3TUYC

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
total genus 46
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC02
1BLQA 1RFJA 1B7TY 1SPYA 1R2UA 1M39A 2KOTA 1B9AA 5DKQA 1U5IB 1GGWA 2K7DA 4ZCVA 4YI9A 2OS8C 1UHHA 5D7FA 5GQQC 2LUXA 4PHJA 1WLZA 2BL0B 3SG5A 1CM1A 3SIAA 2BCAA 1AK8A 4YRUA 1C7VA 4YBHB 2L50A 1MWNA 1EG4A 2ISDA 1RROA 5F6TA 1XFVO 1FPWA 1DJGA 1UHIA 1M45A 2CNPA 3NXAA 5KTYA 1NP8A 3NSOA 2KAYA 1K94A 1JWDA 2VRGA 3C1VA 4TNCA 4I5LB 2JXCA 1AP4A 2F2PA 1DTLA 3TUYB 3F45A 3O4YA 3WHTB 1GQMA 2K61A 4DIRA 3FS7A 1S6IA 2KNEA 4PHKA 1C07A 2EC6C 2JRFA 1J7PA 1XYDA 1J7QA 1CDMA 3AAJA 4PE1A 3VRRA 2LAPA 3RLZA 1W7IB 3ZNIA 4I5NB 1OQPA 3BOWB 3VROA 2KQ6A 2BE4A 1FI5A 4HRHA 2EHBA 2PASA 3PFVA 3PLFB 3GK4X 1YX8A 4GGFA 1WY9A 1DT7B 1UURA 3LCPC 2CCMA 1PK0D 3BYAA 4P2YB 2JNXA 2L51A 1UP5A 5J3XA 3CR4X 2OS8B 1ZMZA 1YVLA 3AAKA 1FW4A 3BUWB 1PVBA 1J55A 4MN0A 1KFXL 1FBVA 1CB1A 3NSKA 4ORAB 5AFPA 1XFUO 3IQQA 1XK4A 5KU1A 3KEVA 2LM5A 1YVHA 1MR8A 1ZUZA 1ODBA 4WQ2A 4F0ZB 2M49B 4FQOA 3VGOA 2CXJA 4CFRA 1K9PA 1JUOA 1SMGA 1CKKA 1CDPA 3LLEA 2ZN8A 1K95A 1IQ3A 1QLSA 1Y1XA 3KF9A 4Q04A 2GGZA 2KGRA 4PHMA 4OKHA 2QACA 5BPJA 1YTZC 3CWGA 1OZOA 1S36A 1ALWA 2K7BA 2WC8A 1SY9A 2FCEA 1ZACA 1EH2A 2BL0C 5DKRA 2F8PA 5IBWA 2L5XB 1QLKA 1Y6WA 2BKHB 1Y1AA 4IL1A 3SG4A 1PSRA 1Y1UA 5ER4X 1QIWA 4UPGA 1NYAA 1KCYA 2JXLA 1JSAA 3HCMA 5D69A 4OCIA 2L2EA 2P6BB 1XFWO 2AMIA 2JPTA 2JT3A 2I7AA 1K90D 1AHRA 1M46A 3BUMB 2M1KB 2KYCA 3DF0A 3KO0A 4ETOA 3MSEB 3JVTC 2JC2A 1SCVA 4PCWA 1XVJA 5FYXA 3AKAA 2LVVA 2ZKMX 4D1EA 4R1EA 1BJFA 4OR9B 1OOJA 2L4IA 1E8AA 1YX7A 1CFPA 3JTDB 5CPVA 3CR2A 2BKIB 1F71A 5DKNA 2LLTA 1BOCA 2LVJA 4PDZA 1UUSA 3PM8A 2JQ6A 4GFTA 5JOLA 3IF7A 3KPXA 4XJKA 2BCBA 1EJ3A 1BR1B 4HRGA 1F70A 5HKWA 1NSHA 1XFXO 4A4CA 1H8BA 5B8IB 2LANA 2LMTA 2LHLA 3LK1A 4XYNA 2PVBA 3DVKA 1WRZA 1L2OC 1Y0VH 4GAOA 4C0LA 1MHOA 1SW8A 4NDDA 4PE4A 4HSZA 1QATA 2LVIA 2KFFA 4C0JA 3DVEA 1KQVA 4MEWA 2KI4B 2ZFDA 5G08A 2LCPA 4NQGA 3TDUA 3OX5A 3I5HC 3E3RA 4QJ3B 2JWWA 2M7LA 1CFFA 1B8RA 1PVAA 1DF0B 1JFKA 3GK1A 1GJYA 1S26D 4N5XA 2EGDA 1W7JB 3BQ3A 2K0JA 4M2OA 1SNLA 1S3PA 5I2OA 4MRYA 1KFUS 1BG1A 1EG3A 1KFUL 4NDCA 1A75B 3JVTB 1MXLC 2A4JA 4ORBB 1HT9A 3SG3A 4BY5A 2KBMA 4AQIA 4N1GA 4P5OE 1DJXA 1LKJA 1WLMA 1M31A 2E30A 2JU0A 2LLUA 3FWBA 3SIBA 5JJGA 3DVJA 1H4BA 1YRUB 5I2QA 1SR6B 2PALA 2WCFA 3D0YA 2F3ZA 2AAOA 3AKBA 4U8DA 1BF5A 2KBIA 3I5IB 2M97A 1SL7A 4GGFC 5TNCA 1CMFA 3FWCA 5CSJA 2LMUA 2ZRTA 1F8HA 4I5KA 1MUXA 2K7CA 3O78A 4ICBA 4E68A 3EK8A 3PATA 1L2OB 1PRWA 2KYFA 2TN4A 1EXRA 3LK0A 1BODA 1KK8C 4WRIA 3OB2B 1ALVA 1XK4C 2H61A 4DS7A 2KAVA 1QX5B 3CLNA 1F55A 4OVNF 3JTDC 4YI8A 4PE0A 1SL8A 1R6PA 1KFXS 1DJYA 2SASA 3K21A 3I5HB 1DVIA 1LVCD 2CT9A 2LP3A 1BR4B 4YGEB 1CFDA 3WXAA 3O2PA 1QIVA 1BU3A 3BUXB 1LA3A 1TRFA 1YUTA 2GV5A 4YGAA 1NCYA 2BBNA 2QPTA 1LXFC 4GPLB 4I5JA 5ER5A 2M3WA 4AQJA 4CPVA 5HYDA 4AOMA 2M7NA 3CGAA 1YURA 2DOQA 1N2DA 4L9MA 2D8NA 2JZIA 2Y1NA 2MLEC 3HX4A 1CTRA 1OSAA 1OMVA 1G33A 1QXPA 2KI4C 1L7ZA 1OMRA 1K93D 1QVIZ 4A4BA 1OZSA 3DVMA 1F4OA 2BBMA 4HREE 1WRLA 1WRKA 1MQ1A 3DD4A 3A4UB 2IS9A 1RWYA 3I5GB 3NSLA 1RJVA 3BXKA 3NSIA 4MVFA 2KDHA 3VRNA 2F3YA 1CDNA 3EKHA 1NX0A 2L0PA 5AEQA 1KK7Z 2MAZA 2MJWB 1QS7A 4MBEA 2LNKA 4QJ5B 4GUKA 2ZRSA 1KK8B 1NWDA 1N65A 1U5IA 1OMDA 1UHKA 1SR6C 1TNWA 2ZNDA 2WCBA 4YGDB 2E6WA 5I8NA 2LVKA 3QRXA 3I5IC 1QV1A 1KSMA 3A8RA 2NXQA 1OE9B 1A4PA 2H2KA 2NLNA 1F54A 1IH0A 1DJHA 3TZ1A 1XO5A 4DUQA 1IQ5A 1A2XA 2OTGC 1J7RA 3PALA 3PN7C 1QVIY 1K9KA 1QTXA 3FIAA 5AXIA 1HQVA 2M9GA 1DGUA 5HKZA 5HLOA 5PALA 2MBXA 5I2LA 2M1UA 2MRDA 1TTXA 2KFGA 1PULA 1S5GZ 2LHIA 1UHNA 2OPOA 1J1DA 1RTP1 1JC2A 5AERA 1UHJA 5K89A 1WDCC 4GGNA 2K8MB 2K2FA 1KK7Y 4CLNA 2O60A 2HPSA 4MZKA 4DRWA 4GNKB 3OP0A 2LC5A 1NUBA 3DF0B 1TNPA 2ZN9A 1KSOA 1SRAA 2LV7A 1YUSA 2JT0A 2AUCA 4MZJA 1SCMB 5HKYA 1NCXA 3BOWA 1TCOB 2MHHA 4NDBA 1XFZO 2PSRA 1B8LA 1N0YA 3ICBA 1XFYO 2LLSA 2LE9B 1Q80A 2HQWA 2JULA 1TN4A 2WORA 2FCDA 3TS5C 5CSNA 4FTGA 4XJKB 2HF5A 2JNFA 2MA2A 1KQMB 2PRUA 1NX2A 1EL4A 4BY4A 2M0RA 1PALA 1QASA 1YR5A 3H4SE 1S5GY 1MF8B 3CS1A 1CM4A 1SKTA 2WNDA 4ORCB 2NZ0A 1NCZA 2GGMA 3WHUB 3OB1B 1B47A 1PSBA 3KHEA 4QJ4B 2B1UA 4MLWA 2V53A 1V1GA 1ZFSA 2JT8A 3I5GC 3M0WA 5CSIA 2OTGB 3PN7B 1ZOTB 4CIDA 2H61C 1TCFA 4M2PA 1B1GA 1UWOA 1IJ6A 4JWQA 5CSFA 1TNQA 2F2OA 3EVUA 4PE7A 3EVRA 2JTTA 1IKUA 4ZCUA 1NPQA 2MLFC 3BUOB 2K7OA 1MXEA 2BECA 4GBAA 4PHNA 1CNPA 1LINA 1WDCB 1D1OA 2JOJA 3GOFA 1BMOA 2BE6A 3CZTX 1X02A 3OX6A 4PALA 1C7WA 1QJTA 2K2AA 2F33A 3SG2A 1DMOA 1S6JA 2L4HA 3RM1A 4YGBB 2JTZA 3D0YB 1CLMA 4USLA 1K96A 3I5FC 1KWOC 2COLB 1B4CA 2Y1MA 3TS5B 1YRTB 2NCOA 4N1FA 1AUIB 2LUCA 2I18A 2G9BA 2M8UA 1K2HA 1IGVA 1G4YR 1K9UA 2KAXA 2L98A 4M2QA 4MRXA 3TDZA 2CTNA 1FI6A 2KI6C 3O6BA 1IJ5A 4OV2A 2ZNEA 1AVSA 2LP2A 1SCMC 2LMVA 2KGBC 1QX7A 1AJ5A 1SK6D 3EKJA 2Y5IA 1A29A 1QX2A 3BUNB 4JPZB 3TDIA 1CLLA 1TIZA 3EK4A 1TNXA 1DJWA 3OHMB 1SBJA 1TOPA 2WCEA 5KSZA 2KFHA 2G2BA 1S1EA 1JF0A 4WQ3A 1B8CA 2I94A 1IRJA 2HETA 2Q91A 2EC6B 1A03A 3CTNA 1NX1A 1KQMC 2I2RE 1NIWA 2M29A 3SG7A 1V1FA 2WOSA 2KSPA 1K8UA 1IWQA 1SL9A 1XA5A 1DGVA 1B7TZ 1RECA 2NCPA 3EK7A 1SYMA 4JQ0D 2O5GA 2Y4QA 5AANA 1AJ4A 2BCXA 2RGIA 3D10A 3WNXB 1VRKA 3VRPA 2R2IA 2FOTA 1G8IA 1IG5A 1DF0A 1FF1A 1BT6A 3IQOA 1LA0A 1CDLA 4DCKA 3TUYC 2HQ8A 1YUUA 1DJZA 4YGCB 2Q4UA 2PMYA 2FJUB 1A75A 3CR5X 3EVVA 4MZLA 1CFCA 1RK9A 3I5FB 1KWOB 1NX3A 3ZWHA 1CMGA 1JFJA 1J1EA 1JBAA 4CFQA 1GGZA 1J7OA 3VRQA 3LL8B 5HLVA 1QV0A 2KHNA 2KI6D 2CBLA 2SCPA 3GK2A 2KQYA 1DJIA 3SJSA 1F4QA 3PSRA 3SG6A 1S6CA 1M63B 4MSPA 1JF2A 4C0KA 1CLBA
