2KAVA

Solution structure of the human voltage-gated sodium channel, brain isoform (nav1.2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
ENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein regulator
molecule keywords Sodium channel protein type 2 subunit alpha
publication title Solution structure of the NaV1.2 C-terminal EF-hand domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kavA01
4P5OE 3NSLA 1K8UA 1DJYA 1NYAA 2LC5A 3NSIA 1XVJA 1NX1A 2LLSA 1A75A 4PCWA 1JSAA 2M7NA 4OCIA 5CPVA 1DGUA 1QLKA 3WNXB 3I5FB 4PHJA 3WHUB 2BL0B 2JTZA 3CR2A 3BUMB 1PALA 2L4IA 2SCPA 2KDHA 1B7TZ 1SBJA 1RWYA 5CSNA 1OMDA 1IQ5A 2M3WA 1DF0A 2F2OA 2KAXA 4I5JA 1DJWA 1H8BA 1WRZA 4AQJA 1XA5A 2LVJA 3H4SE 1WRLA 1CMGA 1EG3A 1XFZO 1CDLA 1W7JB 3GK2A 5CSJA 1NCZA 1SCMB 2ZN9A 3K21A 4GUKA 1XFWO 1GQMA 1SMGA 4DIRA 1J7QA 1EL4A 1B7TY 4AQIA 4PHKA 2JWWA 1TNPA 2KI6C 4NDDA 1G8IA 3CLNA 3AAJA 1K90D 3VROA 4E68A 1C7VA 2JXCA 4XJKA 1NWDA 1F70A 4DUQA 5DKQA 2LAPA 1YURA 1UHHA 3VRRA 1XYDA 4FTGA 4PE7A 2KOTA 4YGBB 2LMUA 4OV2A 4GFTA 2PMYA 1KCYA 3TUYB 5KU1A 3TDIA 1KFUL 1UHNA 3LK1A 5I2OA 2ISDA 3PALA 2BL0C 4USLA 2KAVA 1XFUO 4CPVA 2L51A 5G08A 3RM1A 3SJSA 4PE0A 1IH0A 1N65A 4GBAA 1SK6D 3VRPA 4CFQA 2KHNA 3GOFA 4M2OA 5JJGA 1LA3A 2JT8A 1NP8A 1YUSA 1W7IB 1BG1A 1FBVA 1WRKA 4YGEB 1KSOA 1F54A 1DVIA 3EVRA 3IF7A 3TZ1A 1SCMC 2OS8B 2MLEC 3EVUA 2F3YA 3BOWA 1HQVA 1ZOTB 1MQ1A 3BUXB 2CTNA 1JUOA 1MR8A 2WC8A 4L9MA 2FCDA 3AKAA 3DD4A 2BKIB 1KQMB 5GQQC 4N1GA 1SRAA 2LUCA 1YX7A 1QTXA 2ZNDA 1GGWA 5J3XA 1QATA 1TOPA 2KI4B 1SPYA 2KI6D 3TUYC 1BR1B 1RJVA 3OP0A 4YGCB 3KHEA 2JOJA 1WLZA 4D1EA 4ORAB 2CCMA 3KF9A 5CSIA 1QASA 1FW4A 1BU3A 1CDPA 2L50A 2GGMA 2HQWA 1MF8B 2KNEA 2M1UA 4WQ3A 5I2QA 5KSZA 4ZCUA 2AUCA 1BF5A 2K61A 1K2HA 3KPXA 5AERA 2LUXA 5AANA 1IQ3A 1CNPA 1SR6B 3PATA 1UHJA 3SG2A 1Y1AA 2BKHB 4JQ0D 1TCFA 2JTTA 5IBWA 1SL9A 4PHMA 1UP5A 2H61A 3O2PA 4MRXA 2MBXA 1A75B 1K96A 1N0YA 3OX5A 1KQMC 1S36A 2PVBA 4CLNA 1BLQA 1LVCD 2PRUA 3EKJA 1K95A 1D1OA 1S6IA 1JF0A 1RTP1 3CR4X 1AHRA 3KEVA 2G9BA 2KI4C 4R1EA 3EK4A 2QPTA 1CM1A 3A4UB 4WRIA 4IL1A 2JQ6A 1Y0VH 4PE4A 1B4CA 2O5GA 4HSZA 3LCPC 3NSKA 2LNKA 1EG4A 1A4PA 2KGRA 2K2FA 4M2PA 1AVSA 3I5GC 1DMOA 1AJ4A 1SL8A 5HKZA 2I2RE 2JNXA 1U5IA 1R2UA 1SR6C 2CXJA 4XJKB 5AXIA 2M7LA 2ZRSA 2Y1NA 4GPLB 3E3RA 1L7ZA 1OMVA 1TRFA 2JT0A 1HT9A 1S6JA 1NCYA 1CLBA 1KWOC 1LKJA 2F8PA 1S6CA 2LLTA 2SASA 2MA2A 2ZFDA 1F55A 1K94A 1GJYA 4OKHA 5HKYA 1VRKA 1SL7A 1TTXA 3LK0A 2GGZA 4TNCA 3PSRA 4I5KA 4JWQA 3DVKA 1NPQA 1EXRA 2JNFA 4WQ2A 4ETOA 2LM5A 1EJ3A 1QV1A 1QX5B 3OB1B 1BJFA 1B47A 1DGVA 1JF2A 1ZFSA 1TCOB 3KO0A 4YBHB 1JWDA 2BCBA 2L0PA 3QRXA 4MBEA 3HCMA 1F8HA 1UWOA 1LXFC 1M63B 1C07A 2LMVA 3BOWB 1M39A 2COLB 2NLNA 1K9KA 3I5FC 3TDZA 1CM4A 1TIZA 3BUWB 1NSHA 1OZOA 2JXLA 2EC6B 1BODA 1WDCB 3SG5A 3TDUA 1J7RA 2JU0A 1XFYO 1KK7Z 1NCXA 1LINA 2KBIA 2ZKMX 2WOSA 2Q4UA 1R6PA 1UHKA 3VRQA 1S3PA 2NXQA 1UURA 1PSRA 1CB1A 2K7CA 3I5IB 2HQ8A 2JRFA 3EKHA 1GGZA 4HRHA 2K8MB 5CSFA 2FJUB 3BUOB 1KK7Y 1F4QA 3O4YA 2H2KA 2JT3A 1L2OB 2ZRTA 2CBLA 1G33A 1Q80A 4A4CA 4XYNA 1QJTA 2LHIA 4QJ4B 3WHTB 1CKKA 1DJGA 1PSBA 3HX4A 2LMTA 2MHHA 3JTDB 1TNWA 2BE6A 3F45A 4GNKB 4QJ3B 5F6TA 2Y4QA 2FCEA 1IJ6A 1CLMA 2HPSA 1WDCC 1C7WA 1PRWA 1SCVA 2M49B 1BR4B 3FWBA 3PN7B 1ALWA 4C0LA 4CFRA 2M9GA 1B8RA 2OPOA 3EK7A 1SKTA 1X02A 3ICBA 1AJ5A 1ZUZA 2K7BA 4MLWA 1WLMA 2BBNA 1SW8A 2F2PA 2KFFA 4OR9B 1DTLA 5HYDA 1IWQA 5HKWA 2G2BA 3NXAA 4YRUA 3CTNA 2PASA 4NDBA 1YRUB 1UUSA 1UHIA 2OS8C 2OTGB 1EH2A 5PALA 1K93D 3EVVA 3VRNA 3ZWHA 4A4BA 4YGAA 2AAOA 1OZSA 2MRDA 3VGOA 4MSPA 2LP3A 1L2OC 1YTZC 2L5XB 2BCAA 2EGDA 1A29A 1RFJA 1XK4C 3IQQA 4N5XA 1QVIZ 4ORCB 4GGFA 1V1GA 1KQVA 1U5IB 1CMFA 2Q91A 4YGDB 1WY9A 2KSPA 3D0YA 5I2LA 3JTDC 4NDCA 1DF0B 2JULA 1PULA 1K9PA 4DRWA 2K0JA 4MEWA 1F71A 1LA0A 1MXLC 1J1DA 1XFXO 3PM8A 2H61C 3CGAA 1DJIA 1DJZA 2KFHA 1QXPA 3IQOA 2NCOA 5AEQA 3PN7C 2NZ0A 3D10A 1QX2A 1CLLA 2F3ZA 2PSRA 1QVIY 4N1FA 2WCBA 3OB2B 4ICBA 2V53A 2WCFA 1M45A 3RLZA 2LVKA 1MXEA 2KQYA 2K2AA 3LL8B 3ZNIA 2M8UA 3FWCA 4U8DA 1RECA 2KGBC 1J7PA 2OTGC 1DJHA 4C0KA 1H4BA 4OVNF 2BE4A 3SIBA 2BECA 3JVTB 2M1KB 4ZCVA 2TN4A 2HETA 3SIAA 1Y1XA 1IRJA 1TN4A 3OX6A 4M2QA 3TS5B 1IKUA 4BY5A 1SY9A 1QLSA 1SNLA 5D69A 1J7OA 1N2DA 4MZJA 5B8IB 2E6WA 1CDMA 2O60A 5D7FA 4AOMA 1CFFA 2P6BB 1OMRA 3AAKA 3DF0A 4PALA 1OSAA 4FQOA 1NX0A 1YRTB 1OQPA 1AP4A 1CFCA 1Y1UA 1YUTA 3PFVA 1FI6A 2EHBA 1QX7A 4PE1A 1S26D 2LLUA 1KSMA 3GK4X 1QIWA 4QJ5B 2QACA 1MUXA 3BXKA 1JC2A 2A4JA 2ZNEA 5AFPA 4Q04A 1M31A 1AK8A 2WNDA 2M0RA 3GK1A 3NSOA 1B8CA 2KBMA 2L4HA 2K7DA 4PDZA 1ALVA 5JOLA 5HLOA 1YX8A 3BUNB 4GGNA 1DT7B 1FI5A 1J55A 1AUIB 3FS7A 1IGVA 1Y6WA 1M46A 3JVTC 4YI9A 5TNCA 1YVHA 3C1VA 2BBMA 4I5LB 3TS5C 1J1EA 2D8NA 2MLFC 2I7AA 2M29A 3CS1A 1QIVA 2HF5A 2F33A 3DVEA 2KYCA 2K7OA 4MRYA 1KFXS 1BMOA 2KAYA 2KFGA 2LE9B 1YVLA 2LV7A 2KQ6A 1FPWA 1YR5A 1G4YR 3SG6A 1RK9A 2IS9A 1FF1A 2JPTA 1MHOA 3I5HB 3LLEA 5ER5A 4HRGA 3M0WA 1KK8B 2L98A 5DKNA 2ZN8A 1PVBA 1IG5A 3O78A 4MVFA 1B9AA 1B1GA 1JFJA 1F4OA 2M97A 2EC6C 1XO5A 3EK8A 3BYAA 2NCPA 5FYXA 2JZIA 3SG4A 3CZTX 2WORA 2GV5A 3WXAA 2BCXA 5ER4X 2Y1MA 3MSEB 3OHMB 1OOJA 4DS7A 3A8RA 1YUUA 1NX3A 2PALA 3D0YB 4ORBB 2R2IA 1E8AA 2RGIA 1A2XA 1S5GZ 1BOCA 3DVMA 5K89A 1B8LA 1MWNA 2CNPA 3I5IC 2LHLA 5KTYA 4P2YB 2JC2A 4PHNA 1NIWA 2I94A 4BY4A 2LP2A 1QS7A 1ODBA 1JFKA 4F0ZB 4NQGA 2FOTA 4HREE 1OE9B 4JPZB 2WCEA 1JBAA 1TNXA 3FIAA 1XK4A 3I5HC 1CDNA 1S5GY 1CTRA 1NUBA 3I5GB 1IJ5A 1DJXA 3CWGA 2CT9A 1KFUS 1ZMZA 1KK8C 1CFDA 1V1FA 5BPJA 5HLVA 1QV0A 4DCKA 4C0JA 4I5NB 5I8NA 2LCPA 3O6BA 1XFVO 2VRGA 1PK0D 4YI8A 2MJWB 2DOQA 3SG3A 1S1EA 1ZACA 4MZLA 1PVAA 2I18A 4CIDA 2Y5IA 4GGFC 1KWOB 3AKBA 2LVVA 3CR5X 3DVJA 3PLFB 4MN0A 2KYFA 4UPGA 5DKRA 1A03A 1CFPA 1NX2A 3BQ3A 1BT6A 3SG7A 3DF0B 2L2EA 1TNQA 2MAZA 2B1UA 1RROA 1KFXL 2AMIA 2LVIA 2E30A 4GAOA 2LANA 4MZKA 1K9UA 1SYMA
