2KAVA

Solution structure of the human voltage-gated sodium channel, brain isoform (nav1.2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
ENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium channel protein type 2 subunit alpha
publication title Solution structure of the NaV1.2 C-terminal EF-hand domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein regulator
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kavA01
3CLNA 2E30A 1ALVA 3I5IC 3SG2A 3CS1A 1B8RA 5CSNA 3VGOA 2KFFA 2BL0B 2FCEA 4GGFC 4R1EA 4CPVA 3RM1A 1YR5A 1CM4A 4YGEB 5F6TA 4YGDB 2JXCA 1RTP1 1QV1A 2JPTA 2R2IA 1FI6A 2KOTA 4YI8A 2L0PA 2K8MB 2HQ8A 4MSPA 2ZRTA 1J1EA 2LHLA 2L2EA 3D10A 1SCVA 1UHJA 2A4JA 3NSIA 1B4CA 1OMDA 1CMFA 1Y0VH 1K9PA 1LXFC 1YRTB 1IJ5A 1CTRA 1PVAA 2KNEA 1TN4A 4MZLA 3EKHA 2MRDA 3BXKA 3VRRA 3I5GC 1QLSA 4N1FA 4DS7A 4E68A 5CSFA 1JBAA 3FIAA 1ZFSA 5CSIA 5JJGA 1YVLA 1AHRA 3I5FB 3IQOA 3DVKA 1KFXS 2OS8C 1EH2A 1F71A 1YVHA 2M97A 3KF9A 1V1FA 1XK4A 4MN0A 5ER5A 1PULA 3CTNA 1N0YA 1SL7A 1CDMA 1AVSA 1BR1B 1JF0A 2BBNA 3OB1B 2KI6D 1QTXA 4M2QA 3I5IB 4UPGA 5B8IB 1QS7A 3LLEA 1YUSA 3F45A 1NIWA 5KTYA 2OTGC 1TIZA 1KK8C 2FOTA 4C0JA 2WOSA 1MF8B 1CFFA 1F70A 4PE1A 2HPSA 1PVBA 1S6CA 2NLNA 2WORA 3NSLA 2IS9A 1M31A 1SCMB 1SPYA 4GGNA 2ZN8A 1OZOA 1OZSA 2CT9A 2JNFA 1QX2A 1SMGA 2G2BA 3DF0B 3SG3A 1DJGA 4ZCVA 1LINA 3FWCA 1K94A 2LP3A 3NSOA 1IJ6A 5K89A 3A8RA 1S26D 1RFJA 2EC6C 5AERA 1NX2A 2DOQA 3NSKA 1KSMA 1ZOTB 1L2OC 1TCOB 3SG4A 2WCBA 4TNCA 4HRHA 1M45A 3EKJA 1AUIB 1F8HA 2LE9B 3PM8A 1J7PA 3I5GB 1L7ZA 2BL0C 4N1GA 4DIRA 1CNPA 1R6PA 1K95A 2JWWA 3BOWB 1V1GA 1XFWO 3AKBA 1G33A 1QLKA 1CDLA 4I5LB 1HT9A 1K2HA 3D0YA 1A03A 1IH0A 1J7RA 3CR2A 1YX7A 3BUMB 5D7FA 5HKYA 3SJSA 4MEWA 5J3XA 5DKQA 1UHNA 2WCFA 2K2AA 3O4YA 3JTDB 1CB1A 2CNPA 4IL1A 4OR9B 2LANA 1MWNA 1NSHA 2JZIA 2BE4A 1Q80A 1OSAA 1LA3A 4MBEA 4GFTA 3EVUA 2JTZA 4OKHA 3K21A 2KBMA 2P6BB 2KSPA 4F0ZB 1FW4A 2LVIA 1DGUA 1TNXA 2BCBA 1PRWA 2K7BA 1QV0A 3PSRA 1A75A 3EK7A 1JF2A 1WRKA 1E8AA 2L4HA 2ZNEA 2LV7A 1XYDA 3CR5X 1JFKA 1CM1A 3GK2A 2LAPA 1K90D 2KAYA 2CCMA 3BUXB 1A4PA 2EC6B 2HF5A 1XFZO 1G8IA 4CFRA 4ICBA 2KGRA 4DCKA 1M39A 1Y6WA 3BYAA 3CZTX 1NYAA 1F4QA 1UHHA 2JT3A 2KGBC 4HREE 1QX5B 2WCEA 4DRWA 1NX1A 1SL8A 4NDDA 1KFUL 1IQ5A 2WNDA 1F55A 4P5OE 1ZMZA 1IG5A 1JC2A 1QIVA 1UHIA 1CDPA 1DF0A 3WXAA 1DTLA 2ZNDA 1LVCD 2L4IA 1IQ3A 3AKAA 1SCMC 1UHKA 1JUOA 1W7IB 3JVTC 1QX7A 2KYCA 1DGVA 3TDZA 4DUQA 3ZNIA 2JNXA 1NP8A 4A4BA 1CFCA 1BLQA 1M63B 1W7JB 5AFPA 5AANA 1NCZA 2F3ZA 1U5IA 1PSRA 2LNKA 2MAZA 3TDIA 3EVRA 1KQVA 4L9MA 4PCWA 1AJ5A 2LLTA 1TNPA 4CIDA 3LCPC 1K9UA 4CFQA 1IKUA 3IQQA 1IRJA 2LHIA 2VRGA 2K7CA 5IBWA 1HQVA 2BBMA 3CWGA 1XFYO 4YGBB 5DKRA 2MA2A 2JT0A 4WRIA 2MLEC 1A2XA 1K8UA 2M49B 1SL9A 4JQ0D 1QXPA 2F2OA 4I5JA 3WHTB 1CFPA 1UUSA 1UURA 3MSEB 2BKIB 2K2FA 3JTDC 1WY9A 4M2PA 1N2DA 2JU0A 4MZJA 4YGCB 1D1OA 4NQGA 3M0WA 1XO5A 4ZCUA 3KHEA 3VROA 4PE7A 1YURA 2BE6A 3TZ1A 4XJKB 1MQ1A 1TRFA 1ZACA 2WC8A 2KAVA 2OPOA 1NX0A 4JWQA 2KFGA 1YTZC 1CMGA 4C0LA 4PHNA 2JTTA 2MJWB 3OHMB 4C0KA 1B8LA 1K96A 4YBHB 3D0YB 3JVTB 5HLVA 4BY4A 1EG3A 1DJHA 4USLA 4YI9A 5AXIA 1QIWA 2LCPA 1TOPA 2GGZA 5FYXA 2EGDA 1KCYA 5CSJA 4YRUA 4GAOA 1QATA 1BMOA 4I5KA 4OVNF 1BJFA 4ORBB 2BCAA 1YX8A 1JSAA 1DJIA 1DVIA 1F4OA 1H8BA 3LK1A 2BECA 3PALA 3WHUB 3E3RA 1QASA 3BUOB 1B8CA 1BR4B 1QVIY 2PRUA 2L50A 1A75B 1BT6A 1BU3A 5CPVA 4BY5A 2L98A 4NDCA 4M2OA 1GQMA 1CLLA 2LMUA 2MLFC 3DVJA 2I94A 1AJ4A 3H4SE 3KEVA 1FI5A 1C07A 3C1VA 3SIBA 1KSOA 1OMRA 1RECA 1EJ3A 1XK4C 1TNQA 2LMVA 4AOMA 1FPWA 1GJYA 3CR4X 4MRYA 4GGFA 5G08A 1CDNA 2BKHB 3O6BA 2NCPA 2Y4QA 4N5XA 2F33A 2HETA 4FTGA 5ER4X 5BPJA 4NDBA 2MHHA 3BQ3A 2B1UA 4MVFA 4PALA 5HKZA 3I5HC 3DD4A 1DJWA 1DF0B 2NCOA 4PHMA 3O78A 4QJ3B 1K9KA 1OMVA 1TTXA 2LMTA 4U8DA 1S6IA 2AUCA 2LVKA 3SG6A 2F3YA 2HQWA 1TNWA 4MZKA 1KWOB 2FJUB 4MRXA 1S5GY 1SBJA 1KQMB 1RK9A 1MR8A 2LLSA 4P2YB 1U5IB 2LVJA 1LA0A 2AMIA 2Y1NA 3SG5A 1J1DA 1SNLA 5D69A 1JWDA 1NCYA 3AAKA 1XVJA 2CTNA 1FBVA 2LVVA 1XFXO 3GK4X 2KBIA 1Y1XA 3FWBA 3PFVA 1F54A 5AEQA 1WRLA 1SRAA 2TN4A 3KO0A 1WLZA 4AQJA 1M46A 1N65A 2KI6C 1R2UA 2K61A 1AK8A 3KPXA 1WLMA 2M1UA 3PN7B 2I18A 1S6JA 1XFUO 3RLZA 1ZUZA 2F2PA 1B47A 4PE0A 3TUYB 1K93D 1B9AA 3HX4A 4A4CA 4YGAA 1SY9A 1MXEA 1C7WA 3LK0A 1KK7Y 4OCIA 1CLBA 1MUXA 2JOJA 4HSZA 2M0RA 2Q91A 3PATA 1NX3A 2M9GA 4D1EA 2NXQA 1OE9B 1EXRA 3I5HB 1H4BA 1QVIZ 2COLB 2EHBA 2I2RE 2KQYA 3TDUA 2LM5A 5I2QA 2ZN9A 4I5NB 3BUWB 2KDHA 1DT7B 2M8UA 5GQQC 2Y1MA 1G4YR 2AAOA 1L2OB 2JC2A 2M3WA 2BCXA 1SKTA 3LL8B 4PDZA 1J55A 2KI4B 2PVBA 3OX6A 2M7NA 2V53A 2H61A 1EL4A 4JPZB 2ISDA 1CKKA 3ZWHA 1WDCC 2L51A 2JULA 3EVVA 1B1GA 1BG1A 1IWQA 5KSZA 2LUCA 1SW8A 1YUTA 1MHOA 2NZ0A 2KHNA 1MXLC 1DJYA 1RWYA 1LKJA 1UP5A 2JQ6A 4GBAA 4WQ2A 2CBLA 1EG4A 1NCXA 3BUNB 4MLWA 1OOJA 2Q4UA 3SIAA 2K7DA 3OB2B 4OV2A 4Q04A 4PHJA 3TS5B 5I2LA 4AQIA 5KU1A 2JXLA 1B7TY 1S1EA 2LUXA 1DJZA 2SCPA 2K7OA 1VRKA 2K0JA 1S5GZ 1KWOC 3DVEA 1QJTA 1KQMC 1IGVA 2JT8A 1GGWA 3VRPA 3WNXB 2O5GA 2I7AA 5TNCA 2KFHA 3GK1A 1JFJA 4PHKA 2ZKMX 2ZFDA 2O60A 1DJXA 1RJVA 4GPLB 2CXJA 4ORCB 1J7QA 1YRUB 1GGZA 5HKWA 1XFVO 2SASA 1OQPA 3OP0A 3GOFA 3PN7C 1BF5A 1X02A 2L5XB 1KFUS 4ORAB 4XYNA 1NUBA 3TUYC 1SR6C 3FS7A 1S3PA 1Y1UA 2PSRA 4GNKB 1KFXL 1CLMA 3AAJA 3QRXA 4QJ4B 3EK4A 1WRZA 2JRFA 1KK7Z 2LLUA 1WDCB 4XJKA 2KAXA 2H61C 1BODA 3NXAA 4GUKA 1TCFA 3O2PA 2KQ6A 2ZRSA 1YUUA 4QJ5B 1SYMA 1PSBA 2OS8B 3OX5A 2M7LA 2GV5A 3CGAA 4HRGA 3SG7A 5PALA 3VRQA 3DF0A 3EK8A 3A4UB 1AP4A 2LP2A 5I8NA 1A29A 1SK6D 2M29A 2Y5IA 1DMOA 1Y1AA 1ODBA 2PASA 5DKNA 2QACA 2M1KB 2FCDA 2H2KA 2LC5A 5JOLA 1XA5A 1NWDA 2D8NA 2KI4C 1J7OA 1C7VA 1PALA 4WQ3A 5I2OA 2OTGB 4ETOA 1KK8B 1FF1A 2E6WA 3ICBA 2PALA 2PMYA 2G9BA 2GGMA 3BOWA 4CLNA 2F8PA 3PLFB 2MBXA 3HCMA 1NPQA 1S36A 2RGIA 3I5FC 2KYFA 3IF7A 3DVMA 2QPTA 1ALWA 1PK0D 1CFDA 4FQOA 4PE4A 3TS5C 3VRNA 5HLOA 1UWOA 1RROA 5HYDA 1B7TZ 1SR6B 1BOCA
