5HLOA

Crystal structure of calcium and zinc-bound human s100a8 in space group c2221
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
ALTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Crystal structure of human S100A8 in complex with zinc and calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hloA00
3SG6A 1IJ6A 1TNPA 1R6PA 4JQ0D 1SNLA 1QX2A 4MZJA 3TDIA 1KK8C 1CFDA 1XFVO 1OMVA 3PLFB 1S6IA 5CSIA 2QPTA 1ZFSA 1YRUB 3PN7C 4Q04A 1JWDA 1J7RA 3OB1B 3BYAA 1J1EA 1DJIA 5CPVA 5CSNA 1D1OA 3TUYB 1TOPA 2Y1MA 1S5GY 2M1KB 3O6BA 1A4PA 2LUXA 3KO0A 4NDDA 3WXAA 2JWWA 1UHNA 4L9MA 1U5IB 1DGUA 1TCFA 4JWQA 1DT7B 3SG7A 4GAOA 4PHKA 1IRJA 3IF7A 4HRHA 1DGVA 3I5FC 1XFUO 1K95A 3JTDC 1YVHA 5AXIA 3GOFA 1SCMB 2WCEA 4MBEA 1MWNA 4AQJA 4PALA 1QV0A 1GQMA 3MSEB 1IJ5A 2BCBA 2EHBA 1VRKA 3FIAA 3NSIA 4MRYA 3SG3A 1MHOA 4AOMA 2G2BA 1C7WA 1E8AA 2ZN9A 2ZRTA 2M7NA 4MEWA 2O60A 2M8UA 1K96A 1SW8A 1BLQA 3CWGA 3OHMB 3LLEA 3KPXA 4P2YB 2LANA 4N1FA 2LP2A 2LHIA 4I5KA 4U8DA 1KQMC 1KK8B 4ICBA 1M31A 1YUTA 3H4SE 1NCXA 1DVIA 4MVFA 3I5HC 5JOLA 4PE0A 2JU0A 3PN7B 1KSOA 1KQVA 5ER5A 2MAZA 2LLTA 1FBVA 2JNFA 3VRRA 5AERA 5AFPA 1CDPA 3BUNB 1LINA 5B8IB 2E30A 2MLFC 1QATA 1Y1XA 3NXAA 3F45A 1BT6A 1CFCA 3I5FB 2KGRA 1MF8B 1OMDA 3JTDB 1TIZA 1Y6WA 3EVUA 1YURA 4PE7A 2F3ZA 2NLNA 3E3RA 1DJWA 2LAPA 4PHJA 2M97A 1UHHA 2M29A 4BY5A 1H8BA 1SR6C 1K9PA 1B8CA 2LNKA 1Q80A 1CFPA 1SYMA 4N1GA 1Y0VH 4PHNA 3OP0A 1CLLA 3OX6A 5HLOA 1S26D 1AVSA 2PALA 1OOJA 4XJKA 5IBWA 3FWBA 2LCPA 1QIWA 3SG4A 1DJHA 2MLEC 1N2DA 5F6TA 1IH0A 2MBXA 3O78A 2KHNA 1B8RA 2K61A 1SRAA 3IQOA 1MUXA 2L2EA 1EG4A 1ALWA 1YRTB 3D0YA 1BR4B 2H61A 2V53A 4WQ3A 1FF1A 2KDHA 1DF0A 4N5XA 2HF5A 3PATA 1K90D 1JFKA 3DVMA 5CSFA 3AAJA 2F8PA 1BR1B 1LVCD 2Y1NA 5AANA 3SG5A 3BUOB 4C0JA 1XVJA 4UPGA 1QV1A 1UUSA 4AQIA 1CFFA 5JJGA 1UWOA 1S6CA 1IQ3A 2JXCA 4PE1A 2ZKMX 3EVRA 2L50A 2L51A 2ZN8A 1BG1A 3OB2B 2KBMA 1XK4A 4HRGA 2KI4C 4C0LA 5HKZA 4MSPA 3EKHA 1HT9A 1CB1A 2OPOA 2F2OA 1DJXA 1RK9A 1M46A 3NSKA 5KSZA 1V1GA 4ORCB 1MQ1A 1QTXA 1UHIA 4YGDB 4MN0A 1SY9A 1NIWA 1KFUL 4IL1A 2O5GA 2BL0C 2OS8B 2M0RA 2KYFA 3GK2A 4GBAA 4GPLB 1K8UA 2PSRA 3FS7A 1K93D 2BCXA 1LKJA 1CDLA 2LHLA 4DRWA 5KTYA 1JBAA 3HCMA 3WNXB 2KFHA 1RWYA 1IWQA 1AHRA 2K0JA 3TDUA 1LXFC 1KK7Y 1G4YR 2I2RE 3DVJA 5HKWA 1A75B 2HQWA 1B8LA 5DKQA 1SL7A 2BKHB 1SPYA 1QX7A 1WRKA 5D69A 2KBIA 1TTXA 2OTGC 1N65A 1JFJA 4CFRA 1KFXL 1JF2A 2AAOA 2BBNA 1RFJA 1C07A 3A8RA 1ALVA 1CKKA 1PVBA 3EKJA 4WRIA 1F55A 2BE6A 3WHTB 1ZOTB 2CTNA 2H61C 1NSHA 2KI4B 2LM5A 2LVJA 2KOTA 1OE9B 2WCFA 3KF9A 1NCYA 3EK4A 2PRUA 2EC6C 2KAVA 4NDBA 3ZWHA 1CLBA 1PVAA 1B7TY 1S6JA 3TDZA 1BJFA 1XFZO 3VRPA 5I2QA 1SL8A 2BL0B 1RJVA 1XA5A 4YGCB 2LLUA 2NZ0A 1UHJA 4YBHB 2K7CA 1QVIZ 1U5IA 1CNPA 1CDNA 1XK4C 2FJUB 2LMTA 1OQPA 2KI6D 2GGMA 1NX3A 1J1DA 3VRQA 2JT0A 2HQ8A 1J7PA 4A4BA 1HQVA 1MXLC 4GGNA 4DIRA 2BE4A 3QRXA 1OZOA 1RECA 1YUUA 3C1VA 3A4UB 1AJ4A 2K7BA 1A2XA 4XJKB 4QJ4B 5I2LA 2H2KA 1W7JB 2I7AA 2L0PA 3BUMB 3RLZA 2EGDA 1J7OA 2OTGB 3CR2A 4USLA 4NQGA 1F4QA 4QJ3B 2D8NA 2Q4UA 3SJSA 4OCIA 3GK4X 1SKTA 3BXKA 1KSMA 4YGEB 1EL4A 3BUXB 1B47A 2MA2A 1ODBA 3GK1A 4OR9B 2HETA 1WRZA 3D0YB 1KWOC 1BMOA 3KEVA 1DF0B 2LVKA 1NX2A 2M49B 3BOWA 2K2AA 2KQ6A 5TNCA 5HYDA 2KSPA 2F33A 2EC6B 1ZUZA 2M9GA 1YR5A 2TN4A 1KQMB 2LUCA 1XFYO 2LE9B 3EK7A 2ZRSA 2MHHA 5GQQC 1KFUS 4D1EA 1EXRA 1PK0D 3D10A 3NSLA 2VRGA 3I5HB 3IQQA 4HSZA 2JRFA 2JT3A 4CPVA 4E68A 2COLB 3CR5X 5G08A 3LK0A 2FCDA 3AKAA 3DF0A 3TS5C 1CMGA 1WRLA 5DKNA 2CBLA 2JULA 4DUQA 4FQOA 2PVBA 3DD4A 4GNKB 1IKUA 1ZACA 1L2OC 4ORAB 2L5XB 4M2OA 4NDCA 1GGZA 1AUIB 1KCYA 4OV2A 1FI5A 2BCAA 2LLSA 1NWDA 1WY9A 3PSRA 2I94A 4XYNA 2M1UA 4F0ZB 1NX0A 3ZNIA 2CNPA 2JXLA 1LA0A 1SL9A 2WORA 1SR6B 3O4YA 1MR8A 1NCZA 1NUBA 1KFXS 2LC5A 3LCPC 4M2PA 4I5LB 1SCMC 1JUOA 2L98A 3CLNA 1CM1A 2KFGA 2G9BA 4DS7A 1B9AA 1K94A 1KWOB 4R1EA 1DJYA 1EG3A 2IS9A 3PALA 1PRWA 2KQYA 1YUSA 4WQ2A 2I18A 1F8HA 1Y1UA 4GGFA 1SCVA 5ER4X 2JC2A 1YX8A 1TNQA 2K7OA 2WOSA 3VGOA 4QJ5B 1TRFA 1S5GZ 2KAXA 4FTGA 4YGAA 1G8IA 4HREE 5J3XA 1LA3A 2R2IA 3I5IC 1QASA 1F71A 2BBMA 2JQ6A 4BY4A 4CFQA 1S3PA 1WDCC 1A29A 1KK7Z 2JPTA 3LK1A 1GGWA 2QACA 3TS5B 4GFTA 4ZCUA 1CM4A 1MXEA 5DKRA 4DCKA 3AKBA 2JTZA 2Y4QA 1K9KA 1N0YA 1L2OB 2ZFDA 3EK8A 3PM8A 4MZLA 1SMGA 3ICBA 2KI6C 3O2PA 3K21A 2Q91A 1R2UA 2SASA 1QIVA 1IQ5A 1PALA 5I8NA 1S1EA 1AJ5A 3CTNA 2LMVA 1J7QA 1SBJA 4P5OE 2JNXA 2JOJA 3DVEA 1AP4A 1IGVA 1CLMA 1WLMA 2LVIA 1EJ3A 1WLZA 1XFWO 1K2HA 1OMRA 2WC8A 1BOCA 1B7TZ 3M0WA 3CZTX 4TNCA 3EVVA 1TNXA 1M39A 1UP5A 1XFXO 1G33A 1Y1AA 5CSJA 1QXPA 1M63B 1UURA 2CXJA 1C7VA 1QLSA 1DJGA 1F70A 2DOQA 4GUKA 4PDZA 4I5NB 1CDMA 1FPWA 1QJTA 2K2FA 2BKIB 2ISDA 1A75A 3I5IB 4YGBB 4PHMA 1OZSA 4MRXA 3TZ1A 1JSAA 5KU1A 2JT8A 1WDCB 2LP3A 1FI6A 4C0KA 1CTRA 2M3WA 3BOWB 3I5GC 1V1FA 4ZCVA 2KFFA 4GGFC 2L4IA 3FWCA 1QVIY 2A4JA 1BU3A 1PSRA 4PCWA 2KGBC 1TCOB 4OVNF 1OSAA 5PALA 1YVLA 3LL8B 1QX5B 4CLNA 1UHKA 1XO5A 1QLKA 1A03A 1JC2A 5AEQA 2KYCA 2MRDA 3DVKA 3JVTC 3DF0B 5HKYA 1BODA 5I2OA 1DMOA 4PE4A 4ORBB 3WHUB 1B1GA 2PASA 1B4CA 2GGZA 2HPSA 3CGAA 4YI8A 1NYAA 3VROA 1H4BA 1JF0A 2JTTA 5FYXA 1TN4A 1EH2A 1CMFA 1F4OA 3CS1A 1DJZA 3BQ3A 1PULA 2JZIA 2SCPA 1BF5A 1SK6D 3HX4A 1XYDA 1RROA 2PMYA 2AUCA 2OS8C 1YX7A 3NSOA 1F54A 2WNDA 2F2PA 2MJWB 2NCOA 3CR4X 2KNEA 5D7FA 2FCEA 3OX5A 2M7LA 3TUYC 3VRNA 1IG5A 4YRUA 2Y5IA 2AMIA 3RM1A 1M45A 2F3YA 1QS7A 3I5GB 4MLWA 1TNWA 2RGIA 2NCPA 1AK8A 2CCMA 2LVVA 2KAYA 5K89A 2K7DA 4YI9A 2P6BB 3KHEA 1NX1A 1NPQA 4I5JA 2K8MB 5BPJA 1K9UA 1S36A 2WCBA 1DTLA 3AAKA 3SIBA 4M2QA 2B1UA 1W7IB 2GV5A 3BUWB 4OKHA 1PSBA 2ZNDA 1GJYA 5HLVA 4CIDA 3JVTB 3SG2A 2ZNEA 1YTZC 3SIAA 1ZMZA 2BECA 1J55A 2LV7A 4A4CA 1RTP1 2L4HA 4JPZB 1L7ZA 2CT9A 1FW4A 2E6WA 2LMUA 1NP8A 2NXQA 3PFVA 1X02A 2FOTA 4ETOA 4MZKA
