1NX1A

Calpain domain vi complexed with calpastatin inhibitory domain c (dic)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx1A00
2FOTA 2IS9A 5TNCA 3JVTC 1U5IB 3EVVA 5F6TA 3CTNA 3E3RA 3VRRA 4D1EA 3DVMA 2JXCA 1GGWA 1MXLC 1U5IA 1YR5A 2GGZA 2JNFA 5CSNA 3OB1B 5HYDA 4C0JA 1MR8A 1NPQA 3H4SE 3M0WA 5HLVA 3TDZA 2HETA 4HRGA 1S5GY 4GGFC 2M29A 1BODA 1B8RA 4M2PA 4L9MA 3D0YB 1AJ4A 1HQVA 4I5KA 1KFXS 1F4QA 3TZ1A 1OZOA 3D0YA 4GFTA 2WCBA 4ICBA 3LL8B 3OX6A 1S5GZ 1QASA 2F3ZA 1CFFA 1CNPA 1A03A 1G4YR 5KU1A 1BF5A 2BE4A 1CMGA 2P6BB 3MSEB 1YTZC 2EGDA 2HQWA 1J7PA 1BR4B 3IF7A 3SG2A 4N1GA 4BY5A 1SR6B 1N65A 1J1EA 1UHIA 2WORA 1IG5A 1JUOA 2MLEC 3C1VA 1JWDA 1QIVA 2KAXA 2KFGA 4PE4A 4DCKA 1KSMA 1SCMB 1QS7A 3PLFB 4YI9A 2PASA 4CFRA 1LINA 4OVNF 1BMOA 2LAPA 4MRXA 3FWCA 3GOFA 2L0PA 1KWOB 2EC6C 1F71A 1A4PA 2EHBA 1NCZA 3GK2A 1FI5A 3I5GC 3I5HB 3DVKA 1PSRA 4PCWA 1TOPA 4GAOA 2I94A 2L2EA 2Q4UA 4XYNA 2FCDA 1DGVA 1K9KA 2AAOA 4WQ2A 1OMVA 2E6WA 3EVRA 2ZRTA 3OP0A 1XVJA 1YVHA 2LVKA 1V1GA 3WXAA 2JT0A 1NX3A 1XFYO 2OTGC 1KQVA 3EK4A 1A75B 1ZUZA 1ZACA 3O2PA 1DJIA 5AERA 1RK9A 4NQGA 2MJWB 5B8IB 4DS7A 4M2OA 1A75A 1LVCD 3TDUA 4R1EA 1M46A 3KF9A 1BLQA 1OE9B 3PN7C 3BUXB 1DJHA 1RECA 2JC2A 2HQ8A 5G08A 2BE6A 3BXKA 5CSFA 3LK0A 2M0RA 1EG3A 1B1GA 2PVBA 2LV7A 1MUXA 2JWWA 2ZRSA 1FBVA 1IQ5A 1OMDA 1CFDA 1K94A 1NUBA 1NWDA 2MLFC 5JOLA 2SASA 2JTTA 2LM5A 3BOWB 1WRZA 1K90D 4MZJA 1WY9A 2JXLA 2MHHA 2CCMA 1WDCB 3BUWB 1SPYA 3BOWA 1KFUL 3DF0B 1NP8A 1B47A 4M2QA 4ETOA 1SK6D 4MBEA 1TNWA 3CS1A 2ZNDA 4U8DA 3F45A 1S26D 3DF0A 1QX2A 4N5XA 1DJWA 4YBHB 1TNQA 2KGBC 2O60A 1NX1A 2H61C 2I2RE 4OV2A 1J1DA 2TN4A 1SYMA 1XFWO 2OS8B 3WHUB 3SG7A 2BCAA 5HLOA 1RFJA 1DJXA 2Q91A 3SIBA 1EJ3A 2K7OA 2Y5IA 4N1FA 1CDMA 3KO0A 1L7ZA 1XA5A 2COLB 3HCMA 3ZNIA 4C0KA 1YRUB 1F4OA 1NX0A 3EKHA 1DJGA 1RJVA 1QX5B 2K7BA 1F54A 1UWOA 1QVIZ 4HRHA 2M7LA 1OMRA 4NDCA 3OHMB 2L51A 1H8BA 1YUTA 2WNDA 1CKKA 3I5IC 4YGAA 2JU0A 2LP3A 4USLA 1IH0A 2K61A 4MZLA 1AUIB 5HKZA 3SIAA 1LXFC 1PSBA 1ZFSA 2LVIA 2JZIA 2L50A 2JT8A 1SR6C 1YX7A 4P2YB 5I8NA 4JQ0D 3VRQA 2KFHA 1AK8A 3WNXB 2LMUA 1W7IB 2CTNA 1QATA 1M39A 2BL0B 1SCMC 2M8UA 4A4BA 3QRXA 1OOJA 1IGVA 1K2HA 1GJYA 1JC2A 1DF0B 4I5LB 3TDIA 2L98A 1WRKA 1PVBA 3BUOB 4DUQA 4FTGA 2FJUB 1DF0A 1XFUO 4PHMA 3SJSA 2F8PA 1Y1XA 3DD4A 5KTYA 2ZKMX 2FCEA 4OCIA 4P5OE 3EK8A 1RTP1 2JOJA 2OPOA 1CFCA 1M63B 3I5HC 2KYFA 1MXEA 2BKIB 5GQQC 1K95A 1YX8A 1S6JA 1KQMB 1Y0VH 3CWGA 2LHLA 4DIRA 4UPGA 2CBLA 3NSOA 3VRPA 4MN0A 5CSIA 1B9AA 1FI6A 1YUSA 1OQPA 1S3PA 1SNLA 2KNEA 1MWNA 1PRWA 4HREE 3ICBA 4A4CA 3NSIA 1XFZO 2KOTA 4Q04A 2LNKA 4MRYA 4I5NB 1NIWA 3K21A 4PDZA 1QLKA 5D69A 1KFUS 2LUCA 3CR5X 1XFXO 3OB2B 1CDLA 1BT6A 3CGAA 1XYDA 4OKHA 1TCOB 2L4HA 3LLEA 4WRIA 2K7DA 3WHTB 4CFQA 1SL9A 1J7RA 2LVJA 2M1KB 3TUYB 2LMTA 1W7JB 1XO5A 3BQ3A 2L4IA 1A2XA 1DGUA 5FYXA 4AQJA 2HF5A 4PHJA 1UP5A 1ALWA 2F2PA 1NX2A 1CTRA 1C7VA 2KI6C 1X02A 4NDBA 1Y6WA 1Y1AA 2MRDA 1WDCC 1ODBA 2CT9A 1JF2A 1TTXA 2M7NA 2WOSA 4YGEB 3VGOA 3PATA 2NCPA 2WCFA 2LCPA 5ER5A 1FPWA 5ER4X 2NCOA 1S6CA 2ZNEA 1B8CA 2Y4QA 3O78A 4PE0A 1WLMA 4CLNA 1FF1A 4CPVA 2KGRA 1PVAA 2LC5A 2KI4B 3FS7A 4I5JA 4TNCA 4AQIA 2KHNA 2Y1MA 3I5GB 2BCXA 2OS8C 3KPXA 2CNPA 1PULA 1KK8B 2MA2A 4YGDB 1L2OC 1BG1A 3SG5A 4PHKA 1N0YA 1EH2A 2A4JA 1JFJA 4GUKA 1D1OA 2QPTA 2PSRA 1IQ3A 5K89A 4ORBB 3FWBA 1GGZA 1SMGA 3CR2A 4ORAB 4CIDA 3PALA 5IBWA 1HT9A 4GBAA 4E68A 1CM1A 2HPSA 1B4CA 1FW4A 5HKYA 2KYCA 1JFKA 4GPLB 5CPVA 3ZWHA 1YUUA 4MEWA 3AAJA 1QIWA 4GGNA 1XFVO 2LE9B 1WLZA 3KHEA 2SCPA 3SG6A 3EKJA 1XK4A 2L5XB 2BCBA 4ZCVA 1KCYA 2LLTA 2K2FA 4ORCB 1E8AA 1SKTA 1G8IA 1F55A 