5HLOA

Crystal structure of calcium and zinc-bound human s100a8 in space group c2221
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
ALTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Crystal structure of human S100A8 in complex with zinc and calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hloA00
1JUOA 1KWOC 3DVEA 4CPVA 1QATA 2ZNDA 3GK4X 1J1DA 2P6BB 1XK4C 5ER4X 2LHIA 1RFJA 2FCDA 2M7NA 2JQ6A 5K89A 1M45A 1KQMB 4MRYA 3NSIA 4PHNA 1SPYA 1FBVA 4ORCB 1Y1UA 4HRHA 3SIAA 2K7CA 2WCBA 2KSPA 3KEVA 2RGIA 2E6WA 1GGWA 2K7DA 4DUQA 3D0YA 2VRGA 2BCBA 1OSAA 1PK0D 1S5GZ 1ALWA 5ER5A 5AERA 2WCEA 1BOCA 3PN7C 2LVJA 3TDZA 1KFXL 2A4JA 4USLA 1ZUZA 5G08A 1N0YA 3JVTC 3BUOB 2L4IA 2JULA 3FS7A 4BY5A 1BR4B 3EVVA 3I5GB 2NLNA 1J55A 3VRQA 3JTDC 3TUYC 2PALA 4MZKA 1F54A 1A75A 3LCPC 1JF0A 1EL4A 2JT0A 2KAVA 3RM1A 5B8IB 1XO5A 5AFPA 2FJUB 1J7RA 3EK8A 2KFGA 1XA5A 3FWCA 3CZTX 1DT7B 1S6JA 4UPGA 1G33A 4N1GA 1F4OA 2KNEA 5HKYA 3LL8B 2MJWB 4PDZA 2B1UA 3CTNA 2K7OA 2BCXA 4I5KA 2JT8A 1SYMA 3IQQA 1SRAA 2OTGB 4M2PA 3OX6A 4ICBA 1JSAA 3GOFA 2LCPA 1B8LA 1G4YR 2LVKA 1SBJA 1B7TZ 4OKHA 4N1FA 2BBNA 3BYAA 1UURA 1KFUS 3EK4A 4MEWA 2PSRA 1IWQA 2FOTA 2PMYA 1B4CA 1CMGA 1A03A 3ICBA 4MVFA 3H4SE 5CSFA 1TNQA 1V1FA 4DS7A 5I2LA 4GNKB 1QLKA 2BCAA 2LHLA 4NDCA 4GFTA 5KU1A 1QS7A 2M9GA 3VRPA 1IGVA 2PRUA 4IL1A 1S5GY 1JC2A 3D0YB 3QRXA 1G8IA 3TDUA 1A4PA 3JVTB 2ZNEA 1DTLA 2Q91A 3AKAA 1B47A 1AUIB 4P5OE 1CTRA 1DVIA 2I7AA 1AJ5A 3MSEB 5CSNA 1NWDA 3TUYB 3JTDB 2L4HA 3IF7A 2IS9A 3FWBA 1JBAA 2M1KB 1GQMA 2MHHA 1OZOA 4F0ZB 1PVBA 1CKKA 1W7IB 1A75B 1BR1B 1S36A 1TTXA 2K2AA 5I2QA 2OS8C 3DVMA 2LM5A 1XYDA 2L0PA 4AQIA 1DJGA 1NUBA 2HQ8A 1VRKA 2M1UA 1QX2A 4I5LB 2M7LA 2M0RA 1TN4A 1RTP1 2AUCA 1HT9A 3SG7A 1XFZO 1NX1A 1PULA 1SL7A 1SR6C 2I94A 2AAOA 3EVUA 1TIZA 1KCYA 3PLFB 1XFYO 1NYAA 2SCPA 3OX5A 3TDIA 3CGAA 1NCYA 1QIWA 1QVIZ 3CR5X 4OV2A 2L2EA 2JZIA 3WNXB 1QX5B 3IQOA 1DJWA 1QV0A 4QJ5B 2LNKA 1B7TY 2KBMA 4PCWA 4YBHB 1SK6D 1JFKA 3I5HC 2WORA 1JF2A 2LAPA 2CXJA 2Y1NA 3NXAA 1B1GA 2F3YA 4FQOA 1D1OA 2K7BA 1CLLA 2KFHA 2KI6D 1BODA 3OHMB 2BE6A 4ORAB 3AAKA 1J7OA 3E3RA 2BKHB 4C0LA 5J3XA 4DCKA 1S1EA 3I5FC 2EGDA 1R6PA 2TN4A 2KFFA 1ZOTB 3CR2A 2K8MB 1LINA 1PALA 4YGBB 2KAYA 1B9AA 1KK7Z 2JNFA 2SASA 3SG3A 2ZRSA 3NSOA 4PE7A 3TS5B 1YVHA 5HKZA 1E8AA 2COLB 1KSMA 1SL9A 2JNXA 2L50A 1DGUA 1BT6A 1CLMA 3GK2A 3O6BA 2OS8B 1MR8A 1WLZA 2O60A 1QTXA 2I18A 3DVKA 1WLMA 1YRUB 2HQWA 3NSKA 1RECA 3EKJA 2JTZA 1ODBA 2L5XB 1AP4A 1QX7A 3OB1B 1CMFA 1J7PA 4GPLB 1CFFA 1ZACA 1FI5A 1S26D 3BUWB 3PM8A 4M2QA 1CFPA 1W7JB 2MAZA 1TNXA 3LLEA 1IKUA 5AEQA 5CSIA 3HX4A 1NX0A 1MXLC 1DJHA 1UHIA 1KWOB 1UP5A 3BXKA 3CR4X 3D10A 4PHJA 2LMVA 3WHTB 4YGEB 1CLBA 4BY4A 1F55A 3FIAA 1GJYA 1TNWA 1C7VA 2H61A 2LLTA 1RJVA 4PE1A 2L51A 5DKQA 3EK7A 4YGCB 2CT9A 5DKRA 3A8RA 2JU0A 3NSLA 1DJXA 4YGAA 4OVNF 4PALA 2BE4A 1CDPA 5HLVA 4DIRA 2H61C 3A4UB 1ZFSA 2JOJA 4YI8A 4MZJA 5D69A 4OCIA 1B8CA 5CPVA 1YUSA 1J1EA 2NCOA 2BL0C 4CFRA 2WCFA 2F33A 4HRGA 5BPJA 3PN7B 3SG2A 3I5FB 4Q04A 4TNCA 4C0KA 1M63B 4I5JA 1OZSA 2ZRTA 1BJFA 2M29A 1V1GA 2M97A 1EG4A 3BQ3A 4YGDB 1PVAA 1QLSA 1SKTA 3DF0A 5D7FA 1WY9A 4A4BA 4MSPA 1C07A 1UUSA 2KDHA 2K2FA 2F2PA 1KK7Y 1CB1A 4PE4A 1X02A 1Y0VH 5TNCA 1KK8C 1DMOA 4JPZB 2GGMA 2CNPA 1LKJA 1BG1A 2LMTA 2DOQA 1B8RA 1NCZA 1OQPA 1KQMC 3EKHA 1NPQA 2F3ZA 5HYDA 1S6IA 2KHNA 1YX8A 1BF5A 1QV1A 4DRWA 1PRWA 1SW8A 1UHHA 4AQJA 2PVBA 1KFXS 1R2UA 2MLFC 1YX7A 1K94A 1Y6WA 2KGBC 1F70A 1LA3A 1SCVA 3VGOA 1IQ3A 3DD4A 4P2YB 2H2KA 1OMRA 1M46A 2KQYA 3PALA 1DJZA 1UHKA 2HF5A 2F8PA 4E68A 3SG5A 1K96A 1SY9A 2G9BA 1RWYA 5AANA 1SL8A 2KI6C 2CCMA 5CSJA 5PALA 2KI4C 1PSRA 1TCFA 1TNPA 2LLSA 2LVIA 2ZKMX 1NX3A 3I5GC 1JFJA 1CFDA 2Y5IA 2MLEC 1EH2A 4WQ3A 2LC5A 2JC2A 4ETOA 2BL0B 2LUCA 4WQ2A 1K9UA 1KFUL 3PSRA 2V53A 1L7ZA 1EJ3A 1QASA 1MXEA 1MQ1A 1DF0A 2JRFA 4GGFA 2JWWA 4CIDA 1YRTB 2LP2A 2R2IA 4MZLA 4C0JA 1A2XA 2FCEA 1H4BA 4MN0A 1S6CA 2JPTA 3ZWHA 4PHMA 2E30A 1WRKA 1KK8B 2D8NA 3LK0A 4GGFC 4MLWA 1KQVA 2LMUA 3RLZA 1U5IA 3DF0B 2OTGC 1WRLA 2F2OA 3PFVA 4CFQA 1K8UA 4YI9A 3SJSA 1SMGA 1WRZA 1C7WA 2NXQA 3KO0A 1QXPA 1K95A 5I8NA 1CDLA 3AKBA 2LLUA 3OB2B 1DGVA 2MA2A 1SCMC 1XFXO 3WHUB 2CBLA 2QPTA 4OR9B 2ISDA 5GQQC 1CNPA 3KHEA 1CM1A 2GV5A 3BUMB 1TCOB 2LP3A 1PSBA 3VROA 4D1EA 3BUNB 2EHBA 1SR6B 1UHNA 3CWGA 3VRNA 1ALVA 3BOWA 4MRXA 1EG3A 2EC6C 2LUXA 4NDDA 3ZNIA 5I2OA 1OMVA 4HREE 2K61A 3DVJA 4CLNA 1OMDA 1IRJA 1S3PA 2KI4B 3WXAA 1AVSA 4ZCUA 2BBMA 1WDCC 1A29A 4M2OA 4ZCVA 2WNDA 2Y1MA 3I5HB 4XJKA 1QVIY 2QACA 1RK9A 1L2OC 4N5XA 1LXFC 2MBXA 3AAJA 2PASA 1KSOA 1M39A 3F45A 2KAXA 2JXLA 3LK1A 4WRIA 1YVLA 2JXCA 3GK1A 1IH0A 1XFVO 1XFWO 4JQ0D 1FF1A 2ZFDA 1JWDA 1BLQA 1F4QA 1K90D 1CM4A 2NCPA 5HKWA 4U8DA 1DF0B 3SIBA 1IG5A 2KOTA 3I5IC 1MHOA 1NSHA 3CS1A 1CDMA 2LE9B 1NCXA 1HQVA 2JTTA 4GAOA 1CDNA 1CFCA 1MF8B 2KYCA 2O5GA 2LANA 3KF9A 1QIVA 1GGZA 2KYFA 1UHJA 2WC8A 2BKIB 3PATA 1J7QA 3C1VA 2LV7A 1U5IB 4NQGA 5HLOA 2JT3A 1N2DA 1NP8A 1SCMB 2LVVA 2Q4UA 5JJGA 1F8HA 3VRRA 1TRFA 1YUTA 3CLNA 2NZ0A 3O78A 4FTGA 2ZN9A 1QJTA 1FI6A 2GGZA 1AK8A 3HCMA 5KSZA 1MUXA 4YRUA 1Y1AA 2HETA 1TOPA 2M3WA 3K21A 3O2PA 3O4YA 1IJ6A 2EC6B 4GGNA 5IBWA 4JWQA 2KQ6A 1IJ5A 1YURA 2KGRA 1NIWA 4GUKA 4HSZA 1XFUO 1OOJA 1WDCB 2L98A 3M0WA 4R1EA 1OE9B 2ZN8A 4NDBA 3BOWB 5DKNA 4AOMA 5KTYA 2CTNA 5JOLA 3SG4A 1FW4A 3OP0A 4QJ3B 5AXIA 4L9MA 1DJYA 3TZ1A 2G2BA 1H8BA 2K0JA 1L2OB 3SG6A 2AMIA 4A4CA 1LA0A 1M31A 3TS5C 1Q80A 4ORBB 1AHRA 1BMOA 1YUUA 1K9PA 1K2HA 3EVRA 1MWNA 2BECA 2HPSA 2M49B 4GBAA 4XJKB 5F6TA 2MRDA 1YR5A 1BU3A 2Y4QA 3KPXA 1ZMZA 4PHKA 4XYNA 1RROA 1UWOA 2KBIA 1N65A 1LVCD 1YTZC 4PE0A 3I5IB 1FPWA 4QJ4B 3BUXB 1K9KA 2I2RE 4MBEA 5FYXA 1K93D 4I5NB 1SNLA 1AJ4A 1EXRA 1XK4A 2WOSA 2OPOA 1F71A 1NX2A 1IQ5A 1DJIA 2M8UA 1Y1XA 1XVJA