chains in the Genus database with same CATH superfamily
3SG6A 1IJ6A 1TNPA 1R6PA 4JQ0D 1SNLA 1QX2A 4MZJA 3PM2A 3TDIA 1KK8C 1CFDA 1XFVO 1OMVA 3PLFB 1S6IA 5CSIA 2WCHA 3UO9A 2QPTA 1ZFSA 1YRUB 3PN7C 4Q04A 1JWDA 3D77A 1J7RA 3OB1B 3BYAA 1J1EA 1DJIA 4OZDA 5CPVA 5CSNA 1DC1A 1D1OA 3BFAA 3TUYB 1TOPA 2Y1MA 4INXA 1S5GY 2M1KB 3O6BA 1A4PA 2LUXA 3KO0A 4NDDA 3WXAA 2JWWA 1UHNA 4L9MA 1U5IB 1DGUA 1TCFA 4JWQA 3S0FA 1DT7B 3SG7A 2K60A 4GAOA 4PHKA 1IRJA 3IF7A 4HRHA 1DGVA 3I5FC 1XFUO 1K95A 3JTDC 1YVHA 5AXIA 3SS3A 3GOFA 1SCMB 3V2LA 2WCEA 4MBEA 1MWNA 3NHIA 4PALA 4AQJA 1QV0A 1GQMA 3MSEB 1IJ5A 1OOGA 2BCBA 2EHBA 1VRKA 3FIAA 3NSIA 4MRYA 3SG3A 1MHOA 2KLDA 3B6XA 3UNWA 4AOMA 3NHTA 2G2BA 1C7WA 1E8AA 2ZN9A 2ZRTA 2M7NA 4MEWA 2O60A 2M8UA 1K96A 1SW8A 1BLQA 3CWGA 3OHMB 3LLEA 3KPXA 4P2YB 2LANA 4N1FA 2WCMA 2QDIA 3CZ2A 2LP2A 2LHIA 4I5KA 4U8DA 1KQMC 1KK8B 4ICBA 1M31A 2L2CA 1YUTA 3H4SE 1NCXA 1DVIA 4MVFA 3I5HC 5JOLA 3SS4A 4PE0A 2JU0A 3PN7B 1KSOA 1KQVA 3PJIA 5ER5A 2MAZA 2LLTA 1FBVA 2JNFA 3B87A 3VRRA 5AERA 5AFPA 1CDPA 3BUNB 1LINA 5B8IB 2E30A 2MLFC 2PYQA 1QATA 1Y1XA 1DEKA 3F45A 1BT6A 3NXAA 1CFCA 3I5FB 2KGRA 1MF8B 1OMDA 3JTDB 4JKTA 1TIZA 1Y6WA 3EVUA 1YURA 3R1OA 2F3ZA 2NLNA 3E3RA 1DJWA 2LAPA 4PE7A 2M97A 4PHJA 5FI7A 1UHHA 2M29A 4BY5A 1H8BA 1SR6C 3L47A 1K9PA 1B8CA 2LNKA 1W9ZA 1Q80A 1CFPA 1SYMA 4N1GA 1Y0VH 3D78A 5EL2A 4PHNA 3QMEA 3OP0A 1CLLA 3S0EA 3OX6A 5HLOA 1S26D 1AVSA 2PALA 1OOJA 4XJKA 5IBWA 3FWBA 2LCPA 1QIWA 3SG4A 1DJHA 2MLEC 1N2DA 5F6TA 1IH0A 2MBXA 3O78A 2KHNA 1B8RA 2K61A 1SRAA 3IQOA 1MUXA 2L2EA 1P28A 1EG4A 1ALWA 1YRTB 3D0YA 1BR4B 2H61A 2V53A 4WQ3A 3Q8IA 2KDHA 1FF1A 1DF0A 2BNXA 4N5XA 2HF5A 3PATA 1K90D 1JFKA 3DVMA 5CSFA 3AAJA 2F8PA 1BR1B 1LVCD 2Y1NA 5AANA 3SG5A 3BUOB 4C0JA 1XVJA 4UPGA 1QV1A 1UUSA 4AQIA 1CFFA 5JJGA 1UWOA 1S6CA 1IQ3A 2JXCA 4PE1A 2ZKMX 3EVRA 3S0DA 2L50A 2L51A 2ZN8A 2PQLA 1BG1A 3OB2B 2KBMA 1XK4A 4HRGA 2KI4C 3BFHA 5HKZA 4MSPA 3EKHA 1HT9A 1QWVA 2OPOA 2F2OA 4C0LA 1CB1A 1DJXA 1RK9A 1M46A 3NSKA 3B86A 5KSZA 1V1GA 4ORCB 1MQ1A 1QTXA 1UHIA 4YGDB 4MN0A 1SY9A 1NIWA 1KFUL 4IL1A 2O5GA 2BL0C 2OS8B 2M0RA 2KYFA 3GK2A 4GBAA 3R72A 4GPLB 1K8UA 2PSRA 3FS7A 3K1EA 1K93D 2BCXA 1LKJA 1CDLA 2LHLA 4DRWA 5KTYA 1JBAA 3HCMA 3D74A 2WCLA 3WNXB 2KFHA 1C3YA 1Z4HA 1RWYA 2WC6A 1IWQA 1AHRA 2K0JA 3TDUA 1LXFC 1KK7Y 1G4YR 2I2RE 3DVJA 5HKWA 1A75B 2HQWA 1B8LA 2KLEA 1SL7A 3DY9A 5DKQA 2BKHB 1SPYA 1QX7A 1WRKA 5D69A 2KBIA 1TTXA 2OTGC 1N65A 5DICA 3DYEA 1JFJA 4CFRA 1KFXL 1JF2A 2AAOA 2BBNA 1RFJA 1OOIX 1C07A 3A8RA 1ALVA 1CKKA 1PVBA 3EKJA 4WRIA 1XFRA 1F55A 2BE6A 3WHTB 1ZOTB 2CTNA 2H61C 3S0AA 1NSHA 2KI4B 2LM5A 2LVJA 2KOTA 1OE9B 2WCFA 3KF9A 1NCYA 3D76A 3EK4A 2PRUA 2EC6C 2KAVA 1Z2CB 4NDBA 3ZWHA 1CLBA 1PVAA 1B7TY 3B88A 1IIOA 1S6JA 3TDZA 1BJFA 1XFZO 3VRPA 4PT1A 5I2QA 1SL8A 2BL0B 1RJVA 1XA5A 4YGCB 2LLUA 2NZ0A 1UHJA 4YBHB 2K7CA 1QVIZ 1U5IA 1CNPA 1CDNA 1SSEB 1OOHA 1XK4C 2FJUB 2LMTA 1OQPA 2KI6D 2P70A 2GGMA 1NX3A 1J1DA 3VRQA 2JT0A 2HQ8A 1J7PA 4A4BA 1HQVA 1MXLC 4GGNA 4DIRA 2BE4A 3QRXA 1OZOA 1RECA 1YUUA 3C1VA 3A4UB 1AJ4A 2K7BA 1A2XA 2QEBA 4XJKB 4QJ4B 5I2LA 2H2KA 1W7JB 2I7AA 2L0PA 3BUMB 3RLZA 2EGDA 1J7OA 2OTGB 3CR2A 4USLA 4NQGA 1F4QA 4QJ3B 2D8NA 2Q4UA 3SJSA 4OCIA 3GK4X 1SKTA 3BXKA 1KSMA 3FE6A 1EL4A 3BUXB 1B47A 4YGEB 2MA2A 1ODBA 3GK1A 4IJ7A 1DQEA 4OR9B 2HETA 1WRZA 3D0YB 1KWOC 1BMOA 3KEVA 1GM0A 1DF0B 2LVKA 1NX2A 2M49B 3BOWA 2K2AA 2KQ6A 5TNCA 5HYDA 2KSPA 2F33A 2EC6B 1ZUZA 2M9GA 1YR5A 2TN4A 1KQMB 2LUCA 1XFYO 2LE9B 3EK7A 2ZRSA 3SS5A 2MHHA 5GQQC 1KFUS 4D1EA 1EXRA 1PK0D 2L5YA 3D10A 3DZTA 3IVTA 3NSLA 2VRGA 3I5HB 3IQQA 4HSZA 2JRFA 2JT3A 4CPVA 4E68A 2COLB 2P71A 3CR5X 3LK0A 5G08A 2FCDA 3AKAA 3DF0A 3TS5C 1CMGA 1WRLA 5DKNA 2CBLA 2JULA 4DUQA 4FQOA 2FJYA 2PVBA 3FE8A 3DD4A 4GNKB 1LS8A 1ZACA 1L2OC 1IKUA 4ORAB 2L5XB 4INWA 3NGVA 4M2OA 4NDCA 1GGZA 1AUIB 1KCYA 4OV2A 1FI5A 2BCAA 2LLSA 1NWDA 1WY9A 3PSRA 2I94A 4XYNA 2M1UA 4F0ZB 1NX0A 3ZNIA 2CNPA 2JXLA 1LA0A 2WCKA 1SL9A 2WORA 1SR6B 3O4YA 1MR8A 1NCZA 1NUBA 1KFXS 1OW4A 2LC5A 2QEVA 3LCPC 4M2PA 4I5LB 1SCMC 1JUOA 2L98A 3CLNA 1CM1A 3BFBA 2KFGA 2G9BA 3RZSA 4DS7A 1B9AA 1K94A 1KWOB 3O4XA 4R1EA 1DJYA 1EG3A 2H8VA 2IS9A 3PALA 2WCJA 1PRWA 3R1PA 3R1VA 2KQYA 1YUSA 4WQ2A 2I18A 1F8HA 1Y1UA 4GGFA 1SCVA 5ER4X 2JC2A 1YX8A 1TNQA 2K7OA 2WOSA 3VGOA 2ERBA 4QJ5B 1TRFA 1S5GZ 2KAXA 4FTGA 4YGAA 1G8IA 1T14A 4HREE 5J3XA 3S0BA 1LA3A 2R2IA 3I5IC 1QASA 1F71A 2BBMA 2JQ6A 4BY4A 4CFQA 1S3PA 1WDCC 1A29A 1KK7Z 2JPTA 3LK1A 1GGWA 2QACA 2YGUA 3TS5B 4GFTA 4ZCUA 3VB1A 1CM4A 1MXEA 5DKRA 4DCKA 3AKBA 2JTZA 2Y4QA 1K9KA 1N0YA 1L2OB 2ZFDA 3BJHA 3EK8A 3PM8A 4MZLA 1SMGA 1C3ZA 3ICBA 2KI6C 3O2PA 3K21A 2Q91A 1R2UA 2SASA 1QIVA 1IQ5A 1PALA 5I8NA 4JD9A 1S1EA 1AJ5A 3CTNA 3D73A 2LMVA 3EG5B 1TUJA 1J7QA 1SBJA 4P5OE 2JNXA 2JOJA 3CZ1A 3DVEA 1AP4A 1IGVA 1CLMA 1WLMA 3CZ0A 5FI2A 2LVIA 1EJ3A 1WLZA 1XFWO 1K2HA 1OMRA 2GTEA 2WC8A 1BOCA 1B7TZ 3M0WA 3FE9A 3CZTX 4TNCA 3EVVA 1TNXA 1M39A 1UP5A 1XFXO 1G33A 1Y1AA 5CSJA 1QXPA 1M63B 1TUZA 1UURA 2CXJA 4FQTA 1C7VA 1QLSA 1DELA 1DJGA 1F70A 2DOQA 4GUKA 4PDZA 4I5NB 1CDMA 3OBVA 1FPWA 1QJTA 2K2FA 2WC5A 3B7AA 3CYZA 2BKIB 2ISDA 1A75A 