3TUYC

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 46
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC02
1CLLA 2NLNA 4PALA 1LA0A 1OSAA 3DVKA 1SK6D 1DGUA 4ZCUA 1JC2A 2KFHA 1F4QA 4GFTA 1JFKA 3FS7A 1BMOA 4N5XA 1DGVA 2CTNA 2KI4B 1PULA 1XFXO 5K89A 5KTYA 2VRGA 3EK4A 1JF2A 1OMDA 2KNEA 1QS7A 3WHTB 2WCBA 1F4OA 1BG1A 2FCEA 1BR4B 1B47A 4MLWA 3TZ1A 1S26D 1NCZA 1A75A 2EGDA 1F71A 3CTNA 2K2AA 3SJSA 1PVBA 4TNCA 1KFUL 1XFYO 4DIRA 2HQ8A 1S6IA 2CXJA 2JU0A 1H4BA 1KWOB 1K96A 3D10A 3H4SE 3NSIA 1NWDA 2D8NA 3CS1A 3AKBA 1GJYA 4MN0A 1DT7B 1MQ1A 2JZIA 2Q4UA 2BKHB 3PN7B 5JJGA 5CSIA 1QX5B 2L50A 1BLQA 1AK8A 3GOFA 1NSHA 2E6WA 2JNFA 1WY9A 3BQ3A 4L9MA 4CFRA 3EK7A 2Q91A 3HX4A 1B8RA 3A4UB 3ZNIA 4HRHA 3WHUB 1K2HA 1M39A 3SG5A 1YUUA 1WDCB 1J7OA 2LAPA 2O60A 1NP8A 1DMOA 3I5IC 2MLEC 2LMUA 2ZNEA 1FW4A 2Y4QA 4NDCA 2NZ0A 3GK1A 1CM4A 1RECA 4PHJA 5B8IB 1RWYA 4U8DA 1SCMB 1A2XA 1SY9A 4E68A 1NCXA 2I18A 1B7TY 4NDBA 4C0JA 1AVSA 4GPLB 2PALA 5AERA 4D1EA 5DKNA 1PALA 1G8IA 1RROA 3BXKA 1GQMA 1K95A 3BUXB 2WOSA 2ZNDA 1QV1A 3BUWB 3VRQA 1ALVA 1NPQA 1G33A 2K8MB 4ORBB 3OX5A 2JT8A 5ER4X 1Y1XA 1R6PA 1L2OC 5J3XA 3A8RA 2M9GA 3I5HC 1CDPA 4PHMA 2E30A 1K94A 2M49B 4PCWA 1IWQA 2M7NA 3SG7A 4P5OE 1F8HA 2OS8B 2M1KB 1B9AA 3WNXB 1B8CA 3OX6A 1GGZA 3O6BA 5D7FA 2M29A 2KHNA 2L4IA 2ZFDA 1WRKA 1S6JA 1SW8A 2KDHA 2LCPA 2KAVA 1W7JB 2WNDA 1ZACA 1CFDA 2G2BA 2KAXA 4A4CA 1J7QA 4DRWA 1KSMA 3IQQA 4R1EA 1K9UA 1OMRA 1NIWA 2I2RE 2OTGB 4FTGA 4XJKB 2CNPA 1XO5A 1EH2A 1F70A 1FPWA 1Y6WA 2BL0C 4YGEB 2MA2A 2COLB 1KK7Y 1M31A 1JFJA 3BUMB 1IQ5A 1WRLA 2JPTA 2L4HA 3E3RA 2LVKA 3PM8A 1LXFC 2KBIA 3PFVA 2HPSA 2FJUB 5KSZA 2AUCA 2K7BA 2LVVA 3TDZA 3CGAA 1PK0D 1QIWA 3CLNA 4YGAA 1OQPA 3ICBA 3KF9A 4HREE 3OP0A 1L2OB 5GQQC 3CR2A 3I5HB 4BY5A 2KQ6A 1KQMB 1QVIY 2M1UA 1VRKA 1A03A 1JF0A 1NYAA 2JULA 1QASA 3NSKA 3O78A 3LL8B 1XFWO 4YI9A 1PRWA 1QLSA 1QV0A 2DOQA 1KFXL 4DCKA 3K21A 3MSEB 2BCAA 2HETA 1YURA 2BBNA 5AXIA 3GK4X 4XJKA 3LLEA 4YGDB 3BOWB 1ZFSA 4YGCB 1AJ5A 2M0RA 2Y5IA 3TS5C 1HQVA 1R2UA 1EJ3A 2R2IA 2NXQA 3KPXA 1LA3A 4GGFC 4NDDA 2L2EA 3O2PA 2OPOA 5G08A 2CCMA 3KO0A 1E8AA 1IJ5A 2KYFA 3EVRA 3PLFB 2A4JA 3O4YA 4ZCVA 4PE4A 3BUOB 1F55A 3FIAA 4AOMA 1PSBA 2MRDA 2BL0B 3PSRA 3TDUA 4CPVA 2MBXA 2LLSA 1YR5A 2L0PA 1RTP1 2JWWA 3LK1A 1QX2A 1OZOA 1UHHA 4IL1A 1F54A 1C07A 1XVJA 1AHRA 2LP2A 5I2OA 3OHMB 3I5FC 3TUYB 3HCMA 4DS7A 2PSRA 1BU3A 2O5GA 1UHKA 1OE9B 2K0JA 3DVJA 2P6BB 1MUXA 1YVHA 2AAOA 2LLTA 1UUSA 1DTLA 1NX0A 4MZLA 4PDZA 2SCPA 4CLNA 4MZKA 1V1FA 4ICBA 1RK9A 1TCOB 1CMGA 1IQ3A 1NX2A 1PVAA 4QJ3B 3RLZA 3BOWA 4HSZA 5IBWA 1IH0A 1TTXA 1CFFA 5AANA 2F2PA 3AKAA 3DF0B 2KYCA 1HT9A 1SL8A 1KSOA 1DJIA 4ORCB 4MRXA 5AFPA 2H61C 1MXEA 2JNXA 3SIBA 2I7AA 2LP3A 1YUTA 5HYDA 2K7OA 1K9PA 1MF8B 1XA5A 2GV5A 3SG2A 1IJ6A 2KSPA 3TS5B 1J1DA 1NX1A 5DKQA 1M45A 2JRFA 2I94A 2Y1NA 1S3PA 1SL9A 3GK2A 5ER5A 1DJYA 3CR5X 1L7ZA 3VROA 5I8NA 5CPVA 4MSPA 1XK4A 1DVIA 2B1UA 2MJWB 3IQOA 1CKKA 4OR9B 5HKZA 2JXLA 1S5GZ 2BECA 4C0LA 1U5IB 2F2OA 1FI5A 2MHHA 1YX7A 1TNXA 1YVLA 3JTDC 2LC5A 2ZKMX 3TDIA 1KK8C 4WQ3A 1XYDA 3DF0A 2PRUA 3EVUA 1KQVA 1DF0B 2H2KA 4WRIA 1CDLA 5BPJA 1CLBA 1SKTA 2BCXA 2ISDA 1DJXA 5PALA 1WLMA 3RM1A 1Q80A 2L51A 3I5IB 1QJTA 1NUBA 1J1EA 2EC6C 4AQJA 2M97A 4JPZB 1LVCD 1YRUB 1DJWA 3D0YA 2BE4A 1IRJA 3NXAA 1TIZA 1YTZC 1KCYA 1SMGA 2LMTA 1Y1AA 3VGOA 4GGNA 1CLMA 1ZMZA 3AAKA 4DUQA 2KI6C 2NCPA 1TN4A 1UHIA 1S6CA 4GUKA 3OB1B 2WC8A 1K93D 1QLKA 2LUXA 4I5LB 4QJ5B 1JUOA 2JT3A 4PE7A 1U5IA 2ZN8A 2BKIB 2KBMA 4I5JA 4C0KA 4PHKA 2HQWA 1UURA 4NQGA 4FQOA 1BOCA 1N2DA 1MR8A 2F8PA 2FCDA 2QPTA 1ZOTB 1SBJA 3EKJA 1DF0A 5CSJA 1ZUZA 1KWOC 1AJ4A 2KOTA 2QACA 1JSAA 4PHNA 3ZWHA 3SIAA 4YGBB 4YRUA 1TOPA 1IKUA 2KFFA 3JTDB 1BODA 3PN7C 1LKJA 2LHIA 1CFCA 1CM1A 3IF7A 1CB1A 1B7TZ 2H61A 3DVEA 4PE1A 1N65A 2JXCA 1TNWA 5TNCA 1JWDA 1CMFA 3CZTX 2LVIA 1DJZA 3FWBA 1WDCC 4JWQA 2EC6B 1Y1UA 1XFVO 1V1GA 4OVNF 1QX7A 1OZSA 2GGZA 4Q04A 5D69A 2WCFA 1SRAA 1IGVA 3PALA 2M3WA 2LM5A 4PE0A 1AP4A 2GGMA 1S1EA 1SR6C 2EHBA 1EXRA 1EG3A 1SCMC 3M0WA 1YX8A 1X02A 3FWCA 2K7CA 2KI6D 4I5KA 1C7VA 4M2PA 1SL7A 3F45A 3QRXA 1JBAA 1XFZO 1SYMA 1UHNA 1RJVA 3NSLA 2LVJA 1UP5A 1MXLC 1WRZA 2WCEA 1SNLA 5HKWA 1EG4A 2Y1MA 1MWNA 1DJGA 4YBHB 3VRNA 1BR1B 1K8UA 4MVFA 5DKRA 1SPYA 2K2FA 1KFXS 2WORA 2V53A 4N1FA 2AMIA 1QIVA 2OS8C 4MRYA 4HRGA 4GAOA 4M2QA 2BBMA 2LE9B 3KHEA 1EL4A 2LANA 2MLFC 1CTRA 1M63B 1QTXA 2ZRTA 1KK7Z 2BE6A 1K9KA 3LK0A 4N1GA 3VRPA 1XFUO 2NCOA 2RGIA 3OB2B 4P2YB 1B4CA 5F6TA 3D0YB 2F3ZA 1B8LA 2JTTA 1UWOA 4GNKB 1CFPA 4I5NB 1KFUS 4WQ2A 1FF1A 5HLVA 1YUSA 4A4BA 3JVTC 1BT6A 1WLZA 1G4YR 5AEQA 2OTGC 1FI6A 1TNPA 1AUIB 2LLUA 2JC2A 1QATA 4ORAB 1QVIZ 1A4PA 1MHOA 2KGBC 1SR6B 2LMVA 2M8UA 2HF5A 3I5GC 2M7LA 1QXPA 1K90D 2CT9A 4MEWA 3I5FB 3WXAA 5FYXA 4ETOA 2ZN9A 4YI8A 4BY4A 2KFGA 1C7WA 1ODBA 4CFQA 1OOJA 2KAYA 1CNPA 3SG4A 4JQ0D 2PMYA 2SASA 5CSNA 1GGWA 4OKHA 2JQ6A 2F33A 2PVBA 1A29A 1ALWA 1IG5A 1YRTB 3C1VA 4OV2A 5JOLA 1NX3A 1W7IB 1CDMA 1SCVA 2F3YA 1Y0VH 1N0YA 1KQMC 2IS9A 2LNKA 4MBEA 4CIDA 5KU1A 4MZJA 5I2LA 4XYNA 3LCPC 1OMVA 2LV7A 3PATA 1PSRA 4GGFA 3VRRA 4UPGA 3DD4A 4AQIA 5HLOA 1M46A 3AAJA 5I2QA 2K7DA 2LUCA 1D1OA 1J55A 3KEVA 2L98A 2KQYA 1DJHA 4F0ZB 1J7RA 2KI4C 4QJ4B 3NSOA 2MAZA 2JOJA 2KGRA 4M2OA 1BF5A 2LHLA 1TNQA 2PASA 3CWGA 3JVTB 1S36A 1TCFA 3EKHA 2TN4A 3CR4X 3EVVA 1TRFA 1NCYA 3BYAA 2G9BA 2CBLA 3I5GB 3SG3A 5HKYA 1J7PA 2ZRSA 4OCIA 2BCBA 2FOTA 4USLA 1CDNA 4GBAA 1A75B 2L5XB 3TUYC 2JT0A 1KK8B 1RFJA 3EK8A 1FBVA 1LINA 1XK4C 5CSFA 1BJFA 2JTZA 1H8BA 1B1GA 3BUNB 2K61A 1UHJA 3DVMA 1S5GY 3SG6A
