYNA 1CFCA 3JTDB 4YGEB 1K96A 4PALA 3WNXB 2LLSA 1SBJA 3EVUA 1XFVO 2HQ8A 2JT0A 4YI8A 2BBNA 3O4YA 4PHMA 4C0KA 1QASA 1L2OB 2PMYA 4PE7A 4JPZB 3VRPA 1SPYA 1XFZO 3NSIA 2KDHA 2LP3A 4GNKB 2KYCA 5D69A 5DKRA 1PSRA 1JC2A 1J7RA 3VRQA 1W7JB 1QIWA 2M8UA 2LLUA 3E3RA 1CFDA 1M63B 4XJKA 2KQYA 2L51A 2A4JA 2O60A 1YUSA 1MHOA 2M1UA 1SCMC 1DTLA 2Q91A 1AUIB 1SW8A 3SG5A 4QJ5B 1GJYA 2JNFA 2KAYA 2L4IA 3H4SE 1IJ5A 4F0ZB 1HQVA 1J7PA 3BUMB 1BLQA 2EC6C 2MJWB 1KWOC 1S5GY 2AUCA 1OMRA 1FBVA 1UHIA 1OQPA 1PALA 2WORA 1CFFA 3I5GC 1OSAA 1PSBA 3FS7A 2M97A 3QRXA 3CR5X 3CZTX 1B7TZ 3PALA 1LA3A 2KSPA 2BL0C 1UHHA 3NSLA 3NXAA 3O6BA 4JQ0D 4QJ3B 1JBAA 1XYDA 1DJWA 1B9AA 4I5JA 1DMOA 1B47A 1K9UA 2D8NA 3SG4A 1G33A 3PN7B 1QVIY 2JZIA 4GFTA 2LVVA 3PLFB 1W7IB 3O2PA 1KFXL 2JULA 2ZNEA 2E30A 1TCFA 1B8CA 1WDCB 1A2XA 1AVSA 1JF2A 1FI6A 3WHUB 1MWNA 1PK0D 4HSZA 2H61A 2LVKA 1KFUS 3CGAA 3DVKA 1TN4A 1GQMA 1B4CA 3D0YB 1CMGA 1JWDA 1KQVA 2LM5A 1TIZA 1XFXO 2TN4A 5CSNA 2B1UA 1N2DA 1QV1A 4FTGA 2JU0A 1UHJA 4DCKA 2NCOA 2JOJA 1IWQA 1SNLA 4HRHA 2WCEA 3AAKA 3TUYB 3GK1A 2RGIA 2JTZA 1DJGA 1SR6C 5F6TA 4N1GA 1LKJA 4OCIA 1YRTB 4M2PA 1DJIA 3A4UB 1OMVA 1XK4C 1EXRA 4GAOA 2OS8C 3KEVA 3WXAA 2KFHA 4MBEA 1SL9A 1K93D 3HX4A 5PALA 1EH2A 2KI4C 2MLFC 3DVJA 1JFKA 1A75B 2E6WA 1KQMC 3BYAA 2M0RA 3VRRA 2BCBA 4CFRA 1EL4A 1M39A 3CR2A 1J7OA 1F4QA 4WRIA 3TDIA 2LANA 3EK4A 1DT7B 1IRJA 4NQGA 2JC2A 1BG1A 1YX7A 3BQ3A 4CPVA 2K0JA 2QPTA 3DVMA 2CXJA 1KK7Z 1RWYA 1YTZC 3D0YA 5I8NA 1HT9A 1CKKA 3CS1A 3ZWHA 4U8DA 1NIWA 2CCMA 1S6IA 2LHIA 3TDUA 5HLOA 4C0JA 5KU1A 3FWCA 1MUXA 2OTGC 3VGOA 1MQ1A 1JFJA 1DJYA 1SRAA 1XA5A 2ZKMX 5ER5A 2HPSA 1SL7A 1S36A 1JSAA 1ODBA 3I5IC 2M3WA 2O5GA 4MSPA 5G08A 1B7TY 3LL8B 1CB1A 2KQ6A 2I18A 2KFGA 4MRYA 1TNQA 1K90D 3SIAA 1LA0A 3LCPC 4M2OA 1CLBA 1KK8B 1ZFSA 3PFVA 5CPVA 3JTDC 3SJSA 1WLZA 2F2PA 2HF5A 3BOWB 4MEWA 3IQOA 1BOCA 1YUUA 4NDDA 1A75A 3OP0A 3I5HB 1CM4A 2V53A 2ZRTA 5I2LA 1BR1B 4M2QA 4Q04A 5K89A 1L2OC 3TZ1A 1OE9B 3CWGA 1UWOA 1NCYA 1F54A 2MA2A 4NDBA 1JUOA 3BUWB 1VRKA 4MVFA 1ZUZA 3GK4X 1TOPA 5DKNA 5AERA 2L4HA 3PM8A 1IQ3A 1Y1XA 2H61C 2KI6D 3CTNA 1AP4A 3EKHA 1IG5A 3ICBA 1NX0A 1IQ5A 1N0YA 4GGNA 1WLMA 2EHBA 4DIRA 4PE1A 3FIAA 3KF9A 1QX5B 2Y1NA 2M7NA 3TS5B 1CDMA 1CDPA 4CIDA 1PRWA 5ER4X 4GPLB 1Y6WA 1WRZA 1CMFA 3OX6A 2LNKA 5HKYA 2DOQA 2KFFA 1DGUA 2NLNA 1SCVA 4CLNA 1OZSA 3BOWA 2JT8A 3EVRA 2L5XB 4GGFA 1N65A 3EVVA 2IS9A 2KGBC 3F45A 2K2FA 2KHNA 1QLSA 1UHKA 1ZACA 3PN7C 1QJTA 1F55A 1J1DA 2LMTA 4ICBA 2MLEC 1IGVA 4QJ4B 1KK7Y 3HCMA 1RTP1 2CBLA 2PRUA 3EK8A 1WDCC 1M45A 2MRDA 4YI9A 2LVIA 1R2UA 2ZRSA 2BKIB 3OHMB 2M29A 5JJGA 2K7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCP A;  1KFX S;  3RLZ A;  5DKQ A;  2F2O A;  2BEC A;  3TDZ A;  3IQQ A;  2K8M B;  2L98 A;  2JRF A;  3M0W A;  3VRN A;  1D1O A;  2HQW A;  1RK9 A;  5KSZ A;  1UUR A;  2QAC A;  2G2B A;  1FF1 A;  2KAV A;  4HRG A;  3TUY C;  1REC A;  1IJ6 A;  2COL B;  1NX2 A;  2KOT A;  3JVT B;  3LK1 A;  1G8I A;  4WQ3 A;  5D7F A;  2M7L A;  4D1E A;  2KI6 C;  1CDL A;  2BE4 A;  1C7V A;  4PHJ A;  4P5O E;  3I5F B;  2K7B A;  4AOM A;  2CNP A;  2JQ6 A;  2PVB A;  4MN0 A;  3IF7 A;  4MZL A;  1EJ3 A;  5JOL A;  1YUT A;  1QTX A;  2LC5 A;  1UHN A;  4YGB B;  3O78 A;  1CDN A;  1MXE A;  2Y1M A;  1NYA A;  4PE0 A;  3LLE A;  1RJV A;  1CLM A;  2PAS A;  1OMD A;  1AHR A;  1BF5 A;  1PVB A;  1S6J A;  1ZOT B;  2FOT A;  1X02 A;  2HET A;  2M1K B;  2MBX A;  3VRO A;  2Y4Q A;  3GOF A;  2FJU B;  4PHK A;  3KHE A;  2NCP A;  2VRG A;  1SK6 D;  2JT3 A;  1ALW A;  2P6B B;  4YGA A;  1YVH A;  1FW4 A;  