chains in the Genus database with same CATH superfamily
1BLQA 1RFJA 1B7TY 1SPYA 1R2UA 1M39A 2KOTA 1B9AA 2QEOA 5DKQA 1TUZA 1U5IB 3B6XA 2K7DA 1GGWA 4ZCVA 4YI9A 2OS8C 1UHHA 5D7FA 5GQQC 2LUXA 4PHJA 3NGVA 3R1OA 1WLZA 2BL0B 3SG5A 3L4AA 3DXLA 1CM1A 3SIAA 2BCAA 1AK8A 4YRUA 1C7VA 4YBHB 2L50A 1MWNA 1EG4A 2ISDA 1RROA 5F6TA 1SSEB 1XFVO 1FPWA 1DJGA 1UHIA 1M45A 2CNPA 3NXAA 1IIOA 5KTYA 2KPHA 1NP8A 3NSOA 2KAYA 1K94A 1JWDA 2VRGA 3C1VA 2PYQA 4TNCA 2L5YA 4I5LB 2JXCA 2YGUA 1AP4A 2F2PA 1DTLA 3TUYB 3F45A 3O4YA 3WHTB 1GQMA 2K61A 3BFHA 4DIRA 3FS7A 1S6IA 2KNEA 4PHKA 1C07A 2EC6C 2JRFA 1J7PA 1XYDA 1J7QA 1CDMA 3AAJA 4PE1A 4INXA 2PQLA 3VRRA 2LAPA 3CZ1A 3RLZA 1W7IB 3ZNIA 4I5NB 3B87A 1OQPA 3BOWB 3VROA 2KQ6A 2BE4A 1FI5A 3B88A 4HRHA 3SS3A 2EHBA 2PASA 3PFVA 3PLFB 3GK4X 3V2LA 1T14A 1YX8A 1DELA 1WY9A 3R1PA 4GGFA 1UURA 1DT7B 3LCPC 2CCMA 1PK0D 2ERBA 3BYAA 4P2YB 2JNXA 2L51A 1UP5A 5J3XA 3CR4X 2OS8B 1ZMZA 1YVLA 3AAKA 1FW4A 3SS4A 3BUWB 1PVBA 1J55A 4MN0A 5DICA 1KFXL 2QEBA 1FBVA 1CB1A 3NSKA 4ORAB 5AFPA 1XFUO 3IQQA 1XK4A 5KU1A 3KEVA 2LM5A 1YVHA 1MR8A 1ZUZA 1ODBA 4WQ2A 4F0ZB 2M49B 3BFAA 3O4XA 4FQOA 3VGOA 2CXJA 4CFRA 1K9PA 1C3ZA 4JKTA 1JUOA 1SMGA 1CKKA 1CDPA 3LLEA 2ZN8A 1K95A 1IQ3A 1QLSA 1Y1XA 3KF9A 4Q04A 2GGZA 2KGRA 4PHMA 4OKHA 2QACA 3OGNA 2JPOA 1YTZC 3CWGA 1OZOA 5BPJA 1S36A 1ALWA 2K7BA 2WC8A 1SY9A 2WCLA 2FCEA 1ZACA 1EH2A 2BL0C 2K60A 2F8PA 5DKRA 5IBWA 2L5XB 1QLKA 1Y6WA 2BAPA 2BKHB 3IVTA 1Y1AA 4IL1A 3SG4A 1PSRA 3UNWA 1Y1UA 5ER4X 1QIWA 4KYNA 4UPGA 1NYAA 1KCYA 2JXLA 4INWA 1JSAA 3HCMA 5D69A 4OCIA 2L2EA 1TUJA 2P6BB 5I94A 1XFWO 2AMIA 2JPTA 2JT3A 2I7AA 1K90D 1AHRA 1M46A 3BUMB 2M1KB 2KYCA 3DF0A 3KO0A 2QDIA 3UO9A 4ETOA 3MSEB 3JVTC 2JC2A 1SCVA 4PCWA 1XVJA 5FYXA 3AKAA 2LVVA 2ZKMX 4D1EA 1DC1A 4R1EA 1BJFA 4OR9B 1OOJA 2L4IA 1E8AA 1YX7A 1CFPA 3JTDB 5CPVA 3CR2A 2BKIB 1F71A 5DKNA 2LLTA 1BOCA 2LVJA 4PDZA 1UUSA 3PM8A 2JQ6A 1OOGA 4GFTA 5JOLA 3IF7A 3KPXA 4XJKA 5FI7A 2BCBA 2P70A 1EJ3A 1BR1B 4HRGA 3RZSA 5HKWA 1F70A 1NSHA 1XFXO 4A4CA 1H8BA 5B8IB 2LANA 2LMTA 2LHLA 3LK1A 4IJ7A 4XYNA 2PVBA 3DVKA 1WRZA 1L2OC 1Y0VH 4GAOA 4C0LA 1MHOA 1SW8A 4NDDA 4PE4A 4HSZA 1QATA 2LVIA 2KFFA 4C0JA 3DVEA 1KQVA 4MEWA 3OBVA 2KI4B 2ZFDA 5G08A 2KLEA 3D77A 2LCPA 4NQGA 3TDUA 3OX5A 3I5HC 3E3RA 4QJ3B 2JWWA 2M7LA 1CFFA 1B8RA 1PVAA 1DF0B 1JFKA 3GK1A 1GJYA 1S26D 3B86A 4N5XA 4PT1A 2EGDA 1W7JB 3BQ3A 2K0JA 3FE8A 4M2OA 1SNLA 1S3PA 5I2OA 4MRYA 1KFUS 1BG1A 1EG3A 1KFUL 2H8VA 4NDCA 1A75B 2WC6A 3Q8IA 3JVTB 1MXLC 2A4JA 4ORBB 1HT9A 3SG3A 4BY5A 2KBMA 4AQIA 4N1GA 4P5OE 1DJXA 1LKJA 1WLMA 1M31A 2E30A 2JU0A 2LLUA 3FWBA 3SIBA 5JJGA 3DVJA 1H4BA 3B7AA 1YRUB 2WCJA 5I2QA 3D76A 1SR6B 2PALA 2WCFA 3D0YA 2F3ZA 2AAOA 3AKBA 4U8DA 1BF5A 2KBIA 3I5IB 2M97A 1SL7A 4GGFC 5TNCA 1CMFA 1Z2CB 1C3YA 3S0EA 2GTEA 3FWCA 5CSJA 2LMUA 2ZRTA 1F8HA 4I5KA 1MUXA 2K7CA 3O78A 4ICBA 4E68A 3D78A 4JD9A 3S0BA 3EK8A 3PATA 2FJYA 1L2OB 1PRWA 2KYFA 2TN4A 1EXRA 3LK0A 4F7FA 1BODA 1KK8C 4WRIA 3OB2B 1ALVA 1XK4C 2H61A 4DS7A 2KAVA 1QX5B 3CLNA 1F55A 4OVNF 3JTDC 4YI8A 4PE0A 1SL8A 1R6PA 1KFXS 1DJYA 2SASA 3K21A 3I5HB 1DVIA 1LVCD 2CT9A 2LP3A 1BR4B 4YGEB 1CFDA 3WXAA 3O2PA 1QIVA 1BU3A 3BUXB 1LA3A 1TRFA 1YUTA 2GV5A 4YGAA 1NCYA 2BBNA 2QPTA 1LXFC 4GPLB 4I5JA 5ER5A 2M3WA 4AQJA 3CABA 4CPVA 5HYDA 4AOMA 2M7NA 2WCMA 3CGAA 1YURA 1DEKA 1N2DA 2DOQA 4L9MA 2D8NA 2JZIA 2Y1NA 4OZDA 2MLEC 3HX4A 1CTRA 1OSAA 1OMVA 1G33A 1QXPA 2KI4C 1L7ZA 1ORGA 1OMRA 3R1VA 1K93D 1QVIZ 4A4BA 3R72A 1OZSA 3DVMA 1F4OA 1OW4A 2BBMA 1GM0A 4HREE 1WRLA 1WRKA 1MQ1A 3DD4A 3A4UB 1TWOA 2IS9A 1RWYA 3I5GB 3NSLA 1RJVA 3NHTA 3BXKA 3NSIA 4MVFA 2KDHA 3VRNA 2F3YA 1CDNA 3EKHA 1NX0A 2L0PA 5AEQA 1KK7Z 2MAZA 2KLDA 2MJWB 1QS7A 4MBEA 2LNKA 4QJ5B 4GUKA 2ZRSA 1KK8B 1NWDA 1N65A 1U5IA 1OMDA 1UHKA 1SR6C 1TNWA 2ZNDA 2WCBA 4YGDB 3S0FA 1OOIX 2E6WA 5I8NA 2LVKA 3QRXA 2QEVA 3I5IC 1QV1A 1KSMA 3PJIA 3A8RA 2NXQA 1OE9B 1A4PA 2H2KA 3L47A 2NLNA 1F54A 1IH0A 1DJHA 1Z4HA 3TZ1A 1XO5A 4DUQA 1IQ5A 1A2XA 2OTGC 1J7RA 3PALA 3PN7C 1QVIY 1QWVA 1K9KA 1QTXA 3FIAA 5AXIA 1HQVA 2M9GA 1DGUA 5HKZA 5HLOA 5PALA 2MBXA 5I2LA 2M1UA 2MRDA 1TTXA 3DYEA 2KFGA 5HL1A 1PULA 1S5GZ 2LHIA 1UHNA 2OPOA 1J1DA 1RTP1 1XFRA 5AERA 1JC2A 1UHJA 3CZ0A 5K89A 1WDCC 4GGNA 2K8MB 2K2FA 1KK7Y 4CLNA 2O60A 1P28A 2HPSA 4MZKA 4GNKB 4DRWA 3OP0A 2LC5A 1NUBA 3BFBA 3DF0B 3D75A 3CZ2A 1TNPA 2ZN9A 1KSOA 1SRAA 2LV7A 1YUSA 3BJHA 2JT0A 3VB1A 2AUCA 4MZJA 1SCMB 5HKYA 1NCXA 3BOWA 1LS8A 3K1EA 2P71A 1TCOB 2MHHA 3QMEA 4NDBA 1XFZO 2PSRA 1B8LA 1N0YA 5EL2A 5FI2A 3ICBA 1XFYO 2LLSA 2LE9B 1Q80A 2HQWA 2JULA 1TN4A 2WORA 2FCDA 3TS5C 5CSNA 4FTGA 4XJKB 2HF5A 2JNFA 2MA2A 1KQMB 2PRUA 1NX2A 1EL4A 1DQEA 4BY4A 2WCKA 2M0RA 1PALA 1QASA 1YR5A 3H4SE 1S5GY 1MF8B 3CS1A 1CM4A 1SKTA 2WNDA 4ORCB 3CYZA 2NZ0A 1NCZA 2GGMA 3D73A 3WHUB 3OB1B 1B47A 1PSBA 3KHEA 4QJ4B 2B1UA 4MLWA 2V53A 1V1GA 1ZFSA 2JT8A 3I5GC 3M0WA 5CSIA 5D3OA 2OTGB 3PN7B 1ZOTB 4CIDA 2H61C 1TCFA 4M2PA 3FE6A 1B1GA 3FE9A 1UWOA 1IJ6A 4JWQA 3EG5B 5CSFA 1TNQA 2F2OA 3EVUA 4PE7A 3EVRA 3S0GA 2JTTA 1IKUA 4ZCUA 1NPQA 2MLFC 3BUOB 2K7OA 1MXEA 2BECA 4GBAA 4PHNA 1CNPA 1LINA 1WDCB 1D1OA 2JOJA 3GOFA 1BMOA 1W9ZA 2BE6A 3CZTX 1X02A 3OX6A 4PALA 1C7WA 1QJTA 4FQTA 2K2AA 2F33A 3SG2A 1DMOA 1S6JA 2L4HA 3RM1A 4YGBB 3DY9A 2JTZA 3D0YB 1CLMA 1OOHA 4USLA 1K96A 3I5FC 3CDNA 