chains in the Genus database with same CATH superfamily
1CLLA 1C3YA 3FE6A 2NLNA 3BFAA 1LA0A 1OSAA 4PALA 2GTEA 3DVKA 1SK6D 1DGUA 4ZCUA 1JC2A 2KFHA 1F4QA 4GFTA 1JFKA 3FS7A 1BMOA 3L47A 4N5XA 1DGVA 1Z2CB 2CTNA 2KI4B 1PULA 1XFXO 2PYQA 5K89A 2VRGA 3EK4A 5KTYA 1JF2A 1OMDA 2KNEA 1QS7A 3WHTB 2WCBA 1F4OA 1BG1A 2FCEA 1BR4B 1B47A 4MLWA 3TZ1A 2YGUA 1S26D 1NCZA 1A75A 2EGDA 1F71A 3CTNA 2K2AA 3SJSA 1PVBA 2L2CA 4TNCA 1KFUL 1XFYO 3NGVA 2HQ8A 4DIRA 3CABA 1S6IA 2CXJA 2JU0A 1H4BA 1OOFA 1KWOB 1K96A 3D10A 3H4SE 3FE9A 1NWDA 3NSIA 2D8NA 3CS1A 3AKBA 1GJYA 4MN0A 5FI7A 1DT7B 4JKTA 3SS3A 3D75A 1MQ1A 2JZIA 2Q4UA 2BKHB 3PN7B 5JJGA 5CSIA 1QX5B 2L50A 1BLQA 1AK8A 3GOFA 1NSHA 1DC1A 2E6WA 2JNFA 1WY9A 3BQ3A 4L9MA 3B6XA 3EK7A 3DY9A 4CFRA 2Q91A 3RZSA 3HX4A 1B8RA 3A4UB 3ZNIA 4HRHA 3WHUB 1K2HA 1M39A 3SG5A 1YUUA 1WDCB 2WC5A 1J7OA 2LAPA 2O60A 1NP8A 1DMOA 3I5IC 2MLEC 2LMUA 2ZNEA 1FW4A 2WCJA 2Y4QA 3R1PA 4NDCA 2NZ0A 3GK1A 1CM4A 1RECA 4PHJA 5B8IB 1RWYA 2QEBA 4PT1A 4U8DA 1SCMB 1A2XA 1SY9A 3S0EA 1NCXA 4E68A 2I18A 1B7TY 4NDBA 4C0JA 1AVSA 4GPLB 2PALA 5AERA 4D1EA 5DKNA 1PALA 1G8IA 1RROA 3BXKA 1GQMA 1K95A 3BUXB 2WOSA 2ZNDA 1QV1A 3BUWB 3VRQA 1ALVA 1NPQA 1G33A 2K8MB 4ORBB 3OX5A 2JT8A 5ER4X 1Y1XA 1R6PA 1L2OC 5J3XA 3A8RA 2M9GA 3OBVA 3I5HC 1CDPA 1TWOA 4PHMA 2E30A 1K94A 2M49B 4PCWA 1IWQA 2M7NA 3SG7A 4P5OE 1F8HA 2OS8B 2M1KB 1B9AA 3WNXB 1B8CA 3OX6A 1GGZA 3O6BA 5D7FA 2M29A 2KHNA 4INWA 2L4IA 2ZFDA 1WRKA 1S6JA 4FQTA 1SW8A 2KDHA 2LCPA 2KAVA 1W7JB 2WNDA 1ZACA 1CFDA 2G2BA 2KAXA 4A4CA 1J7QA 1T14A 1KSMA 1DEKA 3IQQA 4R1EA 1K9UA 4DRWA 1OMRA 1NIWA 2BAPA 2I2RE 2OTGB 4FTGA 4XJKB 2CNPA 1XO5A 1EH2A 1F70A 1FPWA 1Y6WA 2BL0C 4YGEB 5D3OA 2ERBA 2MA2A 2COLB 1KK7Y 1M31A 1JFJA 3BUMB 1IQ5A 1WRLA 2KLEA 2JPTA 2L4HA 3E3RA 2LVKA 3S0DA 3PM8A 1LXFC 2KBIA 3PFVA 2HPSA 2FJUB 5KSZA 2AUCA 2K7BA 2LVVA 3TDZA 3CGAA 1PK0D 1QIWA 3CLNA 4YGAA 1OQPA 3ICBA 3KF9A 4HREE 3OP0A 1L2OB 5GQQC 3CR2A 3I5HB 4BY5A 2KQ6A 1KQMB 1QVIY 2M1UA 1VRKA 4JD9A 1JF0A 1A03A 1NYAA 2JULA 1QASA 3NSKA 3O78A 3LL8B 1XFWO 4YI9A 1PRWA 1QLSA 1QV0A 2DOQA 1KFXL 4DCKA 3K21A 3S0GA 2WCMA 3MSEB 2BCAA 1Z4HA 2HETA 1GM0A 1YURA 2BBNA 5AXIA 3GK4X 4XJKA 3LLEA 4YGDB 3BOWB 1ZFSA 4YGCB 2K60A 1AJ5A 2M0RA 3CYZA 2Y5IA 3TS5C 1HQVA 3B86A 1R2UA 1EJ3A 2R2IA 2NXQA 3D76A 3KPXA 1LA3A 4GGFC 4NDDA 1SSEB 2L2EA 2OPOA 3O2PA 5G08A 2CCMA 3KO0A 1E8AA 1IJ5A 2KYFA 3EVRA 3PLFB 2A4JA 3O4YA 4ZCVA 4KYNA 4PE4A 3BUOB 1F55A 3FIAA 4AOMA 1PSBA 2KPHA 2MRDA 2BL0B 3PSRA 2WC6A 3TDUA 2MBXA 4CPVA 2LLSA 1YR5A 2L0PA 1RTP1 1P28A 2JWWA 3D77A 1QX2A 1OZOA 1UHHA 3LK1A 4IL1A 4F7FA 1C07A 1XVJA 1AHRA 2LP2A 5I2OA 3Q8IA 3OHMB 3I5FC 3TUYB 3HCMA 4IJ7A 4DS7A 2PSRA 1BU3A 2O5GA 1UHKA 1OE9B 2K0JA 3DVJA 2P6BB 1MUXA 1YVHA 2AAOA 2LLTA 1UUSA 1DTLA 1F54A 3BFBA 1NX0A 4MZLA 4PDZA 2SCPA 4CLNA 4MZKA 1V1FA 4ICBA 1RK9A 1TCOB 1CMGA 1IQ3A 1NX2A 1PVAA 4QJ3B 3RLZA 3BOWA 4HSZA 5IBWA 1IH0A 1TTXA 1CFFA 3NHTA 5AANA 2F2PA 3AKAA 3DF0B 2KYCA 1HT9A 1SL8A 3FE8A 1KSOA 1DJIA 4ORCB 4MRXA 5AFPA 2H61C 1MXEA 2JNXA 3SIBA 2I7AA 2LP3A 2KLDA 1YUTA 3D78A 5HYDA 2K7OA 2QEOA 1K9PA 1MF8B 1XA5A 2GV5A 3SG2A 1IJ6A 2KSPA 3TS5B 1J1DA 1NX1A 5DKQA 1M45A 2JRFA 2I94A 2Y1NA 1S3PA 1SL9A 3GK2A 5ER5A 2JPOA 1DJYA 3CR5X 1L7ZA 5EL2A 3VROA 5I8NA 5CPVA 4MSPA 1XK4A 1DVIA 2B1UA 2MJWB 3IQOA 1CKKA 4OR9B 5HKZA 3B7AA 2JXLA 1S5GZ 2BECA 4C0LA 1U5IB 1LS8A 2F2OA 2MHHA 1FI5A 1YX7A 1TNXA 1YVLA 3R1VA 3CZ2A 3O4XA 3JTDC 2LC5A 2ZKMX 3TDIA 1KK8C 4WQ3A 1XYDA 3DF0A 2PRUA 3EVUA 1KQVA 1DF0B 1W9ZA 3PJIA 3R72A 2H2KA 4WRIA 1CDLA 3S0FA 5BPJA 1CLBA 1SKTA 2BCXA 2ISDA 1DJXA 5PALA 1WLMA 3RM1A 1IIOA 1Q80A 2L51A 3I5IB 1QJTA 1NUBA 1J1EA 2EC6C 4AQJA 1ORGA 2M97A 3N7HA 4JPZB 1LVCD 1YRUB 3R1OA 1DJWA 3D0YA 2BE4A 1IRJA 3NXAA 1TIZA 3S0BA 1YTZC 1KCYA 1SMGA 2LMTA 1Y1AA 3VGOA 4GGNA 1CLMA 1ZMZA 3B87A 3AAKA 4DUQA 2KI6C 2NCPA 1TN4A 1C3ZA 1S6CA 1UHIA 3QMEA 4GUKA 2FJYA 3OB1B 1DQEA 1K93D 1QLKA 2LUXA 2WC8A 4I5LB 4QJ5B 1JUOA 2JT3A 3CDNA 3SS5A 4PE7A 1U5IA 2ZN8A 2BKIB 2KBMA 2BNXA 4I5JA 4C0KA 4PHKA 2HQWA 3EG5B 1UURA 4INXA 4NQGA 4FQOA 1TUZA 1BOCA 1N2DA 1MR8A 3BFHA 2F8PA 2FCDA 2QPTA 1ZOTB 1SBJA 3EKJA 1DF0A 2WCKA 5CSJA 1ZUZA 1KWOC 1AJ4A 2KOTA 2QACA 2L5YA 1JSAA 1OOHA 4PHNA 3ZWHA 2QDIA 4YGBB 3SIAA 4YRUA 1TOPA 1IKUA 2KFFA 3JTDB 1BODA 3DZTA 3PN7C 1LKJA 1TUJA 2LHIA 1CFCA 1CM1A 3IF7A 1CB1A 3BJHA 1B7TZ 2H61A 3DVEA 4PE1A 1N65A 2JXCA 1TNWA 5TNCA 1JWDA 1CMFA 3CZTX 2LVIA 1DJZA 3FWBA 1WDCC 4JWQA 2EC6B 1Y1UA 2PQLA 1OOIX 3PM2A 1XFVO 3D74A 1V1GA 4OVNF 1QX7A 1OZSA 2GGZA 4Q04A 5D69A 2WCFA 1SRAA 1IGVA 3PALA 2M3WA 2LM5A 3D73A 3OGNA 4PE0A 1AP4A 2GGMA 1S1EA 1SR6C 2EHBA 1EXRA 1EG3A 1SCMC 3M0WA 3VB1A 1YX8A 1X02A 3FWCA 2K7CA 2KI6D 4I5KA 1C7VA 4M2PA 1SL7A 2H8VA 3F45A 3QRXA 1JBAA 1XFZO 1SYMA 1UHNA 1RJVA 3NSLA 2LVJA 1UP5A 1MXLC 1WRZA 2WCEA 1SNLA 5HKWA 1EG4A 2Y1MA 1MWNA 1DJGA 4YBHB 3VRNA 1BR1B 1K8UA 4MVFA 5DKRA 1SPYA 2K2FA 4OZDA 1KFXS 2WORA 2V53A 4N1FA 3DYEA 2AMIA 1QIVA 2OS8C 4MRYA 4HRGA 4GAOA 4M2QA 2BBMA 2LE9B 3KHEA 1EL4A 2LANA 3SS4A 2MLFC 1CTRA 1OW4A 3V2LA 1M63B 1QTXA 2ZRTA 1KK7Z 2BE6A 1K9KA 3LK0A 4N1GA 3VRPA 1XFUO 3B88A 2NCOA 2RGIA 3CZ0A 3OB2B 4P2YB 1XFRA 1B4CA 3NHIA 5F6TA 3D0YB 2F3ZA 2QEHA 1B8LA 2JTTA 1UWOA 4GNKB 1CFPA 4I5NB 1KFUS 4WQ2A 1FF1A 5HLVA 1YUSA 4A4BA 5HL1A 3JVTC 1BT6A 1WLZA 1G4YR 5AEQA 2OTGC 