3I5IB 4YGBB 4PHMA 1OZSA 4MRXA 3TZ1A 1JSAA 5KU1A 3L4LA 2JT8A 1WDCB 5HL1A 2LP3A 1FI6A 4C0KA 1CTRA 2M3WA 3BOWB 3I5GC 1V1FA 4ZCVA 2KFFA 4GGFC 2L4IA 3FWCA 1QVIY 2A4JA 1BU3A 2QEOA 1PSRA 4PCWA 2KGBC 1TCOB 4OVNF 1OSAA 2JPOA 5PALA 1YVLA 1TWOA 3LL8B 3CABA 1QX5B 1ORGA 4CLNA 1UHKA 1XO5A 1QLKA 5FI6A 1A03A 5AEQA 2KYCA 1JC2A 3DXLA 2MRDA 3DVKA 3JVTC 3DF0B 5HKYA 1BODA 5I2OA 1DMOA 3CDNA 4PE4A 5I94A 4ORBB 3WHUB 1B1GA 2PASA 1B4CA 2GGZA 2HPSA 3CGAA 4YI8A 1NYAA 3VROA 1H4BA 1JF0A 2JTTA 5FYXA 1TN4A 1EH2A 3L4AA 1F4OA 3CS1A 1CMFA 1DJZA 3BQ3A 1PULA 2JZIA 2SCPA 1BF5A 1SK6D 3HX4A 1XYDA 1RROA 2PMYA 2AUCA 2OS8C 1YX7A 3NSOA 1F54A 2WNDA 2F2PA 2MJWB 2NCOA 3CR4X 2KNEA 5D7FA 2FCEA 3OX5A 2M7LA 3TUYC 3VRNA 1IG5A 4YRUA 2Y5IA 2AMIA 3OGNA 3RM1A 1M45A 2F3YA 1QS7A 3I5GB 4MLWA 1TNWA 2RGIA 2NCPA 1AK8A 2CCMA 2LVVA 1OOFA 2KAYA 5K89A 2K7DA 4YI9A 2P6BB 3KHEA 1NX1A 1NPQA 4I5JA 2K8MB 5BPJA 1K9UA 1S36A 2KPHA 2WCBA 1DTLA 3AAKA 4KYNA 2QEHA 3SIBA 4M2QA 2B1UA 1W7IB 2GV5A 3BUWB 4OKHA 1PSBA 2ZNDA 1GJYA 5HLVA 4CIDA 3JVTB 3S0GA 4F7FA 5D3OA 3SG2A 2ZNEA 1YTZC 3SIAA 3N7HA 1ZMZA 3D75A 2BECA 1J55A 2LV7A 4A4CA 1RTP1 2L4HA 4JPZB 1L7ZA 2CT9A 1FW4A 2E6WA 2LMUA 1NP8A 2NXQA 3PFVA 1X02A 2BAPA 2FOTA 4ETOA 4MZKA
chains in the Genus database with same CATH topology
3SG6A 1IJ6A 1TNPA 1R6PA 4JQ0D 1SNLA 1QX2A 4MZJA 3TDIA 1KK8C 1CFDA 1XFVO 1OMVA 3PLFB 1S6IA 5CSIA 2QPTA 1ZFSA 1YRUB 3PN7C 4Q04A 1JWDA 1J7RA 3OB1B 3BYAA 1J1EA 1DJIA 5CPVA 5CSNA 1D1OA 3TUYB 1TOPA 2Y1MA 1S5GY 2M1KB 3O6BA 1A4PA 2LUXA 3KO0A 4NDDA 3WXAA 2JWWA 1UHNA 4L9MA 1U5IB 1DGUA 1TCFA 4JWQA 1DT7B 3SG7A 4GAOA 4PHKA 1IRJA 3IF7A 4HRHA 1DGVA 3I5FC 1XFUO 1K95A 3JTDC 1YVHA 5AXIA 3GOFA 1SCMB 2WCEA 4MBEA 1MWNA 4AQJA 4PALA 1QV0A 1GQMA 3MSEB 1IJ5A 2BCBA 2EHBA 1VRKA 3FIAA 3NSIA 4MRYA 3SG3A 1MHOA 4AOMA 2G2BA 1C7WA 1E8AA 2ZN9A 2ZRTA 2M7NA 4MEWA 2O60A 2M8UA 1K96A 1SW8A 1BLQA 3CWGA 3OHMB 3LLEA 3KPXA 4P2YB 2LANA 4N1FA 2LP2A 2LHIA 4I5KA 4U8DA 1KQMC 1KK8B 4ICBA 1M31A 1YUTA 3H4SE 1NCXA 1DVIA 4MVFA 3I5HC 5JOLA 4PE0A 2JU0A 3PN7B 1KSOA 1KQVA 5ER5A 2MAZA 2LLTA 1FBVA 2JNFA 3VRRA 5AERA 5AFPA 1CDPA 3BUNB 1LINA 5B8IB 2E30A 2MLFC 1QATA 1Y1XA 3NXAA 3F45A 1BT6A 1CFCA 3I5FB 2KGRA 1MF8B 1OMDA 3JTDB 1TIZA 1Y6WA 3EVUA 1YURA 4PE7A 2F3ZA 2NLNA 3E3RA 1DJWA 2LAPA 4PHJA 2M97A 1UHHA 2M29A 4BY5A 1H8BA 1SR6C 1K9PA 1B8CA 2LNKA 1Q80A 1CFPA 1SYMA 4N1GA 1Y0VH 4PHNA 3OP0A 1CLLA 3OX6A 5HLOA 1S26D 1AVSA 2PALA 1OOJA 4XJKA 5IBWA 3FWBA 2LCPA 1QIWA 3SG4A 1DJHA 2MLEC 1N2DA 5F6TA 1IH0A 2MBXA 3O78A 2KHNA 1B8RA 2K61A 1SRAA 3IQOA 1MUXA 2L2EA 1EG4A 1ALWA 1YRTB 3D0YA 1BR4B 2H61A 2V53A 4WQ3A 1FF1A 2KDHA 1DF0A 4N5XA 2HF5A 3PATA 1K90D 1JFKA 3DVMA 5CSFA 3AAJA 2F8PA 1BR1B 1LVCD 2Y1NA 5AANA 3SG5A 3BUOB 4C0JA 1XVJA 4UPGA 1QV1A 1UUSA 4AQIA 1CFFA 5JJGA 1UWOA 1S6CA 1IQ3A 2JXCA 4PE1A 2ZKMX 3EVRA 2L50A 2L51A 2ZN8A 1BG1A 3OB2B 2KBMA 1XK4A 4HRGA 2KI4C 4C0LA 5HKZA 4MSPA 3EKHA 1HT9A 1CB1A 2OPOA 2F2OA 1DJXA 1RK9A 1M46A 3NSKA 5KSZA 1V1GA 4ORCB 1MQ1A 1QTXA 1UHIA 4YGDB 4MN0A 1SY9A 1NIWA 1KFUL 4IL1A 2O5GA 2BL0C 2OS8B 2M0RA 2KYFA 3GK2A 4GBAA 4GPLB 1K8UA 2PSRA 3FS7A 1K93D 2BCXA 1LKJA 1CDLA 2LHLA 4DRWA 5KTYA 1JBAA 3HCMA 3WNXB 2KFHA 1RWYA 1IWQA 1AHRA 2K0JA 3TDUA 1LXFC 1KK7Y 1G4YR 2I2RE 3DVJA 5HKWA 1A75B 2HQWA 1B8LA 5DKQA 1SL7A 2BKHB 1SPYA 1QX7A 1WRKA 5D69A 2KBIA 1TTXA 2OTGC 1N65A 1JFJA 4CFRA 1KFXL 1JF2A 2AAOA 2BBNA 1RFJA 1C07A 3A8RA 1ALVA 1CKKA 1PVBA 3EKJA 4WRIA 1F55A 2BE6A 3WHTB 1ZOTB 2CTNA 2H61C 1NSHA 2KI4B 2LM5A 2LVJA 2KOTA 1OE9B 2WCFA 3KF9A 1NCYA 3EK4A 2PRUA 2EC6C 2KAVA 4NDBA 3ZWHA 1CLBA 1PVAA 1B7TY 1S6JA 3TDZA 1BJFA 1XFZO 3VRPA 5I2QA 1SL8A 2BL0B 1RJVA 1XA5A 4YGCB 2LLUA 2NZ0A 1UHJA 4YBHB 2K7CA 1QVIZ 1U5IA 1CNPA 1CDNA 1XK4C 2FJUB 2LMTA 1OQPA 2KI6D 2GGMA 1NX3A 1J1DA 3VRQA 2JT0A 2HQ8A 1J7PA 4A4BA 1HQVA 1MXLC 4GGNA 4DIRA 2BE4A 3QRXA 1OZOA 1RECA 1YUUA 3C1VA 3A4UB 1AJ4A 2K7BA 1A2XA 4XJKB 4QJ4B 5I2LA 2H2KA 1W7JB 2I7AA 2L0PA 3BUMB 3RLZA 2EGDA 1J7OA 2OTGB 3CR2A 4USLA 4NQGA 1F4QA 4QJ3B 2D8NA 2Q4UA 3SJSA 4OCIA 3GK4X 1SKTA 3BXKA 1KSMA 4YGEB 1EL4A 3BUXB 1B47A 2MA2A 1ODBA 3GK1A 4OR9B 2HETA 1WRZA 3D0YB 1KWOC 1BMOA 3KEVA 1DF0B 2LVKA 1NX2A 2M49B 3BOWA 2K2AA 2KQ6A 5TNCA 5HYDA 2KSPA 2F33A 2EC6B 1ZUZA 2M9GA 1YR5A 2TN4A 1KQMB 2LUCA 1XFYO 2LE9B 3EK7A 2ZRSA 2MHHA 5GQQC 1KFUS 4D1EA 1EXRA 1PK0D 3D10A 3NSLA 2VRGA 3I5HB 3IQQA 4HSZA 2JRFA 2JT3A 4CPVA 4E68A 2COLB 3CR5X 5G08A 3LK0A 2FCDA 3AKAA 3DF0A 3TS5C 1CMGA 1WRLA 5DKNA 2CBLA 2JULA 4DUQA 4FQOA 2PVBA 3DD4A 4GNKB 1IKUA 1ZACA 1L2OC 4ORAB 2L5XB 4M2OA 4NDCA 1GGZA 1AUIB 1KCYA 4OV2A 1FI5A 2BCAA 2LLSA 1NWDA 1WY9A 3PSRA 2I94A 4XYNA 2M1UA 4F0ZB 1NX0A 3ZNIA 2CNPA 2JXLA 1LA0A 1SL9A 2WORA 1SR6B 3O4YA 1MR8A 1NCZA 1NUBA 1KFXS 2LC5A 3LCPC 4M2PA 4I5LB 1SCMC 1JUOA 2L98A 3CLNA 1CM1A 2KFGA 2G9BA 4DS7A 1B9AA 1K94A 1KWOB 4R1EA 1DJYA 1EG3A 2IS9A 3PALA 1PRWA 2KQYA 1YUSA 4WQ2A 2I18A 1F8HA 1Y1UA 4GGFA 1SCVA 5ER4X 2JC2A 1YX8A 1TNQA 2K7OA 2WOSA 3VGOA 4QJ5B 1TRFA 1S5GZ 2KAXA 4FTGA 4YGAA 1G8IA 4HREE 5J3XA 1LA3A 2R2IA 3I5IC 1QASA 1F71A 2BBMA 2JQ6A 4BY4A 4CFQA 1S3PA 1WDCC 1A29A 1KK7Z 2JPTA 3LK1A 1GGWA 2QACA 3TS5B 4GFTA 4ZCUA 1CM4A 1MXEA 5DKRA 4DCKA 3AKBA 2JTZA 2Y4QA 1K9KA 1N0YA 1L2OB 2ZFDA 3EK8A 3PM8A 4MZLA 1SMGA 3ICBA 2KI6C 3O2PA 3K21A 2Q91A 1R2UA 2SASA 1QIVA 1IQ5A 1PALA 5I8NA 1S1EA 1AJ5A 3CTNA 2LMVA 1J7QA 1SBJA 4P5OE 2JNXA 2JOJA 3DVEA 1AP4A 1IGVA 1CLMA 1WLMA 2LVIA 1EJ3A 1WLZA 1XFWO 1K2HA 1OMRA 2WC8A 1BOCA 1B7TZ 3M0WA 