5CSJA 1KSOA 1K9UA 2BL0C 4PHNA 2LUXA 1LA3A 1MQ1A 1IWQA 1R2UA 1UHHA 1UHJA 2O5GA 1IJ6A 4BY4A 2JQ6A 1PK0D 2LLUA 1VRKA 3BUNB 2KFFA 3JTDB 2JPTA 1K8UA 1N2DA 1MHOA 3HX4A 5JJGA 2DOQA 4IL1A 1OSAA 1CDPA 1QTXA 1DJZA 1JBAA 2JULA 1QLSA 1UUSA 2NLNA 2H61A 3EK7A 4QJ4B 1YURA 1KQMC 1QJTA 3TS5B 1OZSA 2AMIA 3FIAA 4MZKA 1SRAA 2M49B 1CFPA 4YGBB 4NDDA 1F70A 1KWOC 3I5FB 1SL8A 1LA0A 1ZOTB 2G9BA 3A8RA 1C07A 3JVTB 1WRLA 1UURA 2K8MB 2KDHA 3O4YA 4PE1A 2JNXA 2KI6D 1DJYA 2KQYA 3NXAA 4QJ3B 4YRUA 1YRTB 1CDNA 3A4UB 3BYAA 4MLWA 1K96A 3CR4X 1GQMA 3BUMB 1S36A 3I5IB 3AKAA 1J7QA 2B1UA 5AEQA 2PRUA 1DT7B 2H2KA 4C0LA 4ZCUA 2KSPA 1B8LA 3SG3A 2JTZA 3TUYC 1JSAA 3CZTX 3PFVA 4GGFA 5KSZA 1ALVA 1QV1A 3GK1A 5HKWA 1CLMA 1G33A 2ISDA 5I2LA 2KBIA 2RGIA 1QX7A 3PSRA 2CXJA 1S6IA 2M9GA 4GNKB 2LP2A 1C7WA 1UHKA 1IRJA 4WQ3A 5BPJA 1NYAA 1H4BA 2D8NA 3AKBA 1BOCA 2ZN9A 1KK7Y 2F33A 1EL4A 2WC8A 1S1EA 1CB1A 2PMYA 1DMOA 1QXPA 2KBMA 3VRNA 3CLNA 2KI4C 3EVUA 4YGCB 5I2QA 1J7OA 2LHIA 1AHRA 1KFXL 2JRFA 2M1UA 3LCPC 2ZFDA 1ZMZA 3AAKA 4PE7A 2JT3A 3PM8A 2ZN8A 1KK7Z 4HSZA 1A29A 1AJ5A 3IQQA 1KK8C 2I18A 4PALA 5DKRA 1TRFA 3O6BA 2LVVA 2GGMA 3OX5A 1DVIA 1IKUA 2BBMA 2F2OA 2MAZA 2K7CA 5AANA 5AFPA 1BR1B 1PALA 2EC6B 1R6PA 1IJ5A 4AOMA 2BECA 1CLBA 1F8HA 1B7TY 3KEVA 1K9PA 3DVJA 2GV5A 3LK1A 2QACA 2R2IA 1BU3A 2KAVA 2AUCA 5PALA 1NCYA 5J3XA 2PALA 4MSPA 5I2OA 1JF0A 2VRGA 1SBJA 1TIZA 1B7TZ 5AXIA 3RM1A 1XK4C 2BKHB 2NZ0A 3RLZA 3SG4A 1CLLA 1DTLA 2F3YA 2K2AA 2LMVA 4FQOA 5DKNA 4DRWA 1TNPA 2OTGB 1J55A 1CMFA 2K0JA 4MVFA 1EG4A 1CM4A 1RROA 1SCVA 3IQOA 2LANA 1EXRA 3DVEA 1V1FA 5D7FA 2LLSA 1UHNA 1LKJA 2E30A 3PN7B 1M45A 2KAYA 2WCEA 4JPZB 3VROA 1AVSA 1MF8B 3JTDC 1Q80A 2MBXA 2BBNA 4JWQA 1K93D 1M31A 1Y1UA 2I7AA 2Y1NA 1BJFA 1TCFA 2M97A 1SW8A 4XJKB 4F0ZB 4YI8A 3NSKA 1RWYA 1SY9A 3D10A 1TNXA 1YVLA 1NCXA 4XJKA 2NXQA 3GK4X 3TS5C 1QVIY 1TN4A 2V53A 1L2OB 4OR9B 1AP4A 4QJ5B 2KQ6A 1QV0A 2G2BA 2M3WA 3NSLA 5DKQA 3I5FC 1NSHA 1SL7A
chains in the Genus database with same CATH superfamily
1DEKA 2FOTA 2IS9A 5TNCA 3JVTC 1U5IB 3EVVA 5F6TA 3CTNA 3E3RA 3VRRA 4D1EA 3DVMA 3CYZA 2JXCA 3BFHA 3D73A 1GGWA 1MXLC 1U5IA 2QEOA 3D74A 1YR5A 2GGZA 2JNFA 5CSNA 3OB1B 5HYDA 4C0JA 1MR8A 1NPQA 3H4SE 3M0WA 4IJ7A 5HLVA 3B87A 3TDZA 2HETA 4HRGA 1S5GY 4GGFC 2M29A 1BODA 1B8RA 3SS4A 4M2PA 4L9MA 3D0YB 1AJ4A 1HQVA 4I5KA 3D75A 1KFXS 3SS3A 2WCHA 1F4QA 3TZ1A 1OZOA 3D0YA 4GFTA 2WCBA 4ICBA 3LL8B 3OX6A 1S5GZ 1QASA 2F3ZA 3SS5A 1CFFA 1CNPA 5I94A 1A03A 1G4YR 5KU1A 1BF5A 2BE4A 2L5YA 1CMGA 2P6BB 3MSEB 1YTZC 2EGDA 3R1VA 2HQWA 1IIOA 1J7PA 1BR4B 3IF7A 3SG2A 4N1GA 4BY5A 1SR6B 2P70A 1N65A 1J1EA 1UHIA 2WORA 1IG5A 1JUOA 2MLEC 3C1VA 1JWDA 1QIVA 2KAXA 2KFGA 4PE4A 4DCKA 1KSMA 1SCMB 1QS7A 3PLFB 4YI9A 2PASA 4CFRA 1LINA 4OVNF 1BMOA 2LAPA 4MRXA 5FI2A 3FWCA 4OZDA 3FE6A 3GOFA 2L0PA 1KWOB 1ORGA 2EC6C 1QWVA 1F71A 1A4PA 1W9ZA 1NCZA 2EHBA 3GK2A 1FI5A 3CZ1A 3I5GC 1OOFA 3I5HB 3DVKA 1PSRA 4PCWA 1TOPA 3S0DA 2QEVA 4GAOA 3D78A 2I94A 2L2EA 2Q4UA 4XYNA 2FCDA 1DGVA 1K9KA 2AAOA 4WQ2A 1OMVA 2E6WA 3EVRA 2ZRTA 3OP0A 1XVJA 1YVHA 2LVKA 1V1GA 3WXAA 2JT0A 1NX3A 1XFYO 2OTGC 3S0BA 1KQVA 3EK4A 1A75B 1ZUZA 1ZACA 3O2PA 1DJIA 5AERA 2WCLA 1RK9A 4NQGA 2MJWB 5B8IB 4DS7A 4M2OA 1A75A 1LVCD 3TDUA 4R1EA 1M46A 3KF9A 1BLQA 1OE9B 2QEHA 3PN7C 3BUXB 1DJHA 1RECA 2JC2A 2HQ8A 5G08A 2BE6A 2WC5A 3BXKA 5CSFA 3LK0A 2M0RA 1EG3A 1B1GA 1SSEB 2KPHA 2LV7A 1MUXA 2JWWA 2PVBA 2ZRSA 3CABA 3CZ0A 1FBVA 3IVTA 1IQ5A 1OMDA 1CFDA 1K94A 1NUBA 1NWDA 2MLFC 5JOLA 2SASA 2JTTA 2LM5A 3BOWB 1WRZA 1K90D 4MZJA 1WY9A 2JXLA 2MHHA 2CCMA 1WDCB 3BUWB 1SPYA 3BOWA 1KFUL 3DF0B 1NP8A 1B47A 4M2QA 