3CZ1A 1FI6A 1TNPA 1AUIB 2LLUA 2JC2A 1QATA 4ORAB 1QVIZ 1A4PA 1MHOA 2KGBC 1SR6B 2LMVA 2M8UA 2HF5A 3I5GC 3L4LA 2M7LA 1QXPA 1K90D 2CT9A 4MEWA 3I5FB 3WXAA 5FYXA 4ETOA 2ZN9A 4YI8A 3K1EA 2KFGA 4BY4A 2P71A 2WCLA 1C7WA 1ODBA 4CFQA 1OOJA 2KAYA 1CNPA 3SG4A 4JQ0D 2PMYA 2SASA 5CSNA 3UO9A 1GGWA 4OKHA 2JQ6A 2F33A 2PVBA 1A29A 1ALWA 1IG5A 1YRTB 3C1VA 4OV2A 5JOLA 1NX3A 1W7IB 1CDMA 1OOGA 1SCVA 2F3YA 1Y0VH 1N0YA 1KQMC 2IS9A 2LNKA 4MBEA 4CIDA 5KU1A 4MZJA 5I2LA 4XYNA 3LCPC 5DICA 1OMVA 2LV7A 3PATA 1PSRA 4GGFA 3VRRA 4UPGA 3DD4A 4AQIA 2WCHA 5HLOA 1M46A 3AAJA 5I2QA 2K7DA 2LUCA 1D1OA 1J55A 5I94A 3KEVA 2L98A 2KQYA 1DJHA 4F0ZB 1J7RA 2KI4C 4QJ4B 3NSOA 2MAZA 2JOJA 2KGRA 4M2OA 1BF5A 2LHLA 1TNQA 2PASA 3CWGA 3JVTB 1S36A 1TCFA 3EKHA 3UNWA 2TN4A 3CR4X 3EVVA 5FI2A 1TRFA 1NCYA 2P70A 3BYAA 2G9BA 2CBLA 3I5GB 3SG3A 5HKYA 3S0AA 1J7PA 2ZRSA 4OCIA 2BCBA 2FOTA 4USLA 1CDNA 4GBAA 1A75B 2L5XB 2QEVA 3TUYC 2JT0A 1KK8B 1RFJA 3EK8A 1FBVA 1LINA 3IVTA 1XK4C 5CSFA 1BJFA 2JTZA 3L4AA 1H8BA 1B1GA 3BUNB 2K61A 1DELA 1UHJA 3DXLA 1QWVA 3DVMA 5FI6A 1S5GY 3SG6A
chains in the Genus database with same CATH topology
1CLLA 2NLNA 4PALA 1LA0A 1OSAA 3DVKA 1SK6D 1DGUA 4ZCUA 1JC2A 2KFHA 1F4QA 4GFTA 1JFKA 3FS7A 1BMOA 4N5XA 1DGVA 2CTNA 2KI4B 1PULA 1XFXO 5K89A 5KTYA 2VRGA 3EK4A 1JF2A 1OMDA 2KNEA 1QS7A 3WHTB 2WCBA 1F4OA 1BG1A 2FCEA 1BR4B 1B47A 4MLWA 3TZ1A 1S26D 1NCZA 1A75A 2EGDA 1F71A 3CTNA 2K2AA 3SJSA 1PVBA 4TNCA 1KFUL 1XFYO 4DIRA 2HQ8A 1S6IA 2CXJA 2JU0A 1H4BA 1KWOB 1K96A 3D10A 3H4SE 3NSIA 1NWDA 2D8NA 3CS1A 3AKBA 1GJYA 4MN0A 1DT7B 1MQ1A 2JZIA 2Q4UA 2BKHB 3PN7B 5JJGA 5CSIA 1QX5B 2L50A 1BLQA 1AK8A 3GOFA 1NSHA 2E6WA 2JNFA 1WY9A 3BQ3A 4L9MA 4CFRA 3EK7A 2Q91A 3HX4A 1B8RA 3A4UB 3ZNIA 4HRHA 3WHUB 1K2HA 1M39A 3SG5A 1YUUA 1WDCB 1J7OA 2LAPA 2O60A 1NP8A 1DMOA 3I5IC 2MLEC 2LMUA 2ZNEA 1FW4A 2Y4QA 4NDCA 2NZ0A 3GK1A 1CM4A 1RECA 4PHJA 5B8IB 1RWYA 4U8DA 1SCMB 1A2XA 1SY9A 4E68A 1NCXA 2I18A 1B7TY 4NDBA 4C0JA 1AVSA 4GPLB 2PALA 5AERA 4D1EA 5DKNA 1PALA 1G8IA 1RROA 3BXKA 1GQMA 1K95A 3BUXB 2WOSA 2ZNDA 1QV1A 3BUWB 3VRQA 1ALVA 1NPQA 1G33A 2K8MB 4ORBB 3OX5A 2JT8A 5ER4X 1Y1XA 1R6PA 1L2OC 5J3XA 3A8RA 2M9GA 3I5HC 1CDPA 4PHMA 2E30A 1K94A 2M49B 4PCWA 1IWQA 2M7NA 3SG7A 4P5OE 1F8HA 2OS8B 2M1KB 1B9AA 3WNXB 1B8CA 3OX6A 1GGZA 3O6BA 5D7FA 2M29A 2KHNA 2L4IA 2ZFDA 1WRKA 1S6JA 1SW8A 2KDHA 2LCPA 2KAVA 1W7JB 2WNDA 1ZACA 1CFDA 2G2BA 2KAXA 4A4CA 1J7QA 4DRWA 1KSMA 3IQQA 4R1EA 1K9UA 1OMRA 1NIWA 2I2RE 2OTGB 4FTGA 4XJKB 2CNPA 1XO5A 1EH2A 1F70A 1FPWA 1Y6WA 2BL0C 4YGEB 2MA2A 2COLB 1KK7Y 1M31A 1JFJA 3BUMB 1IQ5A 1WRLA 2JPTA 2L4HA 3E3RA 2LVKA 3PM8A 1LXFC 2KBIA 3PFVA 2HPSA 2FJUB 5KSZA 2AUCA 2K7BA 2LVVA 3TDZA 3CGAA 1PK0D 1QIWA 3CLNA 4YGAA 1OQPA 3ICBA 3KF9A 4HREE 3OP0A 1L2OB 5GQQC 3CR2A 3I5HB 4BY5A 2KQ6A 1KQMB 1QVIY 2M1UA 1VRKA 1A03A 1JF0A 1NYAA 2JULA 1QASA 3NSKA 3O78A 3LL8B 1XFWO 4YI9A 1PRWA 1QLSA 1QV0A 2DOQA 1KFXL 4DCKA 3K21A 3MSEB 2BCAA 2HETA 1YURA 2BBNA 5AXIA 3GK4X 4XJKA 3LLEA 4YGDB 3BOWB 1ZFSA 4YGCB 1AJ5A 2M0RA 2Y5IA 3TS5C 1HQVA 1R2UA 1EJ3A 2R2IA 2NXQA 3KPXA 1LA3A 4GGFC 4NDDA 2L2EA 3O2PA 2OPOA 5G08A 2CCMA 3KO0A 1E8AA 1IJ5A 2KYFA 3EVRA 3PLFB 2A4JA 3O4YA 4ZCVA 4PE4A 3BUOB 1F55A 3FIAA 4AOMA 1PSBA 2MRDA 2BL0B 3PSRA 3TDUA 4CPVA 2MBXA 2LLSA 1YR5A 2L0PA 1RTP1 2JWWA 3LK1A 1QX2A 1OZOA 1UHHA 4IL1A 1F54A 1C07A 1XVJA 1AHRA 2LP2A 5I2OA 3OHMB 3I5FC 3TUYB 3HCMA 4DS7A 2PSRA 1BU3A 2O5GA 1UHKA 1OE9B 2K0JA 3DVJA 2P6BB 1MUXA 1YVHA 2AAOA 2LLTA 1UUSA 1DTLA 1NX0A 4MZLA 4PDZA 2SCPA 4CLNA 4MZKA 1V1FA 4ICBA 1RK9A 1TCOB 1CMGA 1IQ3A 1NX2A 1PVAA 4QJ3B 3RLZA 3BOWA 4HSZA 5IBWA 1IH0A 1TTXA 1CFFA 5AANA 2F2PA 3AKAA 3DF0B 2KYCA 1HT9A 1SL8A 1KSOA 1DJIA 4ORCB 4MRXA 5AFPA 2H61C 1MXEA 2JNXA 3SIBA 2I7AA 2LP3A 1YUTA 5HYDA 2K7OA 1K9PA 1MF8B 1XA5A 2GV5A 3SG2A 1IJ6A 2KSPA 3TS5B 1J1DA 1NX1A 5DKQA 1M45A 2JRFA 2I94A 2Y1NA 1S3PA 1SL9A 3GK2A 5ER5A 1DJYA 3CR5X 1L7ZA 3VROA 5I8NA 5CPVA 4MSPA 1XK4A 1DVIA 2B1UA 2MJWB 3IQOA 1CKKA 4OR9B 5HKZA 2JXLA 1S5GZ 2BECA 4C0LA 1U5IB 2F2OA 1FI5A 2MHHA 1YX7A 1TNXA 1YVLA 3JTDC 2LC5A 2ZKMX 3TDIA 1KK8C 4WQ3A 1XYDA 3DF0A 2PRUA 3EVUA 1KQVA 1DF0B 2H2KA 4WRIA 1CDLA 5BPJA 1CLBA 1SKTA 2BCXA 2ISDA 1DJXA 5PALA 1WLMA 3RM1A 1Q80A 2L51A 3I5IB 1QJTA 1NUBA 1J1EA 2EC6C 4AQJA 2M97A 4JPZB 1LVCD 1YRUB 1DJWA 3D0YA 2BE4A 1IRJA 3NXAA 1TIZA 1YTZC 1KCYA 1SMGA 2LMTA 1Y1AA 3VGOA 4GGNA 1CLMA 1ZMZA 3AAKA 4DUQA 2KI6C 2NCPA 1TN4A 1UHIA 1S6CA 4GUKA 3OB1B 2WC8A 1K93D 1QLKA 2LUXA 4I5LB 4QJ5B 1JUOA 2JT3A 4PE7A 1U5IA 2ZN8A 2BKIB 2KBMA 4I5JA 4C0KA 4PHKA 2HQWA 1UURA 4NQGA 4FQOA 1BOCA 1N2DA 1MR8A 2F8PA 2FCDA 2QPTA 1ZOTB 1SBJA 3EKJA 1DF0A 5CSJA 1ZUZA 1KWOC 1AJ4A 2KOTA 2QACA 1JSAA 4PHNA 3ZWHA 3SIAA 4YGBB 4YRUA 1TOPA 1IKUA 2KFFA 3JTDB 1BODA 3PN7C 1LKJA 2LHIA 1CFCA 1CM1A 3IF7A 1CB1A 1B7TZ 2H61A 3DVEA 4PE1A 1N65A 2JXCA 1TNWA 5TNCA 1JWDA 1CMFA 3CZTX 2LVIA 1DJZA 3FWBA 1WDCC 4JWQA 2EC6B 1Y1UA 1XFVO 1V1GA 4OVNF 1QX7A 1OZSA 2GGZA 4Q04A 5D69A 2WCFA 1SRAA 1IGVA 3PALA 2M3WA 2LM5A 4PE0A 1AP4A 2GGMA 1S1EA 1SR6C 2EHBA 1EXRA 1EG3A 1SCMC 3M0WA 1YX8A 1X02A 3FWCA 2K7CA 2KI6D 4I5KA 1C7VA 4M2PA 1SL7A 3F45A 3QRXA 1JBAA 1XFZO 1SYMA 1UHNA 1RJVA 3NSLA 2LVJA 1UP5A 1MXLC 1WRZA 2WCEA 1SNLA 5HKWA 1EG4A 2Y1MA 1MWNA 1DJGA 4YBHB 3VRNA 1BR1B 1K8UA 4MVFA 5DKRA 1SPYA 2K2FA 1KFXS 2WORA 2V53A 4N1FA 2AMIA 1QIVA 2OS8C 4MRYA 4HRGA 4GAOA 4M2QA 2BBMA 2LE9B 3KHEA 1EL4A 2LANA 2MLFC 1CTRA 1M63B 1QTXA 2ZRTA 1KK7Z 2BE6A 