3DD4 A;  2I94 A;  1Q80 A;  2KYF A;  1LVC D;  4A4B A;  3NSO A;  1YRU B;  1CTR A;  1CM1 A;  1YR5 A;  2SCP A;  2WCB A;  3DF0 B;  1BT6 A;  3A8R A;  2KNE A;  5AEQ A;  4YRU A;  1XFU O;  1LIN A;  4N5X A;  1OZO A;  2ZFD A;  3D10 A;  2MAZ A;  1NWD A;  1B8L A;  3MSE B;  2GGM A;  1KK8 C;  2AMI A;  5HLV A;  4ZCV A;  1BOD A;  3SG7 A;  1SMG A;  4ETO A;  2K2A A;  2Y5I A;  4MZJ A;  4PE4 A;  2BCX A;  3EKJ A;  4GGF C;  3BXK A;  1OOJ A;  2LUX A;  1V1F A;  1BMO A;  3I5H C;  3PSR A;  5HYD A;  1K9K A;  2WND A;  3GK2 A;  1YVL A;  2SAS A;  2LE9 B;  1XFY O;  2JPT A;  1TNX A;  2LMU A;  1R6P A;  1TNW A;  2ZND A;  2WCF A;  3CR4 X;  1L7Z A;  2FCE A;  2GV5 A;  1NUB A;  4NDC A;  2JXL A;  1B8R A;  4I5L B;  3BUX B;  1IKU A;  5HKZ A;  1DF0 B;  1QV0 A;  1J1E A;  4GUK A;  4TNC A;  4C0L A;  2F3Y A;  2CTN A;  1AJ5 A;  3SG6 A;  2AAO A;  2KGR A;  1DVI A;  4ZCU A;  1SL8 A;  1NPQ A;  1CFP A;  4MRX A;  1RFJ A;  4P2Y B;  2LMV A;  1EG3 A;  2ZN9 A;  1QX7 A;  1MXL C;  1PUL A;  3DF0 A;  5AAN A;  5I2O A;  3WHT B;  2GGZ A;  1LXF C;  4ORC B;  1DJH A;  4WQ2 A;  2Q4U A;  3TS5 C;  1ALV A;  2KBM A;  4GBA A;  1BJF A;  2ISD A;  3BUN B;  4JWQ A;  1SCM B;  1A29 A;  1SY9 A;  5AXI A;  1RRO A;  5B8I B;  1GGW A;  2EGD A;  5IBW A;  2F3Z A;  1E8A A;  2L2E A;  1AJ4 A;  3EK7 A;  1NCX A;  1TRF A;  1Y0V H;  2EC6 B;  2LVJ A;  3ZNI A;  1KWO B;  1NP8 A;  2WOS A;  2LHL A;  4AQI A;  1F4O A;  1Y1U A;  4I5K A;  3SIB A;  1U5I B;  1TNP A;  1QIV A;  3I5G B;  1S26 D;  1A03 A;  1BR4 B;  1QXP A;  2CT9 A;  3C1V A;  2JWW A;  1B1G A;  1H4B A;  1K9P A;  5CSI A;  1FI5 A;  2JTT A;  3AKA A;  2BL0 B;  1JF0 A;  4DRW A;  4HRE E;  2LUC A;  1DF0 A;  5CSJ A;  1KCY A;  4BY5 A;  1PVA A;  1UUS A;  1DJX A;  1Y1A A;  3SG2 A;  3AKB A;  4L9M A;  4OVN F;  3OX5 A;  1KFU L;  1K94 A;  4YGD B;  4E68 A;  2PAL A;  3BUO B;  5FYX A;  2K61 A;  4DS7 A;  5TNC A;  1F71 A;  4ORA B;  1UP5 A;  2BKH B;  3RM1 A;  4FQO A;  5GQQ C;  3JVT C;  2I2R E;  2R2I A;  1XVJ A;  5KTY A;  1M31 A;  4AQJ A;  3DVE A;  1K95 A;  3I5F C;  4PDZ A;  1G4Y R;  1S3P A;  2KBI A;  1TTX A;  2L0P A;  4PHN A;  4UPG A;  1NX3 A;  1QAT A;  1WRL A;  1FPW A;  1M46 A;  1MF8 B;  1EG4 A;  4DUQ A;  2NZ0 A;  4ORB B;  1WRK A;  4N1F A;  1K8U A;  1U5I A;  1ZMZ A;  1SR6 B;  1H8B A;  2I7A A;  2H2K A;  2L50 A;  2LP2 A;  1S5G Z;  4OV2 A;  2OS8 B;  3K21 A;  3PAT A;  1J7Q A;  2BBM A;  5CSF A;  1QLK A;  3CLN A;  2KI4 B;  2FCD A;  5BPJ A;  2JNX A;  2WC8 A;  1YX8 A;  1KQM B;  3FWB A;  1KSO A;  1SYM A;  1WY9 A;  2BCA A;  3KO0 A;  4CFQ A;  1GGZ A;  1NCZ A;  1CNP A;  1V1G A;  1DJZ A;  1MR8 A;  1YUR A;  3SG3 A;  4I5N B;  1QVI Z;  2F8P A;  4PCW A;  2PSR A;  1S6C A;  1SKT A;  1F8H A;  1K2H A;  3OB1 B;  4XJK B;  1A4P A;  2JXC A;  5AFP A;  1NX1 A;  1TCO B;  3KPX A;  2K7C A;  2NXQ A;  5HKW A;  1NSH A;  2BE6 A;  2M49 B;  2ZN8 A;  1CLL A;  2OTG B;  5J3X A;  2MHH A;  4USL A;  1AK8 A;  2F33 A;  4IL1 A;  1QX2 A;  3OB2 B;  4R1E A;  1C7W A;  2LV7 A;  2G9B A;  4YBH B;  3AAJ A;  5I2Q A;  2OPO A;  2KAX A;  4OR9 B;  3I5I B;  1S1E A;  3NSK A;  4A4C A;  4YGC B;  2K7D A;  4OKH A;  4BY4 A;  1F70 A;  2LLT A;  1QS7 A;  3LK0 A;  1C07 A;  4MZK A;  1XFW O;  1KSM A;  1XO5 A;  4MLW A;  1XK4 A;  1DGV A;  1J55 A;  2M9G A;  1BU3 A;  1IH0 A;  2LAP A;  4XYN A;  1CFC A;  3JTD B;  4YGE B;  1K96 A;  4PAL A;  3WNX B;  2LLS A;  1SBJ A;  3EVU A;  1XFV O;  2HQ8 A;  2JT0 A;  4YI8 A;  2BBN A;  3O4Y A;  4PHM A;  4C0K A;  1QAS A;  1L2O B;  2PMY A;  4PE7 A;  4JPZ B;  3VRP A;  1SPY A;  1XFZ O;  3NSI A;  2KDH