1KWOC 2COLB 3L4LA 1B4CA 2Y1MA 3TS5B 1YRTB 2NCOA 2QEHA 4N1FA 1AUIB 2LUCA 2I18A 3S0AA 2G9BA 3D74A 2M8UA 1K2HA 1IGVA 1G4YR 1K9UA 2KAXA 2L98A 4M2QA 4MRXA 3TDZA 2CTNA 1FI6A 3N7HA 2KI6C 3O6BA 1IJ5A 4OV2A 2ZNEA 1AVSA 2LP2A 1SCMC 2LMVA 2KGBC 1QX7A 1AJ5A 1SK6D 3EKJA 2Y5IA 3DZTA 1A29A 1QX2A 3BUNB 4JPZB 3TDIA 1CLLA 1TIZA 3EK4A 1TNXA 1DJWA 3OHMB 1SBJA 1TOPA 2WCEA 5KSZA 2KFHA 2G2BA 1S1EA 1JF0A 4WQ3A 1B8CA 2WC5A 2I94A 1IRJA 2HETA 2Q91A 3PM2A 2EC6B 1A03A 3CTNA 1NX1A 1KQMC 2I2RE 1NIWA 2M29A 2BNXA 3SG7A 1V1FA 2WOSA 2KSPA 1K8UA 1IWQA 1SL9A 1XA5A 1DGVA 1B7TZ 1RECA 2NCPA 2L2CA 1SYMA 3EK7A 2O5GA 2Y4QA 4JQ0D 5AANA 1AJ4A 2BCXA 2RGIA 3D10A 3WNXB 1VRKA 3VRPA 2R2IA 2WCHA 2FOTA 1G8IA 1IG5A 1DF0A 1FF1A 1BT6A 3IQOA 1LA0A 1CDLA 3NHIA 4DCKA 3TUYC 2HQ8A 1YUUA 1DJZA 4YGCB 3S0DA 2Q4UA 2PMYA 2FJUB 1A75A 3CR5X 3EVVA 4MZLA 1CFCA 1RK9A 3I5FB 1KWOB 5FI6A 1NX3A 3ZWHA 1CMGA 1JFJA 1J1EA 1JBAA 3SS5A 4CFQA 1GGZA 1J7OA 3VRQA 3LL8B 5HLVA 1QV0A 2KHNA 2KI6D 2CBLA 2SCPA 3GK2A 2KQYA 1DJIA 3SJSA 1F4QA 1OOFA 3PSRA 3SG6A 1S6CA 1M63B 4MSPA 1JF2A 4C0KA 1CLBA
chains in the Genus database with same CATH topology
1BLQA 1RFJA 1B7TY 1SPYA 1R2UA 1M39A 2KOTA 1B9AA 5DKQA 1U5IB 1GGWA 2K7DA 4ZCVA 4YI9A 2OS8C 1UHHA 5D7FA 5GQQC 2LUXA 4PHJA 1WLZA 2BL0B 3SG5A 1CM1A 3SIAA 2BCAA 1AK8A 4YRUA 1C7VA 4YBHB 2L50A 1MWNA 1EG4A 2ISDA 1RROA 5F6TA 1XFVO 1FPWA 1DJGA 1UHIA 1M45A 2CNPA 3NXAA 5KTYA 1NP8A 3NSOA 2KAYA 1K94A 1JWDA 2VRGA 3C1VA 4TNCA 4I5LB 2JXCA 1AP4A 2F2PA 1DTLA 3TUYB 3F45A 3O4YA 3WHTB 1GQMA 2K61A 4DIRA 3FS7A 1S6IA 2KNEA 4PHKA 1C07A 2EC6C 2JRFA 1J7PA 1XYDA 1J7QA 1CDMA 3AAJA 4PE1A 3VRRA 2LAPA 3RLZA 1W7IB 3ZNIA 4I5NB 1OQPA 3BOWB 3VROA 2KQ6A 2BE4A 1FI5A 4HRHA 2EHBA 2PASA 3PFVA 3PLFB 3GK4X 1YX8A 4GGFA 1WY9A 1DT7B 1UURA 3LCPC 2CCMA 1PK0D 3BYAA 4P2YB 2JNXA 2L51A 1UP5A 5J3XA 3CR4X 2OS8B 1ZMZA 1YVLA 3AAKA 1FW4A 3BUWB 1PVBA 1J55A 4MN0A 1KFXL 1FBVA 1CB1A 3NSKA 4ORAB 5AFPA 1XFUO 3IQQA 1XK4A 5KU1A 3KEVA 2LM5A 1YVHA 1MR8A 1ZUZA 1ODBA 4WQ2A 4F0ZB 2M49B 4FQOA 3VGOA 2CXJA 4CFRA 1K9PA 1JUOA 1SMGA 1CKKA 1CDPA 3LLEA 2ZN8A 1K95A 1IQ3A 1QLSA 1Y1XA 3KF9A 4Q04A 2GGZA 2KGRA 4PHMA 4OKHA 2QACA 5BPJA 1YTZC 3CWGA 1OZOA 1S36A 1ALWA 2K7BA 2WC8A 1SY9A 2FCEA 1ZACA 1EH2A 2BL0C 5DKRA 2F8PA 5IBWA 2L5XB 1QLKA 1Y6WA 2BKHB 1Y1AA 4IL1A 3SG4A 1PSRA 1Y1UA 5ER4X 1QIWA 4UPGA 1NYAA 1KCYA 2JXLA 1JSAA 3HCMA 5D69A 4OCIA 2L2EA 2P6BB 1XFWO 2AMIA 2JPTA 2JT3A 2I7AA 1K90D 1AHRA 1M46A 3BUMB 2M1KB 2KYCA 3DF0A 3KO0A 4ETOA 3MSEB 3JVTC 2JC2A 1SCVA 4PCWA 1XVJA 5FYXA 3AKAA 2LVVA 2ZKMX 4D1EA 4R1EA 1BJFA 4OR9B 1OOJA 2L4IA 1E8AA 1YX7A 1CFPA 3JTDB 5CPVA 3CR2A 2BKIB 1F71A 5DKNA 2LLTA 1BOCA 2LVJA 4PDZA 1UUSA 3PM8A 2JQ6A 4GFTA 5JOLA 3IF7A 3KPXA 4XJKA 2BCBA 1EJ3A 1BR1B 4HRGA 1F70A 5HKWA 1NSHA 1XFXO 4A4CA 1H8BA 5B8IB 2LANA 2LMTA 2LHLA 3LK1A 4XYNA 2PVBA 3DVKA 1WRZA 1L2OC 1Y0VH 4GAOA 4C0LA 1MHOA 1SW8A 4NDDA 4PE4A 4HSZA 1QATA 2LVIA 2KFFA 4C0JA 3DVEA 1KQVA 4MEWA 2KI4B 2ZFDA 5G08A 2LCPA 4NQGA 3TDUA 3OX5A 3I5HC 3E3RA 4QJ3B 2JWWA 2M7LA 1CFFA 1B8RA 1PVAA 1DF0B 1JFKA 3GK1A 1GJYA 1S26D 4N5XA 2EGDA 1W7JB 3BQ3A 2K0JA 4M2OA 1SNLA 1S3PA 5I2OA 4MRYA 1KFUS 1BG1A 1EG3A 1KFUL 4NDCA 1A75B 3JVTB 1MXLC 2A4JA 4ORBB 1HT9A 3SG3A 4BY5A 2KBMA 4AQIA 4N1GA 4P5OE 1DJXA 1LKJA 1WLMA 1M31A 2E30A 2JU0A 2LLUA 3FWBA 3SIBA 5JJGA 3DVJA 1H4BA 1YRUB 5I2QA 1SR6B 2PALA 2WCFA 3D0YA 2F3ZA 2AAOA 3AKBA 4U8DA 1BF5A 2KBIA 3I5IB 2M97A 1SL7A 4GGFC 5TNCA 1CMFA 3FWCA 5CSJA 2LMUA 2ZRTA 1F8HA 4I5KA 1MUXA 2K7CA 3O78A 4ICBA 4E68A 3EK8A 3PATA 1L2OB 1PRWA 2KYFA 2TN4A 1EXRA 3LK0A 1BODA 1KK8C 4WRIA 3OB2B 1ALVA 1XK4C 2H61A 4DS7A 2KAVA 1QX5B 3CLNA 1F55A 4OVNF 3JTDC 4YI8A 4PE0A 1SL8A 1R6PA 1KFXS 1DJYA 2SASA 3K21A 3I5HB 1DVIA 1LVCD 2CT9A 2LP3A 1BR4B 4YGEB 1CFDA 3WXAA 3O2PA 1QIVA 1BU3A 3BUXB 1LA3A 1TRFA 1YUTA 2GV5A 4YGAA 1NCYA 2BBNA 2QPTA 1LXFC 4GPLB 4I5JA 5ER5A 2M3WA 4AQJA 4CPVA 5HYDA 4AOMA 2M7NA 3CGAA 1YURA 2DOQA 1N2DA 4L9MA 2D8NA 2JZIA 2Y1NA 2MLEC 3HX4A 1CTRA 1OSAA 1OMVA 1G33A 1QXPA 2KI4C 1L7ZA 1OMRA 1K93D 1QVIZ 4A4BA 1OZSA 3DVMA 1F4OA 2BBMA 4HREE 1WRLA 1WRKA 1MQ1A 3DD4A 3A4UB 2IS9A 1RWYA 3I5GB 3NSLA 1RJVA 3BXKA 3NSIA 4MVFA 2KDHA 3VRNA 2F3YA 1CDNA 3EKHA 1NX0A 2L0PA 5AEQA 1KK7Z 2MAZA 2MJWB 1QS7A 4MBEA 2LNKA 4QJ5B 4GUKA 2ZRSA 1KK8B 1NWDA 1N65A 1U5IA 1OMDA 1UHKA 1SR6C 1TNWA 2ZNDA 2WCBA 4YGDB 2E6WA 5I8NA 2LVKA 3QRXA 3I5IC 1QV1A 1KSMA 3A8RA 2NXQA 1OE9B 1A4PA 2H2KA 2NLNA 1F54A 1IH0A 1DJHA 3TZ1A 1XO5A 4DUQA 1IQ5A 1A2XA 2OTGC 1J7RA 3PALA 3PN7C 1QVIY 1K9KA 1QTXA 3FIAA 5AXIA 1HQVA 2M9GA 1DGUA 5HKZA 5HLOA 5PALA 2MBXA 5I2LA 2M1UA 2MRDA 1TTXA 2KFGA 1PULA 1S5GZ 2LHIA 1UHNA 2OPOA 1J1DA 1RTP1 1JC2A 5AERA 1UHJA 5K89A 1WDCC 4GGNA 2K8MB 2K2FA 1KK7Y 4CLNA 2O60A 2HPSA 4MZKA 4DRWA 4GNKB 3OP0A 2LC5A 1NUBA 3DF0B 1TNPA 2ZN9A 1KSOA 1SRAA 2LV7A 1YUSA 2JT0A 2AUCA 4MZJA 1SCMB 5HKYA 1NCXA 3BOWA 1TCOB 2MHHA 4NDBA 1XFZO 2PSRA 1B8LA 1N0YA 3ICBA 1XFYO 2LLSA 2LE9B 1Q80A 2HQWA 2JULA 1TN4A 2WORA 2FCDA 3TS5C 5CSNA 4FTGA 4XJKB 2HF5A 2JNFA 2MA2A 1KQMB 2PRUA 1NX2A 1EL4A 4BY4A 2M0RA 1PALA 1QASA 1YR5A 3H4SE 1S5GY 1MF8B 3CS1A 1CM4A 1SKTA 2WNDA 4ORCB 2NZ0A 1NCZA 2GGMA 3WHUB 3OB1B 1B47A 1PSBA 3KHEA 4QJ4B 2B1UA 4MLWA 2V53A 1V1GA 1ZFSA 2JT8A 3I5GC 3M0WA 5CSIA 2OTGB 3PN7B 1ZOTB 4CIDA 2H61C 1TCFA 4M2PA 1B1GA 1UWOA 1IJ6A 4JWQA 5CSFA 1TNQA 2F2OA 3EVUA 4PE7A 3EVRA 2JTTA 1IKUA 4ZCUA 1NPQA 2MLFC 3BUOB 2K7OA 1MXEA 2BECA 4GBAA 4PHNA 1CNPA 1LINA 