3CZTX 4TNCA 3EVVA 1TNXA 1M39A 1UP5A 1XFXO 1G33A 1Y1AA 5CSJA 1QXPA 1M63B 1UURA 2CXJA 1C7VA 1QLSA 1DJGA 1F70A 2DOQA 4GUKA 4PDZA 4I5NB 1CDMA 1FPWA 1QJTA 2K2FA 2BKIB 2ISDA 1A75A 3I5IB 4YGBB 4PHMA 1OZSA 4MRXA 3TZ1A 1JSAA 5KU1A 2JT8A 1WDCB 2LP3A 1FI6A 4C0KA 1CTRA 2M3WA 3BOWB 3I5GC 1V1FA 4ZCVA 2KFFA 4GGFC 2L4IA 3FWCA 1QVIY 2A4JA 1BU3A 1PSRA 4PCWA 2KGBC 1TCOB 4OVNF 1OSAA 5PALA 1YVLA 3LL8B 1QX5B 4CLNA 1UHKA 1XO5A 1QLKA 1A03A 1JC2A 5AEQA 2KYCA 2MRDA 3DVKA 3JVTC 3DF0B 5HKYA 1BODA 5I2OA 1DMOA 4PE4A 4ORBB 3WHUB 1B1GA 2PASA 1B4CA 2GGZA 2HPSA 3CGAA 4YI8A 1NYAA 3VROA 1H4BA 1JF0A 2JTTA 5FYXA 1TN4A 1EH2A 1CMFA 1F4OA 3CS1A 1DJZA 3BQ3A 1PULA 2JZIA 2SCPA 1BF5A 1SK6D 3HX4A 1XYDA 1RROA 2PMYA 2AUCA 2OS8C 1YX7A 3NSOA 1F54A 2WNDA 2F2PA 2MJWB 2NCOA 3CR4X 2KNEA 5D7FA 2FCEA 3OX5A 2M7LA 3TUYC 3VRNA 1IG5A 4YRUA 2Y5IA 2AMIA 3RM1A 1M45A 2F3YA 1QS7A 3I5GB 4MLWA 1TNWA 2RGIA 2NCPA 1AK8A 2CCMA 2LVVA 2KAYA 5K89A 2K7DA 4YI9A 2P6BB 3KHEA 1NX1A 1NPQA 4I5JA 2K8MB 5BPJA 1K9UA 1S36A 2WCBA 1DTLA 3AAKA 3SIBA 4M2QA 2B1UA 1W7IB 2GV5A 3BUWB 4OKHA 1PSBA 2ZNDA 1GJYA 5HLVA 4CIDA 3JVTB 3SG2A 2ZNEA 1YTZC 3SIAA 1ZMZA 2BECA 1J55A 2LV7A 4A4CA 1RTP1 2L4HA 4JPZB 1L7ZA 2CT9A 1FW4A 2E6WA 2LMUA 1NP8A 2NXQA 3PFVA 1X02A 2FOTA 4ETOA 4MZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG6 A;  1IJ6 A;  1TNP A;  1R6P A;  4JQ0 D;  1SNL A;  1QX2 A;  4MZJ A;  3TDI A;  1KK8 C;  1CFD A;  1XFV O;  1OMV A;  3PLF B;  1S6I A;  5CSI A;  2QPT A;  1ZFS A;  1YRU B;  3PN7 C;  4Q04 A;  1JWD A;  1J7R A;  3OB1 B;  3BYA A;  1J1E A;  1DJI A;  5CPV A;  5CSN A;  1D1O A;  3TUY B;  1TOP A;  2Y1M A;  1S5G Y;  2M1K B;  3O6B A;  1A4P A;  2LUX A;  3KO0 A;  4NDD A;  3WXA A;  2JWW A;  1UHN A;  4L9M A;  1U5I B;  1DGU A;  1TCF A;  4JWQ A;  1DT7 B;  3SG7 A;  4GAO A;  4PHK A;  1IRJ A;  3IF7 A;  4HRH A;  1DGV A;  3I5F C;  1XFU O;  1K95 A;  3JTD C;  1YVH A;  5AXI A;  3GOF A;  1SCM B;  2WCE A;  4MBE A;  1MWN A;  4AQJ A;  4PAL A;  1QV0 A;  1GQM A;  3MSE B;  1IJ5 A;  2BCB A;  2EHB A;  1VRK A;  3FIA A;  3NSI A;  4MRY A;  3SG3 A;  1MHO A;  4AOM A;  2G2B A;  1C7W A;  1E8A A;  2ZN9 A;  2ZRT A;  2M7N A;  4MEW A;  2O60 A;  2M8U A;  1K96 A;  1SW8 A;  1BLQ A;  3CWG A;  3OHM B;  3LLE A;  3KPX A;  4P2Y B;  2LAN A;  4N1F A;  2LP2 A;  2LHI A;  4I5K A;  4U8D A;  1KQM C;  1KK8 B;  4ICB A;  1M31 A;  1YUT A;  3H4S E;  1NCX A;  1DVI A;  4MVF A;  3I5H C;  5JOL A;  4PE0 A;  2JU0 A;  3PN7 B;  1KSO A;  1KQV A;  5ER5 A;  2MAZ A;  2LLT A;  1FBV A;  2JNF A;  3VRR A;  5AER A;  5AFP A;  1CDP A;  3BUN B;  1LIN A;  5B8I B;  2E30 A;  2MLF C;  1QAT A;  1Y1X A;  3NXA A;  3F45 A;  1BT6 A;  1CFC A;  3I5F B;  2KGR A;  1MF8 B;  1OMD A;  3JTD B;  1TIZ A;  1Y6W A;  3EVU A;  1YUR A;  4PE7 A;  2F3Z A;  2NLN A;  3E3R A;  1DJW A;  2LAP A;  4PHJ A;  2M97 A;  1UHH A;  2M29 A;  4BY5 A;  1H8B A;  1SR6 C;  1K9P A;  1B8C A;  2LNK A;  1Q80 A;  1CFP A;  1SYM A;  4N1G A;  1Y0V H;  4PHN A;  3OP0 A;  1CLL A;  3OX6 A;  5HLO A;  1S26 D;  1AVS A;  2PAL A;  1OOJ A;  4XJK A;  5IBW A;  3FWB A;  2LCP A;  1QIW A;  3SG4 A;  1DJH A;  2MLE C;  1N2D A;  5F6T A;  1IH0 A;  2MBX A;  3O78 A;  2KHN A;  1B8R A;  2K61 A;  1SRA A;  3IQO A;  1MUX A;  2L2E A;  1EG4 A;  1ALW A;  1YRT B;  3D0Y A;  1BR4 B;  2H61 A;  2V53 A;  4WQ3 A;  1FF1 A;  2KDH A;  1DF0 A;  4N5X A;  2HF5 A;  3PAT A;  1K90 D;  1JFK A;  3DVM A;  5CSF A;  3AAJ A;  2F8P A;  1BR1 B;  1LVC D;  2Y1N A;  5AAN A;  3SG5 A;  3BUO B;  4C0J A;  1XVJ A;  4UPG A;  1QV1 A;  1UUS A;  4AQI A;  1CFF A;  5JJG A;  1UWO A;  1S6C A;  1IQ3 A;  2JXC A;  4PE1 A;  2ZKM X;  3EVR A;  2L50 A;  2L51 A;  2ZN8 A;  1BG1 A;  3OB2 B;  2KBM A;  1XK4 A;  4HRG A;  2KI4 C;  4C0L A;  5HKZ A;  4MSP A;  3EKH A;  1HT9 A;  1CB1 A;  2OPO A;  2F2O A;  1DJX A;  1RK9 A;  1M46 A;  3NSK A;  5KSZ A;  1V1G A;  4ORC B;  1MQ1 A;  1QTX A;  1UHI A;  4YGD B;  4MN0 A;  1SY9 A;  1NIW A;  1KFU L;  4IL1 A;  2O5G A;  2BL0 C;  2OS8 B;  2M0R A;  2KYF A;  3GK2 A;  4GBA A;  4GPL B;  1K8U A;  2PSR A;  3FS7 A;  1K93 D;  2BCX A;  1LKJ A;  1CDL A;  2LHL A;  4DRW A;  5KTY A;  1JBA A;  3HCM A;  3WNX B;  2KFH A;  1RWY A;  1IWQ A;  1AHR A;  2K0J A;  3TDU A;  1LXF C;  1KK7 Y;  1G4Y R;  2I2R E;  3DVJ A;  5HKW A;  1A75 B;  2HQW A;  1B8L A;  5DKQ A;  1SL7 A;  2BKH B;  1SPY A;  1QX7 A;  1WRK A;  5D69 A;  2KBI A;  1TTX A;  2OTG C;  1N65 A;  1JFJ A;  4CFR A;  1KFX L;  1JF2 A;  2AAO A;  2BBN A;  1RFJ A;  1C07 A;  3A8R A;  1ALV A;  1CKK A;  1PVB A;  3EKJ A;  4WRI A;  1F55 A;  2BE6 A;  3WHT B;  1ZOT B;  2CTN A;  2H61 C;  1NSH A;  2KI4 B;  2LM5 A;  2LVJ A;  2KOT A;  1OE9 B;  2WCF A;  3KF9 A;  1NCY A;  3EK4 A;  2PRU A;  2EC6 C;  2KAV A;  4NDB A;  3ZWH A;  1CLB A;  1PVA A;  1B7T Y;  1S6J A;  3TDZ A;  1BJF A;  1XFZ O;  3VRP A;  5I2Q A;  1SL8 A;  2BL0 B;  1RJV A;  1XA5 A;  4YGC B;  2LLU A;  2NZ0 A;  1UHJ A;  4YBH B;  2K7C A;  1QVI Z;  1U5I A;  1CNP A;  1CDN A;  1XK4 C;  2FJU B;  2LMT A;  1OQP A;  2KI6 D;  2GGM A;  1NX3 A;  1J1D A;  3VRQ A;  2JT0 A;  2HQ8 A;  1J7P A;  4A4B A;  1HQV A;  1MXL C;  4GGN A;  4DIR A;  2BE4 A;  3QRX A;  1OZO A;  1REC A;  1YUU A;  3C1V A;  3A4U B;  1AJ4 A;  2K7B A;  1A2X A;  4XJK B;  4QJ4 B;  5I2L A;  2H2K A;  1W7J B;  2I7A A;  2L0P A;  3BUM B;  3RLZ A;  2EGD A;  1J7O A;  2OTG B;  3CR2 A;  4USL A;  4NQG A;  1F4Q A;  4QJ3 B;  2D8N A;  2Q4U A;  3SJS A;  4OCI A;  3GK4 X;  1SKT A;  3BXK A;  