A;  2LP3 A;  4GNK B;  2KYC A;  5D69 A;  5DKR A;  1PSR A;  1JC2 A;  1J7R A;  3VRQ A;  1W7J B;  1QIW A;  2M8U A;  2LLU A;  3E3R A;  1CFD A;  1M63 B;  4XJK A;  2KQY A;  2L51 A;  2A4J A;  2O60 A;  1YUS A;  1MHO A;  2M1U A;  1SCM C;  1DTL A;  2Q91 A;  1AUI B;  1SW8 A;  3SG5 A;  4QJ5 B;  1GJY A;  2JNF A;  2KAY A;  2L4I A;  3H4S E;  1IJ5 A;  4F0Z B;  1HQV A;  1J7P A;  3BUM B;  1BLQ A;  2EC6 C;  2MJW B;  1KWO C;  1S5G Y;  2AUC A;  1OMR A;  1FBV A;  1UHI A;  1OQP A;  1PAL A;  2WOR A;  1CFF A;  3I5G C;  1OSA A;  1PSB A;  3FS7 A;  2M97 A;  3QRX A;  3CR5 X;  3CZT X;  1B7T Z;  3PAL A;  1LA3 A;  2KSP A;  2BL0 C;  1UHH A;  3NSL A;  3NXA A;  3O6B A;  4JQ0 D;  4QJ3 B;  1JBA A;  1XYD A;  1DJW A;  1B9A A;  4I5J A;  1DMO A;  1B47 A;  1K9U A;  2D8N A;  3SG4 A;  1G33 A;  3PN7 B;  1QVI Y;  2JZI A;  4GFT A;  2LVV A;  3PLF B;  1W7I B;  3O2P A;  1KFX L;  2JUL A;  2ZNE A;  2E30 A;  1TCF A;  1B8C A;  1WDC B;  1A2X A;  1AVS A;  1JF2 A;  1FI6 A;  3WHU B;  1MWN A;  1PK0 D;  4HSZ A;  2H61 A;  2LVK A;  1KFU S;  3CGA A;  3DVK A;  1TN4 A;  1GQM A;  1B4C A;  3D0Y B;  1CMG A;  1JWD A;  1KQV A;  2LM5 A;  1TIZ A;  1XFX O;  2TN4 A;  5CSN A;  2B1U A;  1N2D A;  1QV1 A;  4FTG A;  2JU0 A;  1UHJ A;  4DCK A;  2NCO A;  2JOJ A;  1IWQ A;  1SNL A;  4HRH A;  2WCE A;  3AAK A;  3TUY B;  3GK1 A;  2RGI A;  2JTZ A;  1DJG A;  1SR6 C;  5F6T A;  4N1G A;  1LKJ A;  4OCI A;  1YRT B;  4M2P A;  1DJI A;  3A4U B;  1OMV A;  1XK4 C;  1EXR A;  4GAO A;  2OS8 C;  3KEV A;  3WXA A;  2KFH A;  4MBE A;  1SL9 A;  1K93 D;  3HX4 A;  5PAL A;  1EH2 A;  2KI4 C;  2MLF C;  3DVJ A;  1JFK A;  1A75 B;  2E6W A;  1KQM C;  3BYA A;  2M0R A;  3VRR A;  2BCB A;  4CFR A;  1EL4 A;  1M39 A;  3CR2 A;  1J7O A;  1F4Q A;  4WRI A;  3TDI A;  2LAN A;  3EK4 A;  1DT7 B;  1IRJ A;  4NQG A;  2JC2 A;  1BG1 A;  1YX7 A;  3BQ3 A;  4CPV A;  2K0J A;  2QPT A;  3DVM A;  2CXJ A;  1KK7 Z;  1RWY A;  1YTZ C;  3D0Y A;  5I8N A;  1HT9 A;  1CKK A;  3CS1 A;  3ZWH A;  4U8D A;  1NIW A;  2CCM A;  1S6I A;  2LHI A;  3TDU A;  5HLO A;  4C0J A;  5KU1 A;  3FWC A;  1MUX A;  2OTG C;  3VGO A;  1MQ1 A;  1JFJ A;  1DJY A;  1SRA A;  1XA5 A;  2ZKM X;  5ER5 A;  2HPS A;  1SL7 A;  1S36 A;  1JSA A;  1ODB A;  3I5I C;  2M3W A;  2O5G A;  4MSP A;  5G08 A;  1B7T Y;  3LL8 B;  1CB1 A;  2KQ6 A;  2I18 A;  2KFG A;  4MRY A;  1TNQ A;  1K90 D;  3SIA A;  1LA0 A;  3LCP C;  4M2O A;  1CLB A;  1KK8 B;  1ZFS A;  3PFV A;  5CPV A;  3JTD C;  3SJS A;  1WLZ A;  2F2P A;  2HF5 A;  3BOW B;  4MEW A;  3IQO A;  1BOC A;  1YUU A;  4NDD A;  1A75 A;  3OP0 A;  3I5H B;  1CM4 A;  2V53 A;  2ZRT A;  5I2L A;  1BR1 B;  4M2Q A;  4Q04 A;  5K89 A;  1L2O C;  3TZ1 A;  1OE9 B;  3CWG A;  1UWO A;  1NCY A;  1F54 A;  2MA2 A;  4NDB A;  1JUO A;  3BUW B;  1VRK A;  4MVF A;  1ZUZ A;  3GK4 X;  1TOP A;  5DKN A;  5AER A;  2L4H A;  3PM8 A;  1IQ3 A;  1Y1X A;  2H61 C;  2KI6 D;  3CTN A;  1AP4 A;  3EKH A;  1IG5 A;  3ICB A;  1NX0 A;  1IQ5 A;  1N0Y A;  4GGN A;  1WLM A;  2EHB A;  4DIR A;  4PE1 A;  3FIA A;  3KF9 A;  1QX5 B;  2Y1N A;  2M7N A;  3TS5 B;  1CDM A;  1CDP A;  4CID A;  1PRW A;  5ER4 X;  4GPL B;  1Y6W A;  1WRZ A;  1CMF A;  3OX6 A;  2LNK A;  5HKY A;  2DOQ A;  2KFF A;  1DGU A;  2NLN A;  1SCV A;  4CLN A;  1OZS A;  3BOW A;  2JT8 A;  3EVR A;  2L5X B;  4GGF A;  1N65 A;  3EVV A;  2IS9 A;  2KGB C;  3F45 A;  2K2F A;  2KHN A;  1QLS A;  1UHK A;  1ZAC A;  3PN7 C;  1QJT A;  1F55 A;  1J1D A;  2LMT A;  4ICB A;  2MLE C;  1IGV A;  4QJ4 B;  1KK7 Y;  3HCM A;  1RTP 1;  2CBL A;  2PRU A;  3EK8 A;  1WDC C;  1M45 A;  2MRD A;  4YI9 A;  2LVI A;  1R2U A;  2ZRS A;  2BKI B;  3OHM B;  2M29 A;  5JJG A;  2K7O A; 