1K9KA 3LK0A 4N1GA 3VRPA 1XFUO 2NCOA 2RGIA 3OB2B 4P2YB 1B4CA 5F6TA 3D0YB 2F3ZA 1B8LA 2JTTA 1UWOA 4GNKB 1CFPA 4I5NB 1KFUS 4WQ2A 1FF1A 5HLVA 1YUSA 4A4BA 3JVTC 1BT6A 1WLZA 1G4YR 5AEQA 2OTGC 1FI6A 1TNPA 1AUIB 2LLUA 2JC2A 1QATA 4ORAB 1QVIZ 1A4PA 1MHOA 2KGBC 1SR6B 2LMVA 2M8UA 2HF5A 3I5GC 2M7LA 1QXPA 1K90D 2CT9A 4MEWA 3I5FB 3WXAA 5FYXA 4ETOA 2ZN9A 4YI8A 4BY4A 2KFGA 1C7WA 1ODBA 4CFQA 1OOJA 2KAYA 1CNPA 3SG4A 4JQ0D 2PMYA 2SASA 5CSNA 1GGWA 4OKHA 2JQ6A 2F33A 2PVBA 1A29A 1ALWA 1IG5A 1YRTB 3C1VA 4OV2A 5JOLA 1NX3A 1W7IB 1CDMA 1SCVA 2F3YA 1Y0VH 1N0YA 1KQMC 2IS9A 2LNKA 4MBEA 4CIDA 5KU1A 4MZJA 5I2LA 4XYNA 3LCPC 1OMVA 2LV7A 3PATA 1PSRA 4GGFA 3VRRA 4UPGA 3DD4A 4AQIA 5HLOA 1M46A 3AAJA 5I2QA 2K7DA 2LUCA 1D1OA 1J55A 3KEVA 2L98A 2KQYA 1DJHA 4F0ZB 1J7RA 2KI4C 4QJ4B 3NSOA 2MAZA 2JOJA 2KGRA 4M2OA 1BF5A 2LHLA 1TNQA 2PASA 3CWGA 3JVTB 1S36A 1TCFA 3EKHA 2TN4A 3CR4X 3EVVA 1TRFA 1NCYA 3BYAA 2G9BA 2CBLA 3I5GB 3SG3A 5HKYA 1J7PA 2ZRSA 4OCIA 2BCBA 2FOTA 4USLA 1CDNA 4GBAA 1A75B 2L5XB 3TUYC 2JT0A 1KK8B 1RFJA 3EK8A 1FBVA 1LINA 1XK4C 5CSFA 1BJFA 2JTZA 1H8BA 1B1GA 3BUNB 2K61A 1UHJA 3DVMA 1S5GY 3SG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLL A;  2NLN A;  4PAL A;  1LA0 A;  1OSA A;  3DVK A;  1SK6 D;  1DGU A;  4ZCU A;  1JC2 A;  2KFH A;  1F4Q A;  4GFT A;  1JFK A;  3FS7 A;  1BMO A;  4N5X A;  1DGV A;  2CTN A;  2KI4 B;  1PUL A;  1XFX O;  5K89 A;  5KTY A;  2VRG A;  3EK4 A;  1JF2 A;  1OMD A;  2KNE A;  1QS7 A;  3WHT B;  2WCB A;  1F4O A;  1BG1 A;  2FCE A;  1BR4 B;  1B47 A;  4MLW A;  3TZ1 A;  1S26 D;  1NCZ A;  1A75 A;  2EGD A;  1F71 A;  3CTN A;  2K2A A;  3SJS A;  1PVB A;  4TNC A;  1KFU L;  1XFY O;  4DIR A;  2HQ8 A;  1S6I A;  2CXJ A;  2JU0 A;  1H4B A;  1KWO B;  1K96 A;  3D10 A;  3H4S E;  3NSI A;  1NWD A;  2D8N A;  3CS1 A;  3AKB A;  1GJY A;  4MN0 A;  1DT7 B;  1MQ1 A;  2JZI A;  2Q4U A;  2BKH B;  3PN7 B;  5JJG A;  5CSI A;  1QX5 B;  2L50 A;  1BLQ A;  1AK8 A;  3GOF A;  1NSH A;  2E6W A;  2JNF A;  1WY9 A;  3BQ3 A;  4L9M A;  4CFR A;  3EK7 A;  2Q91 A;  3HX4 A;  1B8R A;  3A4U B;  3ZNI A;  4HRH A;  3WHU B;  1K2H A;  1M39 A;  3SG5 A;  1YUU A;  1WDC B;  1J7O A;  2LAP A;  2O60 A;  1NP8 A;  1DMO A;  3I5I C;  2MLE C;  2LMU A;  2ZNE A;  1FW4 A;  2Y4Q A;  4NDC A;  2NZ0 A;  3GK1 A;  1CM4 A;  1REC A;  4PHJ A;  5B8I B;  1RWY A;  4U8D A;  1SCM B;  1A2X A;  1SY9 A;  4E68 A;  1NCX A;  2I18 A;  1B7T Y;  4NDB A;  4C0J A;  1AVS A;  4GPL B;  2PAL A;  5AER A;  4D1E A;  5DKN A;  1PAL A;  1G8I A;  1RRO A;  3BXK A;  1GQM A;  1K95 A;  3BUX B;  2WOS A;  2ZND A;  1QV1 A;  3BUW B;  3VRQ A;  1ALV A;  1NPQ A;  1G33 A;  2K8M B;  4ORB B;  3OX5 A;  2JT8 A;  5ER4 X;  1Y1X A;  1R6P A;  1L2O C;  5J3X A;  3A8R A;  2M9G A;  3I5H C;  1CDP A;  4PHM A;  2E30 A;  1K94 A;  2M49 B;  4PCW A;  1IWQ A;  2M7N A;  3SG7 A;  4P5O E;  1F8H A;  2OS8 B;  2M1K B;  1B9A A;  3WNX B;  1B8C A;  3OX6 A;  1GGZ A;  3O6B A;  5D7F A;  2M29 A;  2KHN A;  2L4I A;  2ZFD A;  1WRK A;  1S6J A;  1SW8 A;  2KDH A;  2LCP A;  2KAV A;  1W7J B;  2WND A;  1ZAC A;  1CFD A;  2G2B A;  2KAX A;  4A4C A;  1J7Q A;  4DRW A;  1KSM A;  3IQQ A;  4R1E A;  1K9U A;  1OMR A;  1NIW A;  2I2R E;  2OTG B;  4FTG A;  4XJK B;  2CNP A;  1XO5 A;  1EH2 A;  1F70 A;  1FPW A;  1Y6W A;  2BL0 C;  4YGE B;  2MA2 A;  2COL B;  1KK7 Y;  1M31 A;  1JFJ A;  3BUM B;  1IQ5 A;  1WRL A;  2JPT A;  2L4H A;  3E3R A;  2LVK A;  3PM8 A;  1LXF C;  2KBI A;  3PFV A;  2HPS A;  2FJU B;  5KSZ A;  2AUC A;  2K7B A;  2LVV A;  3TDZ A;  3CGA A;  1PK0 D;  1QIW A;  3CLN A;  4YGA A;  1OQP A;  3ICB A;  3KF9 A;  4HRE E;  3OP0 A;  1L2O B;  5GQQ C;  3CR2 A;  3I5H B;  4BY5 A;  2KQ6 A;  1KQM B;  1QVI Y;  2M1U A;  1VRK A;  1A03 A;  1JF0 A;  1NYA A;  2JUL A;  1QAS A;  3NSK A;  3O78 A;  3LL8 B;  1XFW O;  4YI9 A;  1PRW A;  1QLS A;  1QV0 A;  2DOQ A;  1KFX L;  4DCK A;  3K21 A;  3MSE B;  2BCA A;  2HET A;  1YUR A;  2BBN A;  5AXI A;  3GK4 X;  4XJK A;  3LLE A;  4YGD B;  3BOW B;  1ZFS A;  4YGC B;  1AJ5 A;  2M0R A;  2Y5I A;  3TS5 C;  1HQV A;  1R2U A;  1EJ3 A;  2R2I A;  2NXQ A;  3KPX A;  1LA3 A;  4GGF C;  4NDD A;  2L2E A;  3O2P A;  2OPO A;  5G08 A;  2CCM A;  3KO0 A;  1E8A A;  1IJ5 A;  2KYF A;  3EVR A;  3PLF B;  2A4J A;  3O4Y A;  4ZCV A;  4PE4 A;  3BUO B;  1F55 A;  3FIA A;  4AOM A;  1PSB A;  2MRD A;  2BL0 B;  3PSR A;  3TDU A;  4CPV A;  2MBX A;  2LLS A;  1YR5 A;  2L0P A;  1RTP 1;  2JWW A;  3LK1 A;  1QX2 A;  1OZO A;  1UHH A;  4IL1 A;  1F54 A;  1C07 A;  1XVJ A;  1AHR A;  2LP2 A;  5I2O A;  3OHM B;  3I5F C;  3TUY B;  3HCM A;  4DS7 A;  2PSR A;  1BU3 A;  2O5G A;  1UHK A;  1OE9 B;  2K0J A;  3DVJ A;  2P6B B;  1MUX A;  1YVH A;  2AAO A;  2LLT A;  1UUS A;  1DTL A;  1NX0 A;  4MZL A;  4PDZ A;  2SCP A;  4CLN A;  4MZK A;  1V1F A;  4ICB A;  1RK9 A;  1TCO B;  1CMG A;  1IQ3 A;  1NX2 A;  1PVA A;  4QJ3 B;  3RLZ A;  3BOW A;  4HSZ A;  5IBW A;  1IH0 A;  1TTX A;  1CFF A;  5AAN A;  2F2P A;  3AKA A;  3DF0 B;  2KYC A;  1HT9 A;  1SL8 A;  1KSO A;  1DJI A;  4ORC B;  4MRX A;  5AFP A;  2H61 C;  1MXE A;  2JNX A;  3SIB A;  2I7A A;  2LP3 A;  1YUT A;  5HYD A;  2K7O A;  1K9P A;  1MF8 B;  1XA5 A;  2GV5 A;  3SG2 A;  1IJ6 A;  2KSP A;  3TS5 B;  1J1D A;  1NX1 A;  5DKQ A;  1M45 A;  2JRF A;  2I94 A;  2Y1N A;  1S3P A;  1SL9 A;  3GK2 A;  5ER5 A;  1DJY A;  3CR5 X;  1L7Z A;  3VRO A;  5I8N A;  5CPV A;  4MSP A;  1XK4 A;  1DVI A;  2B1U A;  2MJW B;  3IQO