chains in the Genus database with same CATH superfamily
3CZ0A 1JUOA 1KWOC 3DVEA 4CPVA 1QATA 2ZNDA 3GK4X 1J1DA 2P6BB 1XK4C 5ER4X 2LHIA 1RFJA 2FCDA 2M7NA 2JQ6A 5EL2A 5K89A 1M45A 1KQMB 4MRYA 3NSIA 4PHNA 1SPYA 1FBVA 4ORCB 3S0EA 1Y1UA 4HRHA 3SIAA 2K7CA 2KLDA 2WCBA 2KSPA 3KEVA 2RGIA 2E6WA 1GGWA 2K7DA 4KYNA 1IIOA 4DUQA 3D0YA 2VRGA 2BCBA 1OSAA 1PK0D 1S5GZ 1ALWA 5ER5A 5AERA 2WCEA 1BOCA 2BNXA 3PN7C 2LVJA 3TDZA 1KFXL 3RZSA 2A4JA 4USLA 1ZUZA 5G08A 1N0YA 3JVTC 3UNWA 3BUOB 4JD9A 2L4IA 2JULA 3FS7A 4BY5A 1BR4B 3EVVA 3I5GB 2NLNA 1J55A 3VRQA 3JTDC 3TUYC 2PALA 4MZKA 1F54A 1A75A 3LCPC 1JF0A 3B88A 3DXLA 1EL4A 2JT0A 2KAVA 3RM1A 3S0BA 1XO5A 5B8IB 5AFPA 2FJUB 4OZDA 1J7RA 3EK8A 2KFGA 1XA5A 3FWCA 3CZTX 1DT7B 1S6JA 4UPGA 1G33A 4N1GA 1F4OA 2KNEA 5HKYA 3LL8B 5FI2A 1OOHA 2MJWB 3D77A 2GTEA 4PDZA 2B1UA 3CTNA 2K7OA 2BCXA 2WCJA 4I5KA 2JT8A 1SYMA 3CZ2A 3IQQA 1SRAA 2OTGB 4M2PA 3OX6A 4ICBA 1JSAA 3GOFA 2LCPA 1B8LA 1G4YR 2LVKA 1SBJA 1B7TZ 4OKHA 4N1FA 2BBNA 2PYQA 3BYAA 1UURA 1KFUS 3EK4A 4MEWA 2PSRA 1IWQA 2FOTA 2PMYA 1B4CA 1CMGA 1A03A 2JPOA 2WC6A 2WCMA 3ICBA 4F7FA 4MVFA 3OBVA 3H4SE 5CSFA 1TNQA 1V1FA 4DS7A 5I2LA 4GNKB 1QLKA 2BCAA 2LHLA 2YGUA 2KLEA 4NDCA 4GFTA 5KU1A 1QS7A 2M9GA 3R1OA 3VRPA 1IGVA 2PRUA 1P28A 4IL1A 1S5GY 1JC2A 3D0YB 3QRXA 1G8IA 3TDUA 1A4PA 3JVTB 2ZNEA 1DTLA 2Q91A 3AKAA 1B47A 1AUIB 4P5OE 1CTRA 1DVIA 2I7AA 1AJ5A 2QDIA 3MSEB 1NWDA 3NHIA 5CSNA 3JTDB 2L4HA 3TUYB 1DC1A 3IF7A 2IS9A 3FWBA 5I94A 2M1KB 1GQMA 2MHHA 2PQLA 1OZOA 1JBAA 4F0ZB 3S0DA 1PVBA 2L2CA 3EG5B 5FI7A 1CKKA 1W7IB 1GM0A 1A75B 1BR1B 1S36A 1TTXA 2K2AA 2QEOA 5I2QA 2OS8C 3DVMA 2LM5A 1XYDA 2L0PA 1C3ZA 4AQIA 1DJGA 1NUBA 2HQ8A 1VRKA 2M1UA 1QX2A 4I5LB 2M7LA 2M0RA 1TN4A 1RTP1 2AUCA 1HT9A 3SG7A 1XFZO 1NX1A 1PULA 3SS5A 1SL7A 1SR6C 2I94A 2AAOA 3EVUA 1TIZA 1KCYA 3PLFB 1XFYO 1NYAA 2SCPA 3OX5A 3TDIA 3CGAA 1NCYA 1QIWA 1QVIZ 3CR5X 4OV2A 2L2EA 2JZIA 3WNXB 1QX5B 3IQOA 1DJWA 2QEBA 1QV0A 4QJ5B 2LNKA 1B7TY 1Z2CB 2KBMA 4PCWA 4YBHB 1SK6D 1JFKA 3L4AA 3I5HC 2WORA 1JF2A 2LAPA 2CXJA 2Y1NA 3NXAA 1B1GA 2F3YA 4FQOA 1D1OA 2K7BA 1CLLA 2KFHA 1OOGA 2KI6D 2BAPA 1BODA 3OHMB 1LS8A 2BE6A 1DEKA 4ORAB 3AAKA 1J7OA 1T14A 1OOIX 2BKHB 3E3RA 4C0LA 5J3XA 4DCKA 4FQTA 1S1EA 3I5FC 2EGDA 1R6PA 2TN4A 3CABA 2KFFA 1ZOTB 3CR2A 2K8MB 1LINA 1PALA 4YGBB 2KAYA 1B9AA 1KK7Z 2JNFA 2SASA 3PM2A 3SG3A 2ZRSA 2P70A 3NSOA 4PE7A 2WCHA 3TS5B 1YVHA 5HKZA 1E8AA 2COLB 1KSMA 1SL9A 2JNXA 2L50A 1DGUA 1BT6A 1CLMA 3GK2A 3O6BA 2OS8B 1MR8A 1WLZA 2O60A 1QTXA 2I18A 3B87A 3DVKA 1WLMA 3N7HA 4INWA 1YRUB 2HQWA 3NSKA 1RECA 3EKJA 2JTZA 3L4LA 1ODBA 2L5XB 1AP4A 1QX7A 2WCKA 3OB1B 1CMFA 1J7PA 4GPLB 1CFFA 1ZACA 1FI5A 1S26D 3BUWB 3PM8A 4M2QA 1CFPA 1W7JB 2MAZA 1TNXA 3LLEA 1IKUA 5AEQA 5CSIA 3HX4A 1NX0A 1MXLC 1DJHA 3B6XA 3B86A 1UHIA 1KWOB 1UP5A 3BXKA 3CR4X 3D10A 4PHJA 2LMVA 3WHTB 3NGVA 4YGEB 1CLBA 4BY4A 1F55A 3FIAA 1GJYA 1TNWA 1C7VA 2H61A 2LLTA 1RJVA 4PE1A 2L51A 3FE8A 5DKQA 2WCLA 1OOFA 3EK7A 4YGCB 2CT9A 5D3OA 5DKRA 3K1EA 3A8RA 2JU0A 3NSLA 1DJXA 4YGAA 5HL1A 4OVNF 4PALA 2BE4A 1CDPA 5HLVA 4DIRA 2H61C 3A4UB 1ZFSA 2JOJA 4YI8A 4MZJA 5D69A 4OCIA 1B8CA 5CPVA 1YUSA 1J1EA 2NCOA 2BL0C 4CFRA 2WCFA 2F33A 4HRGA 5BPJA 3PN7B 3SG2A 3I5FB 4Q04A 4TNCA 4C0KA 1M63B 4I5JA 1OZSA 2ZRTA 1BJFA 2M29A 1V1GA 2M97A 1EG4A 3BQ3A 4YGDB 1PVAA 1QLSA 5FI6A 3B7AA 1SKTA 3DF0A 5D7FA 1WY9A 4A4BA 1DQEA 4MSPA 3D73A 1UUSA 1C07A 2KDHA 2K2FA 2F2PA 1KK7Y 3IVTA 4PE4A 1X02A 1Y0VH 5TNCA 1KK8C 1CB1A 1DMOA 4JPZB 2GGMA 2CNPA 1LKJA 3CZ1A 1BG1A 2LMTA 2DOQA 1B8RA 1NCZA 1OQPA 3BFBA 1KQMC 3EKHA 1NPQA 1OW4A 4IJ7A 2F3ZA 3SS3A 5HYDA 1S6IA 2KHNA 1YX8A 1BF5A 1QV1A 4DRWA 1PRWA 2ERBA 2QEVA 1SW8A 1UHHA 4AQJA 2PVBA 1KFXS 1R2UA 2MLFC 1YX7A 1K94A 1Y6WA 2KGBC 1F70A 1LA3A 1SCVA 3VGOA 1IQ3A 4JKTA 3DD4A 4P2YB 2H2KA 1OMRA 1M46A 2KQYA 3PALA 1DJZA 3D74A 1UHKA 3R1VA 1TUJA 2HF5A 2F8PA 4E68A 5DICA 3NHTA 3SG5A 1K96A 1SY9A 2G9BA 1RWYA 5AANA 1SL8A 2KI6C 2CCMA 5CSJA 5PALA 2KI4C 1PSRA 1TCFA 1TNPA 2LLSA 2LVIA 2ZKMX 1NX3A 3I5GC 1JFJA 1CFDA 2Y5IA 2MLEC 1EH2A 4WQ3A 2LC5A 2JC2A 4ETOA 2BL0B 2LUCA 4WQ2A 1K9UA 1KFUL 3PSRA 2V53A 1L7ZA 1EJ3A 1QASA 1MXEA 1MQ1A 3OGNA 1DF0A 2JRFA 4GGFA 2JWWA 4CIDA 1YRTB 2LP2A 2R2IA 4MZLA 4C0JA 1A2XA 2FCEA 1H4BA 4MN0A 1S6CA 2JPTA 3ZWHA 3S0AA 4PHMA 2E30A 1WRKA 1KK8B 2D8NA 3LK0A 4GGFC 4MLWA 1KQVA 2LMUA 3RLZA 1U5IA 3DF0B 2OTGC 1WRLA 2F2OA 1W9ZA 3PFVA 1Z4HA 4CFQA 1K8UA 4YI9A 3SJSA 1SMGA 4PT1A 1WRZA 1C7WA 2NXQA 3KO0A 1QXPA 1K95A 5I8NA 1CDLA 3AKBA 2LLUA 3OB2B 3S0FA 1DGVA 2MA2A 1SCMC 1XFXO 3WHUB 2CBLA 2QPTA 4OR9B 2ISDA 5GQQC 1CNPA 3KHEA 1CM1A 2GV5A 3BUMB 1TCOB 3VB1A 2LP3A 1PSBA 2K60A 3VROA 4D1EA 3BUNB 2EHBA 1SR6B 1UHNA 4INXA 3CWGA 3VRNA 1ALVA 3BOWA 3BJHA 1EG3A 2EC6C 2LUXA 4MRXA 4NDDA 3ZNIA 5I2OA 1OMVA 4HREE 2K61A 3DVJA 4CLNA 1OMDA 1IRJA 1S3PA 2KI4B 3D76A 1AVSA 3WXAA 4ZCUA 1TWOA 2BBMA 1WDCC 1A29A 4M2OA 4ZCVA 2WNDA 2Y1MA 3I5HB 4XJKA 1QVIY 2QACA 3L47A 1RK9A 1L2OC 4N5XA 1LXFC 2MBXA 3AAJA 2PASA 1KSOA 1M39A 3F45A 3DYEA 3O4XA 2KAXA 2JXLA 2L5YA 3LK1A 2P71A 4WRIA 1YVLA 2JXCA 3GK1A 2WC5A 1C3YA 1IH0A 1XFVO 1XFWO 4JQ0D 1FF1A 2ZFDA 1JWDA 1BLQA 1F4QA 1K90D 1CM4A 2NCPA 5HKWA 