1KSM A;  4YGE B;  1EL4 A;  3BUX B;  1B47 A;  2MA2 A;  1ODB A;  3GK1 A;  4OR9 B;  2HET A;  1WRZ A;  3D0Y B;  1KWO C;  1BMO A;  3KEV A;  1DF0 B;  2LVK A;  1NX2 A;  2M49 B;  3BOW A;  2K2A A;  2KQ6 A;  5TNC A;  5HYD A;  2KSP A;  2F33 A;  2EC6 B;  1ZUZ A;  2M9G A;  1YR5 A;  2TN4 A;  1KQM B;  2LUC A;  1XFY O;  2LE9 B;  3EK7 A;  2ZRS A;  2MHH A;  5GQQ C;  1KFU S;  4D1E A;  1EXR A;  1PK0 D;  3D10 A;  3NSL A;  2VRG A;  3I5H B;  3IQQ A;  4HSZ A;  2JRF A;  2JT3 A;  4CPV A;  4E68 A;  2COL B;  3CR5 X;  5G08 A;  3LK0 A;  2FCD A;  3AKA A;  3DF0 A;  3TS5 C;  1CMG A;  1WRL A;  5DKN A;  2CBL A;  2JUL A;  4DUQ A;  4FQO A;  2PVB A;  3DD4 A;  4GNK B;  1IKU A;  1ZAC A;  1L2O C;  4ORA B;  2L5X B;  4M2O A;  4NDC A;  1GGZ A;  1AUI B;  1KCY A;  4OV2 A;  1FI5 A;  2BCA A;  2LLS A;  1NWD A;  1WY9 A;  3PSR A;  2I94 A;  4XYN A;  2M1U A;  4F0Z B;  1NX0 A;  3ZNI A;  2CNP A;  2JXL A;  1LA0 A;  1SL9 A;  2WOR A;  1SR6 B;  3O4Y A;  1MR8 A;  1NCZ A;  1NUB A;  1KFX S;  2LC5 A;  3LCP C;  4M2P A;  4I5L B;  1SCM C;  1JUO A;  2L98 A;  3CLN A;  1CM1 A;  2KFG A;  2G9B A;  4DS7 A;  1B9A A;  1K94 A;  1KWO B;  4R1E A;  1DJY A;  1EG3 A;  2IS9 A;  3PAL A;  1PRW A;  2KQY A;  1YUS A;  4WQ2 A;  2I18 A;  1F8H A;  1Y1U A;  4GGF A;  1SCV A;  5ER4 X;  2JC2 A;  1YX8 A;  1TNQ A;  2K7O A;  2WOS A;  3VGO A;  4QJ5 B;  1TRF A;  1S5G Z;  2KAX A;  4FTG A;  4YGA A;  1G8I A;  4HRE E;  5J3X A;  1LA3 A;  2R2I A;  3I5I C;  1QAS A;  1F71 A;  2BBM A;  2JQ6 A;  4BY4 A;  4CFQ A;  1S3P A;  1WDC C;  1A29 A;  1KK7 Z;  2JPT A;  3LK1 A;  1GGW A;  2QAC A;  3TS5 B;  4GFT A;  4ZCU A;  1CM4 A;  1MXE A;  5DKR A;  4DCK A;  3AKB A;  2JTZ A;  2Y4Q A;  1K9K A;  1N0Y A;  1L2O B;  2ZFD A;  3EK8 A;  3PM8 A;  4MZL A;  1SMG A;  3ICB A;  2KI6 C;  3O2P A;  3K21 A;  2Q91 A;  1R2U A;  2SAS A;  1QIV A;  1IQ5 A;  1PAL A;  5I8N A;  1S1E A;  1AJ5 A;  3CTN A;  2LMV A;  1J7Q A;  1SBJ A;  4P5O E;  2JNX A;  2JOJ A;  3DVE A;  1AP4 A;  1IGV A;  1CLM A;  1WLM A;  2LVI A;  1EJ3 A;  1WLZ A;  1XFW O;  1K2H A;  1OMR A;  2WC8 A;  1BOC A;  1B7T Z;  3M0W A;  3CZT X;  4TNC A;  3EVV A;  1TNX A;  1M39 A;  1UP5 A;  1XFX O;  1G33 A;  1Y1A A;  5CSJ A;  1QXP A;  1M63 B;  1UUR A;  2CXJ A;  1C7V A;  1QLS A;  1DJG A;  1F70 A;  2DOQ A;  4GUK A;  4PDZ A;  4I5N B;  1CDM A;  1FPW A;  1QJT A;  2K2F A;  2BKI B;  2ISD A;  1A75 A;  3I5I B;  4YGB B;  4PHM A;  1OZS A;  4MRX A;  3TZ1 A;  1JSA A;  5KU1 A;  2JT8 A;  1WDC B;  2LP3 A;  1FI6 A;  4C0K A;  1CTR A;  2M3W A;  3BOW B;  3I5G C;  1V1F A;  4ZCV A;  2KFF A;  4GGF C;  2L4I A;  3FWC A;  1QVI Y;  2A4J A;  1BU3 A;  1PSR A;  4PCW A;  2KGB C;  1TCO B;  4OVN F;  1OSA A;  5PAL A;  1YVL A;  3LL8 B;  1QX5 B;  4CLN A;  1UHK A;  1XO5 A;  1QLK A;  1A03 A;  1JC2 A;  5AEQ A;  2KYC A;  2MRD A;  3DVK A;  3JVT C;  3DF0 B;  5HKY A;  1BOD A;  5I2O A;  1DMO A;  4PE4 A;  4ORB B;  3WHU B;  1B1G A;  2PAS A;  1B4C A;  2GGZ A;  2HPS A;  3CGA A;  4YI8 A;  1NYA A;  3VRO A;  1H4B A;  1JF0 A;  2JTT A;  5FYX A;  1TN4 A;  1EH2 A;  1CMF A;  1F4O A;  3CS1 A;  1DJZ A;  3BQ3 A;  1PUL A;  2JZI A;  2SCP A;  1BF5 A;  1SK6 D;  3HX4 A;  1XYD A;  1RRO A;  2PMY A;  2AUC A;  2OS8 C;  1YX7 A;  3NSO A;  1F54 A;  2WND A;  2F2P A;  2MJW B;  2NCO A;  3CR4 X;  2KNE A;  5D7F A;  2FCE A;  3OX5 A;  2M7L A;  3TUY C;  3VRN A;  1IG5 A;  4YRU A;  2Y5I A;  2AMI A;  3RM1 A;  1M45 A;  2F3Y A;  1QS7 A;  3I5G B;  4MLW A;  1TNW A;  2RGI A;  2NCP A;  1AK8 A;  2CCM A;  2LVV A;  2KAY A;  5K89 A;  2K7D A;  4YI9 A;  2P6B B;  3KHE A;  1NX1 A;  1NPQ A;  4I5J A;  2K8M B;  5BPJ A;  1K9U A;  1S36 A;  2WCB A;  1DTL A;  3AAK A;  3SIB A;  4M2Q A;  2B1U A;  1W7I B;  2GV5 A;  3BUW B;  4OKH A;  1PSB A;  2ZND A;  1GJY A;  5HLV A;  4CID A;  3JVT B;  3SG2 A;  2ZNE A;  1YTZ C;  3SIA A;  1ZMZ A;  2BEC A;  1J55 A;  2LV7 A;  4A4C A;  1RTP 1;  2L4H A;  4JPZ B;  1L7Z A;  2CT9 A;  1FW4 A;  2E6W A;  2LMU A;  1NP8 A;  2NXQ A;  3PFV A;  1X02 A;  2FOT A;  4ETO A;  4MZK A; 
#chains in the Genus database with same CATH topology
 3SG6 A;  1IJ6 A;  1TNP A;  1R6P A;  4JQ0 D;  1SNL A;  1QX2 A;  4MZJ A;  3PM2 A;  3TDI A;  1KK8 C;  1CFD A;  1XFV O;  1OMV A;  3PLF B;  1S6I A;  5CSI A;  2WCH A;  3UO9 A;  2QPT A;  1ZFS A;  1YRU B;  3PN7 C;  4Q04 A;  1JWD A;  3D77 A;  1J7R A;  3OB1 B;  3BYA A;  1J1E A;  1DJI A;  4OZD A;  5CPV A;  5CSN A;  1DC1 A;  1D1O A;  3BFA A;  3TUY B;  1TOP A;  2Y1M A;  4INX A;  1S5G Y;  2M1K B;  3O6B A;  1A4P A;  2LUX A;  3KO0 A;  4NDD A;  3WXA A;  2JWW A;  1UHN A;  4L9M A;  1U5I B;  1DGU A;  1TCF A;  4JWQ A;  3S0F A;  1DT7 B;  3SG7 A;  2K60 A;  4GAO A;  4PHK A;  1IRJ A;  3IF7 A;  4HRH A;  1DGV A;  3I5F C;  1XFU O;  1K95 A;  3JTD C;  1YVH A;  5AXI A;  3SS3 A;  3GOF A;  1SCM B;  3V2L A;  2WCE A;  4MBE A;  1MWN A;  3NHI A;  4PAL A;  4AQJ A;  1QV0 A;  1GQM A;  3MSE B;  1IJ5 A;  1OOG A;  2BCB A;  2EHB A;  1VRK A;  3FIA A;  3NSI A;  4MRY A;  3SG3 A;  1MHO A;  2KLD A;  3B6X A;  3UNW A;  4AOM A;  3NHT A;  2G2B A;  1C7W A;  1E8A A;  2ZN9 A;  2ZRT A;  2M7N A;  4MEW A;  2O60 A;  2M8U A;  1K96 A;  1SW8 A;  1BLQ A;  3CWG A;  3OHM B;  3LLE A;  3KPX A;  4P2Y B;  2LAN A;  4N1F A;  2WCM A;  2QDI A;  3CZ2 A;  2LP2 A;  2LHI A;  4I5K A;  4U8D A;  1KQM C;  1KK8 B;  4ICB A;  1M31 A;  2L2C A;  1YUT A;  3H4S E;  1NCX A;  1DVI A;  4MVF A;  3I5H C;  5JOL A;  3SS4 A;  4PE0 A;  2JU0 A;  3PN7 B;  1KSO