4ETOA 1SK6D 4MBEA 1TNWA 5KSZA 3CS1A 2ZNDA 4U8DA 3F45A 2ERBA 1S26D 5FI6A 3DF0A 1QX2A 4N5XA 1DJWA 4YBHB 1C3ZA 2PQLA 1TNQA 2KGBC 2O60A 1NX1A 2H61C 2I2RE 4OV2A 1TWOA 1J1DA 2TN4A 1SYMA 1XFWO 2OS8B 3WHUB 3SG7A 2BCAA 5HLOA 1RFJA 1DJXA 2Q91A 3SIBA 3S0AA 1EJ3A 2K7OA 2Y5IA 4N1FA 1CDMA 3KO0A 1L7ZA 1XA5A 2COLB 3HCMA 3ZNIA 2QDIA 4C0KA 1YRUB 1F4OA 1NX0A 3EKHA 1DJGA 1RJVA 1QX5B 2K7BA 1F54A 1UWOA 1QVIZ 4HRHA 2KLEA 2M7LA 1OMRA 1DC1A 4NDCA 3OHMB 2L51A 1H8BA 1YUTA 2WNDA 3L4LA 1CKKA 1LS8A 3I5IC 2JU0A 2LP3A 4USLA 4YGAA 1IH0A 2K61A 4MZLA 1AUIB 1TUJA 5HKZA 3SIAA 1LXFC 3PJIA 1PSBA 1ZFSA 2LVIA 4INXA 1C3YA 2JZIA 2L50A 2JT8A 1SR6C 1YX7A 4P2YB 5I8NA 4JQ0D 3VRQA 2KFHA 1AK8A 3WNXB 2LMUA 1W7IB 2CTNA 1QATA 1M39A 2BL0B 1SCMC 2M8UA 3N7HA 4A4BA 3QRXA 1OOJA 3R1PA 1IGVA 3NGVA 1GJYA 1K2HA 1JC2A 1DF0B 4I5LB 5D3OA 3TDIA 2L98A 3L4AA 1WRKA 1PVBA 3BUOB 4DUQA 3UNWA 4FTGA 2FJUB 1DF0A 1XFUO 4PHMA 3SJSA 2F8PA 1Y1XA 2P71A 3DD4A 5KTYA 2ZKMX 2FCEA 4OCIA 4P5OE 3EK8A 1RTP1 2JOJA 2OPOA 1CFCA 1M63B 3I5HC 2KYFA 1MXEA 2BKIB 5GQQC 1K95A 1YX8A 1S6JA 2YGUA 1KQMB 1Y0VH 3V2LA 3CWGA 2LHLA 4DIRA 3K1EA 4UPGA 2CBLA 3NSOA 3VRPA 4MN0A 3DZTA 5CSIA 1B9AA 1FI6A 1YUSA 2H8VA 1OQPA 1S3PA 1SNLA 3EG5B 3L47A 2KNEA 1MWNA 1PRWA 4HREE 1Z2CB 3ICBA 4A4CA 3NSIA 1XFZO 2KOTA 2WCKA 4Q04A 2LNKA 4MRYA 4I5NB 1NIWA 3B86A 3K21A 4PDZA 1QLKA 4INWA 5D69A 1KFUS 2LUCA 3CR5X 1XFXO 3OB2B 1CDLA 1BT6A 3CGAA 1XYDA 4FQTA 4OKHA 1TCOB 2L4HA 3LLEA 4WRIA 2K7DA 3WHTB 1TUZA 1SL9A 1J7RA 2LVJA 2M1KB 4CFQA 3TUYB 2LMTA 3BJHA 4JD9A 1W7JB 1XO5A 3BQ3A 2L4IA 1A2XA 1DGUA 5FYXA 4AQJA 2HF5A 4PHJA 1UP5A 1ALWA 2F2PA 1NX2A 1CTRA 1C7VA 2KI6C 1X02A 4NDBA 1Y6WA 1Y1AA 2MRDA 1WDCC 1ODBA 2CT9A 3B88A 1JF2A 1TTXA 2M7NA 3D77A 2WOSA 4YGEB 3VGOA 3PATA 2NCPA 2WCFA 2LCPA 5ER5A 1FPWA 5ER4X 2NCOA 1S6CA 2ZNEA 1B8CA 2Y4QA 3O78A 4PE0A 1WLMA 4CLNA 1FF1A 4CPVA 2KGRA 2KLDA 1PVAA 2LC5A 2KI4B 2WCJA 3FS7A 4I5JA 4TNCA 4AQIA 2KHNA 2Y1MA 3I5GB 2BCXA 2OS8C 3KPXA 2CNPA 1DQEA 1PULA 1KK8B 2MA2A 4YGDB 1L2OC 1BG1A 3SG5A 4PHKA 1N0YA 1EH2A 2A4JA 1JFJA 4GUKA 1D1OA 2QPTA 2PSRA 1IQ3A 5K89A 4ORBB 3FWBA 1GGZA 1SMGA 3CR2A 4ORAB 4CIDA 2JPOA 3PALA 5IBWA 1HT9A 4GBAA 4E68A 1CM1A 2HPSA 1B4CA 1FW4A 3D76A 5HKYA 2KYCA 1JFKA 4GPLB 5CPVA 3ZWHA 1YUUA 1OOGA 4MEWA 3AAJA 1QIWA 3DY9A 4GGNA 1XFVO 4PT1A 2LE9B 1WLZA 3B6XA 2SCPA 3KHEA 3SG6A 3EKJA 1XK4A 2L5XB 2BCBA 3DYEA 4ZCVA 1KCYA 2LLTA 2K2FA 4ORCB 1E8AA 1SKTA 1G8IA 1F55A 5CSJA 1T14A 1KSOA 1K9UA 2BL0C 4PHNA 2LUXA 1LA3A 1MQ1A 1IWQA 1R2UA 1UHHA 2QEBA 1UHJA 2O5GA 1IJ6A 4BY4A 4JKTA 2JQ6A 1PK0D 2LLUA 1VRKA 3BUNB 2KFFA 3JTDB 5DICA 2JPTA 1K8UA 1N2DA 1MHOA 2GTEA 3HX4A 5JJGA 2DOQA 4IL1A 1OSAA 1CDPA 1QTXA 1Z4HA 1DJZA 1JBAA 2JULA 1QLSA 1UUSA 2NLNA 2H61A 3EK7A 4QJ4B 1YURA 1KQMC 1QJTA 3TS5B 1XFRA 1OZSA 2AMIA 3FIAA 4MZKA 1SRAA 2M49B 1CFPA 1DELA 4F7FA 4YGBB 4NDDA 1F70A 1KWOC 3I5FB 1SL8A 1LA0A 1ZOTB 2G9BA 2BNXA 3A8RA 1C07A 3JVTB 3OGNA 1WRLA 1UURA 2K8MB 2KDHA 3O4YA 4PE1A 2JNXA 2KI6D 1DJYA 2KQYA 3NXAA 4QJ3B 3S0FA 4YRUA 1OW4A 1YRTB 3A4UB 1CDNA 3BYAA 4MLWA 1K96A 3CR4X 1GQMA 3BUMB 1S36A 3I5IB 5EL2A 3AKAA 1J7QA 2FJYA 2B1UA 5AEQA 2PRUA 1DT7B 2H2KA 4C0LA 4ZCUA 2KSPA 1B8LA 3SG3A 2JTZA 3CZ2A 3TUYC 1JSAA 3R72A 2BAPA 3CZTX 3FE9A 3PFVA 1ALVA 1QV1A 3GK1A 4GGFA 1CLMA 5HKWA 1G33A 2ISDA 5HL1A 1OOIX 3RZSA 2K60A 5I2LA 3S0GA 2KBIA 2RGIA 1QX7A 3PSRA 2CXJA 1S6IA 2M9GA 4GNKB 2LP2A 1C7WA 1UHKA 3Q8IA 1IRJA 4WQ3A 5BPJA 1NYAA 3CDNA 3VB1A 1H4BA 2D8NA 3AKBA 3BFBA 3OBVA 2ZN9A 1KK7Y 2F33A 1BOCA 1EL4A 2WC8A 1S1EA 1CB1A 5FI7A 2PMYA 3B7AA 1DMOA 1QXPA 2KBMA 3VRNA 3CLNA 2KI4C 3EVUA 4YGCB 5I2QA 1J7OA 2LHIA 