1WDCB 1D1OA 2JOJA 3GOFA 1BMOA 2BE6A 3CZTX 1X02A 3OX6A 4PALA 1C7WA 1QJTA 2K2AA 2F33A 3SG2A 1DMOA 1S6JA 2L4HA 3RM1A 4YGBB 2JTZA 3D0YB 1CLMA 4USLA 1K96A 3I5FC 1KWOC 2COLB 1B4CA 2Y1MA 3TS5B 1YRTB 2NCOA 4N1FA 1AUIB 2LUCA 2I18A 2G9BA 2M8UA 1K2HA 1IGVA 1G4YR 1K9UA 2KAXA 2L98A 4M2QA 4MRXA 3TDZA 2CTNA 1FI6A 2KI6C 3O6BA 1IJ5A 4OV2A 2ZNEA 1AVSA 2LP2A 1SCMC 2LMVA 2KGBC 1QX7A 1AJ5A 1SK6D 3EKJA 2Y5IA 1A29A 1QX2A 3BUNB 4JPZB 3TDIA 1CLLA 1TIZA 3EK4A 1TNXA 1DJWA 3OHMB 1SBJA 1TOPA 2WCEA 5KSZA 2KFHA 2G2BA 1S1EA 1JF0A 4WQ3A 1B8CA 2I94A 1IRJA 2HETA 2Q91A 2EC6B 1A03A 3CTNA 1NX1A 1KQMC 2I2RE 1NIWA 2M29A 3SG7A 1V1FA 2WOSA 2KSPA 1K8UA 1IWQA 1SL9A 1XA5A 1DGVA 1B7TZ 1RECA 2NCPA 3EK7A 1SYMA 4JQ0D 2O5GA 2Y4QA 5AANA 1AJ4A 2BCXA 2RGIA 3D10A 3WNXB 1VRKA 3VRPA 2R2IA 2FOTA 1G8IA 1IG5A 1DF0A 1FF1A 1BT6A 3IQOA 1LA0A 1CDLA 4DCKA 3TUYC 2HQ8A 1YUUA 1DJZA 4YGCB 2Q4UA 2PMYA 2FJUB 1A75A 3CR5X 3EVVA 4MZLA 1CFCA 1RK9A 3I5FB 1KWOB 1NX3A 3ZWHA 1CMGA 1JFJA 1J1EA 1JBAA 4CFQA 1GGZA 1J7OA 3VRQA 3LL8B 5HLVA 1QV0A 2KHNA 2KI6D 2CBLA 2SCPA 3GK2A 2KQYA 1DJIA 3SJSA 1F4QA 3PSRA 3SG6A 1S6CA 1M63B 4MSPA 1JF2A 4C0KA 1CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLQ A;  1RFJ A;  1B7T Y;  1SPY A;  1R2U A;  1M39 A;  2KOT A;  1B9A A;  5DKQ A;  1U5I B;  1GGW A;  2K7D A;  4ZCV A;  4YI9 A;  2OS8 C;  1UHH A;  5D7F A;  5GQQ C;  2LUX A;  4PHJ A;  1WLZ A;  2BL0 B;  3SG5 A;  1CM1 A;  3SIA A;  2BCA A;  1AK8 A;  4YRU A;  1C7V A;  4YBH B;  2L50 A;  1MWN A;  1EG4 A;  2ISD A;  1RRO A;  5F6T A;  1XFV O;  1FPW A;  1DJG A;  1UHI A;  1M45 A;  2CNP A;  3NXA A;  5KTY A;  1NP8 A;  3NSO A;  2KAY A;  1K94 A;  1JWD A;  2VRG A;  3C1V A;  4TNC A;  4I5L B;  2JXC A;  1AP4 A;  2F2P A;  1DTL A;  3TUY B;  3F45 A;  3O4Y A;  3WHT B;  1GQM A;  2K61 A;  4DIR A;  3FS7 A;  1S6I A;  2KNE A;  4PHK A;  1C07 A;  2EC6 C;  2JRF A;  1J7P A;  1XYD A;  1J7Q A;  1CDM A;  3AAJ A;  4PE1 A;  3VRR A;  2LAP A;  3RLZ A;  1W7I B;  3ZNI A;  4I5N B;  1OQP A;  3BOW B;  3VRO A;  2KQ6 A;  2BE4 A;  1FI5 A;  4HRH A;  2EHB A;  2PAS A;  3PFV A;  3PLF B;  3GK4 X;  1YX8 A;  4GGF A;  1WY9 A;  1DT7 B;  1UUR A;  3LCP C;  2CCM A;  1PK0 D;  3BYA A;  4P2Y B;  2JNX A;  2L51 A;  1UP5 A;  5J3X A;  3CR4 X;  2OS8 B;  1ZMZ A;  1YVL A;  3AAK A;  1FW4 A;  3BUW B;  1PVB A;  1J55 A;  4MN0 A;  1KFX L;  1FBV A;  1CB1 A;  3NSK A;  4ORA B;  5AFP A;  1XFU O;  3IQQ A;  1XK4 A;  5KU1 A;  3KEV A;  2LM5 A;  1YVH A;  1MR8 A;  1ZUZ A;  1ODB A;  4WQ2 A;  4F0Z B;  2M49 B;  4FQO A;  3VGO A;  2CXJ A;  4CFR A;  1K9P A;  1JUO A;  1SMG A;  1CKK A;  1CDP A;  3LLE A;  2ZN8 A;  1K95 A;  1IQ3 A;  1QLS A;  1Y1X A;  3KF9 A;  4Q04 A;  2GGZ A;  2KGR A;  4PHM A;  4OKH A;  2QAC A;  5BPJ A;  1YTZ C;  3CWG A;  1OZO A;  1S36 A;  1ALW A;  2K7B A;  2WC8 A;  1SY9 A;  2FCE A;  1ZAC A;  1EH2 A;  2BL0 C;  5DKR A;  2F8P A;  5IBW A;  2L5X B;  1QLK A;  1Y6W A;  2BKH B;  1Y1A A;  4IL1 A;  3SG4 A;  1PSR A;  1Y1U A;  5ER4 X;  1QIW A;  4UPG A;  1NYA A;  1KCY A;  2JXL A;  1JSA A;  3HCM A;  5D69 A;  4OCI A;  2L2E A;  2P6B B;  1XFW O;  2AMI A;  2JPT A;  2JT3 A;  2I7A A;  1K90 D;  1AHR A;  1M46 A;  3BUM B;  2M1K B;  2KYC A;  3DF0 A;  3KO0 A;  4ETO A;  3MSE B;  3JVT C;  2JC2 A;  1SCV A;  4PCW A;  1XVJ A;  5FYX A;  3AKA A;  2LVV A;  2ZKM X;  4D1E A;  4R1E A;  1BJF A;  4OR9 B;  1OOJ A;  2L4I A;  1E8A A;  1YX7 A;  1CFP A;  3JTD B;  5CPV A;  3CR2 A;  2BKI B;  1F71 A;  5DKN A;  2LLT A;  1BOC A;  2LVJ A;  4PDZ A;  1UUS A;  3PM8 A;  2JQ6 A;  4GFT A;  5JOL A;  3IF7 A;  3KPX A;  4XJK A;  2BCB A;  1EJ3 A;  1BR1 B;  4HRG A;  1F70 A;  5HKW A;  1NSH A;  1XFX O;  4A4C A;  1H8B A;  5B8I B;  2LAN A;  2LMT A;  2LHL A;  3LK1 A;  4XYN A;  2PVB A;  3DVK A;  1WRZ A;  1L2O C;  1Y0V H;  4GAO A;  4C0L A;  1MHO A;  1SW8 A;  4NDD A;  4PE4 A;  4HSZ A;  1QAT A;  2LVI A;  2KFF A;  4C0J A;  3DVE A;  1KQV A;  4MEW A;  2KI4 B;  2ZFD A;  5G08 A;  2LCP A;  4NQG A;  3TDU A;  3OX5 A;  3I5H C;  3E3R A;  4QJ3 B;  2JWW A;  2M7L A;  1CFF A;  1B8R A;  1PVA A;  1DF0 B;  1JFK A;  3GK1 A;  1GJY A;  1S26 D;  4N5X A;  2EGD A;  1W7J B;  3BQ3 A;  2K0J A;  4M2O A;  1SNL A;  1S3P A;  5I2O A;  4MRY A;  1KFU S;  1BG1 A;  1EG3 A;  1KFU L;  4NDC A;  1A75 B;  3JVT B;  1MXL C;  2A4J A;  4ORB B;  1HT9 A;  3SG3 A;  4BY5 A;  2KBM A;  4AQI A;  4N1G A;  4P5O E;  1DJX A;  1LKJ A;  1WLM A;  1M31 A;  2E30 A;  2JU0 A;  2LLU A;  3FWB A;  3SIB A;  5JJG A;  3DVJ A;  1H4B A;  1YRU B;  5I2Q A;  1SR6 B;  2PAL A;  2WCF A;  3D0Y A;  2F3Z A;  2AAO A;  3AKB A;  4U8D A;  1BF5 A;  2KBI A;  3I5I B;  2M97 A;  1SL7 A;  4GGF C;  5TNC A;  1CMF A;  3FWC A;  5CSJ A;  2LMU A;  2ZRT A;  1F8H A;  4I5K A;  1MUX A;  2K7C A;  3O78 A;  4ICB A;  4E68 A;  3EK8 A;  3PAT A;  1L2O B;  1PRW A;  2KYF A;  2TN4 A;  1EXR A;  3LK0 A;  1BOD A;  1KK8 C;  4WRI A;  3OB2 B;  1ALV A;  1XK4 C;  2H61 A;  4DS7 A;  2KAV A;  1QX5 B;  3CLN A;  1F55 A;  4OVN F;  3JTD C;  4YI8 A;  4PE0 A;  1SL8 A;  1R6P A;  1KFX S;  1DJY A;  2SAS A;  3K21 A;  3I5H B;  1DVI A;  1LVC D;  2CT9 A;  2LP3 A;  1BR4 B;  4YGE B;  1CFD A;  3WXA A;  3O2P A;  1QIV A;  1BU3 A;  3BUX B;  1LA3 A;  1TRF A;  1YUT A;  2GV5 A;  4YGA A;  1NCY A;  2BBN A;  2QPT A;  1LXF C;  4GPL B;  4I5J A;  5ER5 A;  2M3W A;  4AQJ A;  4CPV A;  5HYD A;  4AOM A;  2M7N A;  3CGA A;  1YUR A;  2DOQ A;  1N2D A;  4L9M A;  2D8N A;  2JZI A;  2Y1N A;  