A;  1KQV A;  3PJI A;  5ER5 A;  2MAZ A;  2LLT A;  1FBV A;  2JNF A;  3B87 A;  3VRR A;  5AER A;  5AFP A;  1CDP A;  3BUN B;  1LIN A;  5B8I B;  2E30 A;  2MLF C;  2PYQ A;  1QAT A;  1Y1X A;  1DEK A;  3F45 A;  1BT6 A;  3NXA A;  1CFC A;  3I5F B;  2KGR A;  1MF8 B;  1OMD A;  3JTD B;  4JKT A;  1TIZ A;  1Y6W A;  3EVU A;  1YUR A;  3R1O A;  2F3Z A;  2NLN A;  3E3R A;  1DJW A;  2LAP A;  4PE7 A;  2M97 A;  4PHJ A;  5FI7 A;  1UHH A;  2M29 A;  4BY5 A;  1H8B A;  1SR6 C;  3L47 A;  1K9P A;  1B8C A;  2LNK A;  1W9Z A;  1Q80 A;  1CFP A;  1SYM A;  4N1G A;  1Y0V H;  3D78 A;  5EL2 A;  4PHN A;  3QME A;  3OP0 A;  1CLL A;  3S0E A;  3OX6 A;  5HLO A;  1S26 D;  1AVS A;  2PAL A;  1OOJ A;  4XJK A;  5IBW A;  3FWB A;  2LCP A;  1QIW A;  3SG4 A;  1DJH A;  2MLE C;  1N2D A;  5F6T A;  1IH0 A;  2MBX A;  3O78 A;  2KHN A;  1B8R A;  2K61 A;  1SRA A;  3IQO A;  1MUX A;  2L2E A;  1P28 A;  1EG4 A;  1ALW A;  1YRT B;  3D0Y A;  1BR4 B;  2H61 A;  2V53 A;  4WQ3 A;  3Q8I A;  2KDH A;  1FF1 A;  1DF0 A;  2BNX A;  4N5X A;  2HF5 A;  3PAT A;  1K90 D;  1JFK A;  3DVM A;  5CSF A;  3AAJ A;  2F8P A;  1BR1 B;  1LVC D;  2Y1N A;  5AAN A;  3SG5 A;  3BUO B;  4C0J A;  1XVJ A;  4UPG A;  1QV1 A;  1UUS A;  4AQI A;  1CFF A;  5JJG A;  1UWO A;  1S6C A;  1IQ3 A;  2JXC A;  4PE1 A;  2ZKM X;  3EVR A;  3S0D A;  2L50 A;  2L51 A;  2ZN8 A;  2PQL A;  1BG1 A;  3OB2 B;  2KBM A;  1XK4 A;  4HRG A;  2KI4 C;  3BFH A;  5HKZ A;  4MSP A;  3EKH A;  1HT9 A;  1QWV A;  2OPO A;  2F2O A;  4C0L A;  1CB1 A;  1DJX A;  1RK9 A;  1M46 A;  3NSK A;  3B86 A;  5KSZ A;  1V1G A;  4ORC B;  1MQ1 A;  1QTX A;  1UHI A;  4YGD B;  4MN0 A;  1SY9 A;  1NIW A;  1KFU L;  4IL1 A;  2O5G A;  2BL0 C;  2OS8 B;  2M0R A;  2KYF A;  3GK2 A;  4GBA A;  3R72 A;  4GPL B;  1K8U A;  2PSR A;  3FS7 A;  3K1E A;  1K93 D;  2BCX A;  1LKJ A;  1CDL A;  2LHL A;  4DRW A;  5KTY A;  1JBA A;  3HCM A;  3D74 A;  2WCL A;  3WNX B;  2KFH A;  1C3Y A;  1Z4H A;  1RWY A;  2WC6 A;  1IWQ A;  1AHR A;  2K0J A;  3TDU A;  1LXF C;  1KK7 Y;  1G4Y R;  2I2R E;  3DVJ A;  5HKW A;  1A75 B;  2HQW A;  1B8L A;  2KLE A;  1SL7 A;  3DY9 A;  5DKQ A;  2BKH B;  1SPY A;  1QX7 A;  1WRK A;  5D69 A;  2KBI A;  1TTX A;  2OTG C;  1N65 A;  5DIC A;  3DYE A;  1JFJ A;  4CFR A;  1KFX L;  1JF2 A;  2AAO A;  2BBN A;  1RFJ A;  1OOI X;  1C07 A;  3A8R A;  1ALV A;  1CKK A;  1PVB A;  3EKJ A;  4WRI A;  1XFR A;  1F55 A;  2BE6 A;  3WHT B;  1ZOT B;  2CTN A;  2H61 C;  3S0A A;  1NSH A;  2KI4 B;  2LM5 A;  2LVJ A;  2KOT A;  1OE9 B;  2WCF A;  3KF9 A;  1NCY A;  3D76 A;  3EK4 A;  2PRU A;  2EC6 C;  2KAV A;  1Z2C B;  4NDB A;  3ZWH A;  1CLB A;  1PVA A;  1B7T Y;  3B88 A;  1IIO A;  1S6J A;  3TDZ A;  1BJF A;  1XFZ O;  3VRP A;  4PT1 A;  5I2Q A;  1SL8 A;  2BL0 B;  1RJV A;  1XA5 A;  4YGC B;  2LLU A;  2NZ0 A;  1UHJ A;  4YBH B;  2K7C A;  1QVI Z;  1U5I A;  1CNP A;  1CDN A;  1SSE B;  1OOH A;  1XK4 C;  2FJU B;  2LMT A;  1OQP A;  2KI6 D;  2P70 A;  2GGM A;  1NX3 A;  1J1D A;  3VRQ A;  2JT0 A;  2HQ8 A;  1J7P A;  4A4B A;  1HQV A;  1MXL C;  4GGN A;  4DIR A;  2BE4 A;  3QRX A;  1OZO A;  1REC A;  1YUU A;  3C1V A;  3A4U B;  1AJ4 A;  2K7B A;  1A2X A;  2QEB A;  4XJK B;  4QJ4 B;  5I2L A;  2H2K A;  1W7J B;  2I7A A;  2L0P A;  3BUM B;  3RLZ A;  2EGD A;  1J7O A;  2OTG B;  3CR2 A;  4USL A;  4NQG A;  1F4Q A;  4QJ3 B;  2D8N A;  2Q4U A;  3SJS A;  4OCI A;  3GK4 X;  1SKT A;  3BXK A;  1KSM A;  3FE6 A;  1EL4 A;  3BUX B;  1B47 A;  4YGE B;  2MA2 A;  1ODB A;  3GK1 A;  4IJ7 A;  1DQE A;  4OR9 B;  2HET A;  1WRZ A;  3D0Y B;  1KWO C;  1BMO A;  3KEV A;  1GM0 A;  1DF0 B;  2LVK A;  1NX2 A;  2M49 B;  3BOW A;  2K2A A;  2KQ6 A;  5TNC A;  5HYD A;  2KSP A;  2F33 A;  2EC6 B;  1ZUZ A;  2M9G A;  1YR5 A;  2TN4 A;  1KQM B;  2LUC A;  1XFY O;  2LE9 B;  3EK7 A;  2ZRS A;  3SS5 A;  2MHH A;  5GQQ C;  1KFU S;  4D1E A;  1EXR A;  1PK0 D;  2L5Y A;  3D10 A;  3DZT A;  3IVT A;  3NSL A;  2VRG A;  3I5H B;  3IQQ A;  4HSZ A;  2JRF A;  2JT3 A;  4CPV A;  4E68 A;  2COL B;  2P71 A;  3CR5 X;  3LK0 A;  5G08 A;  2FCD A;  3AKA A;  3DF0 A;  3TS5 C;  1CMG A;  1WRL A;  5DKN A;  2CBL A;  2JUL A;  4DUQ A;  4FQO A;  2FJY A;  2PVB A;  3FE8 A;  3DD4 A;  4GNK B;  1LS8 A;  1ZAC A;  1L2O C;  1IKU A;  4ORA B;  2L5X B;  4INW A;  3NGV A;  4M2O A;  4NDC A;  1GGZ A;  1AUI B;  1KCY A;  4OV2 A;  1FI5 A;  2BCA A;  2LLS A;  1NWD A;  1WY9 A;  3PSR A;  2I94 A;  4XYN A;  2M1U A;  4F0Z B;  1NX0 A;  3ZNI A;  2CNP A;  2JXL A;  1LA0 A;  2WCK A;  1SL9 A;  2WOR A;  1SR6 B;  3O4Y A;  1MR8 A;  1NCZ A;  1NUB A;  1KFX S;  1OW4 A;  2LC5 A;  2QEV A;  3LCP C;  4M2P A;  4I5L B;  1SCM C;  1JUO A;  2L98 A;  3CLN A;  1CM1 A;  3BFB A;  2KFG A;  2G9B A;  3RZS A;  4DS7 A;  1B9A A;  1K94 A;  1KWO B;  3O4X A;  4R1E A;  1DJY A;  1EG3 A;  2H8V A;  2IS9 A;  3PAL A;  2WCJ A;  1PRW A;  3R1P A;  3R1V A;  2KQY A;  1YUS A;  4WQ2 A;  2I18 A;  1F8H A;  1Y1U A;  4GGF A;  1SCV A;  5ER4 X;  2JC2 A;  1YX8 A;  1TNQ A;  2K7O A;  2WOS A;  3VGO A;  2ERB A;  4QJ5 B;  1TRF A;  1S5G Z;  2KAX A;  4FTG A;  4YGA A;  1G8I A;  1T14 A;  4HRE E;  5J3X A;  3S0B A;  1LA3 A;  2R2I A;  3I5I C;  1QAS A;  1F71 A;  2BBM A;  2JQ6 A;  4BY4 A;  4CFQ A;  1S3P A;  1WDC C;  1A29 A;  1KK7 Z;  2JPT A;  3LK1 A;  1GGW A;  2QAC A;  2YGU A;  3TS5 B;  4GFT A;  4ZCU A;  3VB1 A;  1CM4 A;  1MXE A;  5DKR A;  4DCK A;  3AKB A;  2JTZ A;  2Y4Q A;  1K9K A;  1N0Y A;  1L2O B;  2ZFD A;  3BJH A;  3EK8 A;  3PM8 A;  4MZL