#chains in the Genus database with same CATH topology
 2LCP A;  1KFX S;  3RLZ A;  5DKQ A;  2F2O A;  2BEC A;  3TDZ A;  3IQQ A;  2K8M B;  2L98 A;  2JRF A;  3M0W A;  3VRN A;  2KPH A;  1D1O A;  2HQW A;  1RK9 A;  5KSZ A;  1UUR A;  2QAC A;  2G2B A;  1FF1 A;  2KAV A;  2QEV A;  3QME A;  4HRG A;  3CZ1 A;  3TUY C;  1REC A;  1IJ6 A;  2COL B;  1NX2 A;  2KOT A;  3JVT B;  3LK1 A;  1G8I A;  4WQ3 A;  5D7F A;  2M7L A;  4D1E A;  2KI6 C;  2WCK A;  1CDL A;  2BE4 A;  1C7V A;  4PHJ A;  4P5O E;  3B7A A;  3I5F B;  2K7B A;  4AOM A;  2CNP A;  2JQ6 A;  2PVB A;  4MN0 A;  3IF7 A;  4MZL A;  1EJ3 A;  5JOL A;  3PJI A;  1YUT A;  1QTX A;  2LC5 A;  1UHN A;  5EL2 A;  3OBV A;  4YGB B;  3O78 A;  1CDN A;  3S0F A;  1MXE A;  2Y1M A;  1NYA A;  2P71 A;  4PE0 A;  3LLE A;  1RJV A;  1CLM A;  2PAS A;  1OMD A;  1AHR A;  1BF5 A;  1SSE B;  1PVB A;  1S6J A;  1ZOT B;  2FOT A;  1X02 A;  2HET A;  2M1K B;  2MBX A;  3VRO A;  2Y4Q A;  3GOF A;  2FJU B;  4PHK A;  3KHE A;  2NCP A;  2VRG A;  1SK6 D;  2JT3 A;  1ALW A;  2P6B B;  4YGA A;  1YVH A;  1FW4 A;  1TUZ A;  3DD4 A;  2I94 A;  1Q80 A;  2KYF A;  1LVC D;  3BJH A;  4A4B A;  3NSO A;  1YRU B;  1CTR A;  2H8V A;  1CM1 A;  2PQL A;  3D76 A;  1YR5 A;  2SCP A;  2WCB A;  3DF0 B;  1BT6 A;  3A8R A;  2KNE A;  5AEQ A;  4YRU A;  1XFU O;  1LIN A;  4N5X A;  1OZO A;  2WCM A;  2ZFD A;  3D10 A;  2MAZ A;  1NWD A;  1OOI X;  2GTE A;  1B8L A;  2P70 A;  3MSE B;  2GGM A;  1KK8 C;  2KLD A;  3S0G A;  2AMI A;  5HLV A;  4ZCV A;  1BOD A;  3OGN A;  3SG7 A;  1SMG A;  4ETO A;  2K2A A;  2Y5I A;  4MZJ A;  4PE4 A;  2BCX A;  3EKJ A;  4GGF C;  3BXK A;  1OOJ A;  2LUX A;  1V1F A;  1BMO A;  3I5H C;  3PSR A;  5HYD A;  1K9K A;  2WND A;  3GK2 A;  1YVL A;  2SAS A;  2LE9 B;  1XFY O;  2JPT A;  1TNX A;  2LMU A;  1R6P A;  1TNW A;  2ZND A;  2WCF A;  3CR4 X;  1L7Z A;  2FCE A;  2GV5 A;  1NUB A;  4NDC A;  2JXL A;  1B8R A;  4I5L B;  3BUX B;  1IKU A;  5HKZ A;  1DF0 B;  1QV0 A;  1J1E A;  4GUK A;  4TNC A;  4C0L A;  2F3Y A;  2CTN A;  1AJ5 A;  3SG6 A;  2AAO A;  2KGR A;  1DVI A;  3B6X A;  4ZCU A;  1SL8 A;  1NPQ A;  1CFP A;  4MRX A;  1DEK A;  1OOF A;  1RFJ A;  4P2Y B;  2LMV A;  1EG3 A;  2ERB A;  2ZN9 A;  1QX7 A;  1MXL C;  1PUL A;  3DF0 A;  5AAN A;  5I2O A;  3WHT B;  2GGZ A;  1LXF C;  4ORC B;  1DJH A;  4WQ2 A;  2Q4U A;  3TS5 C;  1ALV A;  2KBM A;  4GBA A;  1BJF A;  2ISD A;  3BUN B;  1GM0 A;  4JWQ A;  1SCM B;  1A29 A;  1SY9 A;  5AXI A;  1Z4H A;  1RRO A;  5B8I B;  1GGW A;  2EGD A;  5IBW A;  2F3Z A;  1E8A A;  2L2E A;  1AJ4 A;  3CAB A;  3EK7 A;  1NCX A;  1TRF A;  1Y0V H;  2EC6 B;  2LVJ A;  3ZNI A;  1KWO B;  1NP8 A;  3D78 A;  2WOS A;  2LHL A;  4AQI A;  1F4O A;  1Y1U A;  4I5K A;  3SIB A;  1U5I B;  1TNP A;  1QIV A;  3I5G B;  1S26 D;  5FI2 A;  1BR4 B;  3V2L A;  1A03 A;  1QXP A;  2CT9 A;  3C1V A;  2JWW A;  1B1G A;  1H4B A;  1K9P A;  5CSI A;  1FI5 A;  2JTT A;  3AKA A;  2BL0 B;  1JF0 A;  4DRW A;  3R72 A;  2YGU A;  4HRE E;  5FI7 A;  2LUC A;  1DF0 A;  5CSJ A;  1KCY A;  4BY5 A;  1PVA A;  1UUS A;  1DJX A;  1Z2C B;  1Y1A A;  3SG2 A;  3AKB A;  4L9M A;  4OVN F;  3L4L A;  5I94 A;  3OX5 A;  1KFU L;  1K94 A;  4YGD B;  4E68 A;  2PAL A;  3BUO B;  5FYX A;  2K61 A;  4DS7 A;  1LS8 A;  5TNC A;  1F71 A;  4ORA B;  1UP5 A;  2BKH B;  3RM1 A;  4FQO A;  5GQQ C;  3JVT C;  2I2R E;  2R2I A;  1XVJ A;  5KTY A;  1M31 A;  4AQJ A;  4F7F A;  3DVE A;  1K95 A;  3I5F C;  4PDZ A;  1G4Y R;  1S3P A;  2KBI A;  1TTX A;  2L0P