3FE8A 1OOHA 1AHRA 1KFXL 2JRFA 2M1UA 3LCPC 3O4XA 2ZFDA 1ZMZA 3AAKA 4PE7A 2JT3A 3PM8A 2ZN8A 1KK7Z 4HSZA 1A29A 2L2CA 1AJ5A 3IQQA 1KK8C 2I18A 4PALA 3S0EA 5DKRA 1TRFA 3O6BA 2LVVA 2GGMA 3OX5A 1DVIA 1IKUA 2BBMA 2F2OA 2MAZA 2K7CA 5AANA 5AFPA 1BR1B 1PALA 2EC6B 1R6PA 1IJ5A 4AOMA 2BECA 1CLBA 1F8HA 1GM0A 1B7TY 3KEVA 1K9PA 3DVJA 2GV5A 3LK1A 2QACA 2R2IA 1BU3A 2KAVA 2AUCA 3NHTA 5PALA 1NCYA 1P28A 5J3XA 2PALA 3NHIA 4MSPA 3UO9A 5I2OA 3DXLA 1JF0A 2PYQA 2VRGA 1SBJA 1TIZA 1B7TZ 5AXIA 3RM1A 1XK4C 2BKHB 2NZ0A 3RLZA 3SG4A 1CLLA 1DTLA 2F3YA 2K2AA 2LMVA 4FQOA 5DKNA 4DRWA 1TNPA 2OTGB 1J55A 1CMFA 3R1OA 2K0JA 4MVFA 1EG4A 1CM4A 1RROA 1SCVA 3IQOA 2LANA 1EXRA 3DVEA 1V1FA 2WCMA 5D7FA 2LLSA 1UHNA 1LKJA 2E30A 3PN7B 1M45A 2KAYA 2WCEA 4JPZB 4KYNA 3VROA 1AVSA 1MF8B 3JTDC 1Q80A 2MBXA 2BBNA 4JWQA 1K93D 1M31A 1Y1UA 2I7AA 2Y1NA 1BJFA 1TCFA 2M97A 1SW8A 4XJKB 4F0ZB 4YI8A 3NSKA 1RWYA 1SY9A 3D10A 1TNXA 1YVLA 2WC6A 3BFAA 1NCXA 4XJKA 2NXQA 3GK4X 3TS5C 1QVIY 1TN4A 2V53A 1L2OB 4OR9B 1AP4A 4QJ5B 2KQ6A 1QV0A 2G2BA 2M3WA 3QMEA 3NSLA 3PM2A 5DKQA 3I5FC 1NSHA 1SL7A
chains in the Genus database with same CATH topology
2FOTA 2IS9A 5TNCA 3JVTC 1U5IB 3EVVA 5F6TA 3CTNA 3E3RA 3VRRA 4D1EA 3DVMA 2JXCA 1GGWA 1MXLC 1U5IA 1YR5A 2GGZA 2JNFA 5CSNA 3OB1B 5HYDA 4C0JA 1MR8A 1NPQA 3H4SE 3M0WA 5HLVA 3TDZA 2HETA 4HRGA 1S5GY 4GGFC 2M29A 1BODA 1B8RA 4M2PA 4L9MA 3D0YB 1AJ4A 1HQVA 4I5KA 1KFXS 1F4QA 3TZ1A 1OZOA 3D0YA 4GFTA 2WCBA 4ICBA 3LL8B 3OX6A 1S5GZ 1QASA 2F3ZA 1CFFA 1CNPA 1A03A 1G4YR 5KU1A 1BF5A 2BE4A 1CMGA 2P6BB 3MSEB 1YTZC 2EGDA 2HQWA 1J7PA 1BR4B 3IF7A 3SG2A 4N1GA 4BY5A 1SR6B 1N65A 1J1EA 1UHIA 2WORA 1IG5A 1JUOA 2MLEC 3C1VA 1JWDA 1QIVA 2KAXA 2KFGA 4PE4A 4DCKA 1KSMA 1SCMB 1QS7A 3PLFB 4YI9A 2PASA 4CFRA 1LINA 4OVNF 1BMOA 2LAPA 4MRXA 3FWCA 3GOFA 2L0PA 1KWOB 2EC6C 1F71A 1A4PA 2EHBA 1NCZA 3GK2A 1FI5A 3I5GC 3I5HB 3DVKA 1PSRA 4PCWA 1TOPA 4GAOA 2I94A 2L2EA 2Q4UA 4XYNA 2FCDA 1DGVA 1K9KA 2AAOA 4WQ2A 1OMVA 2E6WA 3EVRA 2ZRTA 3OP0A 1XVJA 1YVHA 2LVKA 1V1GA 3WXAA 2JT0A 1NX3A 1XFYO 2OTGC 1KQVA 3EK4A 1A75B 1ZUZA 1ZACA 3O2PA 1DJIA 5AERA 1RK9A 4NQGA 2MJWB 5B8IB 4DS7A 4M2OA 1A75A 1LVCD 3TDUA 4R1EA 1M46A 3KF9A 1BLQA 1OE9B 3PN7C 3BUXB 1DJHA 1RECA 2JC2A 2HQ8A 5G08A 2BE6A 3BXKA 5CSFA 3LK0A 2M0RA 1EG3A 1B1GA 2PVBA 2LV7A 1MUXA 2JWWA 2ZRSA 1FBVA 1IQ5A 1OMDA 1CFDA 1K94A 1NUBA 1NWDA 2MLFC 5JOLA 2SASA 2JTTA 2LM5A 3BOWB 1WRZA 1K90D 4MZJA 1WY9A 2JXLA 2MHHA 2CCMA 1WDCB 3BUWB 1SPYA 3BOWA 1KFUL 3DF0B 1NP8A 1B47A 4M2QA 4ETOA 1SK6D 4MBEA 1TNWA 3CS1A 2ZNDA 4U8DA 3F45A 1S26D 3DF0A 1QX2A 4N5XA 1DJWA 4YBHB 1TNQA 2KGBC 2O60A 1NX1A 2H61C 2I2RE 4OV2A 1J1DA 2TN4A 1SYMA 1XFWO 2OS8B 3WHUB 3SG7A 2BCAA 5HLOA 1RFJA 1DJXA 2Q91A 3SIBA 1EJ3A 2K7OA 2Y5IA 4N1FA 1CDMA 3KO0A 1L7ZA 1XA5A 2COLB 3HCMA 3ZNIA 4C0KA 1YRUB 1F4OA 1NX0A 3EKHA 1DJGA 1RJVA 1QX5B 2K7BA 1F54A 1UWOA 1QVIZ 4HRHA 2M7LA 1OMRA 4NDCA 3OHMB 2L51A 1H8BA 1YUTA 2WNDA 1CKKA 3I5IC 4YGAA 2JU0A 2LP3A 4USLA 1IH0A 2K61A 4MZLA 1AUIB 5HKZA 3SIAA 1LXFC 1PSBA 1ZFSA 2LVIA 2JZIA 2L50A 2JT8A 1SR6C 1YX7A 4P2YB 5I8NA 4JQ0D 3VRQA 2KFHA 1AK8A 3WNXB 2LMUA 1W7IB 2CTNA 1QATA 1M39A 2BL0B 1SCMC 2M8UA 4A4BA 3QRXA 1OOJA 1IGVA 1K2HA 1GJYA 1JC2A 1DF0B 4I5LB 3TDIA 2L98A 1WRKA 1PVBA 3BUOB 4DUQA 4FTGA 2FJUB 1DF0A 1XFUO 4PHMA 3SJSA 2F8PA 1Y1XA 3DD4A 5KTYA 2ZKMX 2FCEA 4OCIA 4P5OE 3EK8A 1RTP1 2JOJA 2OPOA 1CFCA 1M63B 3I5HC 2KYFA 1MXEA 2BKIB 5GQQC 1K95A 1YX8A 1S6JA 1KQMB 1Y0VH 3CWGA 2LHLA 4DIRA 4UPGA 2CBLA 3NSOA 3VRPA 4MN0A 5CSIA 1B9AA 1FI6A 1YUSA 1OQPA 1S3PA 1SNLA 2KNEA 1MWNA 1PRWA 4HREE 3ICBA 4A4CA 3NSIA 1XFZO 2KOTA 4Q04A 2LNKA 4MRYA 