2MLE C;  3HX4 A;  1CTR A;  1OSA A;  1OMV A;  1G33 A;  1QXP A;  2KI4 C;  1L7Z A;  1OMR A;  1K93 D;  1QVI Z;  4A4B A;  1OZS A;  3DVM A;  1F4O A;  2BBM A;  4HRE E;  1WRL A;  1WRK A;  1MQ1 A;  3DD4 A;  3A4U B;  2IS9 A;  1RWY A;  3I5G B;  3NSL A;  1RJV A;  3BXK A;  3NSI A;  4MVF A;  2KDH A;  3VRN A;  2F3Y A;  1CDN A;  3EKH A;  1NX0 A;  2L0P A;  5AEQ A;  1KK7 Z;  2MAZ A;  2MJW B;  1QS7 A;  4MBE A;  2LNK A;  4QJ5 B;  4GUK A;  2ZRS A;  1KK8 B;  1NWD A;  1N65 A;  1U5I A;  1OMD A;  1UHK A;  1SR6 C;  1TNW A;  2ZND A;  2WCB A;  4YGD B;  2E6W A;  5I8N A;  2LVK A;  3QRX A;  3I5I C;  1QV1 A;  1KSM A;  3A8R A;  2NXQ A;  1OE9 B;  1A4P A;  2H2K A;  2NLN A;  1F54 A;  1IH0 A;  1DJH A;  3TZ1 A;  1XO5 A;  4DUQ A;  1IQ5 A;  1A2X A;  2OTG C;  1J7R A;  3PAL A;  3PN7 C;  1QVI Y;  1K9K A;  1QTX A;  3FIA A;  5AXI A;  1HQV A;  2M9G A;  1DGU A;  5HKZ A;  5HLO A;  5PAL A;  2MBX A;  5I2L A;  2M1U A;  2MRD A;  1TTX A;  2KFG A;  1PUL A;  1S5G Z;  2LHI A;  1UHN A;  2OPO A;  1J1D A;  1RTP 1;  1JC2 A;  5AER A;  1UHJ A;  5K89 A;  1WDC C;  4GGN A;  2K8M B;  2K2F A;  1KK7 Y;  4CLN A;  2O60 A;  2HPS A;  4MZK A;  4DRW A;  4GNK B;  3OP0 A;  2LC5 A;  1NUB A;  3DF0 B;  1TNP A;  2ZN9 A;  1KSO A;  1SRA A;  2LV7 A;  1YUS A;  2JT0 A;  2AUC A;  4MZJ A;  1SCM B;  5HKY A;  1NCX A;  3BOW A;  1TCO B;  2MHH A;  4NDB A;  1XFZ O;  2PSR A;  1B8L A;  1N0Y A;  3ICB A;  1XFY O;  2LLS A;  2LE9 B;  1Q80 A;  2HQW A;  2JUL A;  1TN4 A;  2WOR A;  2FCD A;  3TS5 C;  5CSN A;  4FTG A;  4XJK B;  2HF5 A;  2JNF A;  2MA2 A;  1KQM B;  2PRU A;  1NX2 A;  1EL4 A;  4BY4 A;  2M0R A;  1PAL A;  1QAS A;  1YR5 A;  3H4S E;  1S5G Y;  1MF8 B;  3CS1 A;  1CM4 A;  1SKT A;  2WND A;  4ORC B;  2NZ0 A;  1NCZ A;  2GGM A;  3WHU B;  3OB1 B;  1B47 A;  1PSB A;  3KHE A;  4QJ4 B;  2B1U A;  4MLW A;  2V53 A;  1V1G A;  1ZFS A;  2JT8 A;  3I5G C;  3M0W A;  5CSI A;  2OTG B;  3PN7 B;  1ZOT B;  4CID A;  2H61 C;  1TCF A;  4M2P A;  1B1G A;  1UWO A;  1IJ6 A;  4JWQ A;  5CSF A;  1TNQ A;  2F2O A;  3EVU A;  4PE7 A;  3EVR A;  2JTT A;  1IKU A;  4ZCU A;  1NPQ A;  2MLF C;  3BUO B;  2K7O A;  1MXE A;  2BEC A;  4GBA A;  4PHN A;  1CNP A;  1LIN A;  1WDC B;  1D1O A;  2JOJ A;  3GOF A;  1BMO A;  2BE6 A;  3CZT X;  1X02 A;  3OX6 A;  4PAL A;  1C7W A;  1QJT A;  2K2A A;  2F33 A;  3SG2 A;  1DMO A;  1S6J A;  2L4H A;  3RM1 A;  4YGB B;  2JTZ A;  3D0Y B;  1CLM A;  4USL A;  1K96 A;  3I5F C;  1KWO C;  2COL B;  1B4C A;  2Y1M A;  3TS5 B;  1YRT B;  2NCO A;  4N1F A;  1AUI B;  2LUC A;  2I18 A;  2G9B A;  2M8U A;  1K2H A;  1IGV A;  1G4Y R;  1K9U A;  2KAX A;  2L98 A;  4M2Q A;  4MRX A;  3TDZ A;  2CTN A;  1FI6 A;  2KI6 C;  3O6B A;  1IJ5 A;  4OV2 A;  2ZNE A;  1AVS A;  2LP2 A;  1SCM C;  2LMV A;  2KGB C;  1QX7 A;  1AJ5 A;  1SK6 D;  3EKJ A;  2Y5I A;  1A29 A;  1QX2 A;  3BUN B;  4JPZ B;  3TDI A;  1CLL A;  1TIZ A;  3EK4 A;  1TNX A;  1DJW A;  3OHM B;  1SBJ A;  1TOP A;  2WCE A;  5KSZ A;  2KFH A;  2G2B A;  1S1E A;  1JF0 A;  4WQ3 A;  1B8C A;  2I94 A;  1IRJ A;  2HET A;  2Q91 A;  2EC6 B;  1A03 A;  3CTN A;  1NX1 A;  1KQM C;  2I2R E;  1NIW A;  2M29 A;  3SG7 A;  1V1F A;  2WOS A;  2KSP A;  1K8U A;  1IWQ A;  1SL9 A;  1XA5 A;  1DGV A;  1B7T Z;  1REC A;  2NCP A;  3EK7 A;  1SYM A;  4JQ0 D;  2O5G A;  2Y4Q A;  5AAN A;  1AJ4 A;  2BCX A;  2RGI A;  3D10 A;  3WNX B;  1VRK A;  3VRP A;  2R2I A;  2FOT A;  1G8I A;  1IG5 A;  1DF0 A;  1FF1 A;  1BT6 A;  3IQO A;  1LA0 A;  1CDL A;  4DCK A;  3TUY C;  2HQ8 A;  1YUU A;  1DJZ A;  4YGC B;  2Q4U A;  2PMY A;  2FJU B;  1A75 A;  3CR5 X;  3EVV A;  4MZL A;  1CFC A;  1RK9 A;  3I5F B;  1KWO B;  1NX3 A;  3ZWH A;  1CMG A;  1JFJ A;  1J1E A;  1JBA A;  4CFQ A;  1GGZ A;  1J7O A;  3VRQ A;  3LL8 B;  5HLV A;  1QV0 A;  2KHN A;  2KI6 D;  2CBL A;  2SCP A;  3GK2 A;  2KQY A;  1DJI A;  3SJS A;  1F4Q A;  3PSR A;  3SG6 A;  1S6C A;  1M63 B;  4MSP A;  1JF2 A;  4C0K A;  1CLB A; 
#chains in the Genus database with same CATH topology
 1BLQ A;  1RFJ A;  1B7T Y;  1SPY A;  1R2U A;  1M39 A;  2KOT A;  1B9A A;  2QEO A;  5DKQ A;  1TUZ A;  1U5I B;  3B6X A;  2K7D A;  1GGW A;  4ZCV A;  4YI9 A;  2OS8 C;  1UHH A;  5D7F A;  5GQQ C;  2LUX A;  4PHJ A;  3NGV A;  3R1O A;  1WLZ A;  2BL0 B;  3SG5 A;  3L4A A;  3DXL A;  1CM1 A;  3SIA A;  2BCA A;  1AK8 A;  4YRU A;  1C7V A;  4YBH B;  2L50 A;  1MWN A;  1EG4 A;  2ISD A;  1RRO A;  5F6T A;  1SSE B;  1XFV O;  1FPW A;  1DJG A;  1UHI A;  1M45 A;  2CNP A;  3NXA A;  1IIO A;  5KTY A;  2KPH A;  1NP8 A;  3NSO A;  2KAY A;  1K94 A;  1JWD A;  2VRG A;  3C1V A;  2PYQ A;  4TNC A;  2L5Y A;  4I5L B;  2JXC A;  2YGU A;  1AP4 A;  2F2P A;  1DTL A;  3TUY B;  3F45 A;  3O4Y A;  3WHT B;  1GQM A;  2K61 A;  3BFH A;  4DIR A;  3FS7 A;  1S6I A;  2KNE A;  4PHK A;  1C07 A;  2EC6 C;  2JRF A;  1J7P A;  1XYD A;  1J7Q A;  1CDM A;  3AAJ A;  4PE1 A;  4INX A;  2PQL A;  3VRR A;  2LAP A;  3CZ1 A;  3RLZ A;  1W7I B;  3ZNI A;  4I5N B;  3B87 A;  1OQP A;  3BOW B;  3VRO A;  2KQ6 A;  2BE4 A;  1FI5 A;  3B88 A;  4HRH A;  3SS3 A;  2EHB A;  2PAS A;  3PFV A;  3PLF B;  3GK4 X;  3V2L A;  1T14 A;  1YX8 A;  1DEL A;  1WY9 A;  3R1P A;  4GGF A;  1UUR A;  1DT7 B;  3LCP C;  2CCM A;  1PK0 D;  2ERB A;  3BYA A;  4P2Y B;  2JNX A;  2L51 A;  1UP5 A;  5J3X A;  3CR4 X;  2OS8 B;  1ZMZ A;  1YVL A;  3AAK A;  1FW4 A;  3SS4 A;  3BUW B;  1PVB A;  1J55 A;  4MN0 A;  5DIC A;  1KFX L;  2QEB A;  1FBV A;  1CB1 A;  3NSK