A;  1SMG A;  1C3Z A;  3ICB A;  2KI6 C;  3O2P A;  3K21 A;  2Q91 A;  1R2U A;  2SAS A;  1QIV A;  1IQ5 A;  1PAL A;  5I8N A;  4JD9 A;  1S1E A;  1AJ5 A;  3CTN A;  3D73 A;  2LMV A;  3EG5 B;  1TUJ A;  1J7Q A;  1SBJ A;  4P5O E;  2JNX A;  2JOJ A;  3CZ1 A;  3DVE A;  1AP4 A;  1IGV A;  1CLM A;  1WLM A;  3CZ0 A;  5FI2 A;  2LVI A;  1EJ3 A;  1WLZ A;  1XFW O;  1K2H A;  1OMR A;  2GTE A;  2WC8 A;  1BOC A;  1B7T Z;  3M0W A;  3FE9 A;  3CZT X;  4TNC A;  3EVV A;  1TNX A;  1M39 A;  1UP5 A;  1XFX O;  1G33 A;  1Y1A A;  5CSJ A;  1QXP A;  1M63 B;  1TUZ A;  1UUR A;  2CXJ A;  4FQT A;  1C7V A;  1QLS A;  1DEL A;  1DJG A;  1F70 A;  2DOQ A;  4GUK A;  4PDZ A;  4I5N B;  1CDM A;  3OBV A;  1FPW A;  1QJT A;  2K2F A;  2WC5 A;  3B7A A;  3CYZ A;  2BKI B;  2ISD A;  1A75 A;  3I5I B;  4YGB B;  4PHM A;  1OZS A;  4MRX A;  3TZ1 A;  1JSA A;  5KU1 A;  3L4L A;  2JT8 A;  1WDC B;  5HL1 A;  2LP3 A;  1FI6 A;  4C0K A;  1CTR A;  2M3W A;  3BOW B;  3I5G C;  1V1F A;  4ZCV A;  2KFF A;  4GGF C;  2L4I A;  3FWC A;  1QVI Y;  2A4J A;  1BU3 A;  2QEO A;  1PSR A;  4PCW A;  2KGB C;  1TCO B;  4OVN F;  1OSA A;  2JPO A;  5PAL A;  1YVL A;  1TWO A;  3LL8 B;  3CAB A;  1QX5 B;  1ORG A;  4CLN A;  1UHK A;  1XO5 A;  1QLK A;  5FI6 A;  1A03 A;  5AEQ A;  2KYC A;  1JC2 A;  3DXL A;  2MRD A;  3DVK A;  3JVT C;  3DF0 B;  5HKY A;  1BOD A;  5I2O A;  1DMO A;  3CDN A;  4PE4 A;  5I94 A;  4ORB B;  3WHU B;  1B1G A;  2PAS A;  1B4C A;  2GGZ A;  2HPS A;  3CGA A;  4YI8 A;  1NYA A;  3VRO A;  1H4B A;  1JF0 A;  2JTT A;  5FYX A;  1TN4 A;  1EH2 A;  3L4A A;  1F4O A;  3CS1 A;  1CMF A;  1DJZ A;  3BQ3 A;  1PUL A;  2JZI A;  2SCP A;  1BF5 A;  1SK6 D;  3HX4 A;  1XYD A;  1RRO A;  2PMY A;  2AUC A;  2OS8 C;  1YX7 A;  3NSO A;  1F54 A;  2WND A;  2F2P A;  2MJW B;  2NCO A;  3CR4 X;  2KNE A;  5D7F A;  2FCE A;  3OX5 A;  2M7L A;  3TUY C;  3VRN A;  1IG5 A;  4YRU A;  2Y5I A;  2AMI A;  3OGN A;  3RM1 A;  1M45 A;  2F3Y A;  1QS7 A;  3I5G B;  4MLW A;  1TNW A;  2RGI A;  2NCP A;  1AK8 A;  2CCM A;  2LVV A;  1OOF A;  2KAY A;  5K89 A;  2K7D A;  4YI9 A;  2P6B B;  3KHE A;  1NX1 A;  1NPQ A;  4I5J A;  2K8M B;  5BPJ A;  1K9U A;  1S36 A;  2KPH A;  2WCB A;  1DTL A;  3AAK A;  4KYN A;  2QEH A;  3SIB A;  4M2Q A;  2B1U A;  1W7I B;  2GV5 A;  3BUW B;  4OKH A;  1PSB A;  2ZND A;  1GJY A;  5HLV A;  4CID A;  3JVT B;  3S0G A;  4F7F A;  5D3O A;  3SG2 A;  2ZNE A;  1YTZ C;  3SIA A;  3N7H A;  1ZMZ A;  3D75 A;  2BEC A;  1J55 A;  2LV7 A;  4A4C A;  1RTP 1;  2L4H A;  4JPZ B;  1L7Z A;  2CT9 A;  1FW4 A;  2E6W A;  2LMU A;  1NP8 A;  2NXQ A;  3PFV A;  1X02 A;  2BAP A;  2FOT A;  4ETO A;  4MZK A; 
#chains in the Genus database with same CATH homology
 3SG6 A;  1IJ6 A;  1TNP A;  1R6P A;  4JQ0 D;  1SNL A;  1QX2 A;  4MZJ A;  3TDI A;  1KK8 C;  1CFD A;  1XFV O;  1OMV A;  3PLF B;  1S6I A;  5CSI A;  2QPT A;  1ZFS A;  1YRU B;  3PN7 C;  4Q04 A;  1JWD A;  1J7R A;  3OB1 B;  3BYA A;  1J1E A;  1DJI A;  5CPV A;  5CSN A;  1D1O A;  3TUY B;  1TOP A;  2Y1M A;  1S5G Y;  2M1K B;  3O6B A;  1A4P A;  2LUX A;  3KO0 A;  4NDD A;  3WXA A;  2JWW A;  1UHN A;  4L9M A;  1U5I B;  1DGU A;  1TCF A;  4JWQ A;  1DT7 B;  3SG7 A;  4GAO A;  4PHK A;  1IRJ A;  3IF7 A;  4HRH A;  1DGV A;  3I5F C;  1XFU O;  1K95 A;  3JTD C;  1YVH A;  5AXI A;  3GOF A;  1SCM B;  2WCE A;  4MBE A;  1MWN A;  4AQJ A;  4PAL A;  1QV0 A;  1GQM A;  3MSE B;  1IJ5 A;  2BCB A;  2EHB A;  1VRK A;  3FIA A;  3NSI A;  4MRY A;  3SG3 A;  1MHO A;  4AOM A;  2G2B A;  1C7W A;  1E8A A;  2ZN9 A;  2ZRT A;  2M7N A;  4MEW A;  2O60 A;  2M8U A;  1K96 A;  1SW8 A;  1BLQ A;  3CWG A;  3OHM B;  3LLE A;  3KPX A;  4P2Y B;  2LAN A;  4N1F A;  2LP2 A;  2LHI A;  4I5K A;  4U8D A;  1KQM C;  1KK8 B;  4ICB A;  1M31 A;  1YUT A;  3H4S E;  1NCX A;  1DVI A;  4MVF A;  3I5H C;  5JOL A;  4PE0 A;  2JU0 A;  3PN7 B;  1KSO A;  1KQV A;  5ER5 A;  2MAZ A;  2LLT A;  1FBV A;  2JNF A;  3VRR A;  5AER A;  5AFP A;  1CDP A;  3BUN B;  1LIN A;  5B8I B;  2E30 A;  2MLF C;  1QAT A;  1Y1X A;  3NXA A;  3F45 A;  1BT6 A;  1CFC A;  3I5F B;  2KGR A;  1MF8 B;  1OMD A;  3JTD B;  1TIZ A;  1Y6W A;  3EVU A;  1YUR A;  4PE7 A;  2F3Z A;  2NLN A;  3E3R A;  1DJW A;  2LAP A;  4PHJ A;  2M97 A;  1UHH A;  2M29 A;  4BY5 A;  1H8B A;  1SR6 C;  1K9P A;  1B8C A;  2LNK A;  1Q80 A;  1CFP A;  1SYM A;  4N1G A;  1Y0V H;  4PHN A;  3OP0 A;  1CLL A;  3OX6 A;  5HLO A;  1S26 D;  1AVS A;  2PAL A;  1OOJ A;  4XJK A;  5IBW A;  3FWB A;  2LCP A;  1QIW A;  3SG4 A;  1DJH A;  2MLE C;  1N2D A;  5F6T A;  1IH0 A;  2MBX A;  3O78 A;  2KHN A;  1B8R A;  2K61 A;  1SRA A;  3IQO A;  1MUX A;  2L2E A;  1EG4 A;  1ALW A;  1YRT B;  3D0Y A;  1BR4 B;  2H61 A;  2V53 A;  4WQ3 A;  1FF1 A;  2KDH A;  1DF0 A;  4N5X A;  2HF5 A;  3PAT A;  1K90 D;  1JFK A;  3DVM A;  5CSF A;  3AAJ A;  2F8P A;  1BR1 B;  1LVC D;  2Y1N A;  5AAN A;  3SG5 A;  3BUO B;  4C0J A;  1XVJ A;  4UPG A;  1QV1 A;  1UUS A;  4AQI A;  1CFF A;  5JJG A;  1UWO A;  1S6C A;  1IQ3 A;  2JXC A;  4PE1 A;  2ZKM X;  3EVR A;  2L50 A;  2L51 A;  2ZN8 A;  1BG1 A;  3OB2 B;  2KBM A;  1XK4 A;  4HRG A;  2KI4 C;  4C0L A;  5HKZ A;  4MSP A;  3EKH A;  1HT9 A;  1CB1 A;  2OPO A;  2F2O A;  1DJX A;  1RK9 A;  1M46 A;  3NSK A;  5KSZ A;  1V1G A;  4ORC B;  1MQ1 A;  1QTX A;  1UHI A;  4YGD B;  4MN0 A;  1SY9 A;  1NIW A;  1KFU L;  4IL1 A;  2O5G A;  2BL0 C;  2OS8 B;  2M0R A;  2KYF A;  3GK2 A;  4GBA A;  4GPL B;  1K8U A;  2PSR A;  3FS7 A;  1K93 D;  2BCX