chains in the Genus database with same CATH superfamily
4P5OE 3NSLA 1K8UA 1DJYA 1NYAA 2LC5A 3NSIA 2BNXA 1XVJA 1QWVA 1NX1A 3SS3A 2LLSA 1A75A 4PCWA 3S0AA 1JSAA 2M7NA 4OCIA 5CPVA 1DGUA 1QLKA 3WNXB 3I5FB 4PHJA 1OOGA 4KYNA 3WHUB 2BL0B 2JTZA 3CR2A 3BUMB 1PALA 2L4IA 2SCPA 2KDHA 1B7TZ 1SBJA 1RWYA 5CSNA 1OMDA 1IQ5A 2M3WA 1DF0A 2F2OA 5D3OA 2KAXA 4I5JA 1DJWA 1H8BA 1WRZA 2BAPA 4AQJA 1XA5A 3D78A 2LVJA 3H4SE 1WRLA 1CMGA 1EG3A 1XFZO 1CDLA 1W7JB 3N7HA 3GK2A 5CSJA 3UO9A 3BFBA 1NCZA 1SCMB 2ZN9A 3CZ0A 3K21A 1XFWO 4GUKA 1GQMA 1SMGA 4DIRA 1J7QA 1EL4A 1B7TY 4AQIA 4PHKA 2JWWA 1DELA 1TNPA 2KI6C 4NDDA 1G8IA 3CLNA 3AAJA 1K90D 3VROA 4E68A 2WCKA 1C7VA 2JXCA 3NHTA 1W9ZA 4XJKA 1NWDA 3FE8A 4DUQA 1F70A 5DKQA 2LAPA 1YURA 1UHHA 3VRRA 1XYDA 4FTGA 4INXA 2KOTA 4PE7A 4YGBB 2LMUA 4OV2A 4GFTA 2PMYA 2YGUA 1KCYA 2QEBA 3TUYB 5KU1A 3BFAA 3TDIA 1KFUL 1UHNA 3L4AA 3LK1A 5I2OA 4PT1A 2ISDA 3EG5B 2BL0C 3PALA 4USLA 2KAVA 1XFUO 4CPVA 2L51A 5G08A 3RM1A 3SJSA 4PE0A 1IH0A 1N65A 4GBAA 1SK6D 3VRPA 4CFQA 2KHNA 3GOFA 4M2OA 5JJGA 1LA3A 3K1EA 2JT8A 1NP8A 1YUSA 1W7IB 1BG1A 1FBVA 1WRKA 4YGEB 1KSOA 1F54A 1DVIA 3EVRA 3IF7A 3TZ1A 1SCMC 2OS8B 2MLEC 3EVUA 2F3YA 3BOWA 1HQVA 1ZOTB 1MQ1A 3BUXB 4OZDA 2CTNA 1JUOA 1MR8A 2JPOA 2WC8A 4L9MA 2FCDA 3AKAA 3DD4A 2BKIB 1KQMB 5GQQC 1OOFA 4N1GA 3PJIA 1SRAA 2LUCA 1YX7A 1QTXA 2ZNDA 1SSEB 1GGWA 5J3XA 1QATA 1TOPA 2KI4B 4F7FA 1SPYA 1XFRA 2KI6D 1BR1B 3TUYC 1RJVA 3OP0A 4YGCB 3KHEA 2JOJA 1WLZA 4D1EA 4ORAB 2CCMA 3KF9A 5CSIA 1QASA 2H8VA 2KLDA 1FW4A 1BU3A 1CDPA 2L50A 2GGMA 2HQWA 1MF8B 2KNEA 2M1UA 4WQ3A 5I2QA 5KSZA 3S0FA 4ZCUA 2AUCA 1BF5A 3D73A 2K61A 1OW4A 1K2HA 3KPXA 3B7AA 5AERA 2LUXA 5AANA 1IQ3A 1CNPA 1P28A 1SR6B 3PATA 1UHJA 3SG2A 1Y1AA 2BKHB 4JQ0D 1TCFA 2JTTA 5IBWA 1SL9A 4PHMA 1UP5A 2H61A 3O2PA 4MRXA 2MBXA 1A75B 1K96A 1N0YA 3OX5A 1KQMC 1S36A 2PVBA 4CLNA 1BLQA 1LVCD 2PRUA 3OBVA 3EKJA 1K95A 1D1OA 1S6IA 2QEHA 1JF0A 2KPHA 1RTP1 3CR4X 1AHRA 3KEVA 2G9BA 2KI4C 4R1EA 3EK4A 2QPTA 2QEOA 2GTEA 1CM1A 3A4UB 4WRIA 4IL1A 2JQ6A 1Y0VH 4PE4A 1B4CA 2O5GA 3CYZA 4HSZA 3LCPC 3L47A 3NSKA 2LNKA 1EG4A 1A4PA 2KGRA 2K2FA 4M2PA 1TWOA 1AVSA 5FI6A 3I5GC 1DMOA 3CZ2A 1AJ4A 1SL8A 5HKZA 2I2RE 2JNXA 1U5IA 3B87A 3DYEA 1R2UA 1SR6C 2CXJA 4XJKB 4INWA 5AXIA 2M7LA 2ZRSA 2Y1NA 4GPLB 3OGNA 3E3RA 1L7ZA 1OMVA 1TRFA 2JT0A 1HT9A 1S6JA 1NCYA 1CLBA 1KWOC 1LKJA 2F8PA 1S6CA 2LLTA 2SASA 2MA2A 2ZFDA 1F55A 1K94A 1GJYA 4OKHA 5HKYA 1VRKA 1SL7A 1TTXA 3LK0A 3NHIA 2GGZA 3DZTA 3PSRA 4I5KA 4TNCA 4JWQA 3DVKA 1NPQA 1EXRA 2JNFA 4WQ2A 4ETOA 5EL2A 2LM5A 1EJ3A 1QV1A 1QX5B 3OB1B 1BJFA 1B47A 1DGVA 1JF2A 1TUJA 1ZFSA 1TCOB 3CZ1A 2P71A 3KO0A 4YBHB 1JWDA 2BCBA 2L0PA 3QRXA 4MBEA 3HCMA 1F8HA 1UWOA 1LXFC 1M63B 3D76A 1C07A 2LMVA 3B6XA 3BOWB 1M39A 2COLB 2NLNA 1K9KA 3I5FC 3TDZA 1CM4A 3RZSA 1TIZA 3BUWB 1NSHA 1OZOA 2JXLA 2EC6B 1BODA 1WDCB 3SG5A 3TDUA 1J7RA 2JU0A 1XFYO 1KK7Z 1NCXA 1LINA 2KBIA 2ZKMX 2WOSA 3SS4A 2Q4UA 1R6PA 1UHKA 3VRQA 1S3PA 2NXQA 3B88A 1UURA 1PSRA 3D75A 3UNWA 1CB1A 2K7CA 3I5IB 2HQ8A 2JRFA 3EKHA 1GGZA 5FI7A 4HRHA 3S0DA 2K8MB 5CSFA 2FJUB 3BUOB 1KK7Y 1F4QA 3O4YA 2H2KA 4FQTA 2JT3A 1L2OB 2ZRTA 2CBLA 1G33A 1Q80A 4A4CA 4XYNA 1QJTA 2LHIA 4QJ4B 3WHTB 3R1VA 1CKKA 1DJGA 1DQEA 3S0GA 1PSBA 3HX4A 2LMTA 2MHHA 3JTDB 1TNWA 1LS8A 2BE6A 3F45A 4GNKB 4QJ3B 3SS5A 1OOIX 5F6TA 2Y4QA 2FCEA 3D77A 1IJ6A 1CLMA 2HPSA 1WDCC 3NGVA 1C7WA 1PRWA 1SCVA 2ERBA 1BR4B 2M49B 3FWBA 3PN7B 1ALWA 4C0LA 4CFRA 2M9GA 2WCLA 1B8RA 2OPOA 2WC6A 3EK7A 1SKTA 1X02A 3ICBA 1AJ5A 1GM0A 1ZUZA 2K7BA 4MLWA 1WLMA 2BBNA 1SW8A 2F2PA 2KFFA 4OR9B 1DTLA 5HYDA 1IWQA 5HKWA 2G2BA 3NXAA 4YRUA 3CTNA 2PASA 4NDBA 1YRUB 1UUSA 4JD9A 1UHIA 2OS8C 2OTGB 2PYQA 1EH2A 5PALA 1K93D 3EVVA 3VRNA 3ZWHA 2QDIA 4A4BA 4YGAA 2AAOA 1DEKA 1OZSA 2MRDA 3VGOA 4MSPA 2LP3A 1L2OC 1YTZC 1Z4HA 2L5XB 2BCAA 2EGDA 3DY9A 1A29A 1RFJA 1XK4C 3IQQA 4N5XA 1QVIZ 4ORCB 4GGFA 1V1GA 1KQVA 2K60A 3PM2A 1U5IB 1CMFA 2Q91A 4YGDB 1WY9A 2KSPA 3D0YA 5I2LA 3JTDC 4NDCA 1DF0B 2JULA 1PULA 1K9PA 4DRWA 2K0JA 4MEWA 1F71A 1LA0A 1MXLC 2WCJA 1J1DA 1XFXO 3R1OA 3PM8A 2H61C 3CGAA 1DJIA 1DJZA 2KFHA 1QXPA 2WCMA 3IQOA 2NCOA 5AEQA 3PN7C 2NZ0A 3D10A 1QX2A 1CLLA 2F3ZA 2PSRA 1QVIY 4N1FA 2WCBA 3OB2B 2WC5A 4ICBA 2V53A 2WCFA 1M45A 3RLZA 2LVKA 1MXEA 2KQYA 2K2AA 3LL8B 3ZNIA 2M8UA 2WCHA 3FWCA 4U8DA 1RECA 2KGBC 1J7PA 1ORGA 2OTGC 3BFHA 1DJHA 3FE6A 4C0KA 1OOHA 3CDNA 1H4BA 4OVNF 2BE4A 3SIBA 2BECA 3JVTB 2M1KB 4ZCVA 2TN4A 2HETA 3SIAA 1Y1XA 1IRJA 1TN4A 3OX6A 4M2QA 3DXLA 3TS5B 1IKUA 4BY5A 1SY9A 1QLSA 1SNLA 3BJHA 5D69A 1J7OA 5DICA 1N2DA 4MZJA 5B8IB 2E6WA 1CDMA 3IVTA 2O60A 4IJ7A 5D7FA 4AOMA 1CFFA 2P6BB 1OMRA 3AAKA 3DF0A 4PALA 1OSAA 4FQOA 1NX0A 1YRTB 1OQPA 3D74A 1AP4A 1Y1UA 1YUTA 3PFVA 1CFCA 2EHBA 1FI6A 1QX7A 4PE1A 1S26D 2LLUA 1KSMA 3GK4X 1QIWA 4QJ5B 2QACA 1MUXA 3BXKA 1JC2A 2A4JA 2ZNEA 5AFPA 4Q04A 1M31A 1AK8A 2WNDA 2M0RA 3GK1A 3NSOA 1B8CA 2KBMA 2L4HA 2K7DA 4PDZA 1ALVA 3S0EA 5JOLA 5HLOA 1YX8A 3BUNB 4GGNA 1DT7B 1FI5A 1J55A 1AUIB 3FS7A 1IGVA 1Y6WA 1M46A 3JVTC 4YI9A 5TNCA 1YVHA 3C1VA 2BBMA 4I5LB 3TS5C 1J1EA 2D8NA 2MLFC 