chains in the Genus database with same CATH superfamily
3VB1A 3CLNA 2E30A 1ALVA 3I5IC 3SG2A 3CS1A 1B8RA 5CSNA 3VGOA 2KFFA 2BL0B 2FCEA 4GGFC 4R1EA 4CPVA 3RM1A 1YR5A 1CM4A 4YGEB 2WCHA 5F6TA 4YGDB 2JXCA 1RTP1 1QV1A 2JPTA 2KPHA 2R2IA 3D74A 2KOTA 1FI6A 4YI8A 2L0PA 2K8MB 2HQ8A 3UO9A 1DC1A 4MSPA 2ZRTA 1J1EA 2LHLA 2L2EA 3D10A 1SCVA 3N7HA 1UHJA 2A4JA 3NSIA 1B4CA 1OMDA 1CMFA 1Y0VH 1K9PA 1LXFC 1C3YA 1YRTB 1IJ5A 1CTRA 1PVAA 2KNEA 1TN4A 4MZLA 1OOHA 3EKHA 2MRDA 3BXKA 3VRRA 3I5GC 1QLSA 4N1FA 4DS7A 4E68A 3CDNA 5CSFA 1JBAA 3FIAA 1ZFSA 5CSIA 5JJGA 1YVLA 1AHRA 3I5FB 3IQOA 1T14A 1KFXS 3DVKA 2OS8C 3R1VA 1EH2A 1F71A 1YVHA 2M97A 3KF9A 5FI6A 1V1FA 1XK4A 4MN0A 5ER5A 1PULA 3CTNA 1N0YA 1SL7A 1CDMA 1AVSA 1BR1B 1JF0A 2BBNA 3OB1B 2KI6D 1QTXA 4M2QA 3I5IB 4UPGA 5B8IB 1QS7A 3LLEA 1YUSA 3F45A 1NIWA 5KTYA 3EG5B 2OTGC 1TIZA 1KK8C 2FOTA 4C0JA 2WOSA 1MF8B 1CFFA 1F70A 3CZ1A 4PE1A 2HPSA 1PVBA 1S6CA 2NLNA 2WORA 3NSLA 2IS9A 1M31A 1SCMB 1SPYA 4GGNA 2ZN8A 1OZOA 1OZSA 2CT9A 3NHTA 2JNFA 1QX2A 1SMGA 2G2BA 3DF0B 3SG3A 1DJGA 4ZCVA 1LINA 3FWCA 1K94A 2LP3A 3NSOA 1IJ6A 2WCMA 5K89A 3A8RA 1S26D 1RFJA 2EC6C 5AERA 1NX2A 2DOQA 3NSKA 1KSMA 2QEBA 1ZOTB 1L2OC 3R1PA 1TCOB 3SG4A 2WCBA 4TNCA 4HRHA 1M45A 3EKJA 1AUIB 1F8HA 3DYEA 2LE9B 3PM8A 1IIOA 1J7PA 3I5GB 1L7ZA 2BL0C 4N1GA 4DIRA 1CNPA 1R6PA 1K95A 2JWWA 3BOWB 1V1GA 1XFWO 3AKBA 3SS4A 1G33A 1QLKA 1CDLA 3DXLA 4I5LB 1HT9A 1K2HA 3D0YA 1A03A 1IH0A 1J7RA 3CR2A 1YX7A 2L5YA 3BUMB 5D7FA 5HKYA 3SJSA 4MEWA 5J3XA 5DKQA 1UHNA 2WCFA 2K2AA 3O4YA 3JTDB 1GM0A 1CB1A 2CNPA 4IL1A 4OR9B 2LANA 1MWNA 1NSHA 2JZIA 2BE4A 1Q80A 1OSAA 3S0AA 1LA3A 4MBEA 4GFTA 3EVUA 2JTZA 4OKHA 3K21A 2KBMA 2P6BB 2KSPA 4F0ZB 1FW4A 2LVIA 1DGUA 1TNXA 2BCBA 1PRWA 2K7BA 1QV0A 3PSRA 3D78A 1A75A 3EK7A 3QMEA 1Z2CB 1JF2A 1WRKA 1E8AA 2L4HA 2ZNEA 2LV7A 1XYDA 3K1EA 3CR5X 1JFKA 2FJYA 3PJIA 1CM1A 3GK2A 2LAPA 1K90D 4F7FA 2KAYA 1BF5A 2CCMA 3BUXB 1A4PA 3IVTA 2EC6B 2HF5A 1XFZO 1G8IA 4CFRA 4ICBA 2KGRA 2QEHA 4DCKA 1M39A 1Y6WA 3BYAA 3CZTX 1NYAA 1F4QA 1UHHA 2JT3A 2KGBC 4HREE 1QX5B 2WCEA 4DRWA 1NX1A 1SL8A 3OBVA 4NDDA 1KFUL 1IQ5A 1OOFA 2WNDA 1F55A 4P5OE 1ZMZA 1IG5A 1JC2A 1QIVA 1UHIA 1QWVA 1CDPA 1DF0A 3WXAA 1DTLA 2ZNDA 1LVCD 2L4IA 1IQ3A 3AKAA 1SCMC 1UHKA 1JUOA 1W7IB 3JVTC 3UNWA 1QX7A 2KYCA 1DGVA 3B86A 3TDZA 4DUQA 3D76A 3ZNIA 2JNXA 1LS8A 1NP8A 4PT1A 4A4BA 3RZSA 1CFCA 1BLQA 3CABA 2WC6A 1M63B 1W7JB 5AFPA 5AANA 1NCZA 2F3ZA 1U5IA 1PSRA 2LNKA 2MAZA 3TDIA 3EVRA 1KQVA 4L9MA 4PCWA 1AJ5A 2LLTA 1TNPA 4CIDA 3LCPC 1K9UA 3CYZA 4CFQA 1IKUA 3IQQA 1IRJA 2LHIA 2VRGA 2K7CA 5IBWA 2PQLA 4OZDA 1HQVA 2BBMA 3CWGA 1XFYO 4YGBB 3L4LA 3OGNA 2MA2A 2JT0A 5DKRA 3L47A 4WRIA 2MLEC 1A2XA 1K8UA 2M49B 1SL9A 4JQ0D 1QXPA 2F2OA 1DEKA 2YGUA 4I5JA 3WHTB 1CFPA 1TUZA 1UUSA 1UURA 2GTEA 3MSEB 2BKIB 2K2FA 3JTDC 1WY9A 4M2PA 1N2DA 2JU0A 4MZJA 4YGCB 1D1OA 3B88A 4NQGA 3M0WA 1XO5A 4ZCUA 3KHEA 3PM2A 3VROA 4PE7A 1YURA 2BE6A 3TZ1A 4XJKB 4KYNA 1MQ1A 2KLEA 1TRFA 1ZACA 2WC8A 2KAVA 2OPOA 1NX0A 4JWQA 2KFGA 1YTZC 1CMGA 4C0LA 4PHNA 2JTTA 2MJWB 3OHMB 4C0KA 1B8LA 1K96A 4YBHB 3D0YB 3JVTB 5HLVA 4BY4A 1EG3A 1DJHA 4USLA 3Q8IA 4YI9A 5AXIA 1QIWA 2LCPA 5D3OA 1TOPA 2GGZA 5FYXA 2EGDA 3S0DA 1KCYA 5CSJA 4YRUA 4GAOA 1QATA 3S0FA 1BMOA 4I5KA 4OVNF 3S0EA 1BJFA 4ORBB 2BCAA 1YX8A 1JSAA 1DJIA 1DVIA 3S0GA 1F4OA 3V2LA 1H8BA 3LK1A 2BECA 3PALA 3WHUB 3E3RA 1QASA 3BJHA 1B8CA 1BR4B 1QVIY 2PRUA 3BUOB 2L50A 1A75B 1BT6A 1BU3A 2QDIA 5CPVA 4BY5A 2L98A 4NDCA 4M2OA 1GQMA 1CLLA 2LMUA 2MLFC 3DVJA 2I94A 3B6XA 1AJ4A 3H4SE 2WCLA 3B87A 3KEVA 1FI5A 1C07A 3C1VA 3SIBA 1KSOA 1OMRA 1RECA 1EJ3A 1XK4C 1TNQA 2JPOA 2LMVA 2QEVA 4FQTA 4AOMA 1GJYA 1FPWA 3CR4X 4MRYA 4GGFA 2K60A 5G08A 2BKHB 1CDNA 3O6BA 2NCPA 2Y4QA 4N5XA 2F33A 2HETA 2P70A 4FTGA 5ER4X 5BPJA 4NDBA 1SSEB 2MHHA 3BQ3A 3NHIA 2B1UA 4MVFA 4PALA 5HKZA 3I5HC 3DD4A 1DJWA 1DF0B 2NCOA 4PHMA 3O78A 4QJ3B 1K9KA 1OMVA 1TTXA 2LMTA 4U8DA 1S6IA 2AUCA 2LVKA 3SG6A 2F3YA 3R1OA 2HQWA 1TNWA 4MZKA 1KWOB 2FJUB 4MRXA 1S5GY 1OW4A 1SBJA 1KQMB 1RK9A 1MR8A 2LLSA 4P2YB 1U5IB 2LVJA 1LA0A 2AMIA 2Y1NA 3SG5A 1J1DA 1SNLA 5D69A 1JWDA 1NCYA 3AAKA 2L2CA 1XVJA 2CTNA 1FBVA 2LVVA 1XFXO 3GK4X 4INXA 2KBIA 1Y1XA 3FWBA 3PFVA 1F54A 5AEQA 1WRLA 1SRAA 2TN4A 3KO0A 1WLZA 4AQJA 1M46A 2H8VA 5I94A 1N65A 2KI6C 1R2UA 2K61A 1AK8A 3KPXA 1WLMA 2M1UA 1C3ZA 2BNXA 3PN7B 2I18A 1S6JA 1XFUO 3RLZA 1ZUZA 2F2PA 1B47A 4PE0A 3TUYB 1DQEA 1K93D 1B9AA 3HX4A 4A4CA 4YGAA 1SY9A 1MXEA 4INWA 1C7WA 3LK0A 1KK7Y 3FE8A 4OCIA 1CLBA 1MUXA 2JOJA 4HSZA 3S0BA 2M0RA 2Q91A 3PATA 1NX3A 2M9GA 4D1EA 2NXQA 1OE9B 1EXRA 3I5HB 1H4BA 1QVIZ 2COLB 2EHBA 2I2RE 2KQYA 3TDUA 5FI2A 2LM5A 5I2QA 2ZN9A 4I5NB 3BUWB 2KDHA 1DT7B 2M8UA 5GQQC 2Y1MA 1ORGA 1G4YR 2AAOA 1L2OB 2JC2A 2M3WA 2BCXA 1SKTA 2WCJA 3LL8B 4PDZA 1J55A 2KI4B 2PVBA 3FE6A 3OX6A 2M7NA 2V53A 2H61A 1EL4A 4JPZB 2ISDA 1CKKA 3ZWHA 1WDCC 3FE9A 1OOIX 2L51A 2JULA 3EVVA 1B1GA 1BG1A 1IWQA 2P71A 5KSZA 2LUCA 1SW8A 1YUTA 2QEOA 4JD9A 1MHOA 2NZ0A 2WC5A 2KHNA 1MXLC 1DJYA 1P28A 1RWYA 1LKJA 1UP5A 2JQ6A 4GBAA 4WQ2A 1XFRA 1EG4A 