A;  3K1E A;  4PHN A;  4UPG A;  1NX3 A;  1QAT A;  1WRL A;  1FPW A;  1M46 A;  1MF8 B;  1EG4 A;  4DUQ A;  2NZ0 A;  1ORG A;  1WRK A;  4N1F A;  4ORB B;  3RZS A;  1K8U A;  1U5I A;  1ZMZ A;  3NGV A;  1SR6 B;  1H8B A;  2I7A A;  2H2K A;  2L50 A;  2LP2 A;  1S5G Z;  2KLE A;  4OV2 A;  2OS8 B;  3K21 A;  3PAT A;  1J7Q A;  3PM2 A;  2BBM A;  5CSF A;  1XFR A;  1QLK A;  3CLN A;  3N7H A;  3D75 A;  2KI4 B;  2FCD A;  5BPJ A;  2JNX A;  2WC8 A;  1YX8 A;  1KQM B;  3FWB A;  1KSO A;  1SYM A;  3FE8 A;  3R1O A;  3L47 A;  1WY9 A;  2BCA A;  3KO0 A;  4CFQ A;  1GGZ A;  1NCZ A;  3B87 A;  1CNP A;  1V1G A;  1DJZ A;  1MR8 A;  1YUR A;  3SG3 A;  4I5N B;  1QVI Z;  2F8P A;  4PCW A;  3R1V A;  2PSR A;  1S6C A;  1SKT A;  1F8H A;  1K2H A;  3OB1 B;  4XJK B;  1A4P A;  2JXC A;  3L4A A;  5AFP A;  1NX1 A;  1TCO B;  3KPX A;  2K7C A;  2NXQ A;  5HKW A;  1NSH A;  2WC5 A;  2WCJ A;  3CZ0 A;  2BE6 A;  2M49 B;  2ZN8 A;  1CLL A;  2OTG B;  5J3X A;  2MHH A;  3FE9 A;  4USL A;  1AK8 A;  2F33 A;  4IL1 A;  1QX2 A;  3OB2 B;  4R1E A;  1C7W A;  2LV7 A;  2G9B A;  2QDI A;  4YBH B;  3AAJ A;  5I2Q A;  2OPO A;  2KAX A;  4OR9 B;  3SS4 A;  3I5I B;  1S1E A;  3NSK A;  4A4C A;  4YGC B;  2K7D A;  4OKH A;  4BY4 A;  3NHT A;  1F70 A;  2LLT A;  1QS7 A;  2FJY A;  2L2C A;  3DYE A;  3LK0 A;  4MZK A;  3UO9 A;  1C07 A;  1XFW O;  1KSM A;  1XO5 A;  4JKT A;  1XK4 A;  4MLW A;  1DGV A;  1J55 A;  2M9G A;  1BU3 A;  1IH0 A;  2LAP A;  4XYN A;  1CFC A;  3JTD B;  4YGE B;  1K96 A;  4PAL A;  3WNX B;  2LLS A;  1SBJ A;  3EVU A;  1XFV O;  2HQ8 A;  2JT0 A;  4YI8 A;  2BBN A;  3O4Y A;  4PHM A;  4C0K A;  1QAS A;  1L2O B;  2PMY A;  4PE7 A;  4JPZ B;  3VRP A;  1SPY A;  1XFZ O;  3NSI A;  2KDH A;  2LP3 A;  4GNK B;  2KYC A;  5D69 A;  3BFB A;  1PSR A;  5DKR A;  1JC2 A;  1J7R A;  4JD9 A;  3VRQ A;  1W7J B;  1QIW A;  4IJ7 A;  2WCH A;  2M8U A;  2LLU A;  1OW4 A;  3E3R A;  1CFD A;  1M63 B;  1OOH A;  4XJK A;  3S0B A;  2KQY A;  2L51 A;  2A4J A;  1P28 A;  2O60 A;  1YUS A;  1MHO A;  2M1U A;  1SCM C;  1DTL A;  2Q91 A;  1AUI B;  1SW8 A;  3SG5 A;  3B86 A;  4QJ5 B;  1GJY A;  2JNF A;  2KAY A;  2L4I A;  3H4S E;  1IJ5 A;  4F0Z B;  3VB1 A;  1HQV A;  1J7P A;  3BUM B;  1BLQ A;  3O4X A;  2EC6 C;  4KYN A;  2MJW B;  1KWO C;  1S5G Y;  2AUC A;  1OMR A;  1FBV A;  1UHI A;  2PYQ A;  1OQP A;  1PAL A;  2WOR A;  1CFF A;  3I5G C;  1OSA A;  1PSB A;  3FS7 A;  2M97 A;  3QRX A;  3CR5 X;  2QEB A;  3CZT X;  1B7T Z;  3PAL A;  1LA3 A;  2KSP A;  2BL0 C;  1UHH A;  3NSL A;  3NXA A;  3O6B A;  4JQ0 D;  4QJ3 B;  1JBA A;  1XYD A;  1DJW A;  1B9A A;  4I5J A;  1DMO A;  1B47 A;  1K9U A;  2D8N A;  3SG4 A;  1G33 A;  3PN7 B;  1QVI Y;  2JZI A;  4GFT A;  2LVV A;  3PLF B;  1W7I B;  3DZT A;  3O2P A;  1KFX L;  2JUL A;  2ZNE A;  2E30 A;  1TCF A;  1OOG A;  1B8C A;  1WDC B;  1A2X A;  5FI6 A;  1AVS A;  1JF2 A;  1FI6 A;  3WHU B;  1MWN A;  1PK0 D;  2WC6 A;  4HSZ A;  2H61 A;  2LVK A;  1KFU S;  3CGA A;  3DVK A;  1TN4 A;  1GQM A;  1B4C A;  3D0Y B;  2BAP A;  1CMG A;  1JWD A;  1KQV A;  2LM5 A;  1TIZ A;  1XFX O;  2TN4 A;  5CSN A;  2B1U A;  1N2D A;  1QV1 A;  4FTG A;  2JU0 A;  3SS5 A;  1UHJ A;  4DCK A;  2NCO A;  4INX A;  2JOJ A;  1IWQ A;  1SNL A;  4HRH A;  2WCE A;  3AAK A;  3TUY B;  3GK1 A;  2RGI A;  2JTZ A;  1DJG A;  1TWO A;  1SR6 C;  3CZ2 A;  5F6T A;  3S0E A;  4N1G A;  1LKJ A;  4OCI A;  3B88 A;  1YRT B;  4M2P A;  1DJI A;  3A4U B;  3S0A A;  1XK4 C;  1OMV A;  1EXR A;  4GAO A;  1DQE A;  1QWV A;  2OS8 C;  3EG5 B;  3NHI A;  3DXL A;  3KEV A;  3WXA A;  3R1P A;  2KFH A;  4MBE A;  