2I7AA 2M29A 3CS1A 1QIVA 2HF5A 2F33A 3DVEA 2KYCA 2K7OA 4MRYA 3VB1A 1KFXS 1BMOA 2KAYA 2KFGA 2LE9B 1YVLA 2LV7A 2KQ6A 3B86A 1YR5A 1FPWA 1G4YR 1IIOA 3QMEA 1RK9A 3FE9A 3SG6A 2IS9A 5I94A 3O4XA 1FF1A 2JPTA 1MHOA 3I5HB 3LLEA 5ER5A 4HRGA 3M0WA 2P70A 1KK8B 2FJYA 2L98A 5DKNA 2ZN8A 1PVBA 1IG5A 3O78A 4MVFA 1B9AA 1B1GA 1JFJA 1F4OA 2M97A 2EC6C 5HL1A 1XO5A 3EK8A 3BYAA 2NCPA 5FYXA 2JZIA 3SG4A 3CZTX 2WORA 2GV5A 3WXAA 2BCXA 5ER4X 2Y1MA 3MSEB 3OHMB 3Q8IA 1OOJA 4DS7A 3A8RA 1YUUA 1NX3A 2PALA 3D0YB 3L4LA 4ORBB 2R2IA 1E8AA 2RGIA 1A2XA 1S5GZ 1BOCA 3DVMA 5K89A 1B8LA 1MWNA 2CNPA 3I5IC 2LHLA 3R72A 5FI2A 5KTYA 3CABA 4P2YB 2JC2A 4PHNA 1TUZA 1NIWA 2I94A 4BY4A 2LP2A 1QS7A 1ODBA 1JFKA 4F0ZB 4NQGA 2FOTA 4HREE 1OE9B 4JPZB 2WCEA 1JBAA 1TNXA 3S0BA 2L2CA 3FIAA 1XK4A 2QEVA 3I5HC 1S5GY 1CDNA 1CTRA 1C3ZA 1NUBA 3I5GB 1IJ5A 1DJXA 3CWGA 2CT9A 1KFUS 1ZMZA 1KK8C 1CFDA 1V1FA 5BPJA 2L5YA 1QV0A 3R1PA 5HLVA 4DCKA 4C0JA 4I5NB 5I8NA 3V2LA 1C3YA 2LCPA 3O6BA 4JKTA 1XFVO 2VRGA 1PK0D 1T14A 4YI8A 2MJWB 2DOQA 3SG3A 1DC1A 1S1EA 1ZACA 4MZLA 1PVAA 2I18A 4CIDA 2Y5IA 4GGFC 1KWOB 3AKBA 2LVVA 3CR5X 3DVJA 3PLFB 4MN0A 1Z2CB 2KYFA 4UPGA 5DKRA 1A03A 1CFPA 1NX2A 3BQ3A 1BT6A 3SG7A 3DF0B 2L2EA 2KLEA 1TNQA 2MAZA 2B1UA 1RROA 1KFXL 2AMIA 2LVIA 2PQLA 2E30A 4GAOA 2LANA 4MZKA 1K9UA 1SYMA
chains in the Genus database with same CATH topology
4P5OE 3NSLA 1K8UA 1DJYA 1NYAA 2LC5A 3NSIA 1XVJA 1NX1A 2LLSA 1A75A 4PCWA 1JSAA 2M7NA 4OCIA 5CPVA 1DGUA 1QLKA 3WNXB 3I5FB 4PHJA 3WHUB 2BL0B 2JTZA 3CR2A 3BUMB 1PALA 2L4IA 2SCPA 2KDHA 1B7TZ 1SBJA 1RWYA 5CSNA 1OMDA 1IQ5A 2M3WA 1DF0A 2F2OA 2KAXA 4I5JA 1DJWA 1H8BA 1WRZA 4AQJA 1XA5A 2LVJA 3H4SE 1WRLA 1CMGA 1EG3A 1XFZO 1CDLA 1W7JB 3GK2A 5CSJA 1NCZA 1SCMB 2ZN9A 3K21A 4GUKA 1XFWO 1GQMA 1SMGA 4DIRA 1J7QA 1EL4A 1B7TY 4AQIA 4PHKA 2JWWA 1TNPA 2KI6C 4NDDA 1G8IA 3CLNA 3AAJA 1K90D 3VROA 4E68A 1C7VA 2JXCA 4XJKA 1NWDA 1F70A 4DUQA 5DKQA 2LAPA 1YURA 1UHHA 3VRRA 1XYDA 4FTGA 4PE7A 2KOTA 4YGBB 2LMUA 4OV2A 4GFTA 2PMYA 1KCYA 3TUYB 5KU1A 3TDIA 1KFUL 1UHNA 3LK1A 5I2OA 2ISDA 3PALA 2BL0C 4USLA 2KAVA 1XFUO 4CPVA 2L51A 5G08A 3RM1A 3SJSA 4PE0A 1IH0A 1N65A 4GBAA 1SK6D 3VRPA 4CFQA 2KHNA 3GOFA 4M2OA 5JJGA 1LA3A 2JT8A 1NP8A 1YUSA 1W7IB 1BG1A 1FBVA 1WRKA 4YGEB 1KSOA 1F54A 1DVIA 3EVRA 3IF7A 3TZ1A 1SCMC 2OS8B 2MLEC 3EVUA 2F3YA 3BOWA 1HQVA 1ZOTB 1MQ1A 3BUXB 2CTNA 1JUOA 1MR8A 2WC8A 4L9MA 2FCDA 3AKAA 3DD4A 2BKIB 1KQMB 5GQQC 4N1GA 1SRAA 2LUCA 1YX7A 1QTXA 2ZNDA 1GGWA 5J3XA 1QATA 1TOPA 2KI4B 1SPYA 2KI6D 3TUYC 1BR1B 1RJVA 3OP0A 4YGCB 3KHEA 2JOJA 1WLZA 4D1EA 4ORAB 2CCMA 3KF9A 5CSIA 1QASA 1FW4A 1BU3A 1CDPA 2L50A 2GGMA 2HQWA 1MF8B 2KNEA 2M1UA 4WQ3A 5I2QA 5KSZA 4ZCUA 2AUCA 1BF5A 2K61A 1K2HA 3KPXA 5AERA 2LUXA 5AANA 1IQ3A 1CNPA 1SR6B 3PATA 1UHJA 3SG2A 1Y1AA 2BKHB 4JQ0D 1TCFA 2JTTA 5IBWA 1SL9A 4PHMA 1UP5A 2H61A 3O2PA 4MRXA 2MBXA 1A75B 1K96A 1N0YA 3OX5A 1KQMC 1S36A 2PVBA 4CLNA 1BLQA 1LVCD 2PRUA 3EKJA 1K95A 1D1OA 1S6IA 1JF0A 1RTP1 3CR4X 1AHRA 3KEVA 2G9BA 2KI4C 4R1EA 3EK4A 2QPTA 1CM1A 3A4UB 4WRIA 4IL1A 2JQ6A 1Y0VH 4PE4A 1B4CA 2O5GA 4HSZA 3LCPC 3NSKA 2LNKA 1EG4A 1A4PA 2KGRA 2K2FA 4M2PA 1AVSA 3I5GC 1DMOA 1AJ4A 1SL8A 5HKZA 2I2RE 2JNXA 1U5IA 1R2UA 1SR6C 2CXJA 4XJKB 5AXIA 2M7LA 2ZRSA 2Y1NA 4GPLB 3E3RA 1L7ZA 1OMVA 1TRFA 2JT0A 1HT9A 1S6JA 1NCYA 1CLBA 1KWOC 1LKJA 2F8PA 1S6CA 2LLTA 2SASA 2MA2A 2ZFDA 1F55A 1K94A 1GJYA 4OKHA 5HKYA 1VRKA 1SL7A 1TTXA 3LK0A 2GGZA 4TNCA 3PSRA 4I5KA 4JWQA 3DVKA 1NPQA 1EXRA 2JNFA 4WQ2A 4ETOA 2LM5A 1EJ3A 1QV1A 1QX5B 3OB1B 1BJFA 1B47A 1DGVA 1JF2A 1ZFSA 1TCOB 3KO0A 4YBHB 1JWDA 2BCBA 2L0PA 3QRXA 4MBEA 3HCMA 1F8HA 1UWOA 1LXFC 1M63B 1C07A 2LMVA 3BOWB 1M39A 2COLB 2NLNA 1K9KA 3I5FC 3TDZA 1CM4A 1TIZA 3BUWB 1NSHA 1OZOA 2JXLA 2EC6B 1BODA 1WDCB 3SG5A 3TDUA 1J7RA 2JU0A 1XFYO 1KK7Z 1NCXA 1LINA 2KBIA 2ZKMX 2WOSA 2Q4UA 1R6PA 1UHKA 3VRQA 1S3PA 2NXQA 1UURA 1PSRA 1CB1A 2K7CA 3I5IB 2HQ8A 2JRFA 3EKHA 1GGZA 4HRHA 2K8MB 5CSFA 2FJUB 3BUOB 1KK7Y 1F4QA 3O4YA 2H2KA 2JT3A 1L2OB 2ZRTA 2CBLA 1G33A 1Q80A 4A4CA 4XYNA 1QJTA 2LHIA 4QJ4B 3WHTB 1CKKA 1DJGA 1PSBA 3HX4A 2LMTA 2MHHA 3JTDB 1TNWA 2BE6A 3F45A 4GNKB 4QJ3B 5F6TA 2Y4QA 2FCEA 1IJ6A 1CLMA 2HPSA 1WDCC 1C7WA 1PRWA 1SCVA 2M49B 1BR4B 3FWBA 3PN7B 1ALWA 4C0LA 4CFRA 2M9GA 1B8RA 2OPOA 3EK7A 1SKTA 1X02A 3ICBA 1AJ5A 1ZUZA 2K7BA 4MLWA 1WLMA 2BBNA 1SW8A 2F2PA 2KFFA 4OR9B 1DTLA 5HYDA 1IWQA 5HKWA 2G2BA 3NXAA 4YRUA 3CTNA 2PASA 4NDBA 1YRUB 1UUSA 1UHIA 2OS8C 2OTGB 1EH2A 5PALA 1K93D 3EVVA 3VRNA 3ZWHA 4A4BA 4YGAA 2AAOA 1OZSA 2MRDA 3VGOA 4MSPA 2LP3A 1L2OC 1YTZC 2L5XB 2BCAA 2EGDA 1A29A 1RFJA 1XK4C 3IQQA 4N5XA 1QVIZ 4ORCB 4GGFA 1V1GA 1KQVA 1U5IB 1CMFA 2Q91A 4YGDB 1WY9A 2KSPA 3D0YA 5I2LA 3JTDC 4NDCA 1DF0B 2JULA 1PULA 1K9PA 4DRWA 2K0JA 4MEWA 1F71A 1LA0A 1MXLC 1J1DA 1XFXO 3PM8A 2H61C 3CGAA 1DJIA 1DJZA 2KFHA 1QXPA 3IQOA 2NCOA 5AEQA 3PN7C 2NZ0A 3D10A 1QX2A 1CLLA 2F3ZA 2PSRA 1QVIY 4N1FA 2WCBA 3OB2B 4ICBA 2V53A 2WCFA 1M45A 3RLZA 2LVKA 1MXEA 2KQYA 2K2AA 3LL8B 3ZNIA 2M8UA 3FWCA 4U8DA 1RECA 2KGBC 1J7PA 2OTGC 1DJHA 4C0KA 1H4BA 4OVNF 2BE4A 3SIBA 2BECA 3JVTB 2M1KB 4ZCVA 2TN4A 2HETA 3SIAA 1Y1XA 1IRJA 1TN4A 3OX6A 4M2QA 3TS5B 1IKUA 4BY5A 1SY9A 1QLSA 1SNLA 5D69A 1J7OA 1N2DA 4MZJA 5B8IB 2E6WA 1CDMA 2O60A 5D7FA 4AOMA 1CFFA 2P6BB 1OMRA 3AAKA 3DF0A 4PALA 1OSAA 4FQOA 1NX0A 1YRTB 1OQPA 1AP4A 1CFCA 1Y1UA 1YUTA 3PFVA 1FI6A 2EHBA 1QX7A 4PE1A 1S26D 2LLUA 1KSMA 3GK4X 1QIWA 4QJ5B 2QACA 1MUXA 3BXKA 1JC2A 2A4JA 2ZNEA 5AFPA 4Q04A 1M31A 1AK8A 