1NCXA 2CBLA 3BUNB 4MLWA 1OOJA 2Q4UA 3SIAA 2K7DA 3OB2B 4OV2A 4Q04A 4PHJA 3TS5B 5I2LA 4AQIA 5KU1A 2JXLA 1B7TY 1S1EA 3SS5A 2LUXA 1DJZA 2SCPA 2K7OA 1VRKA 2K0JA 1S5GZ 1KWOC 3DVEA 1QJTA 1KQMC 1IGVA 3O4XA 3CZ0A 2JT8A 1GGWA 3VRPA 3WNXB 2O5GA 2I7AA 1DELA 2KFHA 5TNCA 3GK1A 4JKTA 1JFJA 4PHKA 3BFHA 2ZKMX 5HL1A 1TWOA 2ZFDA 2O60A 1DJXA 1RJVA 3L4AA 2CXJA 4GPLB 4ORCB 1J7QA 1YRUB 1TUJA 1GGZA 3D75A 5HKWA 1XFVO 2SASA 1OQPA 3OP0A 3GOFA 3PN7C 5DICA 1X02A 2L5XB 1KFUS 1OOGA 4ORAB 4XYNA 1NUBA 3TUYC 1SR6C 3FS7A 1S3PA 1Y1UA 2PSRA 4GNKB 4IJ7A 3DZTA 1KFXL 1CLMA 3AAJA 3D77A 3DY9A 3QRXA 4QJ4B 3EK4A 1WRZA 2JRFA 1KK7Z 2LLUA 3SS3A 1WDCB 4XJKA 2KAXA 2H61C 1BODA 3NXAA 4GUKA 3BFBA 1TCFA 5EL2A 3O2PA 2KQ6A 2ZRSA 1YUUA 3B7AA 4QJ5B 2WCKA 1SYMA 1W9ZA 1PSBA 2OS8B 3OX5A 2M7LA 2BAPA 2GV5A 3CGAA 4HRGA 5PALA 3SG7A 3VRQA 3DF0A 3EK8A 3A4UB 1AP4A 2LP2A 5I8NA 1A29A 1SK6D 2M29A 2Y5IA 1DMOA 1Y1AA 2ERBA 1ODBA 2PASA 5DKNA 2QACA 2M1KB 2FCDA 2H2KA 2LC5A 5JOLA 1XA5A 1NWDA 2D8NA 2KI4C 1J7OA 1C7VA 1PALA 4WQ3A 5I2OA 2OTGB 4ETOA 1KK8B 1FF1A 2E6WA 3ICBA 2PALA 2PMYA 2G9BA 2GGMA 3BOWA 3R72A 4CLNA 2F8PA 5FI7A 1Z4HA 3PLFB 3D73A 2MBXA 3HCMA 3NGVA 1NPQA 1S36A 2RGIA 2PYQA 3I5FC 2KYFA 3IF7A 3DVMA 3BFAA 2QPTA 1ALWA 1PK0D 3CZ2A 2KLDA 1CFDA 4FQOA 4PE4A 3TS5C 3VRNA 5HLOA 1UWOA 1RROA 5HYDA 1B7TZ 1SR6B 1BOCA
chains in the Genus database with same CATH topology
3CLNA 2E30A 1ALVA 3I5IC 3SG2A 3CS1A 1B8RA 5CSNA 3VGOA 2KFFA 2BL0B 2FCEA 4GGFC 4R1EA 4CPVA 3RM1A 1YR5A 1CM4A 4YGEB 5F6TA 4YGDB 2JXCA 1RTP1 1QV1A 2JPTA 2R2IA 1FI6A 2KOTA 4YI8A 2L0PA 2K8MB 2HQ8A 4MSPA 2ZRTA 1J1EA 2LHLA 2L2EA 3D10A 1SCVA 1UHJA 2A4JA 3NSIA 1B4CA 1OMDA 1CMFA 1Y0VH 1K9PA 1LXFC 1YRTB 1IJ5A 1CTRA 1PVAA 2KNEA 1TN4A 4MZLA 3EKHA 2MRDA 3BXKA 3VRRA 3I5GC 1QLSA 4N1FA 4DS7A 4E68A 5CSFA 1JBAA 3FIAA 1ZFSA 5CSIA 5JJGA 1YVLA 1AHRA 3I5FB 3IQOA 3DVKA 1KFXS 2OS8C 1EH2A 1F71A 1YVHA 2M97A 3KF9A 1V1FA 1XK4A 4MN0A 5ER5A 1PULA 3CTNA 1N0YA 1SL7A 1CDMA 1AVSA 1BR1B 1JF0A 2BBNA 3OB1B 2KI6D 1QTXA 4M2QA 3I5IB 4UPGA 5B8IB 1QS7A 3LLEA 1YUSA 3F45A 1NIWA 5KTYA 2OTGC 1TIZA 1KK8C 2FOTA 4C0JA 2WOSA 1MF8B 1CFFA 1F70A 4PE1A 2HPSA 1PVBA 1S6CA 2NLNA 2WORA 3NSLA 2IS9A 1M31A 1SCMB 1SPYA 4GGNA 2ZN8A 1OZOA 1OZSA 2CT9A 2JNFA 1QX2A 1SMGA 2G2BA 3DF0B 3SG3A 1DJGA 4ZCVA 1LINA 3FWCA 1K94A 2LP3A 3NSOA 1IJ6A 5K89A 3A8RA 1S26D 1RFJA 2EC6C 5AERA 1NX2A 2DOQA 3NSKA 1KSMA 1ZOTB 1L2OC 1TCOB 3SG4A 2WCBA 4TNCA 4HRHA 1M45A 3EKJA 1AUIB 1F8HA 2LE9B 3PM8A 1J7PA 3I5GB 1L7ZA 2BL0C 4N1GA 4DIRA 1CNPA 1R6PA 1K95A 2JWWA 3BOWB 1V1GA 1XFWO 3AKBA 1G33A 1QLKA 1CDLA 4I5LB 1HT9A 1K2HA 3D0YA 1A03A 1IH0A 1J7RA 3CR2A 1YX7A 3BUMB 5D7FA 5HKYA 3SJSA 4MEWA 5J3XA 5DKQA 1UHNA 2WCFA 2K2AA 3O4YA 3JTDB 1CB1A 2CNPA 4IL1A 4OR9B 2LANA 1MWNA 1NSHA 2JZIA 2BE4A 1Q80A 1OSAA 1LA3A 4MBEA 4GFTA 3EVUA 2JTZA 4OKHA 3K21A 2KBMA 2P6BB 2KSPA 4F0ZB 1FW4A 2LVIA 1DGUA 1TNXA 2BCBA 1PRWA 2K7BA 1QV0A 3PSRA 1A75A 3EK7A 1JF2A 1WRKA 1E8AA 2L4HA 2ZNEA 2LV7A 1XYDA 3CR5X 1JFKA 1CM1A 3GK2A 2LAPA 1K90D 2KAYA 2CCMA 3BUXB 1A4PA 2EC6B 2HF5A 1XFZO 1G8IA 4CFRA 4ICBA 2KGRA 4DCKA 1M39A 1Y6WA 3BYAA 3CZTX 1NYAA 1F4QA 1UHHA 2JT3A 2KGBC 4HREE 1QX5B 2WCEA 4DRWA 1NX1A 1SL8A 4NDDA 1KFUL 1IQ5A 2WNDA 1F55A 4P5OE 1ZMZA 1IG5A 1JC2A 1QIVA 1UHIA 1CDPA 1DF0A 3WXAA 1DTLA 2ZNDA 1LVCD 2L4IA 1IQ3A 3AKAA 1SCMC 1UHKA 1JUOA 1W7IB 3JVTC 1QX7A 2KYCA 1DGVA 3TDZA 4DUQA 3ZNIA 2JNXA 1NP8A 4A4BA 1CFCA 1BLQA 1M63B 1W7JB 5AFPA 5AANA 1NCZA 2F3ZA 1U5IA 1PSRA 2LNKA 2MAZA 3TDIA 3EVRA 1KQVA 4L9MA 4PCWA 1AJ5A 2LLTA 1TNPA 4CIDA 3LCPC 1K9UA 4CFQA 1IKUA 3IQQA 1IRJA 2LHIA 2VRGA 2K7CA 5IBWA 1HQVA 2BBMA 3CWGA 1XFYO 4YGBB 5DKRA 2MA2A 2JT0A 4WRIA 2MLEC 1A2XA 1K8UA 2M49B 1SL9A 4JQ0D 1QXPA 2F2OA 4I5JA 3WHTB 1CFPA 1UUSA 1UURA 3MSEB 2BKIB 2K2FA 3JTDC 1WY9A 4M2PA 1N2DA 2JU0A 4MZJA 4YGCB 1D1OA 4NQGA 3M0WA 1XO5A 4ZCUA 3KHEA 3VROA 4PE7A 1YURA 2BE6A 3TZ1A 4XJKB 1MQ1A 1TRFA 1ZACA 2WC8A 2KAVA 2OPOA 1NX0A 4JWQA 2KFGA 1YTZC 1CMGA 4C0LA 4PHNA 2JTTA 2MJWB 3OHMB 4C0KA 1B8LA 1K96A 4YBHB 3D0YB 3JVTB 5HLVA 4BY4A 1EG3A 1DJHA 4USLA 4YI9A 5AXIA 1QIWA 2LCPA 1TOPA 2GGZA 5FYXA 2EGDA 1KCYA 5CSJA 4YRUA 4GAOA 1QATA 1BMOA 4I5KA 4OVNF 1BJFA 4ORBB 2BCAA 1YX8A 1JSAA 1DJIA 1DVIA 1F4OA 1H8BA 3LK1A 2BECA 3PALA 3WHUB 3E3RA 1QASA 3BUOB 1B8CA 1BR4B 1QVIY 2PRUA 2L50A 1A75B 1BT6A 1BU3A 5CPVA 4BY5A 2L98A 4NDCA 4M2OA 1GQMA 1CLLA 2LMUA 2MLFC 3DVJA 2I94A 1AJ4A 3H4SE 3KEVA 1FI5A 1C07A 3C1VA 3SIBA 1KSOA 1OMRA 1RECA 1EJ3A 1XK4C 1TNQA 2LMVA 4AOMA 1FPWA 1GJYA 3CR4X 4MRYA 4GGFA 5G08A 1CDNA 2BKHB 3O6BA 2NCPA 2Y4QA 4N5XA 2F33A 2HETA 4FTGA 5ER4X 5BPJA 4NDBA 2MHHA 3BQ3A 2B1UA 4MVFA 4PALA 5HKZA 3I5HC 3DD4A 1DJWA 1DF0B 2NCOA 4PHMA 3O78A 4QJ3B 1K9KA 1OMVA 1TTXA 2LMTA 4U8DA 1S6IA 2AUCA 2LVKA 3SG6A 2F3YA 2HQWA 1TNWA 4MZKA 1KWOB 2FJUB 4MRXA 1S5GY 1SBJA 1KQMB 1RK9A 1MR8A 2LLSA 4P2YB 1U5IB 2LVJA 1LA0A 2AMIA 2Y1NA 3SG5A 1J1DA 1SNLA 5D69A 1JWDA 1NCYA 3AAKA 1XVJA 2CTNA 1FBVA 2LVVA 1XFXO 3GK4X 2KBIA 1Y1XA 3FWBA 3PFVA 1F54A 5AEQA 1WRLA 1SRAA 2TN4A 3KO0A 1WLZA 4AQJA 1M46A 1N65A 2KI6C 1R2UA 2K61A 1AK8A 3KPXA 1WLMA 2M1UA 3PN7B 2I18A 1S6JA 1XFUO 3RLZA 1ZUZA 2F2PA 1B47A 4PE0A 3TUYB 1K93D 1B9AA 3HX4A 4A4CA 4YGAA 1SY9A 1MXEA 1C7WA 3LK0A 1KK7Y 4OCIA 1CLBA 1MUXA 2JOJA 4HSZA 2M0RA 2Q91A 3PATA 1NX3A 2M9GA 4D1EA 2NXQA 1OE9B 1EXRA 3I5HB 1H4BA 1QVIZ 2COLB 2EHBA 2I2RE 2KQYA 3TDUA 2LM5A 5I2QA 2ZN9A 4I5NB 3BUWB 2KDHA 1DT7B 2M8UA 5GQQC 2Y1MA 1G4YR 2AAOA 1L2OB 2JC2A 2M3WA 2BCXA 1SKTA 3LL8B 