A;  1CKK A;  4OR9 B;  5HKZ A;  2JXL A;  1S5G Z;  2BEC A;  4C0L A;  1U5I B;  2F2O A;  1FI5 A;  2MHH A;  1YX7 A;  1TNX A;  1YVL A;  3JTD C;  2LC5 A;  2ZKM X;  3TDI A;  1KK8 C;  4WQ3 A;  1XYD A;  3DF0 A;  2PRU A;  3EVU A;  1KQV A;  1DF0 B;  2H2K A;  4WRI A;  1CDL A;  5BPJ A;  1CLB A;  1SKT A;  2BCX A;  2ISD A;  1DJX A;  5PAL A;  1WLM A;  3RM1 A;  1Q80 A;  2L51 A;  3I5I B;  1QJT A;  1NUB A;  1J1E A;  2EC6 C;  4AQJ A;  2M97 A;  4JPZ B;  1LVC D;  1YRU B;  1DJW A;  3D0Y A;  2BE4 A;  1IRJ A;  3NXA A;  1TIZ A;  1YTZ C;  1KCY A;  1SMG A;  2LMT A;  1Y1A A;  3VGO A;  4GGN A;  1CLM A;  1ZMZ A;  3AAK A;  4DUQ A;  2KI6 C;  2NCP A;  1TN4 A;  1UHI A;  1S6C A;  4GUK A;  3OB1 B;  2WC8 A;  1K93 D;  1QLK A;  2LUX A;  4I5L B;  4QJ5 B;  1JUO A;  2JT3 A;  4PE7 A;  1U5I A;  2ZN8 A;  2BKI B;  2KBM A;  4I5J A;  4C0K A;  4PHK A;  2HQW A;  1UUR A;  4NQG A;  4FQO A;  1BOC A;  1N2D A;  1MR8 A;  2F8P A;  2FCD A;  2QPT A;  1ZOT B;  1SBJ A;  3EKJ A;  1DF0 A;  5CSJ A;  1ZUZ A;  1KWO C;  1AJ4 A;  2KOT A;  2QAC A;  1JSA A;  4PHN A;  3ZWH A;  3SIA A;  4YGB B;  4YRU A;  1TOP A;  1IKU A;  2KFF A;  3JTD B;  1BOD A;  3PN7 C;  1LKJ A;  2LHI A;  1CFC A;  1CM1 A;  3IF7 A;  1CB1 A;  1B7T Z;  2H61 A;  3DVE A;  4PE1 A;  1N65 A;  2JXC A;  1TNW A;  5TNC A;  1JWD A;  1CMF A;  3CZT X;  2LVI A;  1DJZ A;  3FWB A;  1WDC C;  4JWQ A;  2EC6 B;  1Y1U A;  1XFV O;  1V1G A;  4OVN F;  1QX7 A;  1OZS A;  2GGZ A;  4Q04 A;  5D69 A;  2WCF A;  1SRA A;  1IGV A;  3PAL A;  2M3W A;  2LM5 A;  4PE0 A;  1AP4 A;  2GGM A;  1S1E A;  1SR6 C;  2EHB A;  1EXR A;  1EG3 A;  1SCM C;  3M0W A;  1YX8 A;  1X02 A;  3FWC A;  2K7C A;  2KI6 D;  4I5K A;  1C7V A;  4M2P A;  1SL7 A;  3F45 A;  3QRX A;  1JBA A;  1XFZ O;  1SYM A;  1UHN A;  1RJV A;  3NSL A;  2LVJ A;  1UP5 A;  1MXL C;  1WRZ A;  2WCE A;  1SNL A;  5HKW A;  1EG4 A;  2Y1M A;  1MWN A;  1DJG A;  4YBH B;  3VRN A;  1BR1 B;  1K8U A;  4MVF A;  5DKR A;  1SPY A;  2K2F A;  1KFX S;  2WOR A;  2V53 A;  4N1F A;  2AMI A;  1QIV A;  2OS8 C;  4MRY A;  4HRG A;  4GAO A;  4M2Q A;  2BBM A;  2LE9 B;  3KHE A;  1EL4 A;  2LAN A;  2MLF C;  1CTR A;  1M63 B;  1QTX A;  2ZRT A;  1KK7 Z;  2BE6 A;  1K9K A;  3LK0 A;  4N1G A;  3VRP A;  1XFU O;  2NCO A;  2RGI A;  3OB2 B;  4P2Y B;  1B4C A;  5F6T A;  3D0Y B;  2F3Z A;  1B8L A;  2JTT A;  1UWO A;  4GNK B;  1CFP A;  4I5N B;  1KFU S;  4WQ2 A;  1FF1 A;  5HLV A;  1YUS A;  4A4B A;  3JVT C;  1BT6 A;  1WLZ A;  1G4Y R;  5AEQ A;  2OTG C;  1FI6 A;  1TNP A;  1AUI B;  2LLU A;  2JC2 A;  1QAT A;  4ORA B;  1QVI Z;  1A4P A;  1MHO A;  2KGB C;  1SR6 B;  2LMV A;  2M8U A;  2HF5 A;  3I5G C;  2M7L A;  1QXP A;  1K90 D;  2CT9 A;  4MEW A;  3I5F B;  3WXA A;  5FYX A;  4ETO A;  2ZN9 A;  4YI8 A;  4BY4 A;  2KFG A;  1C7W A;  1ODB A;  4CFQ A;  1OOJ A;  2KAY A;  1CNP A;  3SG4 A;  4JQ0 D;  2PMY A;  2SAS A;  5CSN A;  1GGW A;  4OKH A;  2JQ6 A;  2F33 A;  2PVB A;  1A29 A;  1ALW A;  1IG5 A;  1YRT B;  3C1V A;  4OV2 A;  5JOL A;  1NX3 A;  1W7I B;  1CDM A;  1SCV A;  2F3Y A;  1Y0V H;  1N0Y A;  1KQM C;  2IS9 A;  2LNK A;  4MBE A;  4CID A;  5KU1 A;  4MZJ A;  5I2L A;  4XYN A;  3LCP C;  1OMV A;  2LV7 A;  3PAT A;  1PSR A;  4GGF A;  3VRR A;  4UPG A;  3DD4 A;  4AQI A;  5HLO A;  1M46 A;  3AAJ A;  5I2Q A;  2K7D A;  2LUC A;  1D1O A;  1J55 A;  3KEV A;  2L98 A;  2KQY A;  1DJH A;  4F0Z B;  1J7R A;  2KI4 C;  4QJ4 B;  3NSO A;  2MAZ A;  2JOJ A;  2KGR A;  4M2O A;  1BF5 A;  2LHL A;  1TNQ A;  2PAS A;  3CWG A;  3JVT B;  1S36 A;  1TCF A;  3EKH A;  2TN4 A;  3CR4 X;  3EVV A;  1TRF A;  1NCY A;  3BYA A;  2G9B A;  2CBL A;  3I5G B;  3SG3 A;  5HKY A;  1J7P A;  2ZRS A;  4OCI A;  2BCB A;  2FOT A;  4USL A;  1CDN A;  4GBA A;  1A75 B;  2L5X B;  3TUY C;  2JT0 A;  1KK8 B;  1RFJ A;  3EK8 A;  1FBV A;  1LIN A;  1XK4 C;  5CSF A;  1BJF A;  2JTZ A;  1H8B A;  1B1G A;  3BUN B;  2K61 A;  1UHJ A;  3DVM A;  1S5G Y;  3SG6 A; 
#chains in the Genus database with same CATH topology
 1CLL A;  1C3Y A;  3FE6 A;  2NLN A;  3BFA A;  1LA0 A;  1OSA A;  4PAL A;  2GTE A;  3DVK A;  1SK6 D;  1DGU A;  4ZCU A;  1JC2 A;  2KFH A;  1F4Q A;  4GFT A;  1JFK A;  3FS7 A;  1BMO A;  3L47 A;  4N5X A;  1DGV A;  1Z2C B;  2CTN A;  2KI4 B;  1PUL A;  1XFX O;  2PYQ A;  5K89 A;  2VRG A;  3EK4 A;  5KTY A;  1JF2 A;  1OMD A;  2KNE A;  1QS7 A;  3WHT B;  2WCB A;  1F4O A;  1BG1 A;  2FCE A;  1BR4 B;  1B47 A;  4MLW A;  3TZ1 A;  2YGU A;  1S26 D;  1NCZ A;  1A75 A;  2EGD A;  1F71 A;  3CTN A;  2K2A A;  3SJS A;  1PVB A;  2L2C A;  4TNC A;  1KFU L;  1XFY O;  3NGV A;  2HQ8 A;  4DIR A;  3CAB A;  1S6I A;  2CXJ A;  2JU0 A;  1H4B A;  1OOF A;  1KWO B;  1K96 A;  3D10 A;  3H4S E;  3FE9 A;  1NWD A;  3NSI A;  2D8N A;  3CS1 A;  3AKB A;  1GJY A;  4MN0 A;  5FI7 A;  1DT7 B;  4JKT A;  3SS3 A;  3D75 A;  1MQ1 A;  2JZI A;  2Q4U A;  2BKH B;  3PN7 B;  5JJG A;  5CSI A;  1QX5 B;  2L50 A;  1BLQ A;  1AK8 A;  3GOF A;  1NSH A;  1DC1 A;  2E6W A;  2JNF A;  1WY9 A;  3BQ3 A;  4L9M A;  3B6X A;  3EK7 A;  3DY9 A;  4CFR A;  2Q91 A;  3RZS A;  3HX4 A;  1B8R A;  3A4U B;  3ZNI A;  4HRH A;  3WHU B;  1K2H A;  1M39 A;  3SG5 A;  1YUU A;  1WDC B;  2WC5 A;  1J7O A;  2LAP A;  2O60 A;  1NP8 A;  1DMO A;  3I5I C;  2MLE C;  2LMU A;  2ZNE A;  1FW4 A;  2WCJ A;  2Y4Q A;  3R1P A;  4NDC A;  2NZ0 A;  3GK1 A;  1CM4 A;  1REC A;  4PHJ A;  5B8I B;  1RWY A;  2QEB A;  4PT1 A;  4U8D A;  1SCM B;  1A2X A;  1SY9 A;  3S0E A;  