4I5NB 1NIWA 3K21A 4PDZA 1QLKA 5D69A 1KFUS 2LUCA 3CR5X 1XFXO 3OB2B 1CDLA 1BT6A 3CGAA 1XYDA 4OKHA 1TCOB 2L4HA 3LLEA 4WRIA 2K7DA 3WHTB 4CFQA 1SL9A 1J7RA 2LVJA 2M1KB 3TUYB 2LMTA 1W7JB 1XO5A 3BQ3A 2L4IA 1A2XA 1DGUA 5FYXA 4AQJA 2HF5A 4PHJA 1UP5A 1ALWA 2F2PA 1NX2A 1CTRA 1C7VA 2KI6C 1X02A 4NDBA 1Y6WA 1Y1AA 2MRDA 1WDCC 1ODBA 2CT9A 1JF2A 1TTXA 2M7NA 2WOSA 4YGEB 3VGOA 3PATA 2NCPA 2WCFA 2LCPA 5ER5A 1FPWA 5ER4X 2NCOA 1S6CA 2ZNEA 1B8CA 2Y4QA 3O78A 4PE0A 1WLMA 4CLNA 1FF1A 4CPVA 2KGRA 1PVAA 2LC5A 2KI4B 3FS7A 4I5JA 4TNCA 4AQIA 2KHNA 2Y1MA 3I5GB 2BCXA 2OS8C 3KPXA 2CNPA 1PULA 1KK8B 2MA2A 4YGDB 1L2OC 1BG1A 3SG5A 4PHKA 1N0YA 1EH2A 2A4JA 1JFJA 4GUKA 1D1OA 2QPTA 2PSRA 1IQ3A 5K89A 4ORBB 3FWBA 1GGZA 1SMGA 3CR2A 4ORAB 4CIDA 3PALA 5IBWA 1HT9A 4GBAA 4E68A 1CM1A 2HPSA 1B4CA 1FW4A 5HKYA 2KYCA 1JFKA 4GPLB 5CPVA 3ZWHA 1YUUA 4MEWA 3AAJA 1QIWA 4GGNA 1XFVO 2LE9B 1WLZA 3KHEA 2SCPA 3SG6A 3EKJA 1XK4A 2L5XB 2BCBA 4ZCVA 1KCYA 2LLTA 2K2FA 4ORCB 1E8AA 1SKTA 1G8IA 1F55A 5CSJA 1KSOA 1K9UA 2BL0C 4PHNA 2LUXA 1LA3A 1MQ1A 1IWQA 1R2UA 1UHHA 1UHJA 2O5GA 1IJ6A 4BY4A 2JQ6A 1PK0D 2LLUA 1VRKA 3BUNB 2KFFA 3JTDB 2JPTA 1K8UA 1N2DA 1MHOA 3HX4A 5JJGA 2DOQA 4IL1A 1OSAA 1CDPA 1QTXA 1DJZA 1JBAA 2JULA 1QLSA 1UUSA 2NLNA 2H61A 3EK7A 4QJ4B 1YURA 1KQMC 1QJTA 3TS5B 1OZSA 2AMIA 3FIAA 4MZKA 1SRAA 2M49B 1CFPA 4YGBB 4NDDA 1F70A 1KWOC 3I5FB 1SL8A 1LA0A 1ZOTB 2G9BA 3A8RA 1C07A 3JVTB 1WRLA 1UURA 2K8MB 2KDHA 3O4YA 4PE1A 2JNXA 2KI6D 1DJYA 2KQYA 3NXAA 4QJ3B 4YRUA 1YRTB 1CDNA 3A4UB 3BYAA 4MLWA 1K96A 3CR4X 1GQMA 3BUMB 1S36A 3I5IB 3AKAA 1J7QA 2B1UA 5AEQA 2PRUA 1DT7B 2H2KA 4C0LA 4ZCUA 2KSPA 1B8LA 3SG3A 2JTZA 3TUYC 1JSAA 3CZTX 3PFVA 4GGFA 5KSZA 1ALVA 1QV1A 3GK1A 5HKWA 1CLMA 1G33A 2ISDA 5I2LA 2KBIA 2RGIA 1QX7A 3PSRA 2CXJA 1S6IA 2M9GA 4GNKB 2LP2A 1C7WA 1UHKA 1IRJA 4WQ3A 5BPJA 1NYAA 1H4BA 2D8NA 3AKBA 1BOCA 2ZN9A 1KK7Y 2F33A 1EL4A 2WC8A 1S1EA 1CB1A 2PMYA 1DMOA 1QXPA 2KBMA 3VRNA 3CLNA 2KI4C 3EVUA 4YGCB 5I2QA 1J7OA 2LHIA 1AHRA 1KFXL 2JRFA 2M1UA 3LCPC 2ZFDA 1ZMZA 3AAKA 4PE7A 2JT3A 3PM8A 2ZN8A 1KK7Z 4HSZA 1A29A 1AJ5A 3IQQA 1KK8C 2I18A 4PALA 5DKRA 1TRFA 3O6BA 2LVVA 2GGMA 3OX5A 1DVIA 1IKUA 2BBMA 2F2OA 2MAZA 2K7CA 5AANA 5AFPA 1BR1B 1PALA 2EC6B 1R6PA 1IJ5A 4AOMA 2BECA 1CLBA 1F8HA 1B7TY 3KEVA 1K9PA 3DVJA 2GV5A 3LK1A 2QACA 2R2IA 1BU3A 2KAVA 2AUCA 5PALA 1NCYA 5J3XA 2PALA 4MSPA 5I2OA 1JF0A 2VRGA 1SBJA 1TIZA 1B7TZ 5AXIA 3RM1A 1XK4C 2BKHB 2NZ0A 3RLZA 3SG4A 1CLLA 1DTLA 2F3YA 2K2AA 2LMVA 4FQOA 5DKNA 4DRWA 1TNPA 2OTGB 1J55A 1CMFA 2K0JA 4MVFA 1EG4A 1CM4A 1RROA 1SCVA 3IQOA 2LANA 1EXRA 3DVEA 1V1FA 5D7FA 2LLSA 1UHNA 1LKJA 2E30A 3PN7B 1M45A 2KAYA 2WCEA 4JPZB 3VROA 1AVSA 1MF8B 3JTDC 1Q80A 2MBXA 2BBNA 4JWQA 1K93D 1M31A 1Y1UA 2I7AA 2Y1NA 1BJFA 1TCFA 2M97A 1SW8A 4XJKB 4F0ZB 4YI8A 3NSKA 1RWYA 1SY9A 3D10A 1TNXA 1YVLA 1NCXA 4XJKA 2NXQA 3GK4X 3TS5C 1QVIY 1TN4A 2V53A 1L2OB 4OR9B 1AP4A 4QJ5B 2KQ6A 1QV0A 2G2BA 2M3WA 3NSLA 5DKQA 3I5FC 1NSHA 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  2IS9 A;  5TNC A;  3JVT C;  1U5I B;  3EVV A;  5F6T A;  3CTN A;  3E3R A;  3VRR A;  4D1E A;  3DVM A;  2JXC A;  1GGW A;  1MXL C;  1U5I A;  1YR5 A;  2GGZ A;  2JNF A;  5CSN A;  3OB1 B;  5HYD A;  4C0J A;  1MR8 A;  1NPQ A;  3H4S E;  3M0W A;  5HLV A;  3TDZ A;  2HET A;  4HRG A;  1S5G Y;  4GGF C;  2M29 A;  1BOD A;  1B8R A;  4M2P A;  4L9M A;  3D0Y B;  1AJ4 A;  1HQV A;  4I5K A;  1KFX S;  1F4Q A;  3TZ1 A;  1OZO A;  3D0Y A;  4GFT A;  2WCB A;  4ICB A;  3LL8 B;  3OX6 A;  1S5G Z;  1QAS A;  2F3Z A;  1CFF A;  1CNP A;  1A03 A;  1G4Y R;  5KU1 A;  1BF5 A;  2BE4 A;  1CMG A;  2P6B