4PDZA 1J55A 2KI4B 2PVBA 3OX6A 2M7NA 2V53A 2H61A 1EL4A 4JPZB 2ISDA 1CKKA 3ZWHA 1WDCC 2L51A 2JULA 3EVVA 1B1GA 1BG1A 1IWQA 5KSZA 2LUCA 1SW8A 1YUTA 1MHOA 2NZ0A 2KHNA 1MXLC 1DJYA 1RWYA 1LKJA 1UP5A 2JQ6A 4GBAA 4WQ2A 2CBLA 1EG4A 1NCXA 3BUNB 4MLWA 1OOJA 2Q4UA 3SIAA 2K7DA 3OB2B 4OV2A 4Q04A 4PHJA 3TS5B 5I2LA 4AQIA 5KU1A 2JXLA 1B7TY 1S1EA 2LUXA 1DJZA 2SCPA 2K7OA 1VRKA 2K0JA 1S5GZ 1KWOC 3DVEA 1QJTA 1KQMC 1IGVA 2JT8A 1GGWA 3VRPA 3WNXB 2O5GA 2I7AA 5TNCA 2KFHA 3GK1A 1JFJA 4PHKA 2ZKMX 2ZFDA 2O60A 1DJXA 1RJVA 4GPLB 2CXJA 4ORCB 1J7QA 1YRUB 1GGZA 5HKWA 1XFVO 2SASA 1OQPA 3OP0A 3GOFA 3PN7C 1BF5A 1X02A 2L5XB 1KFUS 4ORAB 4XYNA 1NUBA 3TUYC 1SR6C 3FS7A 1S3PA 1Y1UA 2PSRA 4GNKB 1KFXL 1CLMA 3AAJA 3QRXA 4QJ4B 3EK4A 1WRZA 2JRFA 1KK7Z 2LLUA 1WDCB 4XJKA 2KAXA 2H61C 1BODA 3NXAA 4GUKA 1TCFA 3O2PA 2KQ6A 2ZRSA 1YUUA 4QJ5B 1SYMA 1PSBA 2OS8B 3OX5A 2M7LA 2GV5A 3CGAA 4HRGA 3SG7A 5PALA 3VRQA 3DF0A 3EK8A 3A4UB 1AP4A 2LP2A 5I8NA 1A29A 1SK6D 2M29A 2Y5IA 1DMOA 1Y1AA 1ODBA 2PASA 5DKNA 2QACA 2M1KB 2FCDA 2H2KA 2LC5A 5JOLA 1XA5A 1NWDA 2D8NA 2KI4C 1J7OA 1C7VA 1PALA 4WQ3A 5I2OA 2OTGB 4ETOA 1KK8B 1FF1A 2E6WA 3ICBA 2PALA 2PMYA 2G9BA 2GGMA 3BOWA 4CLNA 2F8PA 3PLFB 2MBXA 3HCMA 1NPQA 1S36A 2RGIA 3I5FC 2KYFA 3IF7A 3DVMA 2QPTA 1ALWA 1PK0D 1CFDA 4FQOA 4PE4A 3TS5C 3VRNA 5HLOA 1UWOA 1RROA 5HYDA 1B7TZ 1SR6B 1BOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  2E30 A;  1ALV A;  3I5I C;  3SG2 A;  3CS1 A;  1B8R A;  5CSN A;  3VGO A;  2KFF A;  2BL0 B;  2FCE A;  4GGF C;  4R1E A;  4CPV A;  3RM1 A;  1YR5 A;  1CM4 A;  4YGE B;  5F6T A;  4YGD B;  2JXC A;  1RTP 1;  1QV1 A;  2JPT A;  2R2I A;  1FI6 A;  2KOT A;  4YI8 A;  2L0P A;  2K8M B;  2HQ8 A;  4MSP A;  2ZRT A;  1J1E A;  2LHL A;  2L2E A;  3D10 A;  1SCV A;  1UHJ A;  2A4J A;  3NSI A;  1B4C A;  1OMD A;  1CMF A;  1Y0V H;  1K9P A;  1LXF C;  1YRT B;  1IJ5 A;  1CTR A;  1PVA A;  2KNE A;  1TN4 A;  4MZL A;  3EKH A;  2MRD A;  3BXK A;  3VRR A;  3I5G C;  1QLS A;  4N1F A;  4DS7 A;  4E68 A;  5CSF A;  1JBA A;  3FIA A;  1ZFS A;  5CSI A;  5JJG A;  1YVL A;  1AHR A;  3I5F B;  3IQO A;  3DVK A;  1KFX S;  2OS8 C;  1EH2 A;  1F71 A;  1YVH A;  2M97 A;  3KF9 A;  1V1F A;  1XK4 A;  4MN0 A;  5ER5 A;  1PUL A;  3CTN A;  1N0Y A;  1SL7 A;  1CDM A;  1AVS A;  1BR1 B;  1JF0 A;  2BBN A;  3OB1 B;  2KI6 D;  1QTX A;  4M2Q A;  3I5I B;  4UPG A;  5B8I B;  1QS7 A;  3LLE A;  1YUS A;  3F45 A;  1NIW A;  5KTY A;  2OTG C;  1TIZ A;  1KK8 C;  2FOT A;  4C0J A;  2WOS A;  1MF8 B;  1CFF A;  1F70 A;  4PE1 A;  2HPS A;  1PVB A;  1S6C A;  2NLN A;  2WOR A;  3NSL A;  2IS9 A;  1M31 A;  1SCM B;  1SPY A;  4GGN A;  2ZN8 A;  1OZO A;  1OZS A;  2CT9 A;  2JNF A;  1QX2 A;  1SMG A;  2G2B A;  3DF0 B;  3SG3 A;  1DJG A;  4ZCV A;  1LIN A;  3FWC A;  1K94 A;  2LP3 A;  3NSO A;  1IJ6 A;  5K89 A;  3A8R A;  1S26 D;  1RFJ A;  2EC6 C;  5AER A;  1NX2 A;  2DOQ A;  3NSK A;  1KSM A;  1ZOT B;  1L2O C;  1TCO B;  3SG4 A;  2WCB A;  4TNC A;  4HRH A;  1M45 A;  3EKJ A;  1AUI B;  1F8H A;  2LE9 B;  3PM8 A;  1J7P A;  3I5G B;  1L7Z A;  2BL0 C;  4N1G A;  4DIR A;  1CNP A;  1R6P A;  1K95 A;  2JWW A;  3BOW B;  1V1G A;  1XFW O;  3AKB A;  1G33 A;  1QLK A;  1CDL A;  4I5L B;  1HT9 A;  1K2H A;  3D0Y A;  1A03 A;  1IH0 A;  1J7R A;  3CR2 A;  1YX7 A;  3BUM B;  5D7F A;  5HKY A;  3SJS A;  4MEW A;  5J3X A;  5DKQ A;  1UHN A;  2WCF A;  2K2A A;  3O4Y A;  3JTD B;  1CB1 A;  2CNP A;  4IL1 A;  4OR9 B;  2LAN A;  1MWN A;  1NSH A;  2JZI A;  2BE4 A;  1Q80 A;  1OSA A;  1LA3 A;  4MBE A;  4GFT A;  3EVU A;  2JTZ A;  4OKH A;  3K21 A;  2KBM A;  2P6B B;  2KSP A;  4F0Z B;  1FW4 A;  2LVI A;  1DGU A;  1TNX A;  2BCB A;  1PRW A;  2K7B A;  1QV0 A;  3PSR A;  1A75 A;  3EK7 A;  1JF2 A;  1WRK A;  1E8A A;  2L4H A;  2ZNE A;  2LV7 A;  1XYD A;  3CR5 X;  1JFK A;  1CM1 A;  3GK2 A;  2LAP A;  1K90 D;  2KAY A;  2CCM A;  3BUX B;  1A4P A;  2EC6 B;  2HF5 A;  1XFZ O;  1G8I A;  4CFR A;  4ICB A;  2KGR A;  4DCK A;  1M39 A;  1Y6W A;  3BYA A;  3CZT X;  1NYA A;  1F4Q A;  1UHH A;  2JT3 A;  2KGB C;  4HRE E;  1QX5 B;  2WCE A;  4DRW A;  1NX1 A;  1SL8 A;  4NDD A;  1KFU L;  1IQ5 A;  2WND A;  1F55 A;  4P5O E;  1ZMZ A;  1IG5 A;  1JC2 A;  1QIV A;  1UHI A;  1CDP A;  1DF0 A;  3WXA A;  1DTL A;  2ZND A;  1LVC D;  2L4I A;  1IQ3 A;  3AKA A;  1SCM C;  1UHK A;  1JUO A;  1W7I B;  3JVT C;  1QX7 A;  2KYC A;  1DGV A;  3TDZ A;  4DUQ A;  3ZNI A;  2JNX A;  1NP8 A;  4A4B A;  1CFC A;  1BLQ A;  1M63 B;  1W7J B;  5AFP A;  5AAN A;  1NCZ A;  2F3Z A;  1U5I A;  1PSR A;  2LNK A;  2MAZ A;  3TDI A;  3EVR A;  1KQV A;  4L9M A;  4PCW A;  1AJ5 A;  2LLT A;  1TNP A;  4CID A;  3LCP C;  1K9U A;  4CFQ A;  1IKU A;  3IQQ A;  1IRJ A;  2LHI A;  2VRG A;  2K7C A;  5IBW A;  1HQV A;  2BBM A;  3CWG A;  1XFY O;  4YGB B;  5DKR A;  2MA2 A;  2JT0 A;  4WRI A;  2MLE C;  1A2X A;  1K8U A;  2M49 B;  1SL9 A;  4JQ0 D;  1QXP A;  2F2O A;  4I5J A;  3WHT B;  1CFP A;  1UUS A;  1UUR A;  3MSE B;  2BKI B;  2K2F A;  3JTD C;  1WY9 A;  4M2P A;  1N2D A;  2JU0 A;  4MZJ A;  4YGC B;  1D1O A;  4NQG A;  3M0W A;  1XO5 A;  4ZCU A;  3KHE A;  3VRO A;  4PE7 A;  1YUR A;  2BE6 A;  3TZ1 A;  4XJK B;  1MQ1 A;  1TRF A;  1ZAC A;  2WC8 A;  2KAV A;  2OPO A;  1NX0 A;  4JWQ A;  2KFG A;  1YTZ C;  1CMG A;  4C0L A;  4PHN A;  2JTT A;  2MJW B;  3OHM B;  4C0K A;  1B8L A;  1K96 A;  4YBH B;  3D0Y B;  3JVT B;  5HLV A;  4BY4 A;  1EG3 A;  1DJH A;  4USL A;  4YI9 A;  5AXI A;  1QIW A;  2LCP A;  1TOP A;  2GGZ A;  5FYX