A;  4ORA B;  5AFP A;  1XFU O;  3IQQ A;  1XK4 A;  5KU1 A;  3KEV A;  2LM5 A;  1YVH A;  1MR8 A;  1ZUZ A;  1ODB A;  4WQ2 A;  4F0Z B;  2M49 B;  3BFA A;  3O4X A;  4FQO A;  3VGO A;  2CXJ A;  4CFR A;  1K9P A;  1C3Z A;  4JKT A;  1JUO A;  1SMG A;  1CKK A;  1CDP A;  3LLE A;  2ZN8 A;  1K95 A;  1IQ3 A;  1QLS A;  1Y1X A;  3KF9 A;  4Q04 A;  2GGZ A;  2KGR A;  4PHM A;  4OKH A;  2QAC A;  3OGN A;  2JPO A;  1YTZ C;  3CWG A;  1OZO A;  5BPJ A;  1S36 A;  1ALW A;  2K7B A;  2WC8 A;  1SY9 A;  2WCL A;  2FCE A;  1ZAC A;  1EH2 A;  2BL0 C;  2K60 A;  2F8P A;  5DKR A;  5IBW A;  2L5X B;  1QLK A;  1Y6W A;  2BAP A;  2BKH B;  3IVT A;  1Y1A A;  4IL1 A;  3SG4 A;  1PSR A;  3UNW A;  1Y1U A;  5ER4 X;  1QIW A;  4KYN A;  4UPG A;  1NYA A;  1KCY A;  2JXL A;  4INW A;  1JSA A;  3HCM A;  5D69 A;  4OCI A;  2L2E A;  1TUJ A;  2P6B B;  5I94 A;  1XFW O;  2AMI A;  2JPT A;  2JT3 A;  2I7A A;  1K90 D;  1AHR A;  1M46 A;  3BUM B;  2M1K B;  2KYC A;  3DF0 A;  3KO0 A;  2QDI A;  3UO9 A;  4ETO A;  3MSE B;  3JVT C;  2JC2 A;  1SCV A;  4PCW A;  1XVJ A;  5FYX A;  3AKA A;  2LVV A;  2ZKM X;  4D1E A;  1DC1 A;  4R1E A;  1BJF A;  4OR9 B;  1OOJ A;  2L4I A;  1E8A A;  1YX7 A;  1CFP A;  3JTD B;  5CPV A;  3CR2 A;  2BKI B;  1F71 A;  5DKN A;  2LLT A;  1BOC A;  2LVJ A;  4PDZ A;  1UUS A;  3PM8 A;  2JQ6 A;  1OOG A;  4GFT A;  5JOL A;  3IF7 A;  3KPX A;  4XJK A;  5FI7 A;  2BCB A;  2P70 A;  1EJ3 A;  1BR1 B;  4HRG A;  3RZS A;  5HKW A;  1F70 A;  1NSH A;  1XFX O;  4A4C A;  1H8B A;  5B8I B;  2LAN A;  2LMT A;  2LHL A;  3LK1 A;  4IJ7 A;  4XYN A;  2PVB A;  3DVK A;  1WRZ A;  1L2O C;  1Y0V H;  4GAO A;  4C0L A;  1MHO A;  1SW8 A;  4NDD A;  4PE4 A;  4HSZ A;  1QAT A;  2LVI A;  2KFF A;  4C0J A;  3DVE A;  1KQV A;  4MEW A;  3OBV A;  2KI4 B;  2ZFD A;  5G08 A;  2KLE A;  3D77 A;  2LCP A;  4NQG A;  3TDU A;  3OX5 A;  3I5H C;  3E3R A;  4QJ3 B;  2JWW A;  2M7L A;  1CFF A;  1B8R A;  1PVA A;  1DF0 B;  1JFK A;  3GK1 A;  1GJY A;  1S26 D;  3B86 A;  4N5X A;  4PT1 A;  2EGD A;  1W7J B;  3BQ3 A;  2K0J A;  3FE8 A;  4M2O A;  1SNL A;  1S3P A;  5I2O A;  4MRY A;  1KFU S;  1BG1 A;  1EG3 A;  1KFU L;  2H8V A;  4NDC A;  1A75 B;  2WC6 A;  3Q8I A;  3JVT B;  1MXL C;  2A4J A;  4ORB B;  1HT9 A;  3SG3 A;  4BY5 A;  2KBM A;  4AQI A;  4N1G A;  4P5O E;  1DJX A;  1LKJ A;  1WLM A;  1M31 A;  2E30 A;  2JU0 A;  2LLU A;  3FWB A;  3SIB A;  5JJG A;  3DVJ A;  1H4B A;  3B7A A;  1YRU B;  2WCJ A;  5I2Q A;  3D76 A;  1SR6 B;  2PAL A;  2WCF A;  3D0Y A;  2F3Z A;  2AAO A;  3AKB A;  4U8D A;  1BF5 A;  2KBI A;  3I5I B;  2M97 A;  1SL7 A;  4GGF C;  5TNC A;  1CMF A;  1Z2C B;  1C3Y A;  3S0E A;  2GTE A;  3FWC A;  5CSJ A;  2LMU A;  2ZRT A;  1F8H A;  4I5K A;  1MUX A;  2K7C A;  3O78 A;  4ICB A;  4E68 A;  3D78 A;  4JD9 A;  3S0B A;  3EK8 A;  3PAT A;  2FJY A;  1L2O B;  1PRW A;  2KYF A;  2TN4 A;  1EXR A;  3LK0 A;  4F7F A;  1BOD A;  1KK8 C;  4WRI A;  3OB2 B;  1ALV A;  1XK4 C;  2H61 A;  4DS7 A;  2KAV A;  1QX5 B;  3CLN A;  1F55 A;  4OVN F;  3JTD C;  4YI8 A;  4PE0 A;  1SL8 A;  1R6P A;  1KFX S;  1DJY A;  2SAS A;  3K21 A;  3I5H B;  1DVI A;  1LVC D;  2CT9 A;  2LP3 A;  1BR4 B;  4YGE B;  1CFD A;  3WXA A;  3O2P A;  1QIV A;  1BU3 A;  3BUX B;  1LA3 A;  1TRF A;  1YUT A;  2GV5 A;  4YGA A;  1NCY A;  2BBN A;  2QPT A;  1LXF C;  4GPL B;  4I5J A;  5ER5 A;  2M3W A;  4AQJ A;  3CAB A;  4CPV A;  5HYD A;  4AOM A;  2M7N A;  2WCM A;  3CGA A;  1YUR A;  1DEK A;  1N2D A;  2DOQ A;  4L9M A;  2D8N A;  2JZI A;  2Y1N A;  4OZD A;  2MLE C;  3HX4 A;  1CTR A;  1OSA A;  1OMV A;  1G33 A;  1QXP A;  2KI4 C;  1L7Z A;  1ORG A;  1OMR A;  3R1V A;  1K93 D;  1QVI Z;  4A4B A;  3R72 A;  1OZS A;  3DVM A;  1F4O A;  1OW4 A;  2BBM A;  1GM0 A;  4HRE E;  1WRL A;  1WRK A;  1MQ1 A;  3DD4 A;  3A4U B;  1TWO A;  2IS9 A;  1RWY A;  3I5G B;  3NSL A;  1RJV A;  3NHT A;  3BXK A;  3NSI A;  4MVF A;  2KDH A;  3VRN A;  2F3Y A;  1CDN A;  3EKH A;  1NX0 A;  2L0P A;  5AEQ A;  1KK7 Z;  2MAZ A;  2KLD A;  2MJW B;  1QS7 A;  4MBE A;  2LNK A;  4QJ5 B;  4GUK A;  2ZRS A;  1KK8 B;  1NWD A;  1N65 A;  1U5I A;  1OMD A;  1UHK A;  1SR6 C;  1TNW A;  2ZND A;  2WCB A;  4YGD B;  3S0F A;  1OOI X;  2E6W A;  5I8N A;  2LVK A;  3QRX A;  2QEV A;  3I5I C;  1QV1 A;  1KSM A;  3PJI A;  3A8R A;  2NXQ A;  1OE9 B;  1A4P A;  2H2K A;  3L47 A;  2NLN A;  1F54 A;  1IH0 A;  1DJH A;  1Z4H A;  3TZ1 A;  1XO5 A;  4DUQ A;  1IQ5 A;  1A2X A;  2OTG C;  1J7R A;  3PAL A;  3PN7 C;  1QVI Y;  1QWV A;  1K9K A;  1QTX A;  3FIA A;  5AXI A;  1HQV A;  2M9G A;  1DGU A;  5HKZ A;  5HLO A;  5PAL A;  2MBX A;  5I2L A;  2M1U A;  2MRD A;  1TTX A;  3DYE A;  2KFG A;  5HL1 A;  1PUL A;  1S5G Z;  2LHI A;  1UHN A;  2OPO A;  1J1D A;  1RTP 1;  1XFR A;  5AER A;  1JC2 A;  1UHJ A;  3CZ0 A;  5K89 A;  1WDC C;  4GGN A;  2K8M B;  2K2F A;  1KK7 Y;  4CLN A;  2O60 A;  1P28 A;  2HPS A;  4MZK A;  4GNK B;  4DRW A;  3OP0 A;  2LC5 A;  1NUB A;  3BFB A;  3DF0 B;  3D75 A;  3CZ2 A;  1TNP A;  2ZN9 A;  1KSO A;  1SRA A;  2LV7 A;  1YUS A;  3BJH A;  2JT0 A;  3VB1 A;  2AUC A;  4MZJ A;  1SCM B;  5HKY A;  1NCX A;  3BOW A;  1LS8 A;  3K1E A;  2P71 A;  1TCO B;  2MHH A;  3QME A;  4NDB A;  1XFZ O;  2PSR A;  1B8L A;  1N0Y A;  5EL2 A;  5FI2 A;  3ICB A;  1XFY O;  2LLS A;  2LE9 B;  1Q80 A;  2HQW A;  2JUL A;  1TN4 A;  2WOR A;  2FCD A;  3TS5 C;  5CSN A;  4FTG A;  4XJK B;  2HF5 A;  2JNF A;  2MA2 A;  1KQM B;  2PRU A;  1NX2 A;  1EL4 A;  1DQE