2WNDA 2M0RA 3GK1A 3NSOA 1B8CA 2KBMA 2L4HA 2K7DA 4PDZA 1ALVA 5JOLA 5HLOA 1YX8A 3BUNB 4GGNA 1DT7B 1FI5A 1J55A 1AUIB 3FS7A 1IGVA 1Y6WA 1M46A 3JVTC 4YI9A 5TNCA 1YVHA 3C1VA 2BBMA 4I5LB 3TS5C 1J1EA 2D8NA 2MLFC 2I7AA 2M29A 3CS1A 1QIVA 2HF5A 2F33A 3DVEA 2KYCA 2K7OA 4MRYA 1KFXS 1BMOA 2KAYA 2KFGA 2LE9B 1YVLA 2LV7A 2KQ6A 1FPWA 1YR5A 1G4YR 3SG6A 1RK9A 2IS9A 1FF1A 2JPTA 1MHOA 3I5HB 3LLEA 5ER5A 4HRGA 3M0WA 1KK8B 2L98A 5DKNA 2ZN8A 1PVBA 1IG5A 3O78A 4MVFA 1B9AA 1B1GA 1JFJA 1F4OA 2M97A 2EC6C 1XO5A 3EK8A 3BYAA 2NCPA 5FYXA 2JZIA 3SG4A 3CZTX 2WORA 2GV5A 3WXAA 2BCXA 5ER4X 2Y1MA 3MSEB 3OHMB 1OOJA 4DS7A 3A8RA 1YUUA 1NX3A 2PALA 3D0YB 4ORBB 2R2IA 1E8AA 2RGIA 1A2XA 1S5GZ 1BOCA 3DVMA 5K89A 1B8LA 1MWNA 2CNPA 3I5IC 2LHLA 5KTYA 4P2YB 2JC2A 4PHNA 1NIWA 2I94A 4BY4A 2LP2A 1QS7A 1ODBA 1JFKA 4F0ZB 4NQGA 2FOTA 4HREE 1OE9B 4JPZB 2WCEA 1JBAA 1TNXA 3FIAA 1XK4A 3I5HC 1CDNA 1S5GY 1CTRA 1NUBA 3I5GB 1IJ5A 1DJXA 3CWGA 2CT9A 1KFUS 1ZMZA 1KK8C 1CFDA 1V1FA 5BPJA 5HLVA 1QV0A 4DCKA 4C0JA 4I5NB 5I8NA 2LCPA 3O6BA 1XFVO 2VRGA 1PK0D 4YI8A 2MJWB 2DOQA 3SG3A 1S1EA 1ZACA 4MZLA 1PVAA 2I18A 4CIDA 2Y5IA 4GGFC 1KWOB 3AKBA 2LVVA 3CR5X 3DVJA 3PLFB 4MN0A 2KYFA 4UPGA 5DKRA 1A03A 1CFPA 1NX2A 3BQ3A 1BT6A 3SG7A 3DF0B 2L2EA 1TNQA 2MAZA 2B1UA 1RROA 1KFXL 2AMIA 2LVIA 2E30A 4GAOA 2LANA 4MZKA 1K9UA 1SYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O E;  3NSL A;  1K8U A;  1DJY A;  1NYA A;  2LC5 A;  3NSI A;  1XVJ A;  1NX1 A;  2LLS A;  1A75 A;  4PCW A;  1JSA A;  2M7N A;  4OCI A;  5CPV A;  1DGU A;  1QLK A;  3WNX B;  3I5F B;  4PHJ A;  3WHU B;  2BL0 B;  2JTZ A;  3CR2 A;  3BUM B;  1PAL A;  2L4I A;  2SCP A;  2KDH A;  1B7T Z;  1SBJ A;  1RWY A;  5CSN A;  1OMD A;  1IQ5 A;  2M3W A;  1DF0 A;  2F2O A;  2KAX A;  4I5J A;  1DJW A;  1H8B A;  1WRZ A;  4AQJ A;  1XA5 A;  2LVJ A;  3H4S E;  1WRL A;  1CMG A;  1EG3 A;  1XFZ O;  1CDL A;  1W7J B;  3GK2 A;  5CSJ A;  1NCZ A;  1SCM B;  2ZN9 A;  3K21 A;  4GUK A;  1XFW O;  1GQM A;  1SMG A;  4DIR A;  1J7Q A;  1EL4 A;  1B7T Y;  4AQI A;  4PHK A;  2JWW A;  1TNP A;  2KI6 C;  4NDD A;  1G8I A;  3CLN A;  3AAJ A;  1K90 D;  3VRO A;  4E68 A;  1C7V A;  2JXC A;  4XJK A;  1NWD A;  1F70 A;  4DUQ A;  5DKQ A;  2LAP A;  1YUR A;  1UHH A;  3VRR A;  1XYD A;  4FTG A;  4PE7 A;  2KOT A;  4YGB B;  2LMU A;  4OV2 A;  4GFT A;  2PMY A;  1KCY A;  3TUY B;  5KU1 A;  3TDI A;  1KFU L;  1UHN A;  3LK1 A;  5I2O A;  2ISD A;  3PAL A;  2BL0 C;  4USL A;  2KAV A;  1XFU O;  4CPV A;  2L51 A;  5G08 A;  3RM1 A;  3SJS A;  4PE0 A;  1IH0 A;  1N65 A;  4GBA A;  1SK6 D;  3VRP A;  4CFQ A;  2KHN A;  3GOF A;  4M2O A;  5JJG A;  1LA3 A;  2JT8 A;  1NP8 A;  1YUS A;  1W7I B;  1BG1 A;  1FBV A;  1WRK A;  4YGE B;  1KSO A;  1F54 A;  1DVI A;  3EVR A;  3IF7 A;  3TZ1 A;  1SCM C;  2OS8 B;  2MLE C;  3EVU A;  2F3Y A;  3BOW A;  1HQV A;  1ZOT B;  1MQ1 A;  3BUX B;  2CTN A;  1JUO A;  1MR8 A;  2WC8 A;  4L9M A;  2FCD A;  3AKA A;  3DD4 A;  2BKI B;  1KQM B;  5GQQ C;  4N1G A;  1SRA A;  2LUC A;  1YX7 A;  1QTX A;  2ZND A;  1GGW A;  5J3X A;  1QAT A;  1TOP A;  2KI4 B;  1SPY A;  2KI6 D;  3TUY C;  1BR1 B;  1RJV A;  3OP0 A;  4YGC B;  3KHE A;  2JOJ A;  1WLZ A;  4D1E A;  4ORA B;  2CCM A;  3KF9 A;  5CSI A;  1QAS A;  1FW4 A;  1BU3 A;  1CDP A;  2L50 A;  2GGM A;  2HQW A;  1MF8 B;  2KNE A;  2M1U A;  4WQ3 A;  5I2Q A;  5KSZ A;  4ZCU A;  2AUC A;  1BF5 A;  2K61 A;  1K2H A;  3KPX A;  5AER A;  2LUX A;  5AAN A;  1IQ3 A;  1CNP A;  1SR6 B;  3PAT A;  1UHJ A;  3SG2 A;  1Y1A A;  2BKH B;  4JQ0 D;  1TCF A;  2JTT A;  5IBW A;  1SL9 A;  4PHM A;  1UP5 A;  2H61 A;  3O2P A;  4MRX A;  2MBX A;  1A75 B;  1K96 A;  1N0Y A;  3OX5 A;  1KQM C;  1S36 A;  2PVB A;  4CLN A;  1BLQ A;  1LVC D;  2PRU A;  3EKJ A;  1K95 A;  1D1O A;  1S6I A;  1JF0 A;  1RTP 1;  3CR4 X;  1AHR A;  3KEV A;  2G9B A;  2KI4 C;  4R1E A;  3EK4 A;  2QPT A;  1CM1 A;  3A4U B;  4WRI A;  4IL1 A;  2JQ6 A;  1Y0V H;  4PE4 A;  1B4C A;  2O5G A;  4HSZ A;  3LCP C;  3NSK A;  2LNK A;  1EG4 A;  1A4P A;  2KGR A;  2K2F A;  4M2P A;  1AVS A;  3I5G C;  1DMO A;  1AJ4 A;  1SL8 A;  5HKZ A;  2I2R E;  2JNX A;  1U5I A;  1R2U A;  1SR6 C;  2CXJ A;  4XJK B;  5AXI A;  2M7L A;  2ZRS A;  2Y1N A;  4GPL B;  3E3R A;  1L7Z A;  1OMV A;  1TRF A;  2JT0 A;  1HT9 A;  1S6J A;  1NCY A;  1CLB A;  1KWO C;  1LKJ A;  2F8P A;  1S6C A;  2LLT A;  2SAS A;  2MA2 A;  2ZFD A;  1F55 A;  1K94 A;  1GJY A;  4OKH A;  5HKY A;  1VRK A;  1SL7 A;  1TTX A;  3LK0 A;  2GGZ A;  4TNC A;  3PSR A;  4I5K A;  4JWQ A;  3DVK A;  1NPQ A;  1EXR A;  2JNF A;  4WQ2 A;  4ETO A;  2LM5 A;  1EJ3 A;  1QV1 A;  1QX5 B;  3OB1 B;  1BJF A;  1B47 A;  1DGV A;  1JF2 A;  1ZFS A;  1TCO B;  3KO0 A;  4YBH B;  1JWD A;  2BCB A;  2L0P A;  3QRX A;  4MBE A;  3HCM A;  1F8H A;  1UWO A;  1LXF C;  1M63 B;  1C07 A;  2LMV A;  3BOW B;  1M39 A;  2COL B;  2NLN A;  1K9K A;  3I5F C;  3TDZ A;  1CM4 A;  1TIZ A;  3BUW B;  1NSH A;  1OZO A;  2JXL A;  2EC6 B;  1BOD A;  1WDC B;  3SG5 A;  3TDU A;  1J7R A;  2JU0 A;  1XFY O;  1KK7 Z;  1NCX A;  1LIN A;  2KBI A;  2ZKM X;  2WOS A;  2Q4U A;  1R6P A;  1UHK A;  3VRQ A;  1S3P A;  2NXQ A;  1UUR A;  1PSR A;  1CB1 A;  2K7C A;  3I5I B;  2HQ8 A;  2JRF A;  3EKH A;  1GGZ A;  4HRH A;  2K8M B;  5CSF A;  2FJU B;  3BUO B;  1KK7 Y;  1F4Q A;  3O4Y A;  2H2K A;  2JT3 A;  1L2O B;  2ZRT A;  2CBL A;  1G33 A;  1Q80 A;  4A4C A;  4XYN A;  1QJT A;  2LHI A;  4QJ4 B;  3WHT B;  1CKK A;  1DJG A;  1PSB A;  3HX4 A;  2LMT A;  2MHH A;  