A;  2EGD A;  1KCY A;  5CSJ A;  4YRU A;  4GAO A;  1QAT A;  1BMO A;  4I5K A;  4OVN F;  1BJF A;  4ORB B;  2BCA A;  1YX8 A;  1JSA A;  1DJI A;  1DVI A;  1F4O A;  1H8B A;  3LK1 A;  2BEC A;  3PAL A;  3WHU B;  3E3R A;  1QAS A;  3BUO B;  1B8C A;  1BR4 B;  1QVI Y;  2PRU A;  2L50 A;  1A75 B;  1BT6 A;  1BU3 A;  5CPV A;  4BY5 A;  2L98 A;  4NDC A;  4M2O A;  1GQM A;  1CLL A;  2LMU A;  2MLF C;  3DVJ A;  2I94 A;  1AJ4 A;  3H4S E;  3KEV A;  1FI5 A;  1C07 A;  3C1V A;  3SIB A;  1KSO A;  1OMR A;  1REC A;  1EJ3 A;  1XK4 C;  1TNQ A;  2LMV A;  4AOM A;  1FPW A;  1GJY A;  3CR4 X;  4MRY A;  4GGF A;  5G08 A;  1CDN A;  2BKH B;  3O6B A;  2NCP A;  2Y4Q A;  4N5X A;  2F33 A;  2HET A;  4FTG A;  5ER4 X;  5BPJ A;  4NDB A;  2MHH A;  3BQ3 A;  2B1U A;  4MVF A;  4PAL A;  5HKZ A;  3I5H C;  3DD4 A;  1DJW A;  1DF0 B;  2NCO A;  4PHM A;  3O78 A;  4QJ3 B;  1K9K A;  1OMV A;  1TTX A;  2LMT A;  4U8D A;  1S6I A;  2AUC A;  2LVK A;  3SG6 A;  2F3Y A;  2HQW A;  1TNW A;  4MZK A;  1KWO B;  2FJU B;  4MRX A;  1S5G Y;  1SBJ A;  1KQM B;  1RK9 A;  1MR8 A;  2LLS A;  4P2Y B;  1U5I B;  2LVJ A;  1LA0 A;  2AMI A;  2Y1N A;  3SG5 A;  1J1D A;  1SNL A;  5D69 A;  1JWD A;  1NCY A;  3AAK A;  1XVJ A;  2CTN A;  1FBV A;  2LVV A;  1XFX O;  3GK4 X;  2KBI A;  1Y1X A;  3FWB A;  3PFV A;  1F54 A;  5AEQ A;  1WRL A;  1SRA A;  2TN4 A;  3KO0 A;  1WLZ A;  4AQJ A;  1M46 A;  1N65 A;  2KI6 C;  1R2U A;  2K61 A;  1AK8 A;  3KPX A;  1WLM A;  2M1U A;  3PN7 B;  2I18 A;  1S6J A;  1XFU O;  3RLZ A;  1ZUZ A;  2F2P A;  1B47 A;  4PE0 A;  3TUY B;  1K93 D;  1B9A A;  3HX4 A;  4A4C A;  4YGA A;  1SY9 A;  1MXE A;  1C7W A;  3LK0 A;  1KK7 Y;  4OCI A;  1CLB A;  1MUX A;  2JOJ A;  4HSZ A;  2M0R A;  2Q91 A;  3PAT A;  1NX3 A;  2M9G A;  4D1E A;  2NXQ A;  1OE9 B;  1EXR A;  3I5H B;  1H4B A;  1QVI Z;  2COL B;  2EHB A;  2I2R E;  2KQY A;  3TDU A;  2LM5 A;  5I2Q A;  2ZN9 A;  4I5N B;  3BUW B;  2KDH A;  1DT7 B;  2M8U A;  5GQQ C;  2Y1M A;  1G4Y R;  2AAO A;  1L2O B;  2JC2 A;  2M3W A;  2BCX A;  1SKT A;  3LL8 B;  4PDZ A;  1J55 A;  2KI4 B;  2PVB A;  3OX6 A;  2M7N A;  2V53 A;  2H61 A;  1EL4 A;  4JPZ B;  2ISD A;  1CKK A;  3ZWH A;  1WDC C;  2L51 A;  2JUL A;  3EVV A;  1B1G A;  1BG1 A;  1IWQ A;  5KSZ A;  2LUC A;  1SW8 A;  1YUT A;  1MHO A;  2NZ0 A;  2KHN A;  1MXL C;  1DJY A;  1RWY A;  1LKJ A;  1UP5 A;  2JQ6 A;  4GBA A;  4WQ2 A;  2CBL A;  1EG4 A;  1NCX A;  3BUN B;  4MLW A;  1OOJ A;  2Q4U A;  3SIA A;  2K7D A;  3OB2 B;  4OV2 A;  4Q04 A;  4PHJ A;  3TS5 B;  5I2L A;  4AQI A;  5KU1 A;  2JXL A;  1B7T Y;  1S1E A;  2LUX A;  1DJZ A;  2SCP A;  2K7O A;  1VRK A;  2K0J A;  1S5G Z;  1KWO C;  3DVE A;  1QJT A;  1KQM C;  1IGV A;  2JT8 A;  1GGW A;  3VRP A;  3WNX B;  2O5G A;  2I7A A;  5TNC A;  2KFH A;  3GK1 A;  1JFJ A;  4PHK A;  2ZKM X;  2ZFD A;  2O60 A;  1DJX A;  1RJV A;  4GPL B;  2CXJ A;  4ORC B;  1J7Q A;  1YRU B;  1GGZ A;  5HKW A;  1XFV O;  2SAS A;  1OQP A;  3OP0 A;  3GOF A;  3PN7 C;  1BF5 A;  1X02 A;  2L5X B;  1KFU S;  4ORA B;  4XYN A;  1NUB A;  3TUY C;  1SR6 C;  3FS7 A;  1S3P A;  1Y1U A;  2PSR A;  4GNK B;  1KFX L;  1CLM A;  3AAJ A;  3QRX A;  4QJ4 B;  3EK4 A;  1WRZ A;  2JRF A;  1KK7 Z;  2LLU A;  1WDC B;  4XJK A;  2KAX A;  2H61 C;  1BOD A;  3NXA A;  4GUK A;  1TCF A;  3O2P A;  2KQ6 A;  2ZRS A;  1YUU A;  4QJ5 B;  1SYM A;  1PSB A;  2OS8 B;  3OX5 A;  2M7L A;  2GV5 A;  3CGA A;  4HRG A;  3SG7 A;  5PAL A;  3VRQ A;  3DF0 A;  3EK8 A;  3A4U B;  1AP4 A;  2LP2 A;  5I8N A;  1A29 A;  1SK6 D;  2M29 A;  2Y5I A;  1DMO A;  1Y1A A;  1ODB A;  2PAS A;  5DKN A;  2QAC A;  2M1K B;  2FCD A;  2H2K A;  2LC5 A;  5JOL A;  1XA5 A;  1NWD A;  2D8N A;  2KI4 C;  1J7O A;  1C7V A;  1PAL A;  4WQ3 A;  5I2O A;  2OTG B;  4ETO A;  1KK8 B;  1FF1 A;  2E6W A;  3ICB A;  2PAL A;  2PMY A;  2G9B A;  2GGM A;  3BOW A;  4CLN A;  2F8P A;  3PLF B;  2MBX A;  3HCM A;  1NPQ A;  1S36 A;  2RGI A;  3I5F C;  2KYF A;  3IF7 A;  3DVM A;  2QPT A;  1ALW A;  1PK0 D;  1CFD A;  4FQO A;  4PE4 A;  3TS5 C;  3VRN A;  5HLO A;  1UWO A;  1RRO A;  5HYD A;  1B7T Z;  1SR6 B;  1BOC A; 
#chains in the Genus database with same CATH topology
 3VB1 A;  3CLN A;  2E30 A;  1ALV A;  3I5I C;  3SG2 A;  3CS1 A;  1B8R A;  5CSN A;  3VGO A;  2KFF A;  2BL0 B;  2FCE A;  4GGF C;  4R1E A;  4CPV A;  3RM1 A;  1YR5 A;  1CM4 A;  4YGE B;  2WCH A;  5F6T A;  4YGD B;  2JXC A;  1RTP 1;  1QV1 A;  2JPT A;  2KPH A;  2R2I A;  3D74 A;  2KOT A;  1FI6 A;  4YI8 A;  2L0P A;  2K8M B;  2HQ8 A;  3UO9 A;  1DC1 A;  4MSP A;  2ZRT A;  1J1E A;  2LHL A;  2L2E A;  3D10 A;  1SCV A;  3N7H A;  1UHJ A;  2A4J A;  3NSI A;  1B4C A;  1OMD A;  1CMF A;  1Y0V H;  1K9P A;  1LXF C;  1C3Y A;  1YRT B;  1IJ5 A;  1CTR A;  1PVA A;  2KNE A;  1TN4 A;  4MZL A;  1OOH A;  3EKH A;  2MRD A;  3BXK A;  3VRR A;  3I5G C;  1QLS A;  4N1F A;  4DS7 A;  4E68 A;  3CDN A;  5CSF A;  1JBA A;  3FIA A;  1ZFS A;  5CSI A;  5JJG A;  1YVL A;  1AHR A;  3I5F B;  3IQO A;  1T14 A;  1KFX S;  3DVK A;  2OS8 C;  3R1V A;  1EH2 A;  1F71 A;  1YVH A;  2M97 A;  3KF9 A;  5FI6 A;  1V1F A;  1XK4 A;  4MN0 A;  5ER5 A;  1PUL A;  3CTN A;  1N0Y A;  1SL7 A;  1CDM A;  1AVS A;  1BR1 B;  1JF0 A;  2BBN A;  3OB1 B;  2KI6 D;  1QTX A;  4M2Q A;  3I5I B;  4UPG A;  5B8I B;  1QS7 A;  3LLE A;  1YUS A;  3F45 A;  1NIW A;  5KTY A;  3EG5 B;  2OTG C;  1TIZ A;  1KK8 C;  2FOT A;  4C0J A;  2WOS A;  1MF8 B;  1CFF A;  1F70 A;  3CZ1 A;  4PE1 A;  2HPS A;  1PVB A;  1S6C A;  2NLN A;  2WOR A;  