4U8DA 1DF0B 3SIBA 1IG5A 2KOTA 3I5IC 1MHOA 1NSHA 3CS1A 1CDMA 3R1PA 2LE9B 1NCXA 3S0GA 1HQVA 2JTTA 4GAOA 1CDNA 3DY9A 1CFCA 1TUZA 1MF8B 2KYCA 2O5GA 2LANA 3KF9A 2FJYA 1QIVA 2KPHA 1GGZA 2KYFA 3Q8IA 1UHJA 2WC8A 2BKIB 3PATA 1J7QA 3C1VA 2LV7A 1U5IB 4NQGA 5HLOA 2JT3A 1N2DA 1DELA 1NP8A 1SCMB 2LVVA 2Q4UA 3D78A 5JJGA 3VRRA 1F8HA 1TRFA 1YUTA 3CLNA 2NZ0A 3O78A 4FTGA 2ZN9A 1QJTA 3FE6A 1FI6A 2GGZA 1AK8A 3HCMA 1ORGA 5KSZA 1MUXA 4YRUA 1Y1AA 2HETA 1TOPA 2M3WA 3K21A 3O2PA 3O4YA 1IJ6A 2EC6B 3QMEA 2H8VA 4GGNA 3R72A 5IBWA 4JWQA 2KQ6A 1IJ5A 1SSEB 1YURA 2KGRA 1NIWA 4GUKA 4HSZA 3SS4A 1XFUO 2QEHA 1OOJA 1WDCB 2L98A 3M0WA 4R1EA 1OE9B 2ZN8A 3UO9A 3DZTA 4NDBA 3BOWB 3CDNA 5DKNA 4AOMA 5KTYA 2CTNA 5JOLA 3SG4A 1FW4A 3OP0A 4QJ3B 5AXIA 4L9MA 1DJYA 3TZ1A 2G2BA 1H8BA 2K0JA 1L2OB 3SG6A 2AMIA 4A4CA 1LA0A 1M31A 3BFHA 1Q80A 3FE9A 4ORBB 1AHRA 1BMOA 3TS5C 3V2LA 1YUUA 1K9PA 3CYZA 1K2HA 3EVRA 1MWNA 2BECA 2HPSA 2M49B 4GBAA 4XJKB 5F6TA 2MRDA 3PJIA 1YR5A 1BU3A 2Y4QA 3KPXA 1ZMZA 4PHKA 4XYNA 1RROA 1UWOA 2KBIA 1N65A 1QWVA 1LVCD 1XFRA 1YTZC 4PE0A 3I5IB 1FPWA 4QJ4B 3BUXB 1K9KA 2I2RE 4MBEA 5FYXA 1K93D 4I5NB 1SNLA 1AJ4A 1EXRA 1XK4A 2WOSA 2OPOA 3BFAA 1F71A 1NX2A 3D75A 1IQ5A 1DJIA 2M8UA 1Y1XA 1XVJA
chains in the Genus database with same CATH topology
1JUOA 1KWOC 3DVEA 4CPVA 1QATA 2ZNDA 3GK4X 1J1DA 2P6BB 1XK4C 5ER4X 2LHIA 1RFJA 2FCDA 2M7NA 2JQ6A 5K89A 1M45A 1KQMB 4MRYA 3NSIA 4PHNA 1SPYA 1FBVA 4ORCB 1Y1UA 4HRHA 3SIAA 2K7CA 2WCBA 2KSPA 3KEVA 2RGIA 2E6WA 1GGWA 2K7DA 4DUQA 3D0YA 2VRGA 2BCBA 1OSAA 1PK0D 1S5GZ 1ALWA 5ER5A 5AERA 2WCEA 1BOCA 3PN7C 2LVJA 3TDZA 1KFXL 2A4JA 4USLA 1ZUZA 5G08A 1N0YA 3JVTC 3BUOB 2L4IA 2JULA 3FS7A 4BY5A 1BR4B 3EVVA 3I5GB 2NLNA 1J55A 3VRQA 3JTDC 3TUYC 2PALA 4MZKA 1F54A 1A75A 3LCPC 1JF0A 1EL4A 2JT0A 2KAVA 3RM1A 5B8IB 1XO5A 5AFPA 2FJUB 1J7RA 3EK8A 2KFGA 1XA5A 3FWCA 3CZTX 1DT7B 1S6JA 4UPGA 1G33A 4N1GA 1F4OA 2KNEA 5HKYA 3LL8B 2MJWB 4PDZA 2B1UA 3CTNA 2K7OA 2BCXA 4I5KA 2JT8A 1SYMA 3IQQA 1SRAA 2OTGB 4M2PA 3OX6A 4ICBA 1JSAA 3GOFA 2LCPA 1B8LA 1G4YR 2LVKA 1SBJA 1B7TZ 4OKHA 4N1FA 2BBNA 3BYAA 1UURA 1KFUS 3EK4A 4MEWA 2PSRA 1IWQA 2FOTA 2PMYA 1B4CA 1CMGA 1A03A 3ICBA 4MVFA 3H4SE 5CSFA 1TNQA 1V1FA 4DS7A 5I2LA 4GNKB 1QLKA 2BCAA 2LHLA 4NDCA 4GFTA 5KU1A 1QS7A 2M9GA 3VRPA 1IGVA 2PRUA 4IL1A 1S5GY 1JC2A 3D0YB 3QRXA 1G8IA 3TDUA 1A4PA 3JVTB 2ZNEA 1DTLA 2Q91A 3AKAA 1B47A 1AUIB 4P5OE 1CTRA 1DVIA 2I7AA 1AJ5A 3MSEB 5CSNA 1NWDA 3TUYB 3JTDB 2L4HA 3IF7A 2IS9A 3FWBA 1JBAA 2M1KB 1GQMA 2MHHA 1OZOA 4F0ZB 1PVBA 1CKKA 1W7IB 1A75B 1BR1B 1S36A 1TTXA 2K2AA 5I2QA 2OS8C 3DVMA 2LM5A 1XYDA 2L0PA 4AQIA 1DJGA 1NUBA 2HQ8A 1VRKA 2M1UA 1QX2A 4I5LB 2M7LA 2M0RA 1TN4A 1RTP1 2AUCA 1HT9A 3SG7A 1XFZO 1NX1A 1PULA 1SL7A 1SR6C 2I94A 2AAOA 3EVUA 1TIZA 1KCYA 3PLFB 1XFYO 1NYAA 2SCPA 3OX5A 3TDIA 3CGAA 1NCYA 1QIWA 1QVIZ 3CR5X 4OV2A 2L2EA 2JZIA 3WNXB 1QX5B 3IQOA 1DJWA 1QV0A 4QJ5B 2LNKA 1B7TY 2KBMA 4PCWA 4YBHB 1SK6D 1JFKA 3I5HC 2WORA 1JF2A 2LAPA 2CXJA 2Y1NA 3NXAA 1B1GA 2F3YA 4FQOA 1D1OA 2K7BA 1CLLA 2KFHA 2KI6D 1BODA 3OHMB 2BE6A 4ORAB 3AAKA 1J7OA 3E3RA 2BKHB 4C0LA 5J3XA 4DCKA 1S1EA 3I5FC 2EGDA 1R6PA 2TN4A 2KFFA 1ZOTB 3CR2A 2K8MB 1LINA 1PALA 4YGBB 2KAYA 1B9AA 1KK7Z 2JNFA 2SASA 3SG3A 2ZRSA 3NSOA 4PE7A 3TS5B 1YVHA 5HKZA 1E8AA 2COLB 1KSMA 1SL9A 2JNXA 2L50A 1DGUA 1BT6A 1CLMA 3GK2A 3O6BA 2OS8B 1MR8A 1WLZA 2O60A 1QTXA 2I18A 3DVKA 1WLMA 1YRUB 2HQWA 3NSKA 1RECA 3EKJA 2JTZA 1ODBA 2L5XB 1AP4A 1QX7A 3OB1B 1CMFA 1J7PA 4GPLB 1CFFA 1ZACA 1FI5A 1S26D 3BUWB 3PM8A 4M2QA 1CFPA 1W7JB 2MAZA 1TNXA 3LLEA 1IKUA 5AEQA 5CSIA 3HX4A 1NX0A 1MXLC 1DJHA 1UHIA 1KWOB 1UP5A 3BXKA 3CR4X 3D10A 4PHJA 2LMVA 3WHTB 4YGEB 1CLBA 4BY4A 1F55A 3FIAA 1GJYA 1TNWA 1C7VA 2H61A 2LLTA 1RJVA 4PE1A 2L51A 5DKQA 3EK7A 4YGCB 2CT9A 5DKRA 3A8RA 2JU0A 3NSLA 1DJXA 4YGAA 4OVNF 4PALA 2BE4A 1CDPA 5HLVA 4DIRA 2H61C 3A4UB 1ZFSA 2JOJA 4YI8A 4MZJA 5D69A 4OCIA 1B8CA 5CPVA 1YUSA 1J1EA 2NCOA 2BL0C 4CFRA 2WCFA 2F33A 4HRGA 5BPJA 3PN7B 3SG2A 3I5FB 4Q04A 4TNCA 4C0KA 1M63B 4I5JA 1OZSA 2ZRTA 1BJFA 2M29A 1V1GA 2M97A 1EG4A 3BQ3A 4YGDB 1PVAA 1QLSA 1SKTA 3DF0A 5D7FA 1WY9A 4A4BA 4MSPA 1C07A 1UUSA 2KDHA 2K2FA 2F2PA 1KK7Y 1CB1A 4PE4A 1X02A 1Y0VH 5TNCA 1KK8C 1DMOA 4JPZB 2GGMA 2CNPA 1LKJA 1BG1A 2LMTA 2DOQA 1B8RA 1NCZA 1OQPA 1KQMC 3EKHA 1NPQA 2F3ZA 5HYDA 1S6IA 2KHNA 1YX8A 1BF5A 1QV1A 4DRWA 1PRWA 1SW8A 1UHHA 4AQJA 2PVBA 1KFXS 1R2UA 2MLFC 1YX7A 1K94A 1Y6WA 2KGBC 1F70A 1LA3A 1SCVA 3VGOA 1IQ3A 3DD4A 4P2YB 2H2KA 1OMRA 1M46A 2KQYA 3PALA 1DJZA 1UHKA 2HF5A 2F8PA 4E68A 3SG5A 1K96A 1SY9A 2G9BA 1RWYA 5AANA 1SL8A 2KI6C 2CCMA 5CSJA 5PALA 2KI4C 1PSRA 1TCFA 1TNPA 2LLSA 2LVIA 2ZKMX 1NX3A 3I5GC 1JFJA 1CFDA 2Y5IA 2MLEC 1EH2A 4WQ3A 2LC5A 2JC2A 4ETOA 2BL0B 2LUCA 4WQ2A 1K9UA 1KFUL 3PSRA 2V53A 1L7ZA 1EJ3A 1QASA 1MXEA 1MQ1A 1DF0A 2JRFA 4GGFA 2JWWA 4CIDA 1YRTB 2LP2A 2R2IA 4MZLA 4C0JA 1A2XA 2FCEA 1H4BA 4MN0A 1S6CA 2JPTA 3ZWHA 4PHMA 2E30A 1WRKA 1KK8B 2D8NA 3LK0A 4GGFC 4MLWA 1KQVA 2LMUA 3RLZA 1U5IA 3DF0B 2OTGC 1WRLA 2F2OA 3PFVA 4CFQA 1K8UA 4YI9A 3SJSA 1SMGA 1WRZA 1C7WA 2NXQA 3KO0A 1QXPA 1K95A 5I8NA 1CDLA 3AKBA 2LLUA 3OB2B 1DGVA 2MA2A 1SCMC 1XFXO 3WHUB 2CBLA 2QPTA 4OR9B 2ISDA 5GQQC 1CNPA 3KHEA 1CM1A 2GV5A 3BUMB 1TCOB 2LP3A 1PSBA 3VROA 4D1EA 3BUNB 2EHBA 1SR6B 1UHNA 3CWGA 3VRNA 1ALVA 3BOWA 4MRXA 1EG3A 2EC6C 2LUXA 4NDDA 3ZNIA 5I2OA 1OMVA 4HREE 2K61A 3DVJA 4CLNA 1OMDA 1IRJA 1S3PA 2KI4B 3WXAA 1AVSA 4ZCUA 2BBMA 1WDCC 1A29A 4M2OA 4ZCVA 2WNDA 