3JTD B;  1TNW A;  2BE6 A;  3F45 A;  4GNK B;  4QJ3 B;  5F6T A;  2Y4Q A;  2FCE A;  1IJ6 A;  1CLM A;  2HPS A;  1WDC C;  1C7W A;  1PRW A;  1SCV A;  2M49 B;  1BR4 B;  3FWB A;  3PN7 B;  1ALW A;  4C0L A;  4CFR A;  2M9G A;  1B8R A;  2OPO A;  3EK7 A;  1SKT A;  1X02 A;  3ICB A;  1AJ5 A;  1ZUZ A;  2K7B A;  4MLW A;  1WLM A;  2BBN A;  1SW8 A;  2F2P A;  2KFF A;  4OR9 B;  1DTL A;  5HYD A;  1IWQ A;  5HKW A;  2G2B A;  3NXA A;  4YRU A;  3CTN A;  2PAS A;  4NDB A;  1YRU B;  1UUS A;  1UHI A;  2OS8 C;  2OTG B;  1EH2 A;  5PAL A;  1K93 D;  3EVV A;  3VRN A;  3ZWH A;  4A4B A;  4YGA A;  2AAO A;  1OZS A;  2MRD A;  3VGO A;  4MSP A;  2LP3 A;  1L2O C;  1YTZ C;  2L5X B;  2BCA A;  2EGD A;  1A29 A;  1RFJ A;  1XK4 C;  3IQQ A;  4N5X A;  1QVI Z;  4ORC B;  4GGF A;  1V1G A;  1KQV A;  1U5I B;  1CMF A;  2Q91 A;  4YGD B;  1WY9 A;  2KSP A;  3D0Y A;  5I2L A;  3JTD C;  4NDC A;  1DF0 B;  2JUL A;  1PUL A;  1K9P A;  4DRW A;  2K0J A;  4MEW A;  1F71 A;  1LA0 A;  1MXL C;  1J1D A;  1XFX O;  3PM8 A;  2H61 C;  3CGA A;  1DJI A;  1DJZ A;  2KFH A;  1QXP A;  3IQO A;  2NCO A;  5AEQ A;  3PN7 C;  2NZ0 A;  3D10 A;  1QX2 A;  1CLL A;  2F3Z A;  2PSR A;  1QVI Y;  4N1F A;  2WCB A;  3OB2 B;  4ICB A;  2V53 A;  2WCF A;  1M45 A;  3RLZ A;  2LVK A;  1MXE A;  2KQY A;  2K2A A;  3LL8 B;  3ZNI A;  2M8U A;  3FWC A;  4U8D A;  1REC A;  2KGB C;  1J7P A;  2OTG C;  1DJH A;  4C0K A;  1H4B A;  4OVN F;  2BE4 A;  3SIB A;  2BEC A;  3JVT B;  2M1K B;  4ZCV A;  2TN4 A;  2HET A;  3SIA A;  1Y1X A;  1IRJ A;  1TN4 A;  3OX6 A;  4M2Q A;  3TS5 B;  1IKU A;  4BY5 A;  1SY9 A;  1QLS A;  1SNL A;  5D69 A;  1J7O A;  1N2D A;  4MZJ A;  5B8I B;  2E6W A;  1CDM A;  2O60 A;  5D7F A;  4AOM A;  1CFF A;  2P6B B;  1OMR A;  3AAK A;  3DF0 A;  4PAL A;  1OSA A;  4FQO A;  1NX0 A;  1YRT B;  1OQP A;  1AP4 A;  1CFC A;  1Y1U A;  1YUT A;  3PFV A;  1FI6 A;  2EHB A;  1QX7 A;  4PE1 A;  1S26 D;  2LLU A;  1KSM A;  3GK4 X;  1QIW A;  4QJ5 B;  2QAC A;  1MUX A;  3BXK A;  1JC2 A;  2A4J A;  2ZNE A;  5AFP A;  4Q04 A;  1M31 A;  1AK8 A;  2WND A;  2M0R A;  3GK1 A;  3NSO A;  1B8C A;  2KBM A;  2L4H A;  2K7D A;  4PDZ A;  1ALV A;  5JOL A;  5HLO A;  1YX8 A;  3BUN B;  4GGN A;  1DT7 B;  1FI5 A;  1J55 A;  1AUI B;  3FS7 A;  1IGV A;  1Y6W A;  1M46 A;  3JVT C;  4YI9 A;  5TNC A;  1YVH A;  3C1V A;  2BBM A;  4I5L B;  3TS5 C;  1J1E A;  2D8N A;  2MLF C;  2I7A A;  2M29 A;  3CS1 A;  1QIV A;  2HF5 A;  2F33 A;  3DVE A;  2KYC A;  2K7O A;  4MRY A;  1KFX S;  1BMO A;  2KAY A;  2KFG A;  2LE9 B;  1YVL A;  2LV7 A;  2KQ6 A;  1FPW A;  1YR5 A;  1G4Y R;  3SG6 A;  1RK9 A;  2IS9 A;  1FF1 A;  2JPT A;  1MHO A;  3I5H B;  3LLE A;  5ER5 A;  4HRG A;  3M0W A;  1KK8 B;  2L98 A;  5DKN A;  2ZN8 A;  1PVB A;  1IG5 A;  3O78 A;  4MVF A;  1B9A A;  1B1G A;  1JFJ A;  1F4O A;  2M97 A;  2EC6 C;  1XO5 A;  3EK8 A;  3BYA A;  2NCP A;  5FYX A;  2JZI A;  3SG4 A;  3CZT X;  2WOR A;  2GV5 A;  3WXA A;  2BCX A;  5ER4 X;  2Y1M A;  3MSE B;  3OHM B;  1OOJ A;  4DS7 A;  3A8R A;  1YUU A;  1NX3 A;  2PAL A;  3D0Y B;  4ORB B;  2R2I A;  1E8A A;  2RGI A;  1A2X A;  1S5G Z;  1BOC A;  3DVM A;  5K89 A;  1B8L A;  1MWN A;  2CNP A;  3I5I C;  2LHL A;  5KTY A;  4P2Y B;  2JC2 A;  4PHN A;  1NIW A;  2I94 A;  4BY4 A;  2LP2 A;  1QS7 A;  1ODB A;  1JFK A;  4F0Z B;  4NQG A;  2FOT A;  4HRE E;  1OE9 B;  4JPZ B;  2WCE A;  1JBA A;  1TNX A;  3FIA A;  1XK4 A;  3I5H C;  1CDN A;  1S5G Y;  1CTR A;  1NUB A;  3I5G B;  1IJ5 A;  1DJX A;  3CWG A;  2CT9 A;  1KFU S;  1ZMZ A;  1KK8 C;  1CFD A;  1V1F A;  5BPJ A;  5HLV A;  1QV0 A;  4DCK A;  4C0J A;  4I5N B;  5I8N A;  2LCP A;  3O6B A;  1XFV O;  2VRG A;  1PK0 D;  4YI8 A;  2MJW B;  2DOQ A;  3SG3 A;  1S1E A;  1ZAC A;  4MZL A;  1PVA A;  2I18 A;  4CID A;  2Y5I A;  4GGF C;  1KWO B;  3AKB A;  2LVV A;  3CR5 X;  3DVJ A;  3PLF B;  4MN0 A;  2KYF A;  4UPG A;  5DKR A;  1A03 A;  1CFP A;  1NX2 A;  3BQ3 A;  1BT6 A;  3SG7 A;  3DF0 B;  2L2E A;  1TNQ A;  2MAZ A;  2B1U A;  1RRO A;  1KFX L;  2AMI A;  2LVI A;  2E30 A;  4GAO A;  2LAN A;  4MZK A;  1K9U A;  1SYM A; 
#chains in the Genus database with same CATH topology
 4P5O E;  3NSL A;  1K8U A;  1DJY A;  1NYA A;  2LC5 A;  3NSI A;  2BNX A;  1XVJ A;  1QWV A;  1NX1 A;  3SS3 A;  2LLS A;  1A75 A;  4PCW A;  3S0A A;  1JSA A;  2M7N A;  4OCI A;  5CPV A;  1DGU A;  1QLK A;  3WNX B;  3I5F B;  4PHJ A;  1OOG A;  4KYN A;  3WHU B;  2BL0 B;  2JTZ A;  3CR2 A;  3BUM B;  1PAL A;  2L4I A;  2SCP A;  2KDH A;  1B7T Z;  1SBJ A;  1RWY A;  5CSN A;  1OMD A;  1IQ5 A;  2M3W A;  1DF0 A;  2F2O A;  5D3O A;  2KAX A;  4I5J A;  1DJW A;  1H8B A;  1WRZ A;  2BAP A;  4AQJ A;  1XA5 A;  3D78 A;  2LVJ A;  3H4S E;  1WRL A;  1CMG A;  1EG3 A;  1XFZ O;  1CDL A;  1W7J B;  3N7H A;  3GK2 A;  5CSJ A;  3UO9 A;  3BFB A;  1NCZ A;  1SCM B;  2ZN9 A;  3CZ0 A;  3K21 A;  1XFW O;  4GUK A;  1GQM A;  1SMG A;  4DIR A;  1J7Q A;  1EL4 A;  1B7T Y;  4AQI A;  4PHK A;  2JWW A;  1DEL A;  1TNP A;  2KI6 C;  4NDD A;  1G8I A;  3CLN A;  3AAJ A;  1K90 D;  3VRO A;  4E68 A;  2WCK A;  1C7V A;  2JXC A;  3NHT A;  1W9Z A;  4XJK A;  1NWD A;  3FE8 A;  4DUQ A;  1F70 A;  5DKQ A;  2LAP A;  1YUR A;  1UHH A;  3VRR A;  1XYD A;  4FTG A;  4INX A;  2KOT A;  4PE7 A;  4YGB B;  2LMU A;  4OV2 A;  4GFT A;  2PMY A;  2YGU A;  1KCY A;  2QEB A;  3TUY B;  5KU1 A;  3BFA A;  3TDI A;  1KFU L;  1UHN A;  3L4A A;  3LK1 A;  5I2O A;  4PT1 A;  2ISD A;  3EG5 B;  2BL0 C;  3PAL A;  4USL A;  2KAV A;  1XFU O;  