3NSL A;  2IS9 A;  1M31 A;  1SCM B;  1SPY A;  4GGN A;  2ZN8 A;  1OZO A;  1OZS A;  2CT9 A;  3NHT A;  2JNF A;  1QX2 A;  1SMG A;  2G2B A;  3DF0 B;  3SG3 A;  1DJG A;  4ZCV A;  1LIN A;  3FWC A;  1K94 A;  2LP3 A;  3NSO A;  1IJ6 A;  2WCM A;  5K89 A;  3A8R A;  1S26 D;  1RFJ A;  2EC6 C;  5AER A;  1NX2 A;  2DOQ A;  3NSK A;  1KSM A;  2QEB A;  1ZOT B;  1L2O C;  3R1P A;  1TCO B;  3SG4 A;  2WCB A;  4TNC A;  4HRH A;  1M45 A;  3EKJ A;  1AUI B;  1F8H A;  3DYE A;  2LE9 B;  3PM8 A;  1IIO A;  1J7P A;  3I5G B;  1L7Z A;  2BL0 C;  4N1G A;  4DIR A;  1CNP A;  1R6P A;  1K95 A;  2JWW A;  3BOW B;  1V1G A;  1XFW O;  3AKB A;  3SS4 A;  1G33 A;  1QLK A;  1CDL A;  3DXL A;  4I5L B;  1HT9 A;  1K2H A;  3D0Y A;  1A03 A;  1IH0 A;  1J7R A;  3CR2 A;  1YX7 A;  2L5Y A;  3BUM B;  5D7F A;  5HKY A;  3SJS A;  4MEW A;  5J3X A;  5DKQ A;  1UHN A;  2WCF A;  2K2A A;  3O4Y A;  3JTD B;  1GM0 A;  1CB1 A;  2CNP A;  4IL1 A;  4OR9 B;  2LAN A;  1MWN A;  1NSH A;  2JZI A;  2BE4 A;  1Q80 A;  1OSA A;  3S0A A;  1LA3 A;  4MBE A;  4GFT A;  3EVU A;  2JTZ A;  4OKH A;  3K21 A;  2KBM A;  2P6B B;  2KSP A;  4F0Z B;  1FW4 A;  2LVI A;  1DGU A;  1TNX A;  2BCB A;  1PRW A;  2K7B A;  1QV0 A;  3PSR A;  3D78 A;  1A75 A;  3EK7 A;  3QME A;  1Z2C B;  1JF2 A;  1WRK A;  1E8A A;  2L4H A;  2ZNE A;  2LV7 A;  1XYD A;  3K1E A;  3CR5 X;  1JFK A;  2FJY A;  3PJI A;  1CM1 A;  3GK2 A;  2LAP A;  1K90 D;  4F7F A;  2KAY A;  1BF5 A;  2CCM A;  3BUX B;  1A4P A;  3IVT A;  2EC6 B;  2HF5 A;  1XFZ O;  1G8I A;  4CFR A;  4ICB A;  2KGR A;  2QEH A;  4DCK A;  1M39 A;  1Y6W A;  3BYA A;  3CZT X;  1NYA A;  1F4Q A;  1UHH A;  2JT3 A;  2KGB C;  4HRE E;  1QX5 B;  2WCE A;  4DRW A;  1NX1 A;  1SL8 A;  3OBV A;  4NDD A;  1KFU L;  1IQ5 A;  1OOF A;  2WND A;  1F55 A;  4P5O E;  1ZMZ A;  1IG5 A;  1JC2 A;  1QIV A;  1UHI A;  1QWV A;  1CDP A;  1DF0 A;  3WXA A;  1DTL A;  2ZND A;  1LVC D;  2L4I A;  1IQ3 A;  3AKA A;  1SCM C;  1UHK A;  1JUO A;  1W7I B;  3JVT C;  3UNW A;  1QX7 A;  2KYC A;  1DGV A;  3B86 A;  3TDZ A;  4DUQ A;  3D76 A;  3ZNI A;  2JNX A;  1LS8 A;  1NP8 A;  4PT1 A;  4A4B A;  3RZS A;  1CFC A;  1BLQ A;  3CAB A;  2WC6 A;  1M63 B;  1W7J B;  5AFP A;  5AAN A;  1NCZ A;  2F3Z A;  1U5I A;  1PSR A;  2LNK A;  2MAZ A;  3TDI A;  3EVR A;  1KQV A;  4L9M A;  4PCW A;  1AJ5 A;  2LLT A;  1TNP A;  4CID A;  3LCP C;  1K9U A;  3CYZ A;  4CFQ A;  1IKU A;  3IQQ A;  1IRJ A;  2LHI A;  2VRG A;  2K7C A;  5IBW A;  2PQL A;  4OZD A;  1HQV A;  2BBM A;  3CWG A;  1XFY O;  4YGB B;  3L4L A;  3OGN A;  2MA2 A;  2JT0 A;  5DKR A;  3L47 A;  4WRI A;  2MLE C;  1A2X A;  1K8U A;  2M49 B;  1SL9 A;  4JQ0 D;  1QXP A;  2F2O A;  1DEK A;  2YGU A;  4I5J A;  3WHT B;  1CFP A;  1TUZ A;  1UUS A;  1UUR A;  2GTE A;  3MSE B;  2BKI B;  2K2F A;  3JTD C;  1WY9 A;  4M2P A;  1N2D A;  2JU0 A;  4MZJ A;  4YGC B;  1D1O A;  3B88 A;  4NQG A;  3M0W A;  1XO5 A;  4ZCU A;  3KHE A;  3PM2 A;  3VRO A;  4PE7 A;  1YUR A;  2BE6 A;  3TZ1 A;  4XJK B;  4KYN A;  1MQ1 A;  2KLE A;  1TRF A;  1ZAC A;  2WC8 A;  2KAV A;  2OPO A;  1NX0 A;  4JWQ A;  2KFG A;  1YTZ C;  1CMG A;  4C0L A;  4PHN A;  2JTT A;  2MJW B;  3OHM B;  4C0K A;  1B8L A;  1K96 A;  4YBH B;  3D0Y B;  3JVT B;  5HLV A;  4BY4 A;  1EG3 A;  1DJH A;  4USL A;  3Q8I A;  4YI9 A;  5AXI A;  1QIW A;  2LCP A;  5D3O A;  1TOP A;  2GGZ A;  5FYX A;  2EGD A;  3S0D A;  1KCY A;  5CSJ A;  4YRU A;  4GAO A;  1QAT A;  3S0F A;  1BMO A;  4I5K A;  4OVN F;  3S0E A;  1BJF A;  4ORB B;  2BCA A;  1YX8 A;  1JSA A;  1DJI A;  1DVI A;  3S0G A;  1F4O A;  3V2L A;  1H8B A;  3LK1 A;  2BEC A;  3PAL A;  3WHU B;  3E3R A;  1QAS A;  3BJH A;  1B8C A;  1BR4 B;  1QVI Y;  2PRU A;  3BUO B;  2L50 A;  1A75 B;  1BT6 A;  1BU3 A;  2QDI A;  5CPV A;  4BY5 A;  2L98 A;  4NDC A;  4M2O A;  1GQM A;  1CLL A;  2LMU A;  2MLF C;  3DVJ A;  2I94 A;  3B6X A;  1AJ4 A;  3H4S E;  2WCL A;  3B87 A;  3KEV A;  1FI5 A;  1C07 A;  3C1V A;  3SIB A;  1KSO A;  1OMR A;  1REC A;  1EJ3 A;  1XK4 C;  1TNQ A;  2JPO A;  2LMV A;  2QEV A;  4FQT A;  4AOM A;  1GJY A;  1FPW A;  3CR4 X;  4MRY A;  4GGF A;  2K60 A;  5G08 A;  2BKH B;  1CDN A;  3O6B A;  2NCP A;  2Y4Q A;  4N5X A;  2F33 A;  2HET A;  2P70 A;  4FTG A;  5ER4 X;  5BPJ A;  4NDB A;  1SSE B;  2MHH A;  3BQ3 A;  3NHI A;  2B1U A;  4MVF A;  4PAL A;  5HKZ A;  3I5H C;  3DD4 A;  1DJW A;  1DF0 B;  2NCO A;  4PHM A;  3O78 A;  4QJ3 B;  1K9K A;  1OMV A;  1TTX A;  2LMT A;  4U8D A;  1S6I A;  2AUC A;  2LVK A;  3SG6 A;  2F3Y A;  3R1O A;  2HQW A;  1TNW A;  4MZK A;  1KWO B;  2FJU B;  4MRX A;  1S5G Y;  1OW4 A;  1SBJ A;  1KQM B;  1RK9 A;  1MR8 A;  2LLS A;  4P2Y B;  1U5I B;  2LVJ A;  1LA0 A;  2AMI A;  2Y1N A;  3SG5 A;  1J1D A;  1SNL A;  5D69 A;  1JWD A;  1NCY A;  3AAK A;  2L2C A;  1XVJ A;  2CTN A;  1FBV A;  2LVV A;  1XFX O;  3GK4 X;  4INX A;  2KBI A;  1Y1X A;  3FWB A;  3PFV A;  1F54 A;  5AEQ A;  1WRL A;  1SRA A;  2TN4 A;  3KO0 A;  1WLZ A;  4AQJ A;  1M46 A;  2H8V A;  5I94 A;  1N65 A;  2KI6 C;  1R2U A;  2K61 A;  1AK8 A;  3KPX A;  1WLM A;  2M1U A;  1C3Z A;  2BNX A;  3PN7 B;  2I18 A;  1S6J A;  1XFU O;  3RLZ A;  1ZUZ A;  2F2P A;  1B47 A;  4PE0 A;  3TUY B;  1DQE A;  1K93 D;  1B9A A;  3HX4 A;  4A4C A;  4YGA A;  1SY9 A;  1MXE A;  4INW A;  1C7W A;  3LK0 A;  1KK7 Y;  3FE8 A;  4OCI A;  1CLB A;  1MUX A;  2JOJ A;  4HSZ A;  3S0B A;  2M0R A;  2Q91 A;  3PAT A;  1NX3 A;  2M9G A;  4D1E A;  2NXQ A;  1OE9 B;  1EXR A;  3I5H B;  1H4B A;  1QVI Z;  2COL B;  2EHB