2Y1MA 3I5HB 4XJKA 1QVIY 2QACA 1RK9A 1L2OC 4N5XA 1LXFC 2MBXA 3AAJA 2PASA 1KSOA 1M39A 3F45A 2KAXA 2JXLA 3LK1A 4WRIA 1YVLA 2JXCA 3GK1A 1IH0A 1XFVO 1XFWO 4JQ0D 1FF1A 2ZFDA 1JWDA 1BLQA 1F4QA 1K90D 1CM4A 2NCPA 5HKWA 4U8DA 1DF0B 3SIBA 1IG5A 2KOTA 3I5IC 1MHOA 1NSHA 3CS1A 1CDMA 2LE9B 1NCXA 1HQVA 2JTTA 4GAOA 1CDNA 1CFCA 1MF8B 2KYCA 2O5GA 2LANA 3KF9A 1QIVA 1GGZA 2KYFA 1UHJA 2WC8A 2BKIB 3PATA 1J7QA 3C1VA 2LV7A 1U5IB 4NQGA 5HLOA 2JT3A 1N2DA 1NP8A 1SCMB 2LVVA 2Q4UA 5JJGA 1F8HA 3VRRA 1TRFA 1YUTA 3CLNA 2NZ0A 3O78A 4FTGA 2ZN9A 1QJTA 1FI6A 2GGZA 1AK8A 3HCMA 5KSZA 1MUXA 4YRUA 1Y1AA 2HETA 1TOPA 2M3WA 3K21A 3O2PA 3O4YA 1IJ6A 2EC6B 4GGNA 5IBWA 4JWQA 2KQ6A 1IJ5A 1YURA 2KGRA 1NIWA 4GUKA 4HSZA 1XFUO 1OOJA 1WDCB 2L98A 3M0WA 4R1EA 1OE9B 2ZN8A 4NDBA 3BOWB 5DKNA 4AOMA 5KTYA 2CTNA 5JOLA 3SG4A 1FW4A 3OP0A 4QJ3B 5AXIA 4L9MA 1DJYA 3TZ1A 2G2BA 1H8BA 2K0JA 1L2OB 3SG6A 2AMIA 4A4CA 1LA0A 1M31A 3TS5C 1Q80A 4ORBB 1AHRA 1BMOA 1YUUA 1K9PA 1K2HA 3EVRA 1MWNA 2BECA 2HPSA 2M49B 4GBAA 4XJKB 5F6TA 2MRDA 1YR5A 1BU3A 2Y4QA 3KPXA 1ZMZA 4PHKA 4XYNA 1RROA 1UWOA 2KBIA 1N65A 1LVCD 1YTZC 4PE0A 3I5IB 1FPWA 4QJ4B 3BUXB 1K9KA 2I2RE 4MBEA 5FYXA 1K93D 4I5NB 1SNLA 1AJ4A 1EXRA 1XK4A 2WOSA 2OPOA 1F71A 1NX2A 1IQ5A 1DJIA 2M8UA 1Y1XA 1XVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUO A;  1KWO C;  3DVE A;  4CPV A;  1QAT A;  2ZND A;  3GK4 X;  1J1D A;  2P6B B;  1XK4 C;  5ER4 X;  2LHI A;  1RFJ A;  2FCD A;  2M7N A;  2JQ6 A;  5K89 A;  1M45 A;  1KQM B;  4MRY A;  3NSI A;  4PHN A;  1SPY A;  1FBV A;  4ORC B;  1Y1U A;  4HRH A;  3SIA A;  2K7C A;  2WCB A;  2KSP A;  3KEV A;  2RGI A;  2E6W A;  1GGW A;  2K7D A;  4DUQ A;  3D0Y A;  2VRG A;  2BCB A;  1OSA A;  1PK0 D;  1S5G Z;  1ALW A;  5ER5 A;  5AER A;  2WCE A;  1BOC A;  3PN7 C;  2LVJ A;  3TDZ A;  1KFX L;  2A4J A;  4USL A;  1ZUZ A;  5G08 A;  1N0Y A;  3JVT C;  3BUO B;  2L4I A;  2JUL A;  3FS7 A;  4BY5 A;  1BR4 B;  3EVV A;  3I5G B;  2NLN A;  1J55 A;  3VRQ A;  3JTD C;  3TUY C;  2PAL A;  4MZK A;  1F54 A;  1A75 A;  3LCP C;  1JF0 A;  1EL4 A;  2JT0 A;  2KAV A;  3RM1 A;  5B8I B;  1XO5 A;  5AFP A;  2FJU B;  1J7R A;  3EK8 A;  2KFG A;  1XA5 A;  3FWC A;  3CZT X;  1DT7 B;  1S6J A;  4UPG A;  1G33 A;  4N1G A;  1F4O A;  2KNE A;  5HKY A;  3LL8 B;  2MJW B;  4PDZ A;  2B1U A;  3CTN A;  2K7O A;  2BCX A;  4I5K A;  2JT8 A;  1SYM A;  3IQQ A;  1SRA A;  2OTG B;  4M2P A;  3OX6 A;  4ICB A;  1JSA A;  3GOF A;  2LCP A;  1B8L A;  1G4Y R;  2LVK A;  1SBJ A;  1B7T Z;  4OKH A;  4N1F A;  2BBN A;  3BYA A;  1UUR A;  1KFU S;  3EK4 A;  4MEW A;  2PSR A;  1IWQ A;  2FOT A;  2PMY A;  1B4C A;  1CMG A;  1A03 A;  3ICB A;  4MVF A;  3H4S E;  5CSF A;  1TNQ A;  1V1F A;  4DS7 A;  5I2L A;  4GNK B;  1QLK A;  2BCA A;  2LHL A;  4NDC A;  4GFT A;  5KU1 A;  1QS7 A;  2M9G A;  3VRP A;  1IGV A;  2PRU A;  4IL1 A;  1S5G Y;  1JC2 A;  3D0Y B;  3QRX A;  1G8I A;  3TDU A;  1A4P A;  3JVT B;  2ZNE A;  1DTL A;  2Q91 A;  3AKA A;  1B47 A;  1AUI B;  4P5O E;  1CTR A;  1DVI A;  2I7A A;  1AJ5 A;  3MSE B;  5CSN A;  1NWD A;  3TUY B;  3JTD B;  2L4H A;  3IF7 A;  2IS9 A;  3FWB A;  1JBA A;  2M1K B;  1GQM A;  2MHH A;  1OZO A;  4F0Z B;  1PVB A;  1CKK A;  1W7I B;  1A75 B;  1BR1 B;  1S36 A;  1TTX A;  2K2A A;  5I2Q A;  2OS8 C;  3DVM A;  2LM5 A;  1XYD A;  2L0P A;  4AQI A;  1DJG A;  1NUB A;  2HQ8 A;  1VRK A;  2M1U A;  1QX2 A;  4I5L B;  2M7L A;  2M0R A;  1TN4 A;  1RTP 1;  2AUC A;  1HT9 A;  3SG7 A;  1XFZ O;  1NX1 A;  1PUL A;  1SL7 A;  1SR6 C;  2I94 A;  2AAO A;  3EVU A;  1TIZ A;  1KCY A;  3PLF B;  1XFY O;  1NYA A;  2SCP A;  3OX5 A;  3TDI A;  3CGA A;  1NCY A;  1QIW A;  1QVI Z;  3CR5 X;  4OV2 A;  2L2E A;  2JZI A;  3WNX B;  1QX5 B;  3IQO A;  1DJW A;  1QV0 A;  4QJ5 B;  2LNK A;  1B7T Y;  2KBM A;  4PCW A;  4YBH B;  1SK6 D;  1JFK A;  3I5H C;  2WOR A;  1JF2 A;  2LAP A;  2CXJ A;  2Y1N A;  3NXA A;  1B1G A;  2F3Y A;  4FQO A;  1D1O A;  2K7B A;  1CLL A;  2KFH A;  2KI6 D;  1BOD A;  3OHM B;  2BE6 A;  4ORA B;  3AAK A;  1J7O A;  3E3R A;  2BKH B;  4C0L A;  5J3X A;  4DCK A;  1S1E A;  3I5F C;  2EGD A;  1R6P A;  2TN4 A;  2KFF A;  1ZOT B;  3CR2 A;  2K8M B;  1LIN A;  1PAL A;  4YGB B;  2KAY A;  1B9A A;  1KK7 Z;  2JNF A;  2SAS A;  3SG3 A;  2ZRS A;  3NSO A;  4PE7 A;  3TS5 B;  1YVH A;  5HKZ A;  1E8A A;  2COL B;  1KSM A;  1SL9 A;  2JNX A;  2L50 A;  1DGU A;  1BT6 A;  1CLM A;  3GK2 A;  3O6B A;  2OS8 B;  1MR8 A;  1WLZ A;  2O60 A;  1QTX A;  2I18 A;  3DVK A;  1WLM A;  1YRU B;  2HQW A;  3NSK A;  1REC A;  3EKJ A;  2JTZ A;  1ODB A;  2L5X B;  1AP4 A;  1QX7 A;  3OB1 B;  1CMF A;  1J7P A;  4GPL B;  1CFF A;  1ZAC A;  1FI5 A;  1S26 D;  3BUW B;  3PM8 A;  4M2Q A;  1CFP A;  1W7J B;  2MAZ A;  1TNX A;  3LLE A;  1IKU A;  5AEQ A;  5CSI A;  3HX4 A;  1NX0 A;  1MXL C;  1DJH A;  1UHI A;  1KWO B;  1UP5 A;  3BXK A;  3CR4 X;  3D10 A;  4PHJ A;  2LMV A;  3WHT B;  4YGE B;  1CLB A;  4BY4 A;  1F55 A;  3FIA A;  1GJY A;  1TNW A;  1C7V A;  2H61 A;  2LLT A;  1RJV A;  4PE1 A;  2L51 A;  5DKQ A;  3EK7 A;  4YGC B;  2CT9 A;  5DKR A;  3A8R A;  2JU0 A;  3NSL A;  1DJX A;  4YGA A;  4OVN F;  4PAL A;  2BE4 A;  1CDP A;  5HLV A;  4DIR A;  2H61 C;  3A4U B;  1ZFS A;  2JOJ A;  4YI8 A;  4MZJ A;  5D69 A;  4OCI A;  1B8C A;  5CPV A;  1YUS A;  1J1E A;  2NCO A;  2BL0 C;  4CFR A;  2WCF A;  2F33 A;  4HRG A;  5BPJ A;  3PN7 B;  3SG2 A;  3I5F B;  4Q04 A;  4TNC A;  4C0K A;  1M63 B;  4I5J A;  1OZS A;  2ZRT A;  1BJF A;  2M29 A;  