B;  3MSE B;  1YTZ C;  2EGD A;  2HQW A;  1J7P A;  1BR4 B;  3IF7 A;  3SG2 A;  4N1G A;  4BY5 A;  1SR6 B;  1N65 A;  1J1E A;  1UHI A;  2WOR A;  1IG5 A;  1JUO A;  2MLE C;  3C1V A;  1JWD A;  1QIV A;  2KAX A;  2KFG A;  4PE4 A;  4DCK A;  1KSM A;  1SCM B;  1QS7 A;  3PLF B;  4YI9 A;  2PAS A;  4CFR A;  1LIN A;  4OVN F;  1BMO A;  2LAP A;  4MRX A;  3FWC A;  3GOF A;  2L0P A;  1KWO B;  2EC6 C;  1F71 A;  1A4P A;  2EHB A;  1NCZ A;  3GK2 A;  1FI5 A;  3I5G C;  3I5H B;  3DVK A;  1PSR A;  4PCW A;  1TOP A;  4GAO A;  2I94 A;  2L2E A;  2Q4U A;  4XYN A;  2FCD A;  1DGV A;  1K9K A;  2AAO A;  4WQ2 A;  1OMV A;  2E6W A;  3EVR A;  2ZRT A;  3OP0 A;  1XVJ A;  1YVH A;  2LVK A;  1V1G A;  3WXA A;  2JT0 A;  1NX3 A;  1XFY O;  2OTG C;  1KQV A;  3EK4 A;  1A75 B;  1ZUZ A;  1ZAC A;  3O2P A;  1DJI A;  5AER A;  1RK9 A;  4NQG A;  2MJW B;  5B8I B;  4DS7 A;  4M2O A;  1A75 A;  1LVC D;  3TDU A;  4R1E A;  1M46 A;  3KF9 A;  1BLQ A;  1OE9 B;  3PN7 C;  3BUX B;  1DJH A;  1REC A;  2JC2 A;  2HQ8 A;  5G08 A;  2BE6 A;  3BXK A;  5CSF A;  3LK0 A;  2M0R A;  1EG3 A;  1B1G A;  2PVB A;  2LV7 A;  1MUX A;  2JWW A;  2ZRS A;  1FBV A;  1IQ5 A;  1OMD A;  1CFD A;  1K94 A;  1NUB A;  1NWD A;  2MLF C;  5JOL A;  2SAS A;  2JTT A;  2LM5 A;  3BOW B;  1WRZ A;  1K90 D;  4MZJ A;  1WY9 A;  2JXL A;  2MHH A;  2CCM A;  1WDC B;  3BUW B;  1SPY A;  3BOW A;  1KFU L;  3DF0 B;  1NP8 A;  1B47 A;  4M2Q A;  4ETO A;  1SK6 D;  4MBE A;  1TNW A;  3CS1 A;  2ZND A;  4U8D A;  3F45 A;  1S26 D;  3DF0 A;  1QX2 A;  4N5X A;  1DJW A;  4YBH B;  1TNQ A;  2KGB C;  2O60 A;  1NX1 A;  2H61 C;  2I2R E;  4OV2 A;  1J1D A;  2TN4 A;  1SYM A;  1XFW O;  2OS8 B;  3WHU B;  3SG7 A;  2BCA A;  5HLO A;  1RFJ A;  1DJX A;  2Q91 A;  3SIB A;  1EJ3 A;  2K7O A;  2Y5I A;  4N1F A;  1CDM A;  3KO0 A;  1L7Z A;  1XA5 A;  2COL B;  3HCM A;  3ZNI A;  4C0K A;  1YRU B;  1F4O A;  1NX0 A;  3EKH A;  1DJG A;  1RJV A;  1QX5 B;  2K7B A;  1F54 A;  1UWO A;  1QVI Z;  4HRH A;  2M7L A;  1OMR A;  4NDC A;  3OHM B;  2L51 A;  1H8B A;  1YUT A;  2WND A;  1CKK A;  3I5I C;  4YGA A;  2JU0 A;  2LP3 A;  4USL A;  1IH0 A;  2K61 A;  4MZL A;  1AUI B;  5HKZ A;  3SIA A;  1LXF C;  1PSB A;  1ZFS A;  2LVI A;  2JZI A;  2L50 A;  2JT8 A;  1SR6 C;  1YX7 A;  4P2Y B;  5I8N A;  4JQ0 D;  3VRQ A;  2KFH A;  1AK8 A;  3WNX B;  2LMU A;  1W7I B;  2CTN A;  1QAT A;  1M39 A;  2BL0 B;  1SCM C;  2M8U A;  4A4B A;  3QRX A;  1OOJ A;  1IGV A;  1K2H A;  1GJY A;  1JC2 A;  1DF0 B;  4I5L B;  3TDI A;  2L98 A;  1WRK A;  1PVB A;  3BUO B;  4DUQ A;  4FTG A;  2FJU B;  1DF0 A;  1XFU O;  4PHM A;  3SJS A;  2F8P A;  1Y1X A;  3DD4 A;  5KTY A;  2ZKM X;  2FCE A;  4OCI A;  4P5O E;  3EK8 A;  1RTP 1;  2JOJ A;  2OPO A;  1CFC A;  1M63 B;  3I5H C;  2KYF A;  1MXE A;  2BKI B;  5GQQ C;  1K95 A;  1YX8 A;  1S6J A;  1KQM B;  1Y0V H;  3CWG A;  2LHL A;  4DIR A;  4UPG A;  2CBL A;  3NSO A;  3VRP A;  4MN0 A;  5CSI A;  1B9A A;  1FI6 A;  1YUS A;  1OQP A;  1S3P A;  1SNL A;  2KNE A;  1MWN A;  1PRW A;  4HRE E;  3ICB A;  4A4C A;  3NSI A;  1XFZ O;  2KOT A;  4Q04 A;  2LNK A;  4MRY A;  4I5N B;  1NIW A;  3K21 A;  4PDZ A;  1QLK A;  5D69 A;  1KFU S;  2LUC A;  3CR5 X;  1XFX O;  3OB2 B;  1CDL A;  1BT6 A;  3CGA A;  1XYD A;  4OKH A;  1TCO B;  2L4H A;  3LLE A;  4WRI A;  2K7D A;  3WHT B;  4CFQ A;  1SL9 A;  1J7R A;  2LVJ A;  2M1K B;  3TUY B;  2LMT A;  1W7J B;  1XO5 A;  3BQ3 A;  2L4I A;  1A2X A;  1DGU A;  5FYX A;  4AQJ A;  2HF5 A;  4PHJ A;  1UP5 A;  1ALW A;  2F2P A;  1NX2 A;  1CTR A;  1C7V A;  2KI6 C;  1X02 A;  4NDB A;  1Y6W A;  1Y1A A;  2MRD A;  1WDC C;  1ODB A;  2CT9 A;  1JF2 