1SL9 A;  1K93 D;  3HX4 A;  5PAL A;  3D73 A;  1EH2 A;  2JPO A;  2KI4 C;  3CDN A;  2MLF C;  3DVJ A;  1JFK A;  1A75 B;  2E6W A;  1W9Z A;  1KQM C;  3BYA A;  2M0R A;  3VRR A;  2BCB A;  4CFR A;  3S0D A;  1EL4 A;  1M39 A;  3CR2 A;  1J7O A;  1F4Q A;  4WRI A;  2BNX A;  2LAN A;  3EK4 A;  3TDI A;  1DT7 B;  1IRJ A;  4NQG A;  2JC2 A;  1BG1 A;  1YX7 A;  3BQ3 A;  4CPV A;  2K0J A;  2QEO A;  2QPT A;  3DVM A;  2CXJ A;  1KK7 Z;  1RWY A;  1YTZ C;  3D0Y A;  5I8N A;  5DIC A;  1HT9 A;  1CKK A;  3CS1 A;  3ZWH A;  4U8D A;  1NIW A;  2CCM A;  1S6I A;  2LHI A;  3TDU A;  5HLO A;  4C0J A;  5KU1 A;  3FWC A;  1MUX A;  2OTG C;  2L5Y A;  1MQ1 A;  3VGO A;  1DJY A;  1SRA A;  1JFJ A;  1XA5 A;  2ZKM X;  4FQT A;  5ER5 A;  2HPS A;  1SL7 A;  1S36 A;  1JSA A;  1ODB A;  3I5I C;  2M3W A;  2O5G A;  2WCL A;  4MSP A;  2K60 A;  1B7T Y;  5G08 A;  3FE6 A;  3LL8 B;  1CB1 A;  2KQ6 A;  3CYZ A;  2I18 A;  2KFG A;  4MRY A;  5HL1 A;  1TNQ A;  1K90 D;  3SIA A;  3BFA A;  1LA0 A;  3LCP C;  4M2O A;  1CLB A;  1KK8 B;  1ZFS A;  3PFV A;  5CPV A;  3JTD C;  3SJS A;  1WLZ A;  2F2P A;  2HF5 A;  4OZD A;  3BOW B;  4MEW A;  3IQO A;  1DC1 A;  1YUU A;  1BOC A;  4NDD A;  1A75 A;  3OP0 A;  3I5H B;  1CM4 A;  2V53 A;  2ZRT A;  3D77 A;  5I2L A;  1BR1 B;  4M2Q A;  4Q04 A;  5K89 A;  1L2O C;  3TZ1 A;  1OE9 B;  3CWG A;  3BFH A;  1UWO A;  1NCY A;  1F54 A;  2MA2 A;  4NDB A;  1JUO A;  3BUW B;  1VRK A;  4MVF A;  1ZUZ A;  3GK4 X;  1TOP A;  5DKN A;  5AER A;  2L4H A;  3PM8 A;  1IQ3 A;  3D74 A;  1Y1X A;  2H61 C;  2KI6 D;  3CTN A;  1AP4 A;  3EKH A;  1IG5 A;  3ICB A;  1NX0 A;  1IQ5 A;  1N0Y A;  4GGN A;  1WLM A;  2EHB A;  1IIO A;  4DIR A;  4PE1 A;  1C3Z A;  3FIA A;  3KF9 A;  1QX5 B;  2Y1N A;  2M7N A;  5D3O A;  3Q8I A;  2QEH A;  3IVT A;  3TS5 B;  3UNW A;  1CDM A;  1CDP A;  4CID A;  1PRW A;  5ER4 X;  4GPL B;  1DEL A;  1Y6W A;  1WRZ A;  1CMF A;  3OX6 A;  2LNK A;  5HKY A;  2DOQ A;  2KFF A;  1DGU A;  2NLN A;  1SCV A;  4CLN A;  1OZS A;  3BOW A;  2JT8 A;  3EVR A;  4INW A;  2L5X B;  4GGF A;  1N65 A;  3EVV A;  2IS9 A;  1TUJ A;  2KGB C;  3F45 A;  2K2F A;  2KHN A;  1C3Y A;  1QLS A;  1UHK A;  3DY9 A;  4PT1 A;  1ZAC A;  3PN7 C;  1QJT A;  1F55 A;  1J1D A;  2LMT A;  4ICB A;  2MLE C;  1IGV A;  4QJ4 B;  1KK7 Y;  3HCM A;  1RTP 1;  2CBL A;  2PRU A;  3EK8 A;  1WDC C;  1M45 A;  2MRD A;  4YI9 A;  2LVI A;  1R2U A;  2ZRS A;  1T14 A;  3SS3 A;  2BKI B;  3OHM B;  2M29 A;  5JJG A;  2K7O A; 
#chains in the Genus database with same CATH homology
 2LCP A;  1KFX S;  3RLZ A;  5DKQ A;  2F2O A;  2BEC A;  3TDZ A;  3IQQ A;  2K8M B;  2L98 A;  2JRF A;  3M0W A;  3VRN A;  1D1O A;  2HQW A;  1RK9 A;  5KSZ A;  1UUR A;  2QAC A;  2G2B A;  1FF1 A;  2KAV A;  4HRG A;  3TUY C;  1REC A;  1IJ6 A;  2COL B;  1NX2 A;  2KOT A;  3JVT B;  3LK1 A;  1G8I A;  4WQ3 A;  5D7F A;  2M7L A;  4D1E A;  2KI6 C;  1CDL A;  2BE4 A;  1C7V A;  4PHJ A;  4P5O E;  3I5F B;  2K7B A;  4AOM A;  2CNP A;  2JQ6 A;  2PVB A;  4MN0 A;  3IF7 A;  4MZL A;  1EJ3 A;  5JOL A;  1YUT A;  1QTX A;  2LC5 A;  1UHN A;  4YGB B;  3O78 A;  1CDN A;  1MXE A;  2Y1M A;  1NYA A;  4PE0 A;  3LLE A;  1RJV A;  1CLM A;  2PAS A;  1OMD A;  1AHR A;  1BF5 A;  1PVB A;  1S6J A;  1ZOT B;  2FOT A;  1X02 A;  2HET A;  2M1K B;  2MBX A;  3VRO A;  2Y4Q A;  3GOF A;  2FJU B;  4PHK A;  3KHE A;  2NCP A;  2VRG A;  1SK6 D;  2JT3 A;  1ALW A;  2P6B B;  4YGA A;  1YVH A;  1FW4 A;  3DD4 A;  2I94 A;  1Q80 A;  2KYF A;  1LVC D;  4A4B A;  3NSO A;  1YRU B;  1CTR A;  1CM1 A;  1YR5 A;  2SCP A;  2WCB A;  3DF0 B;  1BT6 A;  3A8R