1NCX A;  4E68 A;  2I18 A;  1B7T Y;  4NDB A;  4C0J A;  1AVS A;  4GPL B;  2PAL A;  5AER A;  4D1E A;  5DKN A;  1PAL A;  1G8I A;  1RRO A;  3BXK A;  1GQM A;  1K95 A;  3BUX B;  2WOS A;  2ZND A;  1QV1 A;  3BUW B;  3VRQ A;  1ALV A;  1NPQ A;  1G33 A;  2K8M B;  4ORB B;  3OX5 A;  2JT8 A;  5ER4 X;  1Y1X A;  1R6P A;  1L2O C;  5J3X A;  3A8R A;  2M9G A;  3OBV A;  3I5H C;  1CDP A;  1TWO A;  4PHM A;  2E30 A;  1K94 A;  2M49 B;  4PCW A;  1IWQ A;  2M7N A;  3SG7 A;  4P5O E;  1F8H A;  2OS8 B;  2M1K B;  1B9A A;  3WNX B;  1B8C A;  3OX6 A;  1GGZ A;  3O6B A;  5D7F A;  2M29 A;  2KHN A;  4INW A;  2L4I A;  2ZFD A;  1WRK A;  1S6J A;  4FQT A;  1SW8 A;  2KDH A;  2LCP A;  2KAV A;  1W7J B;  2WND A;  1ZAC A;  1CFD A;  2G2B A;  2KAX A;  4A4C A;  1J7Q A;  1T14 A;  1KSM A;  1DEK A;  3IQQ A;  4R1E A;  1K9U A;  4DRW A;  1OMR A;  1NIW A;  2BAP A;  2I2R E;  2OTG B;  4FTG A;  4XJK B;  2CNP A;  1XO5 A;  1EH2 A;  1F70 A;  1FPW A;  1Y6W A;  2BL0 C;  4YGE B;  5D3O A;  2ERB A;  2MA2 A;  2COL B;  1KK7 Y;  1M31 A;  1JFJ A;  3BUM B;  1IQ5 A;  1WRL A;  2KLE A;  2JPT A;  2L4H A;  3E3R A;  2LVK A;  3S0D A;  3PM8 A;  1LXF C;  2KBI A;  3PFV A;  2HPS A;  2FJU B;  5KSZ A;  2AUC A;  2K7B A;  2LVV A;  3TDZ A;  3CGA A;  1PK0 D;  1QIW A;  3CLN A;  4YGA A;  1OQP A;  3ICB A;  3KF9 A;  4HRE E;  3OP0 A;  1L2O B;  5GQQ C;  3CR2 A;  3I5H B;  4BY5 A;  2KQ6 A;  1KQM B;  1QVI Y;  2M1U A;  1VRK A;  4JD9 A;  1JF0 A;  1A03 A;  1NYA A;  2JUL A;  1QAS A;  3NSK A;  3O78 A;  3LL8 B;  1XFW O;  4YI9 A;  1PRW A;  1QLS A;  1QV0 A;  2DOQ A;  1KFX L;  4DCK A;  3K21 A;  3S0G A;  2WCM A;  3MSE B;  2BCA A;  1Z4H A;  2HET A;  1GM0 A;  1YUR A;  2BBN A;  5AXI A;  3GK4 X;  4XJK A;  3LLE A;  4YGD B;  3BOW B;  1ZFS A;  4YGC B;  2K60 A;  1AJ5 A;  2M0R A;  3CYZ A;  2Y5I A;  3TS5 C;  1HQV A;  3B86 A;  1R2U A;  1EJ3 A;  2R2I A;  2NXQ A;  3D76 A;  3KPX A;  1LA3 A;  4GGF C;  4NDD A;  1SSE B;  2L2E A;  2OPO A;  3O2P A;  5G08 A;  2CCM A;  3KO0 A;  1E8A A;  1IJ5 A;  2KYF A;  3EVR A;  3PLF B;  2A4J A;  3O4Y A;  4ZCV A;  4KYN A;  4PE4 A;  3BUO B;  1F55 A;  3FIA A;  4AOM A;  1PSB A;  2KPH A;  2MRD A;  2BL0 B;  3PSR A;  2WC6 A;  3TDU A;  2MBX A;  4CPV A;  2LLS A;  1YR5 A;  2L0P A;  1RTP 1;  1P28 A;  2JWW A;  3D77 A;  1QX2 A;  1OZO A;  1UHH A;  3LK1 A;  4IL1 A;  4F7F A;  1C07 A;  1XVJ A;  1AHR A;  2LP2 A;  5I2O A;  3Q8I A;  3OHM B;  3I5F C;  3TUY B;  3HCM A;  4IJ7 A;  4DS7 A;  2PSR A;  1BU3 A;  2O5G A;  1UHK A;  1OE9 B;  2K0J A;  3DVJ A;  2P6B B;  1MUX A;  1YVH A;  2AAO A;  2LLT A;  1UUS A;  1DTL A;  1F54 A;  3BFB A;  1NX0 A;  4MZL A;  4PDZ A;  2SCP A;  4CLN A;  4MZK A;  1V1F A;  4ICB A;  1RK9 A;  1TCO B;  1CMG A;  1IQ3 A;  1NX2 A;  1PVA A;  4QJ3 B;  3RLZ A;  3BOW A;  4HSZ A;  5IBW A;  1IH0 A;  1TTX A;  1CFF A;  3NHT A;  5AAN A;  2F2P A;  3AKA A;  3DF0 B;  2KYC A;  1HT9 A;  1SL8 A;  3FE8 A;  1KSO A;  1DJI A;  4ORC B;  4MRX A;  5AFP A;  2H61 C;  1MXE A;  2JNX A;  3SIB A;  2I7A A;  2LP3 A;  2KLD A;  1YUT A;  3D78 A;  5HYD A;  2K7O A;  2QEO A;  1K9P A;  1MF8 B;  1XA5 A;  2GV5 A;  3SG2 A;  1IJ6 A;  2KSP A;  3TS5 B;  1J1D A;  1NX1 A;  5DKQ A;  1M45 A;  2JRF A;  2I94 A;  2Y1N A;  1S3P A;  1SL9 A;  3GK2 A;  5ER5 A;  2JPO A;  1DJY A;  3CR5 X;  1L7Z A;  5EL2 A;  3VRO A;  5I8N A;  5CPV A;  4MSP A;  1XK4 A;  1DVI A;  2B1U A;  2MJW B;  3IQO A;  1CKK A;  4OR9 B;  5HKZ A;  3B7A A;  2JXL A;  1S5G Z;  2BEC A;  4C0L A;  1U5I B;  1LS8 A;  2F2O A;  2MHH A;  1FI5 A;  1YX7 A;  1TNX A;  1YVL A;  3R1V A;  3CZ2 A;  3O4X A;  3JTD C;  2LC5 A;  2ZKM X;  3TDI A;  1KK8 C;  4WQ3 A;  1XYD A;  3DF0 A;  2PRU A;  3EVU A;  1KQV A;  1DF0 B;  1W9Z A;  3PJI A;  3R72 A;  2H2K A;  4WRI A;  1CDL A;  3S0F A;  5BPJ A;  1CLB A;  1SKT A;  2BCX A;  2ISD A;  1DJX A;  5PAL A;  1WLM A;  3RM1 A;  1IIO A;  1Q80 A;  2L51 A;  3I5I B;  1QJT A;  1NUB A;  1J1E A;  2EC6 C;  4AQJ A;  1ORG A;  2M97 A;  3N7H A;  4JPZ B;  1LVC D;  1YRU B;  3R1O A;  1DJW A;  3D0Y A;  2BE4 A;  1IRJ A;  3NXA A;  1TIZ A;  3S0B A;  1YTZ C;  1KCY A;  1SMG A;  2LMT A;  1Y1A A;  3VGO A;  4GGN A;  1CLM A;  1ZMZ A;  3B87 A;  3AAK A;  4DUQ A;  2KI6 C;  2NCP A;  1TN4 A;  1C3Z A;  1S6C A;  1UHI A;  3QME A;  4GUK A;  2FJY A;  3OB1 B;  1DQE A;  1K93 D;  1QLK A;  2LUX A;  2WC8 A;  4I5L B;  4QJ5 B;  1JUO A;  2JT3 A;  3CDN A;  3SS5 A;  4PE7 A;  1U5I A;  2ZN8 A;  2BKI B;  2KBM A;  2BNX A;  4I5J A;  4C0K A;  4PHK A;  2HQW A;  3EG5 B;  1UUR A;  4INX A;  4NQG A;  4FQO A;  1TUZ A;  1BOC A;  1N2D A;  1MR8 A;  3BFH A;  2F8P A;  2FCD A;  2QPT A;  1ZOT B;  1SBJ A;  3EKJ A;  1DF0 A;  2WCK A;  5CSJ A;  1ZUZ A;  1KWO C;  1AJ4 A;  2KOT A;  2QAC A;  2L5Y A;  1JSA A;  1OOH A;  4PHN A;  3ZWH A;  2QDI A;  4YGB B;  3SIA A;  4YRU A;  1TOP A;  1IKU A;  2KFF A;  3JTD B;  1BOD A;  3DZT A;  3PN7 C;  1LKJ A;  1TUJ A;  2LHI A;  1CFC A;  1CM1 A;  3IF7 A;  1CB1 A;  3BJH A;  1B7T Z;  2H61 A;  3DVE A;  4PE1 A;  1N65 A;  2JXC A;  1TNW A;  5TNC A;  1JWD A;  1CMF A;  3CZT X;  2LVI A;  1DJZ A;  3FWB A;  1WDC C;  4JWQ A;  2EC6 B;  1Y1U A;  2PQL A;  1OOI X;  3PM2 A;  1XFV O;  3D74 A;  1V1G A;  4OVN F;  1QX7 A;  1OZS A;  2GGZ A;  4Q04 A;  5D69 A;  2WCF A;  1SRA A;  1IGV A;  3PAL A;  2M3W A;  2LM5 A;  3D73 A;  3OGN A;  4PE0 A;  1AP4 A;  2GGM A;  1S1E A;  1SR6 C;  2EHB A;  1EXR A;  1EG3 A;  1SCM C;  3M0W A;  3VB1 A;  1YX8 A;  