1V1G A;  2M97 A;  1EG4 A;  3BQ3 A;  4YGD B;  1PVA A;  1QLS A;  1SKT A;  3DF0 A;  5D7F A;  1WY9 A;  4A4B A;  4MSP A;  1C07 A;  1UUS A;  2KDH A;  2K2F A;  2F2P A;  1KK7 Y;  1CB1 A;  4PE4 A;  1X02 A;  1Y0V H;  5TNC A;  1KK8 C;  1DMO A;  4JPZ B;  2GGM A;  2CNP A;  1LKJ A;  1BG1 A;  2LMT A;  2DOQ A;  1B8R A;  1NCZ A;  1OQP A;  1KQM C;  3EKH A;  1NPQ A;  2F3Z A;  5HYD A;  1S6I A;  2KHN A;  1YX8 A;  1BF5 A;  1QV1 A;  4DRW A;  1PRW A;  1SW8 A;  1UHH A;  4AQJ A;  2PVB A;  1KFX S;  1R2U A;  2MLF C;  1YX7 A;  1K94 A;  1Y6W A;  2KGB C;  1F70 A;  1LA3 A;  1SCV A;  3VGO A;  1IQ3 A;  3DD4 A;  4P2Y B;  2H2K A;  1OMR A;  1M46 A;  2KQY A;  3PAL A;  1DJZ A;  1UHK A;  2HF5 A;  2F8P A;  4E68 A;  3SG5 A;  1K96 A;  1SY9 A;  2G9B A;  1RWY A;  5AAN A;  1SL8 A;  2KI6 C;  2CCM A;  5CSJ A;  5PAL A;  2KI4 C;  1PSR A;  1TCF A;  1TNP A;  2LLS A;  2LVI A;  2ZKM X;  1NX3 A;  3I5G C;  1JFJ A;  1CFD A;  2Y5I A;  2MLE C;  1EH2 A;  4WQ3 A;  2LC5 A;  2JC2 A;  4ETO A;  2BL0 B;  2LUC A;  4WQ2 A;  1K9U A;  1KFU L;  3PSR A;  2V53 A;  1L7Z A;  1EJ3 A;  1QAS A;  1MXE A;  1MQ1 A;  1DF0 A;  2JRF A;  4GGF A;  2JWW A;  4CID A;  1YRT B;  2LP2 A;  2R2I A;  4MZL A;  4C0J A;  1A2X A;  2FCE A;  1H4B A;  4MN0 A;  1S6C A;  2JPT A;  3ZWH A;  4PHM A;  2E30 A;  1WRK A;  1KK8 B;  2D8N A;  3LK0 A;  4GGF C;  4MLW A;  1KQV A;  2LMU A;  3RLZ A;  1U5I A;  3DF0 B;  2OTG C;  1WRL A;  2F2O A;  3PFV A;  4CFQ A;  1K8U A;  4YI9 A;  3SJS A;  1SMG A;  1WRZ A;  1C7W A;  2NXQ A;  3KO0 A;  1QXP A;  1K95 A;  5I8N A;  1CDL A;  3AKB A;  2LLU A;  3OB2 B;  1DGV A;  2MA2 A;  1SCM C;  1XFX O;  3WHU B;  2CBL A;  2QPT A;  4OR9 B;  2ISD A;  5GQQ C;  1CNP A;  3KHE A;  1CM1 A;  2GV5 A;  3BUM B;  1TCO B;  2LP3 A;  1PSB A;  3VRO A;  4D1E A;  3BUN B;  2EHB A;  1SR6 B;  1UHN A;  3CWG A;  3VRN A;  1ALV A;  3BOW A;  4MRX A;  1EG3 A;  2EC6 C;  2LUX A;  4NDD A;  3ZNI A;  5I2O A;  1OMV A;  4HRE E;  2K61 A;  3DVJ A;  4CLN A;  1OMD A;  1IRJ A;  1S3P A;  2KI4 B;  3WXA A;  1AVS A;  4ZCU A;  2BBM A;  1WDC C;  1A29 A;  4M2O A;  4ZCV A;  2WND A;  2Y1M A;  3I5H B;  4XJK A;  1QVI Y;  2QAC A;  1RK9 A;  1L2O C;  4N5X A;  1LXF C;  2MBX A;  3AAJ A;  2PAS A;  1KSO A;  1M39 A;  3F45 A;  2KAX A;  2JXL A;  3LK1 A;  4WRI A;  1YVL A;  2JXC A;  3GK1 A;  1IH0 A;  1XFV O;  1XFW O;  4JQ0 D;  1FF1 A;  2ZFD A;  1JWD A;  1BLQ A;  1F4Q A;  1K90 D;  1CM4 A;  2NCP A;  5HKW A;  4U8D A;  1DF0 B;  3SIB A;  1IG5 A;  2KOT A;  3I5I C;  1MHO A;  1NSH A;  3CS1 A;  1CDM A;  2LE9 B;  1NCX A;  1HQV A;  2JTT A;  4GAO A;  1CDN A;  1CFC A;  1MF8 B;  2KYC A;  2O5G A;  2LAN A;  3KF9 A;  1QIV A;  1GGZ A;  2KYF A;  1UHJ A;  2WC8 A;  2BKI B;  3PAT A;  1J7Q A;  3C1V A;  2LV7 A;  1U5I B;  4NQG A;  5HLO A;  2JT3 A;  1N2D A;  1NP8 A;  1SCM B;  2LVV A;  2Q4U A;  5JJG A;  1F8H A;  3VRR A;  1TRF A;  1YUT A;  3CLN A;  2NZ0 A;  3O78 A;  4FTG A;  2ZN9 A;  1QJT A;  1FI6 A;  2GGZ A;  1AK8 A;  3HCM A;  5KSZ A;  1MUX A;  4YRU A;  1Y1A A;  2HET A;  1TOP A;  2M3W A;  3K21 A;  3O2P A;  3O4Y A;  1IJ6 A;  2EC6 B;  4GGN A;  5IBW A;  4JWQ A;  2KQ6 A;  1IJ5 A;  1YUR A;  2KGR A;  1NIW A;  4GUK A;  4HSZ A;  1XFU O;  1OOJ A;  1WDC B;  2L98 A;  3M0W A;  4R1E A;  1OE9 B;  2ZN8 A;  4NDB A;  3BOW B;  5DKN A;  4AOM A;  5KTY A;  2CTN A;  5JOL A;  3SG4 A;  1FW4 A;  3OP0 A;  4QJ3 B;  5AXI A;  4L9M A;  1DJY A;  3TZ1 A;  2G2B A;  1H8B A;  2K0J A;  1L2O B;  3SG6 A;  2AMI A;  4A4C A;  1LA0 A;  1M31 A;  3TS5 C;  1Q80 A;  4ORB B;  1AHR A;  1BMO A;  1YUU A;  1K9P A;  1K2H A;  3EVR A;  1MWN A;  2BEC A;  2HPS A;  2M49 B;  4GBA A;  4XJK B;  5F6T A;  2MRD A;  1YR5 A;  1BU3 A;  2Y4Q A;  3KPX A;  1ZMZ A;  4PHK A;  4XYN A;  1RRO A;  1UWO A;  2KBI A;  1N65 A;  1LVC D;  1YTZ C;  4PE0 A;  3I5I B;  1FPW A;  4QJ4 B;  3BUX B;  1K9K A;  2I2R E;  4MBE A;  5FYX A;  1K93 D;  4I5N B;  1SNL A;  1AJ4 A;  1EXR A;  1XK4 A;  2WOS A;  2OPO A;  1F71 A;  1NX2 A;  1IQ5 A;  1DJI A;  2M8U A;  1Y1X A;  1XVJ A; 
#chains in the Genus database with same CATH topology
 3CZ0 A;  1JUO A;  1KWO C;  3DVE A;  4CPV A;  1QAT A;  2ZND A;  3GK4 X;  1J1D A;  2P6B B;  1XK4 C;  5ER4 X;  2LHI A;  1RFJ A;  2FCD A;  2M7N A;  2JQ6 A;  5EL2 A;  5K89 A;  1M45 A;  1KQM B;  4MRY A;  3NSI A;  4PHN A;  1SPY A;  1FBV A;  4ORC B;  3S0E A;  1Y1U A;  4HRH A;  3SIA A;  2K7C A;  2KLD A;  2WCB A;  2KSP A;  3KEV A;  2RGI A;  2E6W A;  1GGW A;  2K7D A;  4KYN A;  1IIO A;  4DUQ A;  3D0Y A;  2VRG A;  2BCB A;  1OSA A;  1PK0 D;  1S5G Z;  1ALW A;  5ER5 A;  5AER A;  2WCE A;  1BOC A;  2BNX A;  3PN7 C;  2LVJ A;  3TDZ A;  1KFX L;  3RZS A;  2A4J A;  4USL A;  1ZUZ A;  5G08 A;  1N0Y A;  3JVT C;  3UNW A;  3BUO B;  4JD9 A;  2L4I A;  2JUL A;  3FS7 A;  4BY5 A;  1BR4 B;  3EVV A;  3I5G B;  2NLN A;  1J55 A;  3VRQ A;  3JTD C;  3TUY C;  2PAL A;  4MZK A;  1F54 A;  1A75 A;  3LCP C;  1JF0 A;  3B88 A;  3DXL A;  1EL4 A;  2JT0 A;  2KAV A;  3RM1 A;  3S0B A;  1XO5 A;  5B8I B;  5AFP A;  2FJU B;  4OZD A;  1J7R A;  3EK8 A;  2KFG A;  1XA5 A;  3FWC A;  3CZT X;  1DT7 B;  1S6J A;  4UPG A;  1G33 A;  4N1G A;  1F4O A;  2KNE A;  5HKY A;  3LL8 B;  5FI2 A;  1OOH A;  2MJW B;  3D77 A;  2GTE A;  4PDZ A;  2B1U A;  3CTN A;  2K7O A;  2BCX A;  2WCJ A;  4I5K A;  2JT8 A;  1SYM A;  3CZ2 A;  3IQQ A;  1SRA A;  2OTG B;  4M2P A;  3OX6 A;  4ICB A;  1JSA A;  3GOF A;  2LCP A;  1B8L A;  1G4Y R;  2LVK A;  1SBJ A;  1B7T