A;  2KNE A;  5AEQ A;  4YRU A;  1XFU O;  1LIN A;  4N5X A;  1OZO A;  2ZFD A;  3D10 A;  2MAZ A;  1NWD A;  1B8L A;  3MSE B;  2GGM A;  1KK8 C;  2AMI A;  5HLV A;  4ZCV A;  1BOD A;  3SG7 A;  1SMG A;  4ETO A;  2K2A A;  2Y5I A;  4MZJ A;  4PE4 A;  2BCX A;  3EKJ A;  4GGF C;  3BXK A;  1OOJ A;  2LUX A;  1V1F A;  1BMO A;  3I5H C;  3PSR A;  5HYD A;  1K9K A;  2WND A;  3GK2 A;  1YVL A;  2SAS A;  2LE9 B;  1XFY O;  2JPT A;  1TNX A;  2LMU A;  1R6P A;  1TNW A;  2ZND A;  2WCF A;  3CR4 X;  1L7Z A;  2FCE A;  2GV5 A;  1NUB A;  4NDC A;  2JXL A;  1B8R A;  4I5L B;  3BUX B;  1IKU A;  5HKZ A;  1DF0 B;  1QV0 A;  1J1E A;  4GUK A;  4TNC A;  4C0L A;  2F3Y A;  2CTN A;  1AJ5 A;  3SG6 A;  2AAO A;  2KGR A;  1DVI A;  4ZCU A;  1SL8 A;  1NPQ A;  1CFP A;  4MRX A;  1RFJ A;  4P2Y B;  2LMV A;  1EG3 A;  2ZN9 A;  1QX7 A;  1MXL C;  1PUL A;  3DF0 A;  5AAN A;  5I2O A;  3WHT B;  2GGZ A;  1LXF C;  4ORC B;  1DJH A;  4WQ2 A;  2Q4U A;  3TS5 C;  1ALV A;  2KBM A;  4GBA A;  1BJF A;  2ISD A;  3BUN B;  4JWQ A;  1SCM B;  1A29 A;  1SY9 A;  5AXI A;  1RRO A;  5B8I B;  1GGW A;  2EGD A;  5IBW A;  2F3Z A;  1E8A A;  2L2E A;  1AJ4 A;  3EK7 A;  1NCX A;  1TRF A;  1Y0V H;  2EC6 B;  2LVJ A;  3ZNI A;  1KWO B;  1NP8 A;  2WOS A;  2LHL A;  4AQI A;  1F4O A;  1Y1U A;  4I5K A;  3SIB A;  1U5I B;  1TNP A;  1QIV A;  3I5G B;  1S26 D;  1A03 A;  1BR4 B;  1QXP A;  2CT9 A;  3C1V A;  2JWW A;  1B1G A;  1H4B A;  1K9P A;  5CSI A;  1FI5 A;  2JTT A;  3AKA A;  2BL0 B;  1JF0 A;  4DRW A;  4HRE E;  2LUC A;  1DF0 A;  5CSJ A;  1KCY A;  4BY5 A;  1PVA A;  1UUS A;  1DJX A;  1Y1A A;  3SG2 A;  3AKB A;  4L9M A;  4OVN F;  3OX5 A;  1KFU L;  1K94 A;  4YGD B;  4E68 A;  2PAL A;  3BUO B;  5FYX A;  2K61 A;  4DS7 A;  5TNC A;  1F71 A;  4ORA B;  1UP5 A;  2BKH B;  3RM1 A;  4FQO A;  5GQQ C;  3JVT C;  2I2R E;  2R2I A;  1XVJ A;  5KTY A;  1M31 A;  4AQJ A;  3DVE A;  1K95 A;  3I5F C;  4PDZ A;  1G4Y R;  1S3P A;  2KBI A;  1TTX A;  2L0P A;  4PHN A;  4UPG A;  1NX3 A;  1QAT A;  1WRL A;  1FPW A;  1M46 A;  1MF8 B;  1EG4 A;  4DUQ A;  2NZ0 A;  4ORB B;  1WRK A;  4N1F A;  1K8U A;  1U5I A;  1ZMZ A;  1SR6 B;  1H8B A;  2I7A A;  2H2K A;  2L50 A;  2LP2 A;  1S5G Z;  4OV2 A;  2OS8 B;  3K21 A;  3PAT A;  1J7Q A;  2BBM A;  5CSF A;  1QLK A;  3CLN A;  2KI4 B;  2FCD A;  5BPJ A;  2JNX A;  2WC8 A;  1YX8 A;  1KQM B;  3FWB A;  1KSO A;  1SYM A;  1WY9 A;  2BCA A;  3KO0 A;  4CFQ A;  1GGZ A;  1NCZ A;  1CNP A;  1V1G A;  1DJZ A;  1MR8 A;  1YUR A;  3SG3 A;  4I5N B;  1QVI Z;  2F8P A;  4PCW A;  2PSR A;  1S6C A;  1SKT A;  1F8H A;  1K2H A;  3OB1 B;  4XJK B;  1A4P A;  2JXC A;  5AFP A;  1NX1 A;  1TCO B;  3KPX A;  2K7C A;  2NXQ A;  5HKW A;  1NSH A;  2BE6 A;  2M49 B;  2ZN8 A;  1CLL A;  2OTG B;  5J3X A;  2MHH A;  4USL A;  1AK8 A;  2F33 A;  4IL1 A;  1QX2 A;  3OB2 B;  4R1E A;  1C7W A;  2LV7 A;  2G9B A;  4YBH B;  3AAJ A;  5I2Q A;  2OPO A;  2KAX A;  4OR9 B;  3I5I B;  1S1E A;  3NSK A;  4A4C A;  4YGC B;  2K7D A;  4OKH A;  4BY4 A;  1F70 A;  2LLT A;  1QS7 A;  3LK0 A;  1C07 A;  4MZK A;  1XFW O;  1KSM A;  1XO5 A;  4MLW A;  1XK4 A;  1DGV A;  1J55 A;  2M9G A;  1BU3 A;  1IH0 A;  2LAP A;  4XYN A;  1CFC A;  3JTD B;  4YGE B;  1K96 A;  4PAL A;  3WNX B;  2LLS A;  1SBJ A;  3EVU A;  1XFV O;  2HQ8 A;  2JT0 A;  4YI8 A;  2BBN A;  3O4Y A;  4PHM A;  4C0K A;  1QAS A;  1L2O B;  2PMY A;  4PE7 A;  4JPZ B;  3VRP A;  1SPY A;  1XFZ O;  3NSI A;  2KDH A;  2LP3 A;  4GNK B;  2KYC A;  5D69 A;  5DKR A;  1PSR A;  1JC2 A;  1J7R A;  3VRQ A;  1W7J B;  1QIW A;  2M8U A;  2LLU A;  3E3R A;  1CFD A;  