1X02 A;  3FWC A;  2K7C A;  2KI6 D;  4I5K A;  1C7V A;  4M2P A;  1SL7 A;  2H8V A;  3F45 A;  3QRX A;  1JBA A;  1XFZ O;  1SYM A;  1UHN A;  1RJV A;  3NSL A;  2LVJ A;  1UP5 A;  1MXL C;  1WRZ A;  2WCE A;  1SNL A;  5HKW A;  1EG4 A;  2Y1M A;  1MWN A;  1DJG A;  4YBH B;  3VRN A;  1BR1 B;  1K8U A;  4MVF A;  5DKR A;  1SPY A;  2K2F A;  4OZD A;  1KFX S;  2WOR A;  2V53 A;  4N1F A;  3DYE A;  2AMI A;  1QIV A;  2OS8 C;  4MRY A;  4HRG A;  4GAO A;  4M2Q A;  2BBM A;  2LE9 B;  3KHE A;  1EL4 A;  2LAN A;  3SS4 A;  2MLF C;  1CTR A;  1OW4 A;  3V2L A;  1M63 B;  1QTX A;  2ZRT A;  1KK7 Z;  2BE6 A;  1K9K A;  3LK0 A;  4N1G A;  3VRP A;  1XFU O;  3B88 A;  2NCO A;  2RGI A;  3CZ0 A;  3OB2 B;  4P2Y B;  1XFR A;  1B4C A;  3NHI A;  5F6T A;  3D0Y B;  2F3Z A;  2QEH A;  1B8L A;  2JTT A;  1UWO A;  4GNK B;  1CFP A;  4I5N B;  1KFU S;  4WQ2 A;  1FF1 A;  5HLV A;  1YUS A;  4A4B A;  5HL1 A;  3JVT C;  1BT6 A;  1WLZ A;  1G4Y R;  5AEQ A;  2OTG C;  3CZ1 A;  1FI6 A;  1TNP A;  1AUI B;  2LLU A;  2JC2 A;  1QAT A;  4ORA B;  1QVI Z;  1A4P A;  1MHO A;  2KGB C;  1SR6 B;  2LMV A;  2M8U A;  2HF5 A;  3I5G C;  3L4L A;  2M7L A;  1QXP A;  1K90 D;  2CT9 A;  4MEW A;  3I5F B;  3WXA A;  5FYX A;  4ETO A;  2ZN9 A;  4YI8 A;  3K1E A;  2KFG A;  4BY4 A;  2P71 A;  2WCL A;  1C7W A;  1ODB A;  4CFQ A;  1OOJ A;  2KAY A;  1CNP A;  3SG4 A;  4JQ0 D;  2PMY A;  2SAS A;  5CSN A;  3UO9 A;  1GGW A;  4OKH A;  2JQ6 A;  2F33 A;  2PVB A;  1A29 A;  1ALW A;  1IG5 A;  1YRT B;  3C1V A;  4OV2 A;  5JOL A;  1NX3 A;  1W7I B;  1CDM A;  1OOG A;  1SCV A;  2F3Y A;  1Y0V H;  1N0Y A;  1KQM C;  2IS9 A;  2LNK A;  4MBE A;  4CID A;  5KU1 A;  4MZJ A;  5I2L A;  4XYN A;  3LCP C;  5DIC A;  1OMV A;  2LV7 A;  3PAT A;  1PSR A;  4GGF A;  3VRR A;  4UPG A;  3DD4 A;  4AQI A;  2WCH A;  5HLO A;  1M46 A;  3AAJ A;  5I2Q A;  2K7D A;  2LUC A;  1D1O A;  1J55 A;  5I94 A;  3KEV A;  2L98 A;  2KQY A;  1DJH A;  4F0Z B;  1J7R A;  2KI4 C;  4QJ4 B;  3NSO A;  2MAZ A;  2JOJ A;  2KGR A;  4M2O A;  1BF5 A;  2LHL A;  1TNQ A;  2PAS A;  3CWG A;  3JVT B;  1S36 A;  1TCF A;  3EKH A;  3UNW A;  2TN4 A;  3CR4 X;  3EVV A;  5FI2 A;  1TRF A;  1NCY A;  2P70 A;  3BYA A;  2G9B A;  2CBL A;  3I5G B;  3SG3 A;  5HKY A;  3S0A A;  1J7P A;  2ZRS A;  4OCI A;  2BCB A;  2FOT A;  4USL A;  1CDN A;  4GBA A;  1A75 B;  2L5X B;  2QEV A;  3TUY C;  2JT0 A;  1KK8 B;  1RFJ A;  3EK8 A;  1FBV A;  1LIN A;  3IVT A;  1XK4 C;  5CSF A;  1BJF A;  2JTZ A;  3L4A A;  1H8B A;  1B1G A;  3BUN B;  2K61 A;  1DEL A;  1UHJ A;  3DXL A;  1QWV A;  3DVM A;  5FI6 A;  1S5G Y;  3SG6 A; 
#chains in the Genus database with same CATH homology
 1CLL A;  2NLN A;  4PAL A;  1LA0 A;  1OSA A;  3DVK A;  1SK6 D;  1DGU A;  4ZCU A;  1JC2 A;  2KFH A;  1F4Q A;  4GFT A;  1JFK A;  3FS7 A;  1BMO A;  4N5X A;  1DGV A;  2CTN A;  2KI4 B;  1PUL A;  1XFX O;  5K89 A;  5KTY A;  2VRG A;  3EK4 A;  1JF2 A;  1OMD A;  2KNE A;  1QS7 A;  3WHT B;  2WCB A;  1F4O A;  1BG1 A;  2FCE A;  1BR4 B;  1B47 A;  4MLW A;  3TZ1 A;  1S26 D;  1NCZ A;  1A75 A;  2EGD A;  1F71 A;  3CTN A;  2K2A A;  3SJS A;  1PVB A;  4TNC A;  1KFU L;  1XFY O;  4DIR A;  2HQ8 A;  1S6I A;  2CXJ A;  2JU0 A;  1H4B A;  1KWO B;  1K96 A;  3D10 A;  3H4S E;  3NSI A;  1NWD A;  2D8N A;  3CS1 A;  3AKB A;  1GJY A;  4MN0 A;  1DT7 B;  1MQ1 A;  2JZI A;  2Q4U A;  2BKH B;  3PN7 B;  5JJG A;  5CSI A;  1QX5 B;  2L50 A;  1BLQ A;  1AK8 A;  3GOF A;  1NSH A;  2E6W A;  2JNF A;  1WY9 A;  3BQ3 A;  4L9M A;  4CFR A;  3EK7 A;  2Q91 A;  3HX4 A;  1B8R A;  3A4U B;  3ZNI A;  4HRH A;  3WHU B;  1K2H A;  1M39 A;  3SG5 A;  1YUU A;  1WDC B;  1J7O A;  2LAP A;  2O60 A;  1NP8 A;  1DMO A;  3I5I C;  2MLE C;  2LMU A;  2ZNE A;  1FW4 A;  2Y4Q A;  4NDC A;  2NZ0 A;  3GK1 A;  1CM4 A;  1REC A;  4PHJ A;  5B8I B;  1RWY A;  4U8D A;  1SCM B;  1A2X A;  1SY9 A;  4E68 A;  1NCX A;  2I18 A;  1B7T Y;  4NDB A;  4C0J A;  1AVS A;  4GPL B;  2PAL A;  5AER A;  4D1E A;  5DKN A;  1PAL A;  1G8I A;  1RRO A;  3BXK A;  1GQM A;  1K95 A;  3BUX B;  2WOS A;  2ZND A;  1QV1 A;  3BUW B;  3VRQ A;  1ALV A;  1NPQ A;  1G33 A;  2K8M B;  4ORB B;  3OX5 A;  2JT8 A;  5ER4 X;  1Y1X A;  1R6P A;  1L2O C;  5J3X A;  3A8R A;  2M9G A;  3I5H C;  1CDP A;  4PHM A;  2E30 A;  1K94 A;  2M49 B;  4PCW A;  1IWQ A;  2M7N A;  3SG7 A;  4P5O E;  1F8H A;  2OS8 B;  2M1K B;  1B9A A;  3WNX B;  1B8C A;  3OX6 A;  1GGZ A;  3O6B A;  5D7F A;  2M29 A;  2KHN A;  2L4I A;  2ZFD A;  1WRK A;  1S6J A;  1SW8 A;  2KDH A;  2LCP A;  2KAV A;  1W7J B;  2WND A;  1ZAC A;  1CFD A;  2G2B A;  2KAX A;  4A4C A;  1J7Q A;  4DRW A;  1KSM A;  3IQQ A;  4R1E A;  1K9U A;  1OMR A;  1NIW A;  2I2R E;  2OTG B;  4FTG A;  4XJK B;  2CNP A;  1XO5 A;  1EH2 A;  1F70 A;  1FPW A;  1Y6W A;  2BL0 C;  4YGE B;  2MA2 A;  2COL B;  1KK7 Y;  1M31 A;  1JFJ A;  3BUM B;  1IQ5 A;  1WRL A;  2JPT A;  2L4H A;  3E3R A;  2LVK A;  3PM8 A;  1LXF C;  2KBI A;  3PFV A;  2HPS A;  2FJU B;  5KSZ A;  2AUC A;  2K7B A;  2LVV A;  3TDZ A;  3CGA A;  1PK0 D;  1QIW A;  3CLN A;  4YGA A;  1OQP A;  3ICB A;  3KF9 A;  4HRE E;  3OP0 A;  1L2O B;  5GQQ C;  3CR2 A;  3I5H B;  4BY5 A;  2KQ6 A;  1KQM B;  1QVI Y;  2M1U A;  1VRK A;  1A03 A;  1JF0 A;  1NYA A;  2JUL A;  1QAS A;  3NSK A;  3O78 A;  3LL8 B;  1XFW O;  4YI9 A;  1PRW A;  1QLS A;  1QV0 A;  2DOQ A;  1KFX L;  4DCK A;  3K21 A;  3MSE B;  2BCA A;  2HET A;  1YUR A;  2BBN A;  5AXI A;  3GK4 X;  4XJK A;  3LLE A;  4YGD