Z;  4OKH A;  4N1F A;  2BBN A;  2PYQ A;  3BYA A;  1UUR A;  1KFU S;  3EK4 A;  4MEW A;  2PSR A;  1IWQ A;  2FOT A;  2PMY A;  1B4C A;  1CMG A;  1A03 A;  2JPO A;  2WC6 A;  2WCM A;  3ICB A;  4F7F A;  4MVF A;  3OBV A;  3H4S E;  5CSF A;  1TNQ A;  1V1F A;  4DS7 A;  5I2L A;  4GNK B;  1QLK A;  2BCA A;  2LHL A;  2YGU A;  2KLE A;  4NDC A;  4GFT A;  5KU1 A;  1QS7 A;  2M9G A;  3R1O A;  3VRP A;  1IGV A;  2PRU A;  1P28 A;  4IL1 A;  1S5G Y;  1JC2 A;  3D0Y B;  3QRX A;  1G8I A;  3TDU A;  1A4P A;  3JVT B;  2ZNE A;  1DTL A;  2Q91 A;  3AKA A;  1B47 A;  1AUI B;  4P5O E;  1CTR A;  1DVI A;  2I7A A;  1AJ5 A;  2QDI A;  3MSE B;  1NWD A;  3NHI A;  5CSN A;  3JTD B;  2L4H A;  3TUY B;  1DC1 A;  3IF7 A;  2IS9 A;  3FWB A;  5I94 A;  2M1K B;  1GQM A;  2MHH A;  2PQL A;  1OZO A;  1JBA A;  4F0Z B;  3S0D A;  1PVB A;  2L2C A;  3EG5 B;  5FI7 A;  1CKK A;  1W7I B;  1GM0 A;  1A75 B;  1BR1 B;  1S36 A;  1TTX A;  2K2A A;  2QEO A;  5I2Q A;  2OS8 C;  3DVM A;  2LM5 A;  1XYD A;  2L0P A;  1C3Z A;  4AQI A;  1DJG A;  1NUB A;  2HQ8 A;  1VRK A;  2M1U A;  1QX2 A;  4I5L B;  2M7L A;  2M0R A;  1TN4 A;  1RTP 1;  2AUC A;  1HT9 A;  3SG7 A;  1XFZ O;  1NX1 A;  1PUL A;  3SS5 A;  1SL7 A;  1SR6 C;  2I94 A;  2AAO A;  3EVU A;  1TIZ A;  1KCY A;  3PLF B;  1XFY O;  1NYA A;  2SCP A;  3OX5 A;  3TDI A;  3CGA A;  1NCY A;  1QIW A;  1QVI Z;  3CR5 X;  4OV2 A;  2L2E A;  2JZI A;  3WNX B;  1QX5 B;  3IQO A;  1DJW A;  2QEB A;  1QV0 A;  4QJ5 B;  2LNK A;  1B7T Y;  1Z2C B;  2KBM A;  4PCW A;  4YBH B;  1SK6 D;  1JFK A;  3L4A A;  3I5H C;  2WOR A;  1JF2 A;  2LAP A;  2CXJ A;  2Y1N A;  3NXA A;  1B1G A;  2F3Y A;  4FQO A;  1D1O A;  2K7B A;  1CLL A;  2KFH A;  1OOG A;  2KI6 D;  2BAP A;  1BOD A;  3OHM B;  1LS8 A;  2BE6 A;  1DEK A;  4ORA B;  3AAK A;  1J7O A;  1T14 A;  1OOI X;  2BKH B;  3E3R A;  4C0L A;  5J3X A;  4DCK A;  4FQT A;  1S1E A;  3I5F C;  2EGD A;  1R6P A;  2TN4 A;  3CAB A;  2KFF A;  1ZOT B;  3CR2 A;  2K8M B;  1LIN A;  1PAL A;  4YGB B;  2KAY A;  1B9A A;  1KK7 Z;  2JNF A;  2SAS A;  3PM2 A;  3SG3 A;  2ZRS A;  2P70 A;  3NSO A;  4PE7 A;  2WCH A;  3TS5 B;  1YVH A;  5HKZ A;  1E8A A;  2COL B;  1KSM A;  1SL9 A;  2JNX A;  2L50 A;  1DGU A;  1BT6 A;  1CLM A;  3GK2 A;  3O6B A;  2OS8 B;  1MR8 A;  1WLZ A;  2O60 A;  1QTX A;  2I18 A;  3B87 A;  3DVK A;  1WLM A;  3N7H A;  4INW A;  1YRU B;  2HQW A;  3NSK A;  1REC A;  3EKJ A;  2JTZ A;  3L4L A;  1ODB A;  2L5X B;  1AP4 A;  1QX7 A;  2WCK A;  3OB1 B;  1CMF A;  1J7P A;  4GPL B;  1CFF A;  1ZAC A;  1FI5 A;  1S26 D;  3BUW B;  3PM8 A;  4M2Q A;  1CFP A;  1W7J B;  2MAZ A;  1TNX A;  3LLE A;  1IKU A;  5AEQ A;  5CSI A;  3HX4 A;  1NX0 A;  1MXL C;  1DJH A;  3B6X A;  3B86 A;  1UHI A;  1KWO B;  1UP5 A;  3BXK A;  3CR4 X;  3D10 A;  4PHJ A;  2LMV A;  3WHT B;  3NGV A;  4YGE B;  1CLB A;  4BY4 A;  1F55 A;  3FIA A;  1GJY A;  1TNW A;  1C7V A;  2H61 A;  2LLT A;  1RJV A;  4PE1 A;  2L51 A;  3FE8 A;  5DKQ A;  2WCL A;  1OOF A;  3EK7 A;  4YGC B;  2CT9 A;  5D3O A;  5DKR A;  3K1E A;  3A8R A;  2JU0 A;  3NSL A;  1DJX A;  4YGA A;  5HL1 A;  4OVN F;  4PAL A;  2BE4 A;  1CDP A;  5HLV A;  4DIR A;  2H61 C;  3A4U B;  1ZFS A;  2JOJ A;  4YI8 A;  4MZJ A;  5D69 A;  4OCI A;  1B8C A;  5CPV A;  1YUS A;  1J1E A;  2NCO A;  2BL0 C;  4CFR A;  2WCF A;  2F33 A;  4HRG A;  5BPJ A;  3PN7 B;  3SG2 A;  3I5F B;  4Q04 A;  4TNC A;  4C0K A;  1M63 B;  4I5J A;  1OZS A;  2ZRT A;  1BJF A;  2M29 A;  1V1G A;  2M97 A;  1EG4 A;  3BQ3 A;  4YGD B;  1PVA A;  1QLS A;  5FI6 A;  3B7A A;  1SKT A;  3DF0 A;  5D7F A;  1WY9 A;  4A4B A;  1DQE A;  4MSP A;  3D73 A;  1UUS A;  1C07 A;  2KDH A;  2K2F A;  2F2P A;  1KK7 Y;  3IVT A;  4PE4 A;  1X02 A;  1Y0V H;  5TNC A;  1KK8 C;  1CB1 A;  1DMO A;  4JPZ B;  2GGM A;  2CNP A;  1LKJ A;  3CZ1 A;  1BG1 A;  2LMT A;  2DOQ A;  1B8R A;  1NCZ A;  1OQP A;  3BFB A;  1KQM C;  3EKH A;  1NPQ A;  1OW4 A;  4IJ7 A;  2F3Z A;  3SS3 A;  5HYD A;  1S6I A;  2KHN A;  1YX8 A;  1BF5 A;  1QV1 A;  4DRW A;  1PRW A;  2ERB A;  2QEV A;  1SW8 A;  1UHH A;  4AQJ A;  2PVB A;  1KFX S;  1R2U A;  2MLF C;  1YX7 A;  1K94 A;  1Y6W A;  2KGB C;  1F70 A;  1LA3 A;  1SCV A;  3VGO A;  1IQ3 A;  4JKT A;  3DD4 A;  4P2Y B;  2H2K A;  1OMR A;  1M46 A;  2KQY A;  3PAL A;  1DJZ A;  3D74 A;  1UHK A;  3R1V A;  1TUJ A;  2HF5 A;  2F8P A;  4E68 A;  5DIC A;  3NHT A;  3SG5 A;  1K96 A;  1SY9 A;  2G9B A;  1RWY A;  5AAN A;  1SL8 A;  2KI6 C;  2CCM A;  5CSJ A;  5PAL A;  2KI4 C;  1PSR A;  1TCF A;  1TNP A;  2LLS A;  2LVI A;  2ZKM X;  1NX3 A;  3I5G C;  1JFJ A;  1CFD A;  2Y5I A;  2MLE C;  1EH2 A;  4WQ3 A;  2LC5 A;  2JC2 A;  4ETO A;  2BL0 B;  2LUC A;  4WQ2 A;  1K9U A;  1KFU L;  3PSR A;  2V53 A;  1L7Z A;  1EJ3 A;  1QAS A;  1MXE A;  1MQ1 A;  3OGN A;  1DF0 A;  2JRF A;  4GGF A;  2JWW A;  4CID A;  1YRT B;  2LP2 A;  2R2I A;  4MZL A;  4C0J A;  1A2X A;  2FCE A;  1H4B A;  4MN0 A;  1S6C A;  2JPT A;  3ZWH A;  3S0A A;  4PHM A;  2E30 A;  1WRK A;  1KK8 B;  2D8N A;  3LK0 A;  4GGF C;  4MLW A;  1KQV A;  2LMU A;  3RLZ A;  1U5I A;  3DF0 B;  2OTG C;  1WRL A;  2F2O A;  1W9Z A;  3PFV A;  1Z4H A;  4CFQ A;  1K8U A;  4YI9 A;  3SJS A;  1SMG A;  4PT1 A;  1WRZ A;  1C7W A;  2NXQ A;  3KO0 A;  1QXP A;  1K95 A;  5I8N A;  1CDL A;  3AKB A;  2LLU A;  3OB2 B;  3S0F A;  1DGV A;  2MA2 A;  1SCM C;  1XFX O;  3WHU B;  2CBL A;  2QPT A;  4OR9 B;  2ISD A;  5GQQ C;  1CNP A;  3KHE A;  1CM1 A;  2GV5 A;  3BUM B;  1TCO B;  3VB1 A;  2LP3 A;  1PSB