4CPV A;  2L51 A;  5G08 A;  3RM1 A;  3SJS A;  4PE0 A;  1IH0 A;  1N65 A;  4GBA A;  1SK6 D;  3VRP A;  4CFQ A;  2KHN A;  3GOF A;  4M2O A;  5JJG A;  1LA3 A;  3K1E A;  2JT8 A;  1NP8 A;  1YUS A;  1W7I B;  1BG1 A;  1FBV A;  1WRK A;  4YGE B;  1KSO A;  1F54 A;  1DVI A;  3EVR A;  3IF7 A;  3TZ1 A;  1SCM C;  2OS8 B;  2MLE C;  3EVU A;  2F3Y A;  3BOW A;  1HQV A;  1ZOT B;  1MQ1 A;  3BUX B;  4OZD A;  2CTN A;  1JUO A;  1MR8 A;  2JPO A;  2WC8 A;  4L9M A;  2FCD A;  3AKA A;  3DD4 A;  2BKI B;  1KQM B;  5GQQ C;  1OOF A;  4N1G A;  3PJI A;  1SRA A;  2LUC A;  1YX7 A;  1QTX A;  2ZND A;  1SSE B;  1GGW A;  5J3X A;  1QAT A;  1TOP A;  2KI4 B;  4F7F A;  1SPY A;  1XFR A;  2KI6 D;  1BR1 B;  3TUY C;  1RJV A;  3OP0 A;  4YGC B;  3KHE A;  2JOJ A;  1WLZ A;  4D1E A;  4ORA B;  2CCM A;  3KF9 A;  5CSI A;  1QAS A;  2H8V A;  2KLD A;  1FW4 A;  1BU3 A;  1CDP A;  2L50 A;  2GGM A;  2HQW A;  1MF8 B;  2KNE A;  2M1U A;  4WQ3 A;  5I2Q A;  5KSZ A;  3S0F A;  4ZCU A;  2AUC A;  1BF5 A;  3D73 A;  2K61 A;  1OW4 A;  1K2H A;  3KPX A;  3B7A A;  5AER A;  2LUX A;  5AAN A;  1IQ3 A;  1CNP A;  1P28 A;  1SR6 B;  3PAT A;  1UHJ A;  3SG2 A;  1Y1A A;  2BKH B;  4JQ0 D;  1TCF A;  2JTT A;  5IBW A;  1SL9 A;  4PHM A;  1UP5 A;  2H61 A;  3O2P A;  4MRX A;  2MBX A;  1A75 B;  1K96 A;  1N0Y A;  3OX5 A;  1KQM C;  1S36 A;  2PVB A;  4CLN A;  1BLQ A;  1LVC D;  2PRU A;  3OBV A;  3EKJ A;  1K95 A;  1D1O A;  1S6I A;  2QEH A;  1JF0 A;  2KPH A;  1RTP 1;  3CR4 X;  1AHR A;  3KEV A;  2G9B A;  2KI4 C;  4R1E A;  3EK4 A;  2QPT A;  2QEO A;  2GTE A;  1CM1 A;  3A4U B;  4WRI A;  4IL1 A;  2JQ6 A;  1Y0V H;  4PE4 A;  1B4C A;  2O5G A;  3CYZ A;  4HSZ A;  3LCP C;  3L47 A;  3NSK A;  2LNK A;  1EG4 A;  1A4P A;  2KGR A;  2K2F A;  4M2P A;  1TWO A;  1AVS A;  5FI6 A;  3I5G C;  1DMO A;  3CZ2 A;  1AJ4 A;  1SL8 A;  5HKZ A;  2I2R E;  2JNX A;  1U5I A;  3B87 A;  3DYE A;  1R2U A;  1SR6 C;  2CXJ A;  4XJK B;  4INW A;  5AXI A;  2M7L A;  2ZRS A;  2Y1N A;  4GPL B;  3OGN A;  3E3R A;  1L7Z A;  1OMV A;  1TRF A;  2JT0 A;  1HT9 A;  1S6J A;  1NCY A;  1CLB A;  1KWO C;  1LKJ A;  2F8P A;  1S6C A;  2LLT A;  2SAS A;  2MA2 A;  2ZFD A;  1F55 A;  1K94 A;  1GJY A;  4OKH A;  5HKY A;  1VRK A;  1SL7 A;  1TTX A;  3LK0 A;  3NHI A;  2GGZ A;  3DZT A;  3PSR A;  4I5K A;  4TNC A;  4JWQ A;  3DVK A;  1NPQ A;  1EXR A;  2JNF A;  4WQ2 A;  4ETO A;  5EL2 A;  2LM5 A;  1EJ3 A;  1QV1 A;  1QX5 B;  3OB1 B;  1BJF A;  1B47 A;  1DGV A;  1JF2 A;  1TUJ A;  1ZFS A;  1TCO B;  3CZ1 A;  2P71 A;  3KO0 A;  4YBH B;  1JWD A;  2BCB A;  2L0P A;  3QRX A;  4MBE A;  3HCM A;  1F8H A;  1UWO A;  1LXF C;  1M63 B;  3D76 A;  1C07 A;  2LMV A;  3B6X A;  3BOW B;  1M39 A;  2COL B;  2NLN A;  1K9K A;  3I5F C;  3TDZ A;  1CM4 A;  3RZS A;  1TIZ A;  3BUW B;  1NSH A;  1OZO A;  2JXL A;  2EC6 B;  1BOD A;  1WDC B;  3SG5 A;  3TDU A;  1J7R A;  2JU0 A;  1XFY O;  1KK7 Z;  1NCX A;  1LIN A;  2KBI A;  2ZKM X;  2WOS A;  3SS4 A;  2Q4U A;  1R6P A;  1UHK A;  3VRQ A;  1S3P A;  2NXQ A;  3B88 A;  1UUR A;  1PSR A;  3D75 A;  3UNW A;  1CB1 A;  2K7C A;  3I5I B;  2HQ8 A;  2JRF A;  3EKH A;  1GGZ A;  5FI7 A;  4HRH A;  3S0D A;  2K8M B;  5CSF A;  2FJU B;  3BUO B;  1KK7 Y;  1F4Q A;  3O4Y A;  2H2K A;  4FQT A;  2JT3 A;  1L2O B;  2ZRT A;  2CBL A;  1G33 A;  1Q80 A;  4A4C A;  4XYN A;  1QJT A;  2LHI A;  4QJ4 B;  3WHT B;  3R1V A;  1CKK A;  1DJG A;  1DQE A;  3S0G A;  1PSB A;  3HX4 A;  2LMT A;  2MHH A;  3JTD B;  1TNW A;  1LS8 A;  2BE6 A;  3F45 A;  4GNK B;  4QJ3 B;  3SS5 A;  1OOI X;  5F6T A;  2Y4Q A;  2FCE A;  3D77 A;  1IJ6 A;  1CLM A;  2HPS A;  1WDC C;  3NGV A;  1C7W A;  1PRW A;  1SCV A;  2ERB A;  1BR4 B;  2M49 B;  3FWB A;  3PN7 B;  1ALW A;  4C0L A;  4CFR A;  2M9G A;  2WCL A;  1B8R A;  2OPO A;  2WC6 A;  3EK7 A;  1SKT A;  1X02 A;  3ICB A;  1AJ5 A;  1GM0 A;  1ZUZ A;  2K7B A;  4MLW A;  1WLM A;  2BBN A;  1SW8 A;  2F2P A;  2KFF A;  4OR9 B;  1DTL A;  5HYD A;  1IWQ A;  5HKW A;  2G2B A;  3NXA A;  4YRU A;  3CTN A;  2PAS A;  4NDB A;  1YRU B;  1UUS A;  4JD9 A;  1UHI A;  2OS8 C;  2OTG B;  2PYQ A;  1EH2 A;  5PAL A;  1K93 D;  3EVV A;  3VRN A;  3ZWH A;  2QDI A;  4A4B A;  4YGA A;  2AAO A;  1DEK A;  1OZS A;  2MRD A;  3VGO A;  4MSP A;  2LP3 A;  1L2O C;  1YTZ C;  1Z4H A;  2L5X B;  2BCA A;  2EGD A;  3DY9 A;  1A29 A;  1RFJ A;  1XK4 C;  3IQQ A;  4N5X A;  1QVI Z;  4ORC B;  4GGF A;  1V1G A;  1KQV A;  2K60 A;  3PM2 A;  1U5I B;  1CMF A;  2Q91 A;  4YGD B;  1WY9 A;  2KSP A;  3D0Y A;  5I2L A;  3JTD C;  4NDC A;  1DF0 B;  2JUL A;  1PUL A;  1K9P A;  4DRW A;  2K0J A;  4MEW A;  1F71 A;  1LA0 A;  1MXL C;  2WCJ A;  1J1D A;  1XFX O;  3R1O A;  3PM8 A;  2H61 C;  3CGA A;  1DJI A;  1DJZ A;  2KFH A;  1QXP A;  2WCM A;  3IQO A;  2NCO A;  5AEQ A;  3PN7 C;  2NZ0 A;  3D10 A;  1QX2 A;  1CLL A;  2F3Z A;  2PSR A;  1QVI Y;  4N1F A;  2WCB A;  3OB2 B;  2WC5 A;  4ICB A;  2V53 A;  2WCF A;  1M45 A;  3RLZ A;  2LVK A;  1MXE A;  2KQY A;  2K2A A;  3LL8 B;  3ZNI A;  2M8U A;  2WCH A;  3FWC A;  4U8D A;  1REC A;  2KGB C;  1J7P A;  1ORG A;  2OTG C;  3BFH A;  1DJH A;  3FE6 A;  4C0K A;  1OOH A;  3CDN A;  1H4B A;  4OVN F;  2BE4 A;  3SIB A;  2BEC A;  3JVT B;  2M1K B;  4ZCV A;  2TN4 A;  2HET A;  3SIA A;  1Y1X A;  1IRJ A;  1TN4 A;  3OX6 A;  4M2Q A;  3DXL A;  3TS5 B;  1IKU A;  4BY5 A;  1SY9 A;  1QLS A;  1SNL A;  3BJH A;  5D69 A;  1J7O A;  5DIC A;  1N2D A;  4MZJ A;  5B8I B;  2E6W A;  1CDM A;  3IVT A;  2O60 A;  4IJ7 A;  5D7F A;  