A;  2I2R E;  2KQY A;  3TDU A;  5FI2 A;  2LM5 A;  5I2Q A;  2ZN9 A;  4I5N B;  3BUW B;  2KDH A;  1DT7 B;  2M8U A;  5GQQ C;  2Y1M A;  1ORG A;  1G4Y R;  2AAO A;  1L2O B;  2JC2 A;  2M3W A;  2BCX A;  1SKT A;  2WCJ A;  3LL8 B;  4PDZ A;  1J55 A;  2KI4 B;  2PVB A;  3FE6 A;  3OX6 A;  2M7N A;  2V53 A;  2H61 A;  1EL4 A;  4JPZ B;  2ISD A;  1CKK A;  3ZWH A;  1WDC C;  3FE9 A;  1OOI X;  2L51 A;  2JUL A;  3EVV A;  1B1G A;  1BG1 A;  1IWQ A;  2P71 A;  5KSZ A;  2LUC A;  1SW8 A;  1YUT A;  2QEO A;  4JD9 A;  1MHO A;  2NZ0 A;  2WC5 A;  2KHN A;  1MXL C;  1DJY A;  1P28 A;  1RWY A;  1LKJ A;  1UP5 A;  2JQ6 A;  4GBA A;  4WQ2 A;  1XFR A;  1EG4 A;  1NCX A;  2CBL A;  3BUN B;  4MLW A;  1OOJ A;  2Q4U A;  3SIA A;  2K7D A;  3OB2 B;  4OV2 A;  4Q04 A;  4PHJ A;  3TS5 B;  5I2L A;  4AQI A;  5KU1 A;  2JXL A;  1B7T Y;  1S1E A;  3SS5 A;  2LUX A;  1DJZ A;  2SCP A;  2K7O A;  1VRK A;  2K0J A;  1S5G Z;  1KWO C;  3DVE A;  1QJT A;  1KQM C;  1IGV A;  3O4X A;  3CZ0 A;  2JT8 A;  1GGW A;  3VRP A;  3WNX B;  2O5G A;  2I7A A;  1DEL A;  2KFH A;  5TNC A;  3GK1 A;  4JKT A;  1JFJ A;  4PHK A;  3BFH A;  2ZKM X;  5HL1 A;  1TWO A;  2ZFD A;  2O60 A;  1DJX A;  1RJV A;  3L4A A;  2CXJ A;  4GPL B;  4ORC B;  1J7Q A;  1YRU B;  1TUJ A;  1GGZ A;  3D75 A;  5HKW A;  1XFV O;  2SAS A;  1OQP A;  3OP0 A;  3GOF A;  3PN7 C;  5DIC A;  1X02 A;  2L5X B;  1KFU S;  1OOG A;  4ORA B;  4XYN A;  1NUB A;  3TUY C;  1SR6 C;  3FS7 A;  1S3P A;  1Y1U A;  2PSR A;  4GNK B;  4IJ7 A;  3DZT A;  1KFX L;  1CLM A;  3AAJ A;  3D77 A;  3DY9 A;  3QRX A;  4QJ4 B;  3EK4 A;  1WRZ A;  2JRF A;  1KK7 Z;  2LLU A;  3SS3 A;  1WDC B;  4XJK A;  2KAX A;  2H61 C;  1BOD A;  3NXA A;  4GUK A;  3BFB A;  1TCF A;  5EL2 A;  3O2P A;  2KQ6 A;  2ZRS A;  1YUU A;  3B7A A;  4QJ5 B;  2WCK A;  1SYM A;  1W9Z A;  1PSB A;  2OS8 B;  3OX5 A;  2M7L A;  2BAP A;  2GV5 A;  3CGA A;  4HRG A;  5PAL A;  3SG7 A;  3VRQ A;  3DF0 A;  3EK8 A;  3A4U B;  1AP4 A;  2LP2 A;  5I8N A;  1A29 A;  1SK6 D;  2M29 A;  2Y5I A;  1DMO A;  1Y1A A;  2ERB A;  1ODB A;  2PAS A;  5DKN A;  2QAC A;  2M1K B;  2FCD A;  2H2K A;  2LC5 A;  5JOL A;  1XA5 A;  1NWD A;  2D8N A;  2KI4 C;  1J7O A;  1C7V A;  1PAL A;  4WQ3 A;  5I2O A;  2OTG B;  4ETO A;  1KK8 B;  1FF1 A;  2E6W A;  3ICB A;  2PAL A;  2PMY A;  2G9B A;  2GGM A;  3BOW A;  3R72 A;  4CLN A;  2F8P A;  5FI7 A;  1Z4H A;  3PLF B;  3D73 A;  2MBX A;  3HCM A;  3NGV A;  1NPQ A;  1S36 A;  2RGI A;  2PYQ A;  3I5F C;  2KYF A;  3IF7 A;  3DVM A;  3BFA A;  2QPT A;  1ALW A;  1PK0 D;  3CZ2 A;  2KLD A;  1CFD A;  4FQO A;  4PE4 A;  3TS5 C;  3VRN A;  5HLO A;  1UWO A;  1RRO A;  5HYD A;  1B7T Z;  1SR6 B;  1BOC A; 
#chains in the Genus database with same CATH homology
 3CLN A;  2E30 A;  1ALV A;  3I5I C;  3SG2 A;  3CS1 A;  1B8R A;  5CSN A;  3VGO A;  2KFF A;  2BL0 B;  2FCE A;  4GGF C;  4R1E A;  4CPV A;  3RM1 A;  1YR5 A;  1CM4 A;  4YGE B;  5F6T A;  4YGD B;  2JXC A;  1RTP 1;  1QV1 A;  2JPT A;  2R2I A;  1FI6 A;  2KOT A;  4YI8 A;  2L0P A;  2K8M B;  2HQ8 A;  4MSP A;  2ZRT A;  1J1E A;  2LHL A;  2L2E A;  3D10 A;  1SCV A;  1UHJ A;  2A4J A;  3NSI A;  1B4C A;  1OMD A;  1CMF A;  1Y0V H;  1K9P A;  1LXF C;  1YRT B;  1IJ5 A;  1CTR A;  1PVA A;  2KNE A;  1TN4 A;  4MZL A;  3EKH A;  2MRD A;  3BXK A;  3VRR A;  3I5G C;  1QLS A;  4N1F A;  4DS7 A;  4E68 A;  5CSF A;  1JBA A;  3FIA A;  1ZFS A;  5CSI A;  5JJG A;  1YVL A;  1AHR A;  3I5F B;  3IQO A;  3DVK A;  1KFX S;  2OS8 C;  1EH2 A;  1F71 A;  1YVH A;  2M97 A;  3KF9 A;  1V1F A;  1XK4 A;  4MN0 A;  5ER5 A;  1PUL A;  3CTN A;  1N0Y A;  1SL7 A;  1CDM A;  1AVS A;  1BR1 B;  1JF0 A;  2BBN A;  3OB1 B;  2KI6 D;  1QTX A;  4M2Q A;  3I5I B;  4UPG A;  5B8I B;  1QS7 A;  3LLE A;  1YUS A;  3F45 A;  1NIW A;  5KTY A;  2OTG C;  1TIZ A;  1KK8 C;  2FOT A;  4C0J A;  2WOS A;  1MF8 B;  1CFF A;  1F70 A;  4PE1 A;  2HPS A;  1PVB A;  1S6C A;  2NLN A;  2WOR A;  3NSL A;  2IS9 A;  1M31 A;  1SCM B;  1SPY A;  4GGN A;  2ZN8 A;  1OZO A;  1OZS A;  2CT9 A;  2JNF A;  1QX2 A;  1SMG A;  2G2B A;  3DF0 B;  3SG3 A;  1DJG A;  4ZCV A;  1LIN A;  3FWC A;  1K94 A;  2LP3 A;  3NSO A;  1IJ6 A;  5K89 A;  3A8R A;  1S26 D;  1RFJ A;  2EC6 C;  5AER A;  1NX2 A;  2DOQ A;  3NSK A;  1KSM A;  1ZOT B;  1L2O C;  1TCO B;  3SG4 A;  2WCB A;  4TNC A;  4HRH A;  1M45 A;  3EKJ A;  1AUI B;  1F8H A;  2LE9 B;  3PM8 A;  1J7P A;  3I5G B;  1L7Z A;  2BL0 C;  4N1G A;  4DIR A;  1CNP A;  1R6P A;  1K95 A;  2JWW A;  3BOW B;  1V1G A;  1XFW O;  3AKB A;  1G33 A;  1QLK A;  1CDL A;  4I5L B;  1HT9 A;  1K2H A;  3D0Y A;  1A03 A;  1IH0 A;  1J7R A;  3CR2 A;  1YX7 A;  3BUM B;  5D7F A;  5HKY A;  3SJS A;  4MEW A;  5J3X A;  5DKQ A;  1UHN A;  2WCF A;  2K2A A;  3O4Y A;  3JTD B;  1CB1 A;  2CNP A;  4IL1 A;  4OR9 B;  2LAN A;  1MWN A;  1NSH A;  2JZI A;  2BE4 A;  1Q80 A;  1OSA A;  1LA3 A;  4MBE A;  4GFT A;  3EVU A;  2JTZ A;  4OKH A;  3K21 A;  2KBM A;  2P6B B;  2KSP A;  4F0Z B;  1FW4 A;  2LVI A;  1DGU A;  1TNX A;  2BCB A;  1PRW A;  2K7B A;  1QV0 A;  3PSR A;  1A75 A;  3EK7 A;  1JF2 A;  1WRK A;  1E8A A;  2L4H A;  2ZNE A;  2LV7 A;  1XYD A;  3CR5 X;  1JFK A;  1CM1 A;  3GK2 A;  2LAP A;  1K90 D;  2KAY A;  2CCM A;  3BUX B;  1A4P A;  2EC6 B;  2HF5 A;  1XFZ O;  1G8I A;  4CFR A;  4ICB A;  2KGR A;  4DCK A;  1M39 A;  1Y6W A;  3BYA A;  3CZT X;  1NYA A;  1F4Q A;  1UHH A;  2JT3 A;  2KGB C;  4HRE E;  1QX5 B;  2WCE A;  4DRW A;  1NX1 A;  1SL8 A;  4NDD A;  1KFU L;  1IQ5 A;  2WND A;  