A;  2K60 A;  3VRO A;  4D1E A;  3BUN B;  2EHB A;  1SR6 B;  1UHN A;  4INX A;  3CWG A;  3VRN A;  1ALV A;  3BOW A;  3BJH A;  1EG3 A;  2EC6 C;  2LUX A;  4MRX A;  4NDD A;  3ZNI A;  5I2O A;  1OMV A;  4HRE E;  2K61 A;  3DVJ A;  4CLN A;  1OMD A;  1IRJ A;  1S3P A;  2KI4 B;  3D76 A;  1AVS A;  3WXA A;  4ZCU A;  1TWO A;  2BBM A;  1WDC C;  1A29 A;  4M2O A;  4ZCV A;  2WND A;  2Y1M A;  3I5H B;  4XJK A;  1QVI Y;  2QAC A;  3L47 A;  1RK9 A;  1L2O C;  4N5X A;  1LXF C;  2MBX A;  3AAJ A;  2PAS A;  1KSO A;  1M39 A;  3F45 A;  3DYE A;  3O4X A;  2KAX A;  2JXL A;  2L5Y A;  3LK1 A;  2P71 A;  4WRI A;  1YVL A;  2JXC A;  3GK1 A;  2WC5 A;  1C3Y A;  1IH0 A;  1XFV O;  1XFW O;  4JQ0 D;  1FF1 A;  2ZFD A;  1JWD A;  1BLQ A;  1F4Q A;  1K90 D;  1CM4 A;  2NCP A;  5HKW A;  4U8D A;  1DF0 B;  3SIB A;  1IG5 A;  2KOT A;  3I5I C;  1MHO A;  1NSH A;  3CS1 A;  1CDM A;  3R1P A;  2LE9 B;  1NCX A;  3S0G A;  1HQV A;  2JTT A;  4GAO A;  1CDN A;  3DY9 A;  1CFC A;  1TUZ A;  1MF8 B;  2KYC A;  2O5G A;  2LAN A;  3KF9 A;  2FJY A;  1QIV A;  2KPH A;  1GGZ A;  2KYF A;  3Q8I A;  1UHJ A;  2WC8 A;  2BKI B;  3PAT A;  1J7Q A;  3C1V A;  2LV7 A;  1U5I B;  4NQG A;  5HLO A;  2JT3 A;  1N2D A;  1DEL A;  1NP8 A;  1SCM B;  2LVV A;  2Q4U A;  3D78 A;  5JJG A;  3VRR A;  1F8H A;  1TRF A;  1YUT A;  3CLN A;  2NZ0 A;  3O78 A;  4FTG A;  2ZN9 A;  1QJT A;  3FE6 A;  1FI6 A;  2GGZ A;  1AK8 A;  3HCM A;  1ORG A;  5KSZ A;  1MUX A;  4YRU A;  1Y1A A;  2HET A;  1TOP A;  2M3W A;  3K21 A;  3O2P A;  3O4Y A;  1IJ6 A;  2EC6 B;  3QME A;  2H8V A;  4GGN A;  3R72 A;  5IBW A;  4JWQ A;  2KQ6 A;  1IJ5 A;  1SSE B;  1YUR A;  2KGR A;  1NIW A;  4GUK A;  4HSZ A;  3SS4 A;  1XFU O;  2QEH A;  1OOJ A;  1WDC B;  2L98 A;  3M0W A;  4R1E A;  1OE9 B;  2ZN8 A;  3UO9 A;  3DZT A;  4NDB A;  3BOW B;  3CDN A;  5DKN A;  4AOM A;  5KTY A;  2CTN A;  5JOL A;  3SG4 A;  1FW4 A;  3OP0 A;  4QJ3 B;  5AXI A;  4L9M A;  1DJY A;  3TZ1 A;  2G2B A;  1H8B A;  2K0J A;  1L2O B;  3SG6 A;  2AMI A;  4A4C A;  1LA0 A;  1M31 A;  3BFH A;  1Q80 A;  3FE9 A;  4ORB B;  1AHR A;  1BMO A;  3TS5 C;  3V2L A;  1YUU A;  1K9P A;  3CYZ A;  1K2H A;  3EVR A;  1MWN A;  2BEC A;  2HPS A;  2M49 B;  4GBA A;  4XJK B;  5F6T A;  2MRD A;  3PJI A;  1YR5 A;  1BU3 A;  2Y4Q A;  3KPX A;  1ZMZ A;  4PHK A;  4XYN A;  1RRO A;  1UWO A;  2KBI A;  1N65 A;  1QWV A;  1LVC D;  1XFR A;  1YTZ C;  4PE0 A;  3I5I B;  1FPW A;  4QJ4 B;  3BUX B;  1K9K A;  2I2R E;  4MBE A;  5FYX A;  1K93 D;  4I5N B;  1SNL A;  1AJ4 A;  1EXR A;  1XK4 A;  2WOS A;  2OPO A;  3BFA A;  1F71 A;  1NX2 A;  3D75 A;  1IQ5 A;  1DJI A;  2M8U A;  1Y1X A;  1XVJ A; 
#chains in the Genus database with same CATH homology
 1JUO A;  1KWO C;  3DVE A;  4CPV A;  1QAT A;  2ZND A;  3GK4 X;  1J1D A;  2P6B B;  1XK4 C;  5ER4 X;  2LHI A;  1RFJ A;  2FCD A;  2M7N A;  2JQ6 A;  5K89 A;  1M45 A;  1KQM B;  4MRY A;  3NSI A;  4PHN A;  1SPY A;  1FBV A;  4ORC B;  1Y1U A;  4HRH A;  3SIA A;  2K7C A;  2WCB A;  2KSP A;  3KEV A;  2RGI A;  2E6W A;  1GGW A;  2K7D A;  4DUQ A;  3D0Y A;  2VRG A;  2BCB A;  1OSA A;  1PK0 D;  1S5G Z;  1ALW A;  5ER5 A;  5AER A;  2WCE A;  1BOC A;  3PN7 C;  2LVJ A;  3TDZ A;  1KFX L;  2A4J A;  4USL A;  1ZUZ A;  5G08 A;  1N0Y A;  3JVT C;  3BUO B;  2L4I A;  2JUL A;  3FS7 A;  4BY5 A;  1BR4 B;  3EVV A;  3I5G B;  2NLN A;  1J55 A;  3VRQ A;  3JTD C;  3TUY C;  2PAL A;  4MZK A;  1F54 A;  1A75 A;  3LCP C;  1JF0 A;  1EL4 A;  2JT0 A;  2KAV A;  3RM1 A;  5B8I B;  1XO5 A;  5AFP A;  2FJU B;  1J7R A;  3EK8 A;  2KFG A;  1XA5 A;  3FWC A;  3CZT X;  1DT7 B;  1S6J A;  4UPG A;  1G33 A;  4N1G A;  1F4O A;  2KNE A;  5HKY A;  3LL8 B;  2MJW B;  4PDZ A;  2B1U A;  3CTN A;  2K7O A;  2BCX A;  4I5K A;  2JT8 A;  1SYM A;  3IQQ A;  1SRA A;  2OTG B;  4M2P A;  3OX6 A;  4ICB A;  1JSA A;  3GOF A;  2LCP A;  1B8L A;  1G4Y R;  2LVK A;  1SBJ A;  1B7T Z;  4OKH A;  4N1F A;  2BBN A;  3BYA A;  1UUR A;  1KFU S;  3EK4 A;  4MEW A;  2PSR A;  1IWQ A;  2FOT A;  2PMY A;  1B4C A;  1CMG A;  1A03 A;  3ICB A;  4MVF A;  3H4S E;  5CSF A;  1TNQ A;  1V1F A;  4DS7 A;  5I2L A;  4GNK B;  1QLK A;  2BCA A;  2LHL A;  4NDC A;  4GFT A;  5KU1 A;  1QS7 A;  2M9G A;  3VRP A;  1IGV A;  2PRU A;  4IL1 A;  1S5G Y;  1JC2 A;  3D0Y B;  3QRX A;  1G8I A;  3TDU A;  1A4P A;  3JVT B;  2ZNE A;  1DTL A;  2Q91 A;  3AKA A;  1B47 A;  1AUI B;  4P5O E;  1CTR A;  1DVI A;  2I7A A;  1AJ5 A;  3MSE B;  5CSN A;  1NWD A;  3TUY B;  3JTD B;  2L4H A;  3IF7 A;  2IS9 A;  3FWB A;  1JBA A;  2M1K B;  1GQM A;  2MHH A;  1OZO A;  4F0Z B;  1PVB A;  1CKK A;  1W7I B;  1A75 B;  1BR1 B;  1S36 A;  1TTX A;  2K2A A;  5I2Q A;  2OS8 C;  3DVM A;  2LM5 A;  1XYD A;  2L0P A;  4AQI A;  1DJG A;  1NUB A;  2HQ8 A;  1VRK A;  2M1U A;  1QX2 A;  4I5L B;  2M7L A;  2M0R A;  1TN4 A;  1RTP 1;  2AUC A;  1HT9 A;  3SG7 A;  1XFZ O;  1NX1 A;  1PUL A;  1SL7 A;  1SR6 C;  2I94 A;  2AAO A;  3EVU A;  1TIZ A;  1KCY A;  3PLF B;  1XFY O;  1NYA A;  2SCP A;  3OX5 A;  3TDI A;  3CGA A;  1NCY A;  1QIW A;  1QVI Z;  3CR5 X;  4OV2 A;  2L2E A;  2JZI A;  3WNX B;  1QX5 B;  3IQO A;  1DJW A;  1QV0 A;  4QJ5 B;  2LNK A;  1B7T Y;  2KBM A;  4PCW A;  4YBH B;  1SK6 D;  1JFK A;  3I5H C;  2WOR A;  1JF2 A;  2LAP A;  2CXJ A;  2Y1N A;  3NXA A;  1B1G A;  2F3Y A;  4FQO A;  1D1O A;  2K7B A;  1CLL A;  2KFH A;  2KI6 D;  1BOD A;  3OHM B;  2BE6 A;  4ORA B;  3AAK A;  1J7O A;  3E3R A;  2BKH B;  4C0L A;  5J3X A;  4DCK A;  1S1E A;  3I5F