A;  4BY4 A;  2WCK A;  2M0R A;  1PAL A;  1QAS A;  1YR5 A;  3H4S E;  1S5G Y;  1MF8 B;  3CS1 A;  1CM4 A;  1SKT A;  2WND A;  4ORC B;  3CYZ A;  2NZ0 A;  1NCZ A;  2GGM A;  3D73 A;  3WHU B;  3OB1 B;  1B47 A;  1PSB A;  3KHE A;  4QJ4 B;  2B1U A;  4MLW A;  2V53 A;  1V1G A;  1ZFS A;  2JT8 A;  3I5G C;  3M0W A;  5CSI A;  5D3O A;  2OTG B;  3PN7 B;  1ZOT B;  4CID A;  2H61 C;  1TCF A;  4M2P A;  3FE6 A;  1B1G A;  3FE9 A;  1UWO A;  1IJ6 A;  4JWQ A;  3EG5 B;  5CSF A;  1TNQ A;  2F2O A;  3EVU A;  4PE7 A;  3EVR A;  3S0G A;  2JTT A;  1IKU A;  4ZCU A;  1NPQ A;  2MLF C;  3BUO B;  2K7O A;  1MXE A;  2BEC A;  4GBA A;  4PHN A;  1CNP A;  1LIN A;  1WDC B;  1D1O A;  2JOJ A;  3GOF A;  1BMO A;  1W9Z A;  2BE6 A;  3CZT X;  1X02 A;  3OX6 A;  4PAL A;  1C7W A;  1QJT A;  4FQT A;  2K2A A;  2F33 A;  3SG2 A;  1DMO A;  1S6J A;  2L4H A;  3RM1 A;  4YGB B;  3DY9 A;  2JTZ A;  3D0Y B;  1CLM A;  1OOH A;  4USL A;  1K96 A;  3I5F C;  3CDN A;  1KWO C;  2COL B;  3L4L A;  1B4C A;  2Y1M A;  3TS5 B;  1YRT B;  2NCO A;  2QEH A;  4N1F A;  1AUI B;  2LUC A;  2I18 A;  3S0A A;  2G9B A;  3D74 A;  2M8U A;  1K2H A;  1IGV A;  1G4Y R;  1K9U A;  2KAX A;  2L98 A;  4M2Q A;  4MRX A;  3TDZ A;  2CTN A;  1FI6 A;  3N7H A;  2KI6 C;  3O6B A;  1IJ5 A;  4OV2 A;  2ZNE A;  1AVS A;  2LP2 A;  1SCM C;  2LMV A;  2KGB C;  1QX7 A;  1AJ5 A;  1SK6 D;  3EKJ A;  2Y5I A;  3DZT A;  1A29 A;  1QX2 A;  3BUN B;  4JPZ B;  3TDI A;  1CLL A;  1TIZ A;  3EK4 A;  1TNX A;  1DJW A;  3OHM B;  1SBJ A;  1TOP A;  2WCE A;  5KSZ A;  2KFH A;  2G2B A;  1S1E A;  1JF0 A;  4WQ3 A;  1B8C A;  2WC5 A;  2I94 A;  1IRJ A;  2HET A;  2Q91 A;  3PM2 A;  2EC6 B;  1A03 A;  3CTN A;  1NX1 A;  1KQM C;  2I2R E;  1NIW A;  2M29 A;  2BNX A;  3SG7 A;  1V1F A;  2WOS A;  2KSP A;  1K8U A;  1IWQ A;  1SL9 A;  1XA5 A;  1DGV A;  1B7T Z;  1REC A;  2NCP A;  2L2C A;  1SYM A;  3EK7 A;  2O5G A;  2Y4Q A;  4JQ0 D;  5AAN A;  1AJ4 A;  2BCX A;  2RGI A;  3D10 A;  3WNX B;  1VRK A;  3VRP A;  2R2I A;  2WCH A;  2FOT A;  1G8I A;  1IG5 A;  1DF0 A;  1FF1 A;  1BT6 A;  3IQO A;  1LA0 A;  1CDL A;  3NHI A;  4DCK A;  3TUY C;  2HQ8 A;  1YUU A;  1DJZ A;  4YGC B;  3S0D A;  2Q4U A;  2PMY A;  2FJU B;  1A75 A;  3CR5 X;  3EVV A;  4MZL A;  1CFC A;  1RK9 A;  3I5F B;  1KWO B;  5FI6 A;  1NX3 A;  3ZWH A;  1CMG A;  1JFJ A;  1J1E A;  1JBA A;  3SS5 A;  4CFQ A;  1GGZ A;  1J7O A;  3VRQ A;  3LL8 B;  5HLV A;  1QV0 A;  2KHN A;  2KI6 D;  2CBL A;  2SCP A;  3GK2 A;  2KQY A;  1DJI A;  3SJS A;  1F4Q A;  1OOF A;  3PSR A;  3SG6 A;  1S6C A;  1M63 B;  4MSP A;  1JF2 A;  4C0K A;  1CLB A; 
#chains in the Genus database with same CATH homology
 1BLQ A;  1RFJ A;  1B7T Y;  1SPY A;  1R2U A;  1M39 A;  2KOT A;  1B9A A;  5DKQ A;  1U5I B;  1GGW A;  2K7D A;  4ZCV A;  4YI9 A;  2OS8 C;  1UHH A;  5D7F A;  5GQQ C;  2LUX A;  4PHJ A;  1WLZ A;  2BL0 B;  3SG5 A;  1CM1 A;  3SIA A;  2BCA A;  1AK8 A;  4YRU A;  1C7V A;  4YBH B;  2L50 A;  1MWN A;  1EG4 A;  2ISD A;  1RRO A;  5F6T A;  1XFV O;  1FPW A;  1DJG A;  1UHI A;  1M45 A;  2CNP A;  3NXA A;  5KTY A;  1NP8 A;  3NSO A;  2KAY A;  1K94 A;  1JWD A;  2VRG A;  3C1V A;  4TNC A;  4I5L B;  2JXC A;  1AP4 A;  2F2P A;  1DTL A;  3TUY B;  3F45 A;  3O4Y A;  3WHT B;  1GQM A;  2K61 A;  4DIR A;  3FS7 A;  1S6I A;  2KNE A;  4PHK A;  1C07 A;  2EC6 C;  2JRF A;  1J7P A;  1XYD A;  1J7Q A;  1CDM A;  3AAJ A;  4PE1 A;  3VRR A;  2LAP A;  3RLZ A;  1W7I B;  3ZNI A;  4I5N B;  1OQP A;  3BOW B;  3VRO A;  2KQ6 A;  2BE4 A;  1FI5 A;  4HRH A;  2EHB A;  2PAS A;  3PFV A;  3PLF B;  3GK4 X;  1YX8 A;  4GGF A;  1WY9 A;  1DT7 B;  1UUR A;  3LCP C;  2CCM A;  1PK0 D;  3BYA A;  4P2Y B;  2JNX A;  2L51 A;  1UP5 A;  5J3X A;  3CR4 X;  2OS8 B;  1ZMZ A;  1YVL A;  3AAK A;  1FW4 A;  3BUW B;  1PVB A;  1J55 A;  4MN0 A;  1KFX L;  1FBV A;  1CB1 A;  3NSK A;  4ORA B;  5AFP A;  1XFU O;  3IQQ A;  1XK4 A;  5KU1 A;  3KEV A;  2LM5 A;  1YVH A;  1MR8 A;  1ZUZ A;  1ODB A;  4WQ2 A;  4F0Z B;  2M49 B;  4FQO A;  3VGO A;  2CXJ A;  4CFR A;  1K9P A;  1JUO A;  1SMG A;  1CKK A;  1CDP A;  3LLE A;  2ZN8 A;  1K95 A;  1IQ3 A;  1QLS A;  1Y1X A;  3KF9 A;  4Q04 A;  2GGZ A;  2KGR A;  4PHM A;  4OKH A;  2QAC A;  5BPJ A;  1YTZ C;  3CWG A;  1OZO A;  1S36 A;  1ALW A;  2K7B A;  2WC8 A;  1SY9 A;  2FCE A;  1ZAC A;  1EH2 A;  2BL0 C;  5DKR A;  2F8P A;  5IBW A;  2L5X B;  1QLK A;  1Y6W A;  2BKH B;  1Y1A A;  4IL1 A;  3SG4 A;  1PSR A;  1Y1U A;  5ER4 X;  1QIW A;  4UPG A;  1NYA A;  1KCY A;  2JXL A;  1JSA A;  3HCM A;  5D69 A;  4OCI A;  2L2E A;  2P6B B;  1XFW O;  2AMI A;  2JPT A;  2JT3 A;  2I7A A;  1K90 D;  1AHR A;  1M46 A;  3BUM B;  2M1K B;  2KYC A;  3DF0 A;  3KO0 A;  4ETO A;  3MSE B;  3JVT C;  2JC2 A;  1SCV A;  4PCW A;  1XVJ A;  5FYX A;  3AKA A;  2LVV A;  2ZKM X;  4D1E A;  4R1E A;  1BJF A;  4OR9 B;  1OOJ A;  2L4I A;  1E8A A;  1YX7 A;  1CFP A;  3JTD B;  5CPV A;  3CR2 A;  2BKI B;  1F71 A;  5DKN A;  2LLT A;  1BOC A;  2LVJ A;  4PDZ A;  1UUS A;  3PM8 A;  2JQ6 A;  4GFT A;  5JOL A;  3IF7 A;  3KPX A;  4XJK A;  2BCB A;  1EJ3 A;  1BR1 B;  4HRG A;  1F70 A;  5HKW A;  1NSH A;  1XFX O;  4A4C A;  1H8B A;  5B8I B;  2LAN A;  2LMT A;  2LHL A;  3LK1 A;  4XYN A;  2PVB A;  3DVK A;  1WRZ A;  1L2O C;  1Y0V H;  4GAO A;  4C0L A;  1MHO A;  1SW8 A;  4NDD A;  4PE4 A;  4HSZ A;  1QAT A;  2LVI A;  2KFF A;  4C0J A;  3DVE A;  1KQV A;  4MEW A;  2KI4 B;  2ZFD A;  5G08 A;  2LCP A;  4NQG A;  3TDU A;  