A;  1LKJ A;  1CDL A;  2LHL A;  4DRW A;  5KTY A;  1JBA A;  3HCM A;  3WNX B;  2KFH A;  1RWY A;  1IWQ A;  1AHR A;  2K0J A;  3TDU A;  1LXF C;  1KK7 Y;  1G4Y R;  2I2R E;  3DVJ A;  5HKW A;  1A75 B;  2HQW A;  1B8L A;  5DKQ A;  1SL7 A;  2BKH B;  1SPY A;  1QX7 A;  1WRK A;  5D69 A;  2KBI A;  1TTX A;  2OTG C;  1N65 A;  1JFJ A;  4CFR A;  1KFX L;  1JF2 A;  2AAO A;  2BBN A;  1RFJ A;  1C07 A;  3A8R A;  1ALV A;  1CKK A;  1PVB A;  3EKJ A;  4WRI A;  1F55 A;  2BE6 A;  3WHT B;  1ZOT B;  2CTN A;  2H61 C;  1NSH A;  2KI4 B;  2LM5 A;  2LVJ A;  2KOT A;  1OE9 B;  2WCF A;  3KF9 A;  1NCY A;  3EK4 A;  2PRU A;  2EC6 C;  2KAV A;  4NDB A;  3ZWH A;  1CLB A;  1PVA A;  1B7T Y;  1S6J A;  3TDZ A;  1BJF A;  1XFZ O;  3VRP A;  5I2Q A;  1SL8 A;  2BL0 B;  1RJV A;  1XA5 A;  4YGC B;  2LLU A;  2NZ0 A;  1UHJ A;  4YBH B;  2K7C A;  1QVI Z;  1U5I A;  1CNP A;  1CDN A;  1XK4 C;  2FJU B;  2LMT A;  1OQP A;  2KI6 D;  2GGM A;  1NX3 A;  1J1D A;  3VRQ A;  2JT0 A;  2HQ8 A;  1J7P A;  4A4B A;  1HQV A;  1MXL C;  4GGN A;  4DIR A;  2BE4 A;  3QRX A;  1OZO A;  1REC A;  1YUU A;  3C1V A;  3A4U B;  1AJ4 A;  2K7B A;  1A2X A;  4XJK B;  4QJ4 B;  5I2L A;  2H2K A;  1W7J B;  2I7A A;  2L0P A;  3BUM B;  3RLZ A;  2EGD A;  1J7O A;  2OTG B;  3CR2 A;  4USL A;  4NQG A;  1F4Q A;  4QJ3 B;  2D8N A;  2Q4U A;  3SJS A;  4OCI A;  3GK4 X;  1SKT A;  3BXK A;  1KSM A;  4YGE B;  1EL4 A;  3BUX B;  1B47 A;  2MA2 A;  1ODB A;  3GK1 A;  4OR9 B;  2HET A;  1WRZ A;  3D0Y B;  1KWO C;  1BMO A;  3KEV A;  1DF0 B;  2LVK A;  1NX2 A;  2M49 B;  3BOW A;  2K2A A;  2KQ6 A;  5TNC A;  5HYD A;  2KSP A;  2F33 A;  2EC6 B;  1ZUZ A;  2M9G A;  1YR5 A;  2TN4 A;  1KQM B;  2LUC A;  1XFY O;  2LE9 B;  3EK7 A;  2ZRS A;  2MHH A;  5GQQ C;  1KFU S;  4D1E A;  1EXR A;  1PK0 D;  3D10 A;  3NSL A;  2VRG A;  3I5H B;  3IQQ A;  4HSZ A;  2JRF A;  2JT3 A;  4CPV A;  4E68 A;  2COL B;  3CR5 X;  5G08 A;  3LK0 A;  2FCD A;  3AKA A;  3DF0 A;  3TS5 C;  1CMG A;  1WRL A;  5DKN A;  2CBL A;  2JUL A;  4DUQ A;  4FQO A;  2PVB A;  3DD4 A;  4GNK B;  1IKU A;  1ZAC A;  1L2O C;  4ORA B;  2L5X B;  4M2O A;  4NDC A;  1GGZ A;  1AUI B;  1KCY A;  4OV2 A;  1FI5 A;  2BCA A;  2LLS A;  1NWD A;  1WY9 A;  3PSR A;  2I94 A;  4XYN A;  2M1U A;  4F0Z B;  1NX0 A;  3ZNI A;  2CNP A;  2JXL A;  1LA0 A;  1SL9 A;  2WOR A;  1SR6 B;  3O4Y A;  1MR8 A;  1NCZ A;  1NUB A;  1KFX S;  2LC5 A;  3LCP C;  4M2P A;  4I5L B;  1SCM C;  1JUO A;  2L98 A;  3CLN A;  1CM1 A;  2KFG A;  2G9B A;  4DS7 A;  1B9A A;  1K94 A;  1KWO B;  4R1E A;  1DJY A;  1EG3 A;  2IS9 A;  3PAL A;  1PRW A;  2KQY A;  1YUS A;  4WQ2 A;  2I18 A;  1F8H A;  1Y1U A;  4GGF A;  1SCV A;  5ER4 X;  2JC2 A;  1YX8 A;  1TNQ A;  2K7O A;  2WOS A;  3VGO A;  4QJ5 B;  1TRF A;  1S5G Z;  2KAX A;  4FTG A;  4YGA A;  1G8I A;  4HRE E;  5J3X A;  1LA3 A;  2R2I A;  3I5I C;  1QAS A;  1F71 A;  2BBM A;  2JQ6 A;  4BY4 A;  4CFQ A;  1S3P A;  1WDC C;  1A29 A;  1KK7 Z;  2JPT A;  3LK1 A;  1GGW A;  2QAC A;  3TS5 B;  4GFT A;  4ZCU A;  1CM4 A;  1MXE A;  5DKR A;  4DCK A;  3AKB A;  2JTZ A;  2Y4Q A;  1K9K A;  1N0Y A;  1L2O B;  2ZFD A;  3EK8 A;  3PM8 A;  4MZL A;  1SMG A;  3ICB A;  2KI6 C;  3O2P A;  3K21 A;  2Q91 A;  1R2U A;  2SAS A;  1QIV A;  1IQ5 A;  1PAL A;  5I8N A;  1S1E A;  1AJ5 A;  3CTN A;  2LMV A;  1J7Q A;  1SBJ A;  4P5O E;  2JNX A;  2JOJ A;  3DVE A;  1AP4 A;  1IGV A;  1CLM A;  1WLM A;  2LVI A;  1EJ3 A;  1WLZ A;  1XFW O;  1K2H A;  1OMR A;  2WC8 A;  1BOC A;  1B7T Z;  3M0W A;  3CZT X;  4TNC A;  3EVV A;  1TNX A;  1M39 A;  1UP5 A;  1XFX O;  1G33 A;  1Y1A A;  5CSJ A;  1QXP A;  1M63 B;  1UUR A;  2CXJ A;  1C7V A;  1QLS A;  1DJG A;  1F70 A;  2DOQ A;  4GUK A;  4PDZ A;  4I5N B;  1CDM A;  1FPW A;  1QJT A;  2K2F A;  2BKI B;  2ISD A;  1A75 A;  3I5I B;  4YGB B;  4PHM A;  1OZS A;  4MRX A;  3TZ1 A;  1JSA A;  5KU1 A;  2JT8 A;  1WDC B;  2LP3 A;  1FI6 A;  4C0K A;  1CTR A;  2M3W A;  3BOW B;  3I5G C;  1V1F A;  4ZCV A;  2KFF A;  4GGF C;  2L4I A;  3FWC A;  1QVI Y;  2A4J A;  1BU3 A;  1PSR A;  4PCW A;  2KGB C;  1TCO B;  4OVN F;  1OSA A;  5PAL A;  1YVL A;  3LL8 B;  1QX5 B;  4CLN A;  1UHK A;  1XO5 A;  1QLK A;  1A03 A;  1JC2 A;  5AEQ A;  2KYC A;  2MRD A;  3DVK A;  3JVT C;  3DF0 B;  5HKY A;  1BOD A;  5I2O A;  1DMO A;  4PE4 A;  4ORB B;  3WHU B;  1B1G A;  2PAS A;  1B4C A;  2GGZ A;  2HPS A;  3CGA A;  4YI8 A;  1NYA A;  3VRO A;  1H4B A;  1JF0 A;  2JTT A;  5FYX A;  1TN4 A;  1EH2 A;  1CMF A;  1F4O A;  3CS1 A;  1DJZ A;  3BQ3 A;  1PUL A;  2JZI A;  2SCP A;  1BF5 A;  1SK6 D;  3HX4 A;  1XYD A;  1RRO A;  2PMY A;  2AUC A;  2OS8 C;  1YX7 A;  3NSO A;  1F54 A;  2WND A;  2F2P A;  2MJW B;  2NCO A;  3CR4 X;  2KNE A;  5D7F A;  2FCE A;  3OX5 A;  2M7L A;  3TUY C;  3VRN A;  1IG5 A;  4YRU A;  2Y5I A;  2AMI A;  3RM1 A;  1M45 A;  2F3Y A;  1QS7 A;  3I5G B;  4MLW A;  1TNW A;  2RGI A;  2NCP A;  1AK8 A;  2CCM A;  2LVV A;  2KAY A;  5K89 A;  2K7D A;  4YI9 A;  2P6B B;  3KHE A;  1NX1 A;  1NPQ A;  4I5J A;  2K8M B;  5BPJ A;  1K9U A;  1S36 A;  2WCB A;  1DTL A;  3AAK A;  3SIB A;  4M2Q A;  2B1U A;  1W7I B;  2GV5 A;  3BUW B;  4OKH A;  1PSB A;  2ZND A;  1GJY A;  5HLV A;  4CID A;  3JVT B;  3SG2 A;  2ZNE A;  1YTZ C;  3SIA A;  1ZMZ A;  2BEC A;  1J55 A;  2LV7 A;  4A4C A;  1RTP 1;  2L4H A;  4JPZ B;  1L7Z A;  2CT9 A;  1FW4 A;  2E6W A;  2LMU A;  1NP8 A;  2NXQ A;  3PFV A;  1X02 A;  2FOT A;  4ETO A;  4MZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...