4AOM A;  1CFF A;  2P6B B;  1OMR A;  3AAK A;  3DF0 A;  4PAL A;  1OSA A;  4FQO A;  1NX0 A;  1YRT B;  1OQP A;  3D74 A;  1AP4 A;  1Y1U A;  1YUT A;  3PFV A;  1CFC A;  2EHB A;  1FI6 A;  1QX7 A;  4PE1 A;  1S26 D;  2LLU A;  1KSM A;  3GK4 X;  1QIW A;  4QJ5 B;  2QAC A;  1MUX A;  3BXK A;  1JC2 A;  2A4J A;  2ZNE A;  5AFP A;  4Q04 A;  1M31 A;  1AK8 A;  2WND A;  2M0R A;  3GK1 A;  3NSO A;  1B8C A;  2KBM A;  2L4H A;  2K7D A;  4PDZ A;  1ALV A;  3S0E A;  5JOL A;  5HLO A;  1YX8 A;  3BUN B;  4GGN A;  1DT7 B;  1FI5 A;  1J55 A;  1AUI B;  3FS7 A;  1IGV A;  1Y6W A;  1M46 A;  3JVT C;  4YI9 A;  5TNC A;  1YVH A;  3C1V A;  2BBM A;  4I5L B;  3TS5 C;  1J1E A;  2D8N A;  2MLF C;  2I7A A;  2M29 A;  3CS1 A;  1QIV A;  2HF5 A;  2F33 A;  3DVE A;  2KYC A;  2K7O A;  4MRY A;  3VB1 A;  1KFX S;  1BMO A;  2KAY A;  2KFG A;  2LE9 B;  1YVL A;  2LV7 A;  2KQ6 A;  3B86 A;  1YR5 A;  1FPW A;  1G4Y R;  1IIO A;  3QME A;  1RK9 A;  3FE9 A;  3SG6 A;  2IS9 A;  5I94 A;  3O4X A;  1FF1 A;  2JPT A;  1MHO A;  3I5H B;  3LLE A;  5ER5 A;  4HRG A;  3M0W A;  2P70 A;  1KK8 B;  2FJY A;  2L98 A;  5DKN A;  2ZN8 A;  1PVB A;  1IG5 A;  3O78 A;  4MVF A;  1B9A A;  1B1G A;  1JFJ A;  1F4O A;  2M97 A;  2EC6 C;  5HL1 A;  1XO5 A;  3EK8 A;  3BYA A;  2NCP A;  5FYX A;  2JZI A;  3SG4 A;  3CZT X;  2WOR A;  2GV5 A;  3WXA A;  2BCX A;  5ER4 X;  2Y1M A;  3MSE B;  3OHM B;  3Q8I A;  1OOJ A;  4DS7 A;  3A8R A;  1YUU A;  1NX3 A;  2PAL A;  3D0Y B;  3L4L A;  4ORB B;  2R2I A;  1E8A A;  2RGI A;  1A2X A;  1S5G Z;  1BOC A;  3DVM A;  5K89 A;  1B8L A;  1MWN A;  2CNP A;  3I5I C;  2LHL A;  3R72 A;  5FI2 A;  5KTY A;  3CAB A;  4P2Y B;  2JC2 A;  4PHN A;  1TUZ A;  1NIW A;  2I94 A;  4BY4 A;  2LP2 A;  1QS7 A;  1ODB A;  1JFK A;  4F0Z B;  4NQG A;  2FOT A;  4HRE E;  1OE9 B;  4JPZ B;  2WCE A;  1JBA A;  1TNX A;  3S0B A;  2L2C A;  3FIA A;  1XK4 A;  2QEV A;  3I5H C;  1S5G Y;  1CDN A;  1CTR A;  1C3Z A;  1NUB A;  3I5G B;  1IJ5 A;  1DJX A;  3CWG A;  2CT9 A;  1KFU S;  1ZMZ A;  1KK8 C;  1CFD A;  1V1F A;  5BPJ A;  2L5Y A;  1QV0 A;  3R1P A;  5HLV A;  4DCK A;  4C0J A;  4I5N B;  5I8N A;  3V2L A;  1C3Y A;  2LCP A;  3O6B A;  4JKT A;  1XFV O;  2VRG A;  1PK0 D;  1T14 A;  4YI8 A;  2MJW B;  2DOQ A;  3SG3 A;  1DC1 A;  1S1E A;  1ZAC A;  4MZL A;  1PVA A;  2I18 A;  4CID A;  2Y5I A;  4GGF C;  1KWO B;  3AKB A;  2LVV A;  3CR5 X;  3DVJ A;  3PLF B;  4MN0 A;  1Z2C B;  2KYF A;  4UPG A;  5DKR A;  1A03 A;  1CFP A;  1NX2 A;  3BQ3 A;  1BT6 A;  3SG7 A;  3DF0 B;  2L2E A;  2KLE A;  1TNQ A;  2MAZ A;  2B1U A;  1RRO A;  1KFX L;  2AMI A;  2LVI A;  2PQL A;  2E30 A;  4GAO A;  2LAN A;  4MZK A;  1K9U A;  1SYM A; 
#chains in the Genus database with same CATH homology
 4P5O E;  3NSL A;  1K8U A;  1DJY A;  1NYA A;  2LC5 A;  3NSI A;  1XVJ A;  1NX1 A;  2LLS A;  1A75 A;  4PCW A;  1JSA A;  2M7N A;  4OCI A;  5CPV A;  1DGU A;  1QLK A;  3WNX B;  3I5F B;  4PHJ A;  3WHU B;  2BL0 B;  2JTZ A;  3CR2 A;  3BUM B;  1PAL A;  2L4I A;  2SCP A;  2KDH A;  1B7T Z;  1SBJ A;  1RWY A;  5CSN A;  1OMD A;  1IQ5 A;  2M3W A;  1DF0 A;  2F2O A;  2KAX A;  4I5J A;  1DJW A;  1H8B A;  1WRZ A;  4AQJ A;  1XA5 A;  2LVJ A;  3H4S E;  1WRL A;  1CMG A;  1EG3 A;  1XFZ O;  1CDL A;  1W7J B;  3GK2 A;  5CSJ A;  1NCZ A;  1SCM B;  2ZN9 A;  3K21 A;  4GUK A;  1XFW O;  1GQM A;  1SMG A;  4DIR A;  1J7Q A;  1EL4 A;  1B7T Y;  4AQI A;  4PHK A;  2JWW A;  1TNP A;  2KI6 C;  4NDD A;  1G8I A;  3CLN A;  3AAJ A;  1K90 D;  3VRO A;  4E68 A;  1C7V A;  2JXC A;  4XJK A;  1NWD A;  1F70 A;  4DUQ A;  5DKQ A;  2LAP A;  1YUR A;  1UHH A;  3VRR A;  1XYD A;  4FTG A;  4PE7 A;  2KOT A;  4YGB B;  2LMU A;  4OV2 A;  4GFT A;  2PMY A;  1KCY A;  3TUY B;  5KU1 A;  3TDI A;  1KFU L;  1UHN A;  3LK1 A;  5I2O A;  2ISD A;  3PAL A;  2BL0 C;  4USL A;  2KAV A;  1XFU O;  4CPV A;  2L51 A;  5G08 A;  3RM1 A;  3SJS A;  4PE0 A;  1IH0 A;  1N65 A;  4GBA A;  1SK6 D;  3VRP A;  4CFQ A;  2KHN A;  3GOF A;  4M2O A;  5JJG A;  1LA3 A;  2JT8 A;  1NP8 A;  1YUS A;  1W7I B;  1BG1 A;  1FBV A;  1WRK A;  4YGE B;  1KSO A;  1F54 A;  1DVI A;  3EVR A;  3IF7 A;  3TZ1 A;  1SCM C;  2OS8 B;  2MLE C;  3EVU A;  2F3Y A;  3BOW A;  1HQV A;  1ZOT B;  1MQ1 A;  3BUX B;  2CTN A;  1JUO A;  1MR8 A;  2WC8 A;  4L9M A;  2FCD A;  3AKA A;  3DD4 A;  2BKI B;  1KQM B;  5GQQ C;  4N1G A;  1SRA A;  2LUC A;  1YX7 A;  1QTX A;  2ZND A;  1GGW A;  5J3X A;  1QAT A;  1TOP A;  2KI4 B;  1SPY A;  2KI6 D;  3TUY C;  1BR1 B;  1RJV A;  3OP0 A;  4YGC B;  3KHE A;  2JOJ A;  1WLZ A;  4D1E A;  4ORA B;  2CCM A;  3KF9 A;  5CSI A;  1QAS A;  1FW4 A;  1BU3 A;  1CDP A;  2L50 A;  2GGM A;  2HQW A;  1MF8 B;  2KNE A;  2M1U A;  4WQ3 A;  5I2Q A;  5KSZ A;  4ZCU A;  2AUC A;  1BF5 A;  2K61 A;  1K2H A;  3KPX A;  5AER A;  2LUX A;  5AAN A;  1IQ3 A;  1CNP A;  1SR6 B;  3PAT A;  1UHJ A;  3SG2 A;  1Y1A A;  2BKH B;  4JQ0 D;  1TCF A;  2JTT A;  5IBW A;  1SL9 A;  4PHM A;  1UP5 A;  2H61 A;  3O2P A;  4MRX A;  2MBX A;  1A75 B;  1K96 A;  1N0Y A;  3OX5 A;  1KQM C;  1S36 A;  2PVB A;  4CLN A;  1BLQ A;  1LVC D;  2PRU A;  3EKJ A;  1K95 A;  1D1O A;  1S6I A;  1JF0 A;  1RTP 1;  3CR4 X;  1AHR A;  3KEV A;  2G9B A;  2KI4 C;  4R1E A;  3EK4 A;  2QPT A;  1CM1 A;  3A4U B;  4WRI A;  4IL1 A;  2JQ6 A;  1Y0V H;  4PE4 A;  1B4C A;  2O5G A;  4HSZ A;  3LCP C;  3NSK A;  2LNK A;  1EG4 A;  1A4P A;  2KGR A;  2K2F A;  4M2P A;  1AVS A;  3I5G C;  1DMO A;  1AJ4 A;  1SL8 A;  5HKZ A;  2I2R E;  2JNX A;  1U5I A;  1R2U