3OX5 A;  3I5H C;  3E3R A;  4QJ3 B;  2JWW A;  2M7L A;  1CFF A;  1B8R A;  1PVA A;  1DF0 B;  1JFK A;  3GK1 A;  1GJY A;  1S26 D;  4N5X A;  2EGD A;  1W7J B;  3BQ3 A;  2K0J A;  4M2O A;  1SNL A;  1S3P A;  5I2O A;  4MRY A;  1KFU S;  1BG1 A;  1EG3 A;  1KFU L;  4NDC A;  1A75 B;  3JVT B;  1MXL C;  2A4J A;  4ORB B;  1HT9 A;  3SG3 A;  4BY5 A;  2KBM A;  4AQI A;  4N1G A;  4P5O E;  1DJX A;  1LKJ A;  1WLM A;  1M31 A;  2E30 A;  2JU0 A;  2LLU A;  3FWB A;  3SIB A;  5JJG A;  3DVJ A;  1H4B A;  1YRU B;  5I2Q A;  1SR6 B;  2PAL A;  2WCF A;  3D0Y A;  2F3Z A;  2AAO A;  3AKB A;  4U8D A;  1BF5 A;  2KBI A;  3I5I B;  2M97 A;  1SL7 A;  4GGF C;  5TNC A;  1CMF A;  3FWC A;  5CSJ A;  2LMU A;  2ZRT A;  1F8H A;  4I5K A;  1MUX A;  2K7C A;  3O78 A;  4ICB A;  4E68 A;  3EK8 A;  3PAT A;  1L2O B;  1PRW A;  2KYF A;  2TN4 A;  1EXR A;  3LK0 A;  1BOD A;  1KK8 C;  4WRI A;  3OB2 B;  1ALV A;  1XK4 C;  2H61 A;  4DS7 A;  2KAV A;  1QX5 B;  3CLN A;  1F55 A;  4OVN F;  3JTD C;  4YI8 A;  4PE0 A;  1SL8 A;  1R6P A;  1KFX S;  1DJY A;  2SAS A;  3K21 A;  3I5H B;  1DVI A;  1LVC D;  2CT9 A;  2LP3 A;  1BR4 B;  4YGE B;  1CFD A;  3WXA A;  3O2P A;  1QIV A;  1BU3 A;  3BUX B;  1LA3 A;  1TRF A;  1YUT A;  2GV5 A;  4YGA A;  1NCY A;  2BBN A;  2QPT A;  1LXF C;  4GPL B;  4I5J A;  5ER5 A;  2M3W A;  4AQJ A;  4CPV A;  5HYD A;  4AOM A;  2M7N A;  3CGA A;  1YUR A;  2DOQ A;  1N2D A;  4L9M A;  2D8N A;  2JZI A;  2Y1N A;  2MLE C;  3HX4 A;  1CTR A;  1OSA A;  1OMV A;  1G33 A;  1QXP A;  2KI4 C;  1L7Z A;  1OMR A;  1K93 D;  1QVI Z;  4A4B A;  1OZS A;  3DVM A;  1F4O A;  2BBM A;  4HRE E;  1WRL A;  1WRK A;  1MQ1 A;  3DD4 A;  3A4U B;  2IS9 A;  1RWY A;  3I5G B;  3NSL A;  1RJV A;  3BXK A;  3NSI A;  4MVF A;  2KDH A;  3VRN A;  2F3Y A;  1CDN A;  3EKH A;  1NX0 A;  2L0P A;  5AEQ A;  1KK7 Z;  2MAZ A;  2MJW B;  1QS7 A;  4MBE A;  2LNK A;  4QJ5 B;  4GUK A;  2ZRS A;  1KK8 B;  1NWD A;  1N65 A;  1U5I A;  1OMD A;  1UHK A;  1SR6 C;  1TNW A;  2ZND A;  2WCB A;  4YGD B;  2E6W A;  5I8N A;  2LVK A;  3QRX A;  3I5I C;  1QV1 A;  1KSM A;  3A8R A;  2NXQ A;  1OE9 B;  1A4P A;  2H2K A;  2NLN A;  1F54 A;  1IH0 A;  1DJH A;  3TZ1 A;  1XO5 A;  4DUQ A;  1IQ5 A;  1A2X A;  2OTG C;  1J7R A;  3PAL A;  3PN7 C;  1QVI Y;  1K9K A;  1QTX A;  3FIA A;  5AXI A;  1HQV A;  2M9G A;  1DGU A;  5HKZ A;  5HLO A;  5PAL A;  2MBX A;  5I2L A;  2M1U A;  2MRD A;  1TTX A;  2KFG A;  1PUL A;  1S5G Z;  2LHI A;  1UHN A;  2OPO A;  1J1D A;  1RTP 1;  1JC2 A;  5AER A;  1UHJ A;  5K89 A;  1WDC C;  4GGN A;  2K8M B;  2K2F A;  1KK7 Y;  4CLN A;  2O60 A;  2HPS A;  4MZK A;  4DRW A;  4GNK B;  3OP0 A;  2LC5 A;  1NUB A;  3DF0 B;  1TNP A;  2ZN9 A;  1KSO A;  1SRA A;  2LV7 A;  1YUS A;  2JT0 A;  2AUC A;  4MZJ A;  1SCM B;  5HKY A;  1NCX A;  3BOW A;  1TCO B;  2MHH A;  4NDB A;  1XFZ O;  2PSR A;  1B8L A;  1N0Y A;  3ICB A;  1XFY O;  2LLS A;  2LE9 B;  1Q80 A;  2HQW A;  2JUL A;  1TN4 A;  2WOR A;  2FCD A;  3TS5 C;  5CSN A;  4FTG A;  4XJK B;  2HF5 A;  2JNF A;  2MA2 A;  1KQM B;  2PRU A;  1NX2 A;  1EL4 A;  4BY4 A;  2M0R A;  1PAL A;  1QAS A;  1YR5 A;  3H4S E;  1S5G Y;  1MF8 B;  3CS1 A;  1CM4 A;  1SKT A;  2WND A;  4ORC B;  2NZ0 A;  1NCZ A;  2GGM A;  3WHU B;  3OB1 B;  1B47 A;  1PSB A;  3KHE A;  4QJ4 B;  2B1U A;  4MLW A;  2V53 A;  1V1G A;  1ZFS A;  2JT8 A;  3I5G C;  3M0W A;  5CSI A;  2OTG B;  3PN7 B;  1ZOT B;  4CID A;  2H61 C;  1TCF A;  4M2P A;  1B1G A;  1UWO A;  1IJ6 A;  4JWQ A;  5CSF A;  1TNQ A;  2F2O A;  3EVU A;  4PE7 A;  3EVR A;  2JTT A;  1IKU A;  4ZCU A;  1NPQ A;  2MLF C;  3BUO B;  2K7O A;  1MXE A;  2BEC A;  4GBA A;  4PHN A;  1CNP A;  1LIN A;  1WDC B;  1D1O A;  2JOJ A;  3GOF A;  1BMO A;  2BE6 A;  3CZT X;  1X02 A;  3OX6 A;  4PAL A;  1C7W A;  1QJT A;  2K2A A;  2F33 A;  3SG2 A;  1DMO A;  1S6J A;  2L4H A;  3RM1 A;  4YGB B;  2JTZ A;  3D0Y B;  1CLM A;  4USL A;  1K96 A;  3I5F C;  1KWO C;  2COL B;  1B4C A;  2Y1M A;  3TS5 B;  1YRT B;  2NCO A;  4N1F A;  1AUI B;  2LUC A;  2I18 A;  2G9B A;  2M8U A;  1K2H A;  1IGV A;  1G4Y R;  1K9U A;  2KAX A;  2L98 A;  4M2Q A;  4MRX A;  3TDZ A;  2CTN A;  1FI6 A;  2KI6 C;  3O6B A;  1IJ5 A;  4OV2 A;  2ZNE A;  1AVS A;  2LP2 A;  1SCM C;  2LMV A;  2KGB C;  1QX7 A;  1AJ5 A;  1SK6 D;  3EKJ A;  2Y5I A;  1A29 A;  1QX2 A;  3BUN B;  4JPZ B;  3TDI A;  1CLL A;  1TIZ A;  3EK4 A;  1TNX A;  1DJW A;  3OHM B;  1SBJ A;  1TOP A;  2WCE A;  5KSZ A;  2KFH A;  2G2B A;  1S1E A;  1JF0 A;  4WQ3 A;  1B8C A;  2I94 A;  1IRJ A;  2HET A;  2Q91 A;  2EC6 B;  1A03 A;  3CTN A;  1NX1 A;  1KQM C;  2I2R E;  1NIW A;  2M29 A;  3SG7 A;  1V1F A;  2WOS A;  2KSP A;  1K8U A;  1IWQ A;  1SL9 A;  1XA5 A;  1DGV A;  1B7T Z;  1REC A;  2NCP A;  3EK7 A;  1SYM A;  4JQ0 D;  2O5G A;  2Y4Q A;  5AAN A;  1AJ4 A;  2BCX A;  2RGI A;  3D10 A;  3WNX B;  1VRK A;  3VRP A;  2R2I A;  2FOT A;  1G8I A;  1IG5 A;  1DF0 A;  1FF1 A;  1BT6 A;  3IQO A;  1LA0 A;  1CDL A;  4DCK A;  3TUY C;  2HQ8 A;  1YUU A;  1DJZ A;  4YGC B;  2Q4U A;  2PMY A;  2FJU B;  1A75 A;  3CR5 X;  3EVV A;  4MZL A;  1CFC A;  1RK9 A;  3I5F B;  1KWO B;  1NX3 A;  3ZWH A;  1CMG A;  1JFJ A;  1J1E A;  1JBA A;  4CFQ A;  1GGZ A;  1J7O A;  3VRQ A;  3LL8 B;  5HLV A;  1QV0 A;  2KHN A;  2KI6 D;  2CBL A;  2SCP A;  3GK2 A;  2KQY A;  1DJI A;  3SJS A;  1F4Q A;  3PSR A;  3SG6 A;  1S6C A;  1M63 B;  4MSP A;  1JF2 A;  4C0K A;  1CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...