B;  3BOW B;  1ZFS A;  4YGC B;  1AJ5 A;  2M0R A;  2Y5I A;  3TS5 C;  1HQV A;  1R2U A;  1EJ3 A;  2R2I A;  2NXQ A;  3KPX A;  1LA3 A;  4GGF C;  4NDD A;  2L2E A;  3O2P A;  2OPO A;  5G08 A;  2CCM A;  3KO0 A;  1E8A A;  1IJ5 A;  2KYF A;  3EVR A;  3PLF B;  2A4J A;  3O4Y A;  4ZCV A;  4PE4 A;  3BUO B;  1F55 A;  3FIA A;  4AOM A;  1PSB A;  2MRD A;  2BL0 B;  3PSR A;  3TDU A;  4CPV A;  2MBX A;  2LLS A;  1YR5 A;  2L0P A;  1RTP 1;  2JWW A;  3LK1 A;  1QX2 A;  1OZO A;  1UHH A;  4IL1 A;  1F54 A;  1C07 A;  1XVJ A;  1AHR A;  2LP2 A;  5I2O A;  3OHM B;  3I5F C;  3TUY B;  3HCM A;  4DS7 A;  2PSR A;  1BU3 A;  2O5G A;  1UHK A;  1OE9 B;  2K0J A;  3DVJ A;  2P6B B;  1MUX A;  1YVH A;  2AAO A;  2LLT A;  1UUS A;  1DTL A;  1NX0 A;  4MZL A;  4PDZ A;  2SCP A;  4CLN A;  4MZK A;  1V1F A;  4ICB A;  1RK9 A;  1TCO B;  1CMG A;  1IQ3 A;  1NX2 A;  1PVA A;  4QJ3 B;  3RLZ A;  3BOW A;  4HSZ A;  5IBW A;  1IH0 A;  1TTX A;  1CFF A;  5AAN A;  2F2P A;  3AKA A;  3DF0 B;  2KYC A;  1HT9 A;  1SL8 A;  1KSO A;  1DJI A;  4ORC B;  4MRX A;  5AFP A;  2H61 C;  1MXE A;  2JNX A;  3SIB A;  2I7A A;  2LP3 A;  1YUT A;  5HYD A;  2K7O A;  1K9P A;  1MF8 B;  1XA5 A;  2GV5 A;  3SG2 A;  1IJ6 A;  2KSP A;  3TS5 B;  1J1D A;  1NX1 A;  5DKQ A;  1M45 A;  2JRF A;  2I94 A;  2Y1N A;  1S3P A;  1SL9 A;  3GK2 A;  5ER5 A;  1DJY A;  3CR5 X;  1L7Z A;  3VRO A;  5I8N A;  5CPV A;  4MSP A;  1XK4 A;  1DVI A;  2B1U A;  2MJW B;  3IQO A;  1CKK A;  4OR9 B;  5HKZ A;  2JXL A;  1S5G Z;  2BEC A;  4C0L A;  1U5I B;  2F2O A;  1FI5 A;  2MHH A;  1YX7 A;  1TNX A;  1YVL A;  3JTD C;  2LC5 A;  2ZKM X;  3TDI A;  1KK8 C;  4WQ3 A;  1XYD A;  3DF0 A;  2PRU A;  3EVU A;  1KQV A;  1DF0 B;  2H2K A;  4WRI A;  1CDL A;  5BPJ A;  1CLB A;  1SKT A;  2BCX A;  2ISD A;  1DJX A;  5PAL A;  1WLM A;  3RM1 A;  1Q80 A;  2L51 A;  3I5I B;  1QJT A;  1NUB A;  1J1E A;  2EC6 C;  4AQJ A;  2M97 A;  4JPZ B;  1LVC D;  1YRU B;  1DJW A;  3D0Y A;  2BE4 A;  1IRJ A;  3NXA A;  1TIZ A;  1YTZ C;  1KCY A;  1SMG A;  2LMT A;  1Y1A A;  3VGO A;  4GGN A;  1CLM A;  1ZMZ A;  3AAK A;  4DUQ A;  2KI6 C;  2NCP A;  1TN4 A;  1UHI A;  1S6C A;  4GUK A;  3OB1 B;  2WC8 A;  1K93 D;  1QLK A;  2LUX A;  4I5L B;  4QJ5 B;  1JUO A;  2JT3 A;  4PE7 A;  1U5I A;  2ZN8 A;  2BKI B;  2KBM A;  4I5J A;  4C0K A;  4PHK A;  2HQW A;  1UUR A;  4NQG A;  4FQO A;  1BOC A;  1N2D A;  1MR8 A;  2F8P A;  2FCD A;  2QPT A;  1ZOT B;  1SBJ A;  3EKJ A;  1DF0 A;  5CSJ A;  1ZUZ A;  1KWO C;  1AJ4 A;  2KOT A;  2QAC A;  1JSA A;  4PHN A;  3ZWH A;  3SIA A;  4YGB B;  4YRU A;  1TOP A;  1IKU A;  2KFF A;  3JTD B;  1BOD A;  3PN7 C;  1LKJ A;  2LHI A;  1CFC A;  1CM1 A;  3IF7 A;  1CB1 A;  1B7T Z;  2H61 A;  3DVE A;  4PE1 A;  1N65 A;  2JXC A;  1TNW A;  5TNC A;  1JWD A;  1CMF A;  3CZT X;  2LVI A;  1DJZ A;  3FWB A;  1WDC C;  4JWQ A;  2EC6 B;  1Y1U A;  1XFV O;  1V1G A;  4OVN F;  1QX7 A;  1OZS A;  2GGZ A;  4Q04 A;  5D69 A;  2WCF A;  1SRA A;  1IGV A;  3PAL A;  2M3W A;  2LM5 A;  4PE0 A;  1AP4 A;  2GGM A;  1S1E A;  1SR6 C;  2EHB A;  1EXR A;  1EG3 A;  1SCM C;  3M0W A;  1YX8 A;  1X02 A;  3FWC A;  2K7C A;  2KI6 D;  4I5K A;  1C7V A;  4M2P A;  1SL7 A;  3F45 A;  3QRX A;  1JBA A;  1XFZ O;  1SYM A;  1UHN A;  1RJV A;  3NSL A;  2LVJ A;  1UP5 A;  1MXL C;  1WRZ A;  2WCE A;  1SNL A;  5HKW A;  1EG4 A;  2Y1M A;  1MWN A;  1DJG A;  4YBH B;  3VRN A;  1BR1 B;  1K8U A;  4MVF A;  5DKR A;  1SPY A;  2K2F A;  1KFX S;  2WOR A;  2V53 A;  4N1F A;  2AMI A;  1QIV A;  2OS8 C;  4MRY A;  4HRG A;  4GAO A;  4M2Q A;  2BBM A;  2LE9 B;  3KHE A;  1EL4 A;  2LAN A;  2MLF C;  1CTR A;  1M63 B;  1QTX A;  2ZRT A;  1KK7 Z;  2BE6 A;  1K9K A;  3LK0 A;  4N1G A;  3VRP A;  1XFU O;  2NCO A;  2RGI A;  3OB2 B;  4P2Y B;  1B4C A;  5F6T A;  3D0Y B;  2F3Z A;  1B8L A;  2JTT A;  1UWO A;  4GNK B;  1CFP A;  4I5N B;  1KFU S;  4WQ2 A;  1FF1 A;  5HLV A;  1YUS A;  4A4B A;  3JVT C;  1BT6 A;  1WLZ A;  1G4Y R;  5AEQ A;  2OTG C;  1FI6 A;  1TNP A;  1AUI B;  2LLU A;  2JC2 A;  1QAT A;  4ORA B;  1QVI Z;  1A4P A;  1MHO A;  2KGB C;  1SR6 B;  2LMV A;  2M8U A;  2HF5 A;  3I5G C;  2M7L A;  1QXP A;  1K90 D;  2CT9 A;  4MEW A;  3I5F B;  3WXA A;  5FYX A;  4ETO A;  2ZN9 A;  4YI8 A;  4BY4 A;  2KFG A;  1C7W A;  1ODB A;  4CFQ A;  1OOJ A;  2KAY A;  1CNP A;  3SG4 A;  4JQ0 D;  2PMY A;  2SAS A;  5CSN A;  1GGW A;  4OKH A;  2JQ6 A;  2F33 A;  2PVB A;  1A29 A;  1ALW A;  1IG5 A;  1YRT B;  3C1V A;  4OV2 A;  5JOL A;  1NX3 A;  1W7I B;  1CDM A;  1SCV A;  2F3Y A;  1Y0V H;  1N0Y A;  1KQM C;  2IS9 A;  2LNK A;  4MBE A;  4CID A;  5KU1 A;  4MZJ A;  5I2L A;  4XYN A;  3LCP C;  1OMV A;  2LV7 A;  3PAT A;  1PSR A;  4GGF A;  3VRR A;  4UPG A;  3DD4 A;  4AQI A;  5HLO A;  1M46 A;  3AAJ A;  5I2Q A;  2K7D A;  2LUC A;  1D1O A;  1J55 A;  3KEV A;  2L98 A;  2KQY A;  1DJH A;  4F0Z B;  1J7R A;  2KI4 C;  4QJ4 B;  3NSO A;  2MAZ A;  2JOJ A;  2KGR A;  4M2O A;  1BF5 A;  2LHL A;  1TNQ A;  2PAS A;  3CWG A;  3JVT B;  1S36 A;  1TCF A;  3EKH A;  2TN4 A;  3CR4 X;  3EVV A;  1TRF A;  1NCY A;  3BYA A;  2G9B A;  2CBL A;  3I5G B;  3SG3 A;  5HKY A;  1J7P A;  2ZRS A;  4OCI A;  2BCB A;  2FOT A;  4USL A;  1CDN A;  4GBA A;  1A75 B;  2L5X B;  3TUY C;  2JT0 A;  1KK8 B;  1RFJ A;  3EK8 A;  1FBV A;  1LIN A;  1XK4 C;  5CSF A;  1BJF A;  2JTZ A;  1H8B A;  1B1G A;  3BUN B;  2K61 A;  1UHJ A;  3DVM A;  1S5G Y;  3SG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...