1M63 B;  4XJK A;  2KQY A;  2L51 A;  2A4J A;  2O60 A;  1YUS A;  1MHO A;  2M1U A;  1SCM C;  1DTL A;  2Q91 A;  1AUI B;  1SW8 A;  3SG5 A;  4QJ5 B;  1GJY A;  2JNF A;  2KAY A;  2L4I A;  3H4S E;  1IJ5 A;  4F0Z B;  1HQV A;  1J7P A;  3BUM B;  1BLQ A;  2EC6 C;  2MJW B;  1KWO C;  1S5G Y;  2AUC A;  1OMR A;  1FBV A;  1UHI A;  1OQP A;  1PAL A;  2WOR A;  1CFF A;  3I5G C;  1OSA A;  1PSB A;  3FS7 A;  2M97 A;  3QRX A;  3CR5 X;  3CZT X;  1B7T Z;  3PAL A;  1LA3 A;  2KSP A;  2BL0 C;  1UHH A;  3NSL A;  3NXA A;  3O6B A;  4JQ0 D;  4QJ3 B;  1JBA A;  1XYD A;  1DJW A;  1B9A A;  4I5J A;  1DMO A;  1B47 A;  1K9U A;  2D8N A;  3SG4 A;  1G33 A;  3PN7 B;  1QVI Y;  2JZI A;  4GFT A;  2LVV A;  3PLF B;  1W7I B;  3O2P A;  1KFX L;  2JUL A;  2ZNE A;  2E30 A;  1TCF A;  1B8C A;  1WDC B;  1A2X A;  1AVS A;  1JF2 A;  1FI6 A;  3WHU B;  1MWN A;  1PK0 D;  4HSZ A;  2H61 A;  2LVK A;  1KFU S;  3CGA A;  3DVK A;  1TN4 A;  1GQM A;  1B4C A;  3D0Y B;  1CMG A;  1JWD A;  1KQV A;  2LM5 A;  1TIZ A;  1XFX O;  2TN4 A;  5CSN A;  2B1U A;  1N2D A;  1QV1 A;  4FTG A;  2JU0 A;  1UHJ A;  4DCK A;  2NCO A;  2JOJ A;  1IWQ A;  1SNL A;  4HRH A;  2WCE A;  3AAK A;  3TUY B;  3GK1 A;  2RGI A;  2JTZ A;  1DJG A;  1SR6 C;  5F6T A;  4N1G A;  1LKJ A;  4OCI A;  1YRT B;  4M2P A;  1DJI A;  3A4U B;  1OMV A;  1XK4 C;  1EXR A;  4GAO A;  2OS8 C;  3KEV A;  3WXA A;  2KFH A;  4MBE A;  1SL9 A;  1K93 D;  3HX4 A;  5PAL A;  1EH2 A;  2KI4 C;  2MLF C;  3DVJ A;  1JFK A;  1A75 B;  2E6W A;  1KQM C;  3BYA A;  2M0R A;  3VRR A;  2BCB A;  4CFR A;  1EL4 A;  1M39 A;  3CR2 A;  1J7O A;  1F4Q A;  4WRI A;  3TDI A;  2LAN A;  3EK4 A;  1DT7 B;  1IRJ A;  4NQG A;  2JC2 A;  1BG1 A;  1YX7 A;  3BQ3 A;  4CPV A;  2K0J A;  2QPT A;  3DVM A;  2CXJ A;  1KK7 Z;  1RWY A;  1YTZ C;  3D0Y A;  5I8N A;  1HT9 A;  1CKK A;  3CS1 A;  3ZWH A;  4U8D A;  1NIW A;  2CCM A;  1S6I A;  2LHI A;  3TDU A;  5HLO A;  4C0J A;  5KU1 A;  3FWC A;  1MUX A;  2OTG C;  3VGO A;  1MQ1 A;  1JFJ A;  1DJY A;  1SRA A;  1XA5 A;  2ZKM X;  5ER5 A;  2HPS A;  1SL7 A;  1S36 A;  1JSA A;  1ODB A;  3I5I C;  2M3W A;  2O5G A;  4MSP A;  5G08 A;  1B7T Y;  3LL8 B;  1CB1 A;  2KQ6 A;  2I18 A;  2KFG A;  4MRY A;  1TNQ A;  1K90 D;  3SIA A;  1LA0 A;  3LCP C;  4M2O A;  1CLB A;  1KK8 B;  1ZFS A;  3PFV A;  5CPV A;  3JTD C;  3SJS A;  1WLZ A;  2F2P A;  2HF5 A;  3BOW B;  4MEW A;  3IQO A;  1BOC A;  1YUU A;  4NDD A;  1A75 A;  3OP0 A;  3I5H B;  1CM4 A;  2V53 A;  2ZRT A;  5I2L A;  1BR1 B;  4M2Q A;  4Q04 A;  5K89 A;  1L2O C;  3TZ1 A;  1OE9 B;  3CWG A;  1UWO A;  1NCY A;  1F54 A;  2MA2 A;  4NDB A;  1JUO A;  3BUW B;  1VRK A;  4MVF A;  1ZUZ A;  3GK4 X;  1TOP A;  5DKN A;  5AER A;  2L4H A;  3PM8 A;  1IQ3 A;  1Y1X A;  2H61 C;  2KI6 D;  3CTN A;  1AP4 A;  3EKH A;  1IG5 A;  3ICB A;  1NX0 A;  1IQ5 A;  1N0Y A;  4GGN A;  1WLM A;  2EHB A;  4DIR A;  4PE1 A;  3FIA A;  3KF9 A;  1QX5 B;  2Y1N A;  2M7N A;  3TS5 B;  1CDM A;  1CDP A;  4CID A;  1PRW A;  5ER4 X;  4GPL B;  1Y6W A;  1WRZ A;  1CMF A;  3OX6 A;  2LNK A;  5HKY A;  2DOQ A;  2KFF A;  1DGU A;  2NLN A;  1SCV A;  4CLN A;  1OZS A;  3BOW A;  2JT8 A;  3EVR A;  2L5X B;  4GGF A;  1N65 A;  3EVV A;  2IS9 A;  2KGB C;  3F45 A;  2K2F A;  2KHN A;  1QLS A;  1UHK A;  1ZAC A;  3PN7 C;  1QJT A;  1F55 A;  1J1D A;  2LMT A;  4ICB A;  2MLE C;  1IGV A;  4QJ4 B;  1KK7 Y;  3HCM A;  1RTP 1;  2CBL A;  2PRU A;  3EK8 A;  1WDC C;  1M45 A;  2MRD A;  4YI9 A;  2LVI A;  1R2U A;  2ZRS A;  2BKI B;  3OHM B;  2M29 A;  5JJG A;  2K7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...