1F55 A;  4P5O E;  1ZMZ A;  1IG5 A;  1JC2 A;  1QIV A;  1UHI A;  1CDP A;  1DF0 A;  3WXA A;  1DTL A;  2ZND A;  1LVC D;  2L4I A;  1IQ3 A;  3AKA A;  1SCM C;  1UHK A;  1JUO A;  1W7I B;  3JVT C;  1QX7 A;  2KYC A;  1DGV A;  3TDZ A;  4DUQ A;  3ZNI A;  2JNX A;  1NP8 A;  4A4B A;  1CFC A;  1BLQ A;  1M63 B;  1W7J B;  5AFP A;  5AAN A;  1NCZ A;  2F3Z A;  1U5I A;  1PSR A;  2LNK A;  2MAZ A;  3TDI A;  3EVR A;  1KQV A;  4L9M A;  4PCW A;  1AJ5 A;  2LLT A;  1TNP A;  4CID A;  3LCP C;  1K9U A;  4CFQ A;  1IKU A;  3IQQ A;  1IRJ A;  2LHI A;  2VRG A;  2K7C A;  5IBW A;  1HQV A;  2BBM A;  3CWG A;  1XFY O;  4YGB B;  5DKR A;  2MA2 A;  2JT0 A;  4WRI A;  2MLE C;  1A2X A;  1K8U A;  2M49 B;  1SL9 A;  4JQ0 D;  1QXP A;  2F2O A;  4I5J A;  3WHT B;  1CFP A;  1UUS A;  1UUR A;  3MSE B;  2BKI B;  2K2F A;  3JTD C;  1WY9 A;  4M2P A;  1N2D A;  2JU0 A;  4MZJ A;  4YGC B;  1D1O A;  4NQG A;  3M0W A;  1XO5 A;  4ZCU A;  3KHE A;  3VRO A;  4PE7 A;  1YUR A;  2BE6 A;  3TZ1 A;  4XJK B;  1MQ1 A;  1TRF A;  1ZAC A;  2WC8 A;  2KAV A;  2OPO A;  1NX0 A;  4JWQ A;  2KFG A;  1YTZ C;  1CMG A;  4C0L A;  4PHN A;  2JTT A;  2MJW B;  3OHM B;  4C0K A;  1B8L A;  1K96 A;  4YBH B;  3D0Y B;  3JVT B;  5HLV A;  4BY4 A;  1EG3 A;  1DJH A;  4USL A;  4YI9 A;  5AXI A;  1QIW A;  2LCP A;  1TOP A;  2GGZ A;  5FYX A;  2EGD A;  1KCY A;  5CSJ A;  4YRU A;  4GAO A;  1QAT A;  1BMO A;  4I5K A;  4OVN F;  1BJF A;  4ORB B;  2BCA A;  1YX8 A;  1JSA A;  1DJI A;  1DVI A;  1F4O A;  1H8B A;  3LK1 A;  2BEC A;  3PAL A;  3WHU B;  3E3R A;  1QAS A;  3BUO B;  1B8C A;  1BR4 B;  1QVI Y;  2PRU A;  2L50 A;  1A75 B;  1BT6 A;  1BU3 A;  5CPV A;  4BY5 A;  2L98 A;  4NDC A;  4M2O A;  1GQM A;  1CLL A;  2LMU A;  2MLF C;  3DVJ A;  2I94 A;  1AJ4 A;  3H4S E;  3KEV A;  1FI5 A;  1C07 A;  3C1V A;  3SIB A;  1KSO A;  1OMR A;  1REC A;  1EJ3 A;  1XK4 C;  1TNQ A;  2LMV A;  4AOM A;  1FPW A;  1GJY A;  3CR4 X;  4MRY A;  4GGF A;  5G08 A;  1CDN A;  2BKH B;  3O6B A;  2NCP A;  2Y4Q A;  4N5X A;  2F33 A;  2HET A;  4FTG A;  5ER4 X;  5BPJ A;  4NDB A;  2MHH A;  3BQ3 A;  2B1U A;  4MVF A;  4PAL A;  5HKZ A;  3I5H C;  3DD4 A;  1DJW A;  1DF0 B;  2NCO A;  4PHM A;  3O78 A;  4QJ3 B;  1K9K A;  1OMV A;  1TTX A;  2LMT A;  4U8D A;  1S6I A;  2AUC A;  2LVK A;  3SG6 A;  2F3Y A;  2HQW A;  1TNW A;  4MZK A;  1KWO B;  2FJU B;  4MRX A;  1S5G Y;  1SBJ A;  1KQM B;  1RK9 A;  1MR8 A;  2LLS A;  4P2Y B;  1U5I B;  2LVJ A;  1LA0 A;  2AMI A;  2Y1N A;  3SG5 A;  1J1D A;  1SNL A;  5D69 A;  1JWD A;  1NCY A;  3AAK A;  1XVJ A;  2CTN A;  1FBV A;  2LVV A;  1XFX O;  3GK4 X;  2KBI A;  1Y1X A;  3FWB A;  3PFV A;  1F54 A;  5AEQ A;  1WRL A;  1SRA A;  2TN4 A;  3KO0 A;  1WLZ A;  4AQJ A;  1M46 A;  1N65 A;  2KI6 C;  1R2U A;  2K61 A;  1AK8 A;  3KPX A;  1WLM A;  2M1U A;  3PN7 B;  2I18 A;  1S6J A;  1XFU O;  3RLZ A;  1ZUZ A;  2F2P A;  1B47 A;  4PE0 A;  3TUY B;  1K93 D;  1B9A A;  3HX4 A;  4A4C A;  4YGA A;  1SY9 A;  1MXE A;  1C7W A;  3LK0 A;  1KK7 Y;  4OCI A;  1CLB A;  1MUX A;  2JOJ A;  4HSZ A;  2M0R A;  2Q91 A;  3PAT A;  1NX3 A;  2M9G A;  4D1E A;  2NXQ A;  1OE9 B;  1EXR A;  3I5H B;  1H4B A;  1QVI Z;  2COL B;  2EHB A;  2I2R E;  2KQY A;  3TDU A;  2LM5 A;  5I2Q A;  2ZN9 A;  4I5N B;  3BUW B;  2KDH A;  1DT7 B;  2M8U A;  5GQQ C;  2Y1M A;  1G4Y R;  2AAO A;  1L2O B;  2JC2 A;  2M3W A;  2BCX A;  1SKT A;  3LL8 B;  4PDZ A;  1J55 A;  2KI4 B;  2PVB A;  3OX6 A;  2M7N A;  2V53 A;  2H61 A;  1EL4 A;  4JPZ B;  2ISD A;  1CKK A;  3ZWH A;  1WDC C;  2L51 A;  2JUL A;  3EVV A;  1B1G A;  1BG1 A;  1IWQ A;  5KSZ A;  2LUC A;  1SW8 A;  1YUT A;  1MHO A;  2NZ0 A;  2KHN A;  1MXL C;  1DJY A;  1RWY A;  1LKJ A;  1UP5 A;  2JQ6 A;  4GBA A;  4WQ2 A;  2CBL A;  1EG4 A;  1NCX A;  3BUN B;  4MLW A;  1OOJ A;  2Q4U A;  3SIA A;  2K7D A;  3OB2 B;  4OV2 A;  4Q04 A;  4PHJ A;  3TS5 B;  5I2L A;  4AQI A;  5KU1 A;  2JXL A;  1B7T Y;  1S1E A;  2LUX A;  1DJZ A;  2SCP A;  2K7O A;  1VRK A;  2K0J A;  1S5G Z;  1KWO C;  3DVE A;  1QJT A;  1KQM C;  1IGV A;  2JT8 A;  1GGW A;  3VRP A;  3WNX B;  2O5G A;  2I7A A;  5TNC A;  2KFH A;  3GK1 A;  1JFJ A;  4PHK A;  2ZKM X;  2ZFD A;  2O60 A;  1DJX A;  1RJV A;  4GPL B;  2CXJ A;  4ORC B;  1J7Q A;  1YRU B;  1GGZ A;  5HKW A;  1XFV O;  2SAS A;  1OQP A;  3OP0 A;  3GOF A;  3PN7 C;  1BF5 A;  1X02 A;  2L5X B;  1KFU S;  4ORA B;  4XYN A;  1NUB A;  3TUY C;  1SR6 C;  3FS7 A;  1S3P A;  1Y1U A;  2PSR A;  4GNK B;  1KFX L;  1CLM A;  3AAJ A;  3QRX A;  4QJ4 B;  3EK4 A;  1WRZ A;  2JRF A;  1KK7 Z;  2LLU A;  1WDC B;  4XJK A;  2KAX A;  2H61 C;  1BOD A;  3NXA A;  4GUK A;  1TCF A;  3O2P A;  2KQ6 A;  2ZRS A;  1YUU A;  4QJ5 B;  1SYM A;  1PSB A;  2OS8 B;  3OX5 A;  2M7L A;  2GV5 A;  3CGA A;  4HRG A;  3SG7 A;  5PAL A;  3VRQ A;  3DF0 A;  3EK8 A;  3A4U B;  1AP4 A;  2LP2 A;  5I8N A;  1A29 A;  1SK6 D;  2M29 A;  2Y5I A;  1DMO A;  1Y1A A;  1ODB A;  2PAS A;  5DKN A;  2QAC A;  2M1K B;  2FCD A;  2H2K A;  2LC5 A;  5JOL A;  1XA5 A;  1NWD A;  2D8N A;  2KI4 C;  1J7O A;  1C7V A;  1PAL A;  4WQ3 A;  5I2O A;  2OTG B;  4ETO A;  1KK8 B;  1FF1 A;  2E6W A;  3ICB A;  2PAL A;  2PMY A;  2G9B A;  2GGM A;  3BOW A;  4CLN A;  2F8P A;  3PLF B;  2MBX A;  3HCM A;  1NPQ A;  1S36 A;  2RGI A;  3I5F C;  2KYF A;  3IF7 A;  3DVM A;  2QPT A;  1ALW A;  1PK0 D;  1CFD A;  4FQO A;  4PE4 A;  3TS5 C;  3VRN A;  5HLO A;  1UWO A;  1RRO A;  5HYD A;  1B7T Z;  1SR6 B;  1BOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...