A;  1SR6 C;  2CXJ A;  4XJK B;  5AXI A;  2M7L A;  2ZRS A;  2Y1N A;  4GPL B;  3E3R A;  1L7Z A;  1OMV A;  1TRF A;  2JT0 A;  1HT9 A;  1S6J A;  1NCY A;  1CLB A;  1KWO C;  1LKJ A;  2F8P A;  1S6C A;  2LLT A;  2SAS A;  2MA2 A;  2ZFD A;  1F55 A;  1K94 A;  1GJY A;  4OKH A;  5HKY A;  1VRK A;  1SL7 A;  1TTX A;  3LK0 A;  2GGZ A;  4TNC A;  3PSR A;  4I5K A;  4JWQ A;  3DVK A;  1NPQ A;  1EXR A;  2JNF A;  4WQ2 A;  4ETO A;  2LM5 A;  1EJ3 A;  1QV1 A;  1QX5 B;  3OB1 B;  1BJF A;  1B47 A;  1DGV A;  1JF2 A;  1ZFS A;  1TCO B;  3KO0 A;  4YBH B;  1JWD A;  2BCB A;  2L0P A;  3QRX A;  4MBE A;  3HCM A;  1F8H A;  1UWO A;  1LXF C;  1M63 B;  1C07 A;  2LMV A;  3BOW B;  1M39 A;  2COL B;  2NLN A;  1K9K A;  3I5F C;  3TDZ A;  1CM4 A;  1TIZ A;  3BUW B;  1NSH A;  1OZO A;  2JXL A;  2EC6 B;  1BOD A;  1WDC B;  3SG5 A;  3TDU A;  1J7R A;  2JU0 A;  1XFY O;  1KK7 Z;  1NCX A;  1LIN A;  2KBI A;  2ZKM X;  2WOS A;  2Q4U A;  1R6P A;  1UHK A;  3VRQ A;  1S3P A;  2NXQ A;  1UUR A;  1PSR A;  1CB1 A;  2K7C A;  3I5I B;  2HQ8 A;  2JRF A;  3EKH A;  1GGZ A;  4HRH A;  2K8M B;  5CSF A;  2FJU B;  3BUO B;  1KK7 Y;  1F4Q A;  3O4Y A;  2H2K A;  2JT3 A;  1L2O B;  2ZRT A;  2CBL A;  1G33 A;  1Q80 A;  4A4C A;  4XYN A;  1QJT A;  2LHI A;  4QJ4 B;  3WHT B;  1CKK A;  1DJG A;  1PSB A;  3HX4 A;  2LMT A;  2MHH A;  3JTD B;  1TNW A;  2BE6 A;  3F45 A;  4GNK B;  4QJ3 B;  5F6T A;  2Y4Q A;  2FCE A;  1IJ6 A;  1CLM A;  2HPS A;  1WDC C;  1C7W A;  1PRW A;  1SCV A;  2M49 B;  1BR4 B;  3FWB A;  3PN7 B;  1ALW A;  4C0L A;  4CFR A;  2M9G A;  1B8R A;  2OPO A;  3EK7 A;  1SKT A;  1X02 A;  3ICB A;  1AJ5 A;  1ZUZ A;  2K7B A;  4MLW A;  1WLM A;  2BBN A;  1SW8 A;  2F2P A;  2KFF A;  4OR9 B;  1DTL A;  5HYD A;  1IWQ A;  5HKW A;  2G2B A;  3NXA A;  4YRU A;  3CTN A;  2PAS A;  4NDB A;  1YRU B;  1UUS A;  1UHI A;  2OS8 C;  2OTG B;  1EH2 A;  5PAL A;  1K93 D;  3EVV A;  3VRN A;  3ZWH A;  4A4B A;  4YGA A;  2AAO A;  1OZS A;  2MRD A;  3VGO A;  4MSP A;  2LP3 A;  1L2O C;  1YTZ C;  2L5X B;  2BCA A;  2EGD A;  1A29 A;  1RFJ A;  1XK4 C;  3IQQ A;  4N5X A;  1QVI Z;  4ORC B;  4GGF A;  1V1G A;  1KQV A;  1U5I B;  1CMF A;  2Q91 A;  4YGD B;  1WY9 A;  2KSP A;  3D0Y A;  5I2L A;  3JTD C;  4NDC A;  1DF0 B;  2JUL A;  1PUL A;  1K9P A;  4DRW A;  2K0J A;  4MEW A;  1F71 A;  1LA0 A;  1MXL C;  1J1D A;  1XFX O;  3PM8 A;  2H61 C;  3CGA A;  1DJI A;  1DJZ A;  2KFH A;  1QXP A;  3IQO A;  2NCO A;  5AEQ A;  3PN7 C;  2NZ0 A;  3D10 A;  1QX2 A;  1CLL A;  2F3Z A;  2PSR A;  1QVI Y;  4N1F A;  2WCB A;  3OB2 B;  4ICB A;  2V53 A;  2WCF A;  1M45 A;  3RLZ A;  2LVK A;  1MXE A;  2KQY A;  2K2A A;  3LL8 B;  3ZNI A;  2M8U A;  3FWC A;  4U8D A;  1REC A;  2KGB C;  1J7P A;  2OTG C;  1DJH A;  4C0K A;  1H4B A;  4OVN F;  2BE4 A;  3SIB A;  2BEC A;  3JVT B;  2M1K B;  4ZCV A;  2TN4 A;  2HET A;  3SIA A;  1Y1X A;  1IRJ A;  1TN4 A;  3OX6 A;  4M2Q A;  3TS5 B;  1IKU A;  4BY5 A;  1SY9 A;  1QLS A;  1SNL A;  5D69 A;  1J7O A;  1N2D A;  4MZJ A;  5B8I B;  2E6W A;  1CDM A;  2O60 A;  5D7F A;  4AOM A;  1CFF A;  2P6B B;  1OMR A;  3AAK A;  3DF0 A;  4PAL A;  1OSA A;  4FQO A;  1NX0 A;  1YRT B;  1OQP A;  1AP4 A;  1CFC A;  1Y1U A;  1YUT A;  3PFV A;  1FI6 A;  2EHB A;  1QX7 A;  4PE1 A;  1S26 D;  2LLU A;  1KSM A;  3GK4 X;  1QIW A;  4QJ5 B;  2QAC A;  1MUX A;  3BXK A;  1JC2 A;  2A4J A;  2ZNE A;  5AFP A;  4Q04 A;  1M31 A;  1AK8 A;  2WND A;  2M0R A;  3GK1 A;  3NSO A;  1B8C A;  2KBM A;  2L4H A;  2K7D A;  4PDZ A;  1ALV A;  5JOL A;  5HLO A;  1YX8 A;  3BUN B;  4GGN A;  1DT7 B;  1FI5 A;  1J55 A;  1AUI B;  3FS7 A;  1IGV A;  1Y6W A;  1M46 A;  3JVT C;  4YI9 A;  5TNC A;  1YVH A;  3C1V A;  2BBM A;  4I5L B;  3TS5 C;  1J1E A;  2D8N A;  2MLF C;  2I7A A;  2M29 A;  3CS1 A;  1QIV A;  2HF5 A;  2F33 A;  3DVE A;  2KYC A;  2K7O A;  4MRY A;  1KFX S;  1BMO A;  2KAY A;  2KFG A;  2LE9 B;  1YVL A;  2LV7 A;  2KQ6 A;  1FPW A;  1YR5 A;  1G4Y R;  3SG6 A;  1RK9 A;  2IS9 A;  1FF1 A;  2JPT A;  1MHO A;  3I5H B;  3LLE A;  5ER5 A;  4HRG A;  3M0W A;  1KK8 B;  2L98 A;  5DKN A;  2ZN8 A;  1PVB A;  1IG5 A;  3O78 A;  4MVF A;  1B9A A;  1B1G A;  1JFJ A;  1F4O A;  2M97 A;  2EC6 C;  1XO5 A;  3EK8 A;  3BYA A;  2NCP A;  5FYX A;  2JZI A;  3SG4 A;  3CZT X;  2WOR A;  2GV5 A;  3WXA A;  2BCX A;  5ER4 X;  2Y1M A;  3MSE B;  3OHM B;  1OOJ A;  4DS7 A;  3A8R A;  1YUU A;  1NX3 A;  2PAL A;  3D0Y B;  4ORB B;  2R2I A;  1E8A A;  2RGI A;  1A2X A;  1S5G Z;  1BOC A;  3DVM A;  5K89 A;  1B8L A;  1MWN A;  2CNP A;  3I5I C;  2LHL A;  5KTY A;  4P2Y B;  2JC2 A;  4PHN A;  1NIW A;  2I94 A;  4BY4 A;  2LP2 A;  1QS7 A;  1ODB A;  1JFK A;  4F0Z B;  4NQG A;  2FOT A;  4HRE E;  1OE9 B;  4JPZ B;  2WCE A;  1JBA A;  1TNX A;  3FIA A;  1XK4 A;  3I5H C;  1CDN A;  1S5G Y;  1CTR A;  1NUB A;  3I5G B;  1IJ5 A;  1DJX A;  3CWG A;  2CT9 A;  1KFU S;  1ZMZ A;  1KK8 C;  1CFD A;  1V1F A;  5BPJ A;  5HLV A;  1QV0 A;  4DCK A;  4C0J A;  4I5N B;  5I8N A;  2LCP A;  3O6B A;  1XFV O;  2VRG A;  1PK0 D;  4YI8 A;  2MJW B;  2DOQ A;  3SG3 A;  1S1E A;  1ZAC A;  4MZL A;  1PVA A;  2I18 A;  4CID A;  2Y5I A;  4GGF C;  1KWO B;  3AKB A;  2LVV A;  3CR5 X;  3DVJ A;  3PLF B;  4MN0 A;  2KYF A;  4UPG A;  5DKR A;  1A03 A;  1CFP A;  1NX2 A;  3BQ3 A;  1BT6 A;  3SG7 A;  3DF0 B;  2L2E A;  1TNQ A;  2MAZ A;  2B1U A;  1RRO A;  1KFX L;  2AMI A;  2LVI A;  2E30 A;  4GAO A;  2LAN A;  4MZK A;  1K9U A;  1SYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...