C;  2EGD A;  1R6P A;  2TN4 A;  2KFF A;  1ZOT B;  3CR2 A;  2K8M B;  1LIN A;  1PAL A;  4YGB B;  2KAY A;  1B9A A;  1KK7 Z;  2JNF A;  2SAS A;  3SG3 A;  2ZRS A;  3NSO A;  4PE7 A;  3TS5 B;  1YVH A;  5HKZ A;  1E8A A;  2COL B;  1KSM A;  1SL9 A;  2JNX A;  2L50 A;  1DGU A;  1BT6 A;  1CLM A;  3GK2 A;  3O6B A;  2OS8 B;  1MR8 A;  1WLZ A;  2O60 A;  1QTX A;  2I18 A;  3DVK A;  1WLM A;  1YRU B;  2HQW A;  3NSK A;  1REC A;  3EKJ A;  2JTZ A;  1ODB A;  2L5X B;  1AP4 A;  1QX7 A;  3OB1 B;  1CMF A;  1J7P A;  4GPL B;  1CFF A;  1ZAC A;  1FI5 A;  1S26 D;  3BUW B;  3PM8 A;  4M2Q A;  1CFP A;  1W7J B;  2MAZ A;  1TNX A;  3LLE A;  1IKU A;  5AEQ A;  5CSI A;  3HX4 A;  1NX0 A;  1MXL C;  1DJH A;  1UHI A;  1KWO B;  1UP5 A;  3BXK A;  3CR4 X;  3D10 A;  4PHJ A;  2LMV A;  3WHT B;  4YGE B;  1CLB A;  4BY4 A;  1F55 A;  3FIA A;  1GJY A;  1TNW A;  1C7V A;  2H61 A;  2LLT A;  1RJV A;  4PE1 A;  2L51 A;  5DKQ A;  3EK7 A;  4YGC B;  2CT9 A;  5DKR A;  3A8R A;  2JU0 A;  3NSL A;  1DJX A;  4YGA A;  4OVN F;  4PAL A;  2BE4 A;  1CDP A;  5HLV A;  4DIR A;  2H61 C;  3A4U B;  1ZFS A;  2JOJ A;  4YI8 A;  4MZJ A;  5D69 A;  4OCI A;  1B8C A;  5CPV A;  1YUS A;  1J1E A;  2NCO A;  2BL0 C;  4CFR A;  2WCF A;  2F33 A;  4HRG A;  5BPJ A;  3PN7 B;  3SG2 A;  3I5F B;  4Q04 A;  4TNC A;  4C0K A;  1M63 B;  4I5J A;  1OZS A;  2ZRT A;  1BJF A;  2M29 A;  1V1G A;  2M97 A;  1EG4 A;  3BQ3 A;  4YGD B;  1PVA A;  1QLS A;  1SKT A;  3DF0 A;  5D7F A;  1WY9 A;  4A4B A;  4MSP A;  1C07 A;  1UUS A;  2KDH A;  2K2F A;  2F2P A;  1KK7 Y;  1CB1 A;  4PE4 A;  1X02 A;  1Y0V H;  5TNC A;  1KK8 C;  1DMO A;  4JPZ B;  2GGM A;  2CNP A;  1LKJ A;  1BG1 A;  2LMT A;  2DOQ A;  1B8R A;  1NCZ A;  1OQP A;  1KQM C;  3EKH A;  1NPQ A;  2F3Z A;  5HYD A;  1S6I A;  2KHN A;  1YX8 A;  1BF5 A;  1QV1 A;  4DRW A;  1PRW A;  1SW8 A;  1UHH A;  4AQJ A;  2PVB A;  1KFX S;  1R2U A;  2MLF C;  1YX7 A;  1K94 A;  1Y6W A;  2KGB C;  1F70 A;  1LA3 A;  1SCV A;  3VGO A;  1IQ3 A;  3DD4 A;  4P2Y B;  2H2K A;  1OMR A;  1M46 A;  2KQY A;  3PAL A;  1DJZ A;  1UHK A;  2HF5 A;  2F8P A;  4E68 A;  3SG5 A;  1K96 A;  1SY9 A;  2G9B A;  1RWY A;  5AAN A;  1SL8 A;  2KI6 C;  2CCM A;  5CSJ A;  5PAL A;  2KI4 C;  1PSR A;  1TCF A;  1TNP A;  2LLS A;  2LVI A;  2ZKM X;  1NX3 A;  3I5G C;  1JFJ A;  1CFD A;  2Y5I A;  2MLE C;  1EH2 A;  4WQ3 A;  2LC5 A;  2JC2 A;  4ETO A;  2BL0 B;  2LUC A;  4WQ2 A;  1K9U A;  1KFU L;  3PSR A;  2V53 A;  1L7Z A;  1EJ3 A;  1QAS A;  1MXE A;  1MQ1 A;  1DF0 A;  2JRF A;  4GGF A;  2JWW A;  4CID A;  1YRT B;  2LP2 A;  2R2I A;  4MZL A;  4C0J A;  1A2X A;  2FCE A;  1H4B A;  4MN0 A;  1S6C A;  2JPT A;  3ZWH A;  4PHM A;  2E30 A;  1WRK A;  1KK8 B;  2D8N A;  3LK0 A;  4GGF C;  4MLW A;  1KQV A;  2LMU A;  3RLZ A;  1U5I A;  3DF0 B;  2OTG C;  1WRL A;  2F2O A;  3PFV A;  4CFQ A;  1K8U A;  4YI9 A;  3SJS A;  1SMG A;  1WRZ A;  1C7W A;  2NXQ A;  3KO0 A;  1QXP A;  1K95 A;  5I8N A;  1CDL A;  3AKB A;  2LLU A;  3OB2 B;  1DGV A;  2MA2 A;  1SCM C;  1XFX O;  3WHU B;  2CBL A;  2QPT A;  4OR9 B;  2ISD A;  5GQQ C;  1CNP A;  3KHE A;  1CM1 A;  2GV5 A;  3BUM B;  1TCO B;  2LP3 A;  1PSB A;  3VRO A;  4D1E A;  3BUN B;  2EHB A;  1SR6 B;  1UHN A;  3CWG A;  3VRN A;  1ALV A;  3BOW A;  4MRX A;  1EG3 A;  2EC6 C;  2LUX A;  4NDD A;  3ZNI A;  5I2O A;  1OMV A;  4HRE E;  2K61 A;  3DVJ A;  4CLN A;  1OMD A;  1IRJ A;  1S3P A;  2KI4 B;  3WXA A;  1AVS A;  4ZCU A;  2BBM A;  1WDC C;  1A29 A;  4M2O A;  4ZCV A;  2WND A;  2Y1M A;  3I5H B;  4XJK A;  1QVI Y;  2QAC A;  1RK9 A;  1L2O C;  4N5X A;  1LXF C;  2MBX A;  3AAJ A;  2PAS A;  1KSO A;  1M39 A;  3F45 A;  2KAX A;  2JXL A;  3LK1 A;  4WRI A;  1YVL A;  2JXC A;  3GK1 A;  1IH0 A;  1XFV O;  1XFW O;  4JQ0 D;  1FF1 A;  2ZFD A;  1JWD A;  1BLQ A;  1F4Q A;  1K90 D;  1CM4 A;  2NCP A;  5HKW A;  4U8D A;  1DF0 B;  3SIB A;  1IG5 A;  2KOT A;  3I5I C;  1MHO A;  1NSH A;  3CS1 A;  1CDM A;  2LE9 B;  1NCX A;  1HQV A;  2JTT A;  4GAO A;  1CDN A;  1CFC A;  1MF8 B;  2KYC A;  2O5G A;  2LAN A;  3KF9 A;  1QIV A;  1GGZ A;  2KYF A;  1UHJ A;  2WC8 A;  2BKI B;  3PAT A;  1J7Q A;  3C1V A;  2LV7 A;  1U5I B;  4NQG A;  5HLO A;  2JT3 A;  1N2D A;  1NP8 A;  1SCM B;  2LVV A;  2Q4U A;  5JJG A;  1F8H A;  3VRR A;  1TRF A;  1YUT A;  3CLN A;  2NZ0 A;  3O78 A;  4FTG A;  2ZN9 A;  1QJT A;  1FI6 A;  2GGZ A;  1AK8 A;  3HCM A;  5KSZ A;  1MUX A;  4YRU A;  1Y1A A;  2HET A;  1TOP A;  2M3W A;  3K21 A;  3O2P A;  3O4Y A;  1IJ6 A;  2EC6 B;  4GGN A;  5IBW A;  4JWQ A;  2KQ6 A;  1IJ5 A;  1YUR A;  2KGR A;  1NIW A;  4GUK A;  4HSZ A;  1XFU O;  1OOJ A;  1WDC B;  2L98 A;  3M0W A;  4R1E A;  1OE9 B;  2ZN8 A;  4NDB A;  3BOW B;  5DKN A;  4AOM A;  5KTY A;  2CTN A;  5JOL A;  3SG4 A;  1FW4 A;  3OP0 A;  4QJ3 B;  5AXI A;  4L9M A;  1DJY A;  3TZ1 A;  2G2B A;  1H8B A;  2K0J A;  1L2O B;  3SG6 A;  2AMI A;  4A4C A;  1LA0 A;  1M31 A;  3TS5 C;  1Q80 A;  4ORB B;  1AHR A;  1BMO A;  1YUU A;  1K9P A;  1K2H A;  3EVR A;  1MWN A;  2BEC A;  2HPS A;  2M49 B;  4GBA A;  4XJK B;  5F6T A;  2MRD A;  1YR5 A;  1BU3 A;  2Y4Q A;  3KPX A;  1ZMZ A;  4PHK A;  4XYN A;  1RRO A;  1UWO A;  2KBI A;  1N65 A;  1LVC D;  1YTZ C;  4PE0 A;  3I5I B;  1FPW A;  4QJ4 B;  3BUX B;  1K9K A;  2I2R E;  4MBE A;  5FYX A;  1K93 D;  4I5N B;  1SNL A;  1AJ4 A;  1EXR A;  1XK4 A;  2WOS A;  2OPO A;  1F71 A;  1NX2 A;  1IQ5 A;  1DJI A;  2M8U A;  1Y1X A;  1XVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...