A;  1TTX A;  2M7N A;  2WOS A;  4YGE B;  3VGO A;  3PAT A;  2NCP A;  2WCF A;  2LCP A;  5ER5 A;  1FPW A;  5ER4 X;  2NCO A;  1S6C A;  2ZNE A;  1B8C A;  2Y4Q A;  3O78 A;  4PE0 A;  1WLM A;  4CLN A;  1FF1 A;  4CPV A;  2KGR A;  1PVA A;  2LC5 A;  2KI4 B;  3FS7 A;  4I5J A;  4TNC A;  4AQI A;  2KHN A;  2Y1M A;  3I5G B;  2BCX A;  2OS8 C;  3KPX A;  2CNP A;  1PUL A;  1KK8 B;  2MA2 A;  4YGD B;  1L2O C;  1BG1 A;  3SG5 A;  4PHK A;  1N0Y A;  1EH2 A;  2A4J A;  1JFJ A;  4GUK A;  1D1O A;  2QPT A;  2PSR A;  1IQ3 A;  5K89 A;  4ORB B;  3FWB A;  1GGZ A;  1SMG A;  3CR2 A;  4ORA B;  4CID A;  3PAL A;  5IBW A;  1HT9 A;  4GBA A;  4E68 A;  1CM1 A;  2HPS A;  1B4C A;  1FW4 A;  5HKY A;  2KYC A;  1JFK A;  4GPL B;  5CPV A;  3ZWH A;  1YUU A;  4MEW A;  3AAJ A;  1QIW A;  4GGN A;  1XFV O;  2LE9 B;  1WLZ A;  3KHE A;  2SCP A;  3SG6 A;  3EKJ A;  1XK4 A;  2L5X B;  2BCB A;  4ZCV A;  1KCY A;  2LLT A;  2K2F A;  4ORC B;  1E8A A;  1SKT A;  1G8I A;  1F55 A;  5CSJ A;  1KSO A;  1K9U A;  2BL0 C;  4PHN A;  2LUX A;  1LA3 A;  1MQ1 A;  1IWQ A;  1R2U A;  1UHH A;  1UHJ A;  2O5G A;  1IJ6 A;  4BY4 A;  2JQ6 A;  1PK0 D;  2LLU A;  1VRK A;  3BUN B;  2KFF A;  3JTD B;  2JPT A;  1K8U A;  1N2D A;  1MHO A;  3HX4 A;  5JJG A;  2DOQ A;  4IL1 A;  1OSA A;  1CDP A;  1QTX A;  1DJZ A;  1JBA A;  2JUL A;  1QLS A;  1UUS A;  2NLN A;  2H61 A;  3EK7 A;  4QJ4 B;  1YUR A;  1KQM C;  1QJT A;  3TS5 B;  1OZS A;  2AMI A;  3FIA A;  4MZK A;  1SRA A;  2M49 B;  1CFP A;  4YGB B;  4NDD A;  1F70 A;  1KWO C;  3I5F B;  1SL8 A;  1LA0 A;  1ZOT B;  2G9B A;  3A8R A;  1C07 A;  3JVT B;  1WRL A;  1UUR A;  2K8M B;  2KDH A;  3O4Y A;  4PE1 A;  2JNX A;  2KI6 D;  1DJY A;  2KQY A;  3NXA A;  4QJ3 B;  4YRU A;  1YRT B;  1CDN A;  3A4U B;  3BYA A;  4MLW A;  1K96 A;  3CR4 X;  1GQM A;  3BUM B;  1S36 A;  3I5I B;  3AKA A;  1J7Q A;  2B1U A;  5AEQ A;  2PRU A;  1DT7 B;  2H2K A;  4C0L A;  4ZCU A;  2KSP A;  1B8L A;  3SG3 A;  2JTZ A;  3TUY C;  1JSA A;  3CZT X;  3PFV A;  4GGF A;  5KSZ A;  1ALV A;  1QV1 A;  3GK1 A;  5HKW A;  1CLM A;  1G33 A;  2ISD A;  5I2L A;  2KBI A;  2RGI A;  1QX7 A;  3PSR A;  2CXJ A;  1S6I A;  2M9G A;  4GNK B;  2LP2 A;  1C7W A;  1UHK A;  1IRJ A;  4WQ3 A;  5BPJ A;  1NYA A;  1H4B A;  2D8N A;  3AKB A;  1BOC A;  2ZN9 A;  1KK7 Y;  2F33 A;  1EL4 A;  2WC8 A;  1S1E A;  1CB1 A;  2PMY A;  1DMO A;  1QXP A;  2KBM A;  3VRN A;  3CLN A;  2KI4 C;  3EVU A;  4YGC B;  5I2Q A;  1J7O A;  2LHI A;  1AHR A;  1KFX L;  2JRF A;  2M1U A;  3LCP C;  2ZFD A;  1ZMZ A;  3AAK A;  4PE7 A;  2JT3 A;  3PM8 A;  2ZN8 A;  1KK7 Z;  4HSZ A;  1A29 A;  1AJ5 A;  3IQQ A;  1KK8 C;  2I18 A;  4PAL A;  5DKR A;  1TRF A;  3O6B A;  2LVV A;  2GGM A;  3OX5 A;  1DVI A;  1IKU A;  2BBM A;  2F2O A;  2MAZ A;  2K7C A;  5AAN A;  5AFP A;  1BR1 B;  1PAL A;  2EC6 B;  1R6P A;  1IJ5 A;  4AOM A;  2BEC A;  1CLB A;  1F8H A;  1B7T Y;  3KEV A;  1K9P A;  3DVJ A;  2GV5 A;  3LK1 A;  2QAC A;  2R2I A;  1BU3 A;  2KAV A;  2AUC A;  5PAL A;  1NCY A;  5J3X A;  2PAL A;  4MSP A;  5I2O A;  1JF0 A;  2VRG A;  1SBJ A;  1TIZ A;  1B7T Z;  5AXI A;  3RM1 A;  1XK4 C;  2BKH B;  2NZ0 A;  3RLZ A;  3SG4 A;  1CLL A;  1DTL A;  2F3Y A;  2K2A A;  2LMV A;  4FQO A;  5DKN A;  4DRW A;  1TNP A;  2OTG B;  1J55 A;  1CMF A;  2K0J A;  4MVF A;  1EG4 A;  1CM4 A;  1RRO A;  1SCV A;  3IQO A;  2LAN A;  1EXR A;  3DVE A;  1V1F A;  5D7F A;  2LLS A;  1UHN A;  1LKJ A;  2E30 A;  3PN7 B;  1M45 A;  2KAY A;  2WCE A;  4JPZ B;  3VRO A;  1AVS A;  1MF8 B;  3JTD C;  1Q80 A;  2MBX A;  2BBN A;  4JWQ A;  1K93 D;  1M31 A;  1Y1U A;  2I7A A;  2Y1N A;  1BJF A;  1TCF A;  2M97 A;  1SW8 A;  4XJK B;  4F0Z B;  4YI8 A;  3NSK A;  1RWY A;  1SY9 A;  3D10 A;  1TNX A;  1YVL A;  1NCX A;  4XJK A;  2NXQ A;  3GK4 X;  3TS5 C;  1QVI Y;  1TN4 A;  2V53 A;  1L2O B;  4OR9 B;  1AP4 A;  4QJ5 B;  2KQ6 A;  1QV0 A;  2G2B A;  2M3W A;  3NSL A;  5DKQ A;  3I5F C;  1NSH A;  1SL7 A; 
#chains in the Genus database with same CATH topology
 1DEK A;  2FOT A;  2IS9 A;  5TNC A;  3JVT C;  1U5I B;  3EVV A;  5F6T A;  3CTN A;  3E3R A;  3VRR A;  4D1E A;  3DVM A;  3CYZ A;  2JXC A;  3BFH A;  3D73 A;  1GGW A;  1MXL C;  1U5I A;  2QEO A;  3D74 A;  1YR5 A;  2GGZ A;  2JNF A;  5CSN A;  3OB1 B;  5HYD A;  4C0J A;  1MR8 A;  1NPQ A;  3H4S E;  3M0W A;  4IJ7 A;  5HLV A;  3B87 A;  3TDZ A;  2HET A;  4HRG A;  1S5G Y;  4GGF C;  2M29 A;  1BOD A;  1B8R A;  3SS4 A;  4M2P A;  4L9M A;  3D0Y B;  1AJ4 A;  1HQV A;  4I5K A;  3D75 A;  1KFX S;  3SS3 A;  2WCH A;  1F4Q A;  3TZ1 A;  1OZO A;  3D0Y A;  4GFT A;  2WCB A;  4ICB A;  3LL8 B;  3OX6 A;  1S5G Z;  1QAS A;  2F3Z A;  3SS5 A;  1CFF A;  1CNP A;  5I94 A;  1A03 A;  1G4Y R;  5KU1 A;  1BF5 A;  2BE4 A;  2L5Y A;  1CMG A;  2P6B B;  3MSE B;  1YTZ C;  2EGD A;  3R1V A;  2HQW A;  1IIO A;  1J7P A;  1BR4 B;  3IF7 A;  3SG2 A;  4N1G A;  4BY5 A;  1SR6 B;  2P70 A;  1N65 A;  1J1E A;  1UHI A;  2WOR A;  1IG5 A;  1JUO A;  2MLE C;  3C1V A;  1JWD A;  1QIV A;  2KAX A;  2KFG A;  4PE4 A;  4DCK A;  1KSM A;  1SCM B;  1QS7 A;  3PLF B;  4YI9 A;  2PAS A;  4CFR A;  1LIN A;  4OVN F;  1BMO A;  2LAP A;  4MRX A;  5FI2 A;  3FWC A;  4OZD A;  3FE6 A;  3GOF A;  2L0P A;  1KWO B;  1ORG A;  2EC6 C;  1QWV A;  1F71 A;  1A4P A;  1W9Z A;  1NCZ A;  2EHB A;  3GK2 A;  1FI5 A;  3CZ1 A;  3I5G C;  1OOF A;  3I5H B;  3DVK A;  1PSR A;  4PCW A;  1TOP A;  3S0D A;  2QEV A;  4GAO A;  3D78 A;  2I94 A;  2L2E A;  2Q4U A;  4XYN A;  2FCD A;  1DGV A;  1K9K A;  2AAO A;  4WQ2 A;  1OMV A;  2E6W A;  3EVR A;  2ZRT A;  3OP0 A;  1XVJ A;  1YVH A;  2LVK A;  1V1G A;  3WXA A;  2JT0 A;  1NX3 A;  1XFY O;  2OTG C;  3S0B A;  1KQV A;  3EK4 A;  1A75 B;  1ZUZ A;  1ZAC A;  3O2P A;  1DJI A;  5AER A;  2WCL A;  1RK9 A;  4NQG A;  2MJW B;  5B8I B;  4DS7 A;  4M2O A;  1A75 A;  1LVC D;  3TDU A;  4R1E A;  1M46 A;  3KF9 A;  1BLQ A;  1OE9 B;  2QEH A;  3PN7 C;  3BUX B;  1DJH A;  1REC A;  2JC2 A;  2HQ8 A;  5G08 A;  2BE6 A;  2WC5 A;  3BXK A;  5CSF A;  3LK0 A;  2M0R A;  1EG3 A;  1B1G A;  1SSE B;  2KPH A;  2LV7 A;  1MUX A;  2JWW A;  2PVB A;  2ZRS A;  3CAB A;  3CZ0 A;  1FBV A;  3IVT A;  1IQ5 A;  1OMD A;  1CFD A;  1K94 A;  1NUB A;  1NWD A;  2MLF C;  5JOL A;  2SAS A;  2JTT A;  2LM5 A;  3BOW B;  1WRZ A;  1K90 D;  4MZJ A;  1WY9 A;  2JXL A;  2MHH A;  2CCM A;  1WDC B;  3BUW B;  1SPY A;  3BOW A;  1KFU L;  3DF0 B;  1NP8 A;  1B47 A;  4M2Q A;  4ETO A;  1SK6 D;  4MBE A;  1TNW A;  5KSZ A;  3CS1 A;  2ZND A;  4U8D A;  3F45 A;  2ERB A;  1S26 D;  5FI6 A;  3DF0 A;  1QX2 A;  4N5X A;  1DJW A;  4YBH B;  1C3Z A;  2PQL A;  1TNQ A;  2KGB C;  2O60 A;  1NX1 A;  2H61 C;  2I2R E;  4OV2 A;  1TWO A;  1J1D A;  2TN4 A;  1SYM A;  1XFW O;  2OS8 B;  3WHU B;  3SG7 A;  2BCA A;  5HLO A;  1RFJ A;  1DJX A;  2Q91 A;  3SIB A;  3S0A A;  1EJ3 A;  2K7O A;  2Y5I A;  4N1F A;  1CDM A;  3KO0 A;  1L7Z A;  1XA5 A;  2COL B;  3HCM A;  3ZNI A;  2QDI A;  4C0K A;  1YRU B;  1F4O A;  1NX0 A;  3EKH A;  1DJG A;  1RJV A;  1QX5 B;  2K7B A;  1F54 A;  1UWO A;  1QVI Z;  4HRH A;  2KLE A;  2M7L A;  1OMR A;  1DC1 A;  4NDC A;  3OHM B;  2L51 A;  1H8B A;  1YUT A;  2WND A;  3L4L A;  1CKK A;  1LS8 A;  3I5I C;  2JU0 A;  2LP3 A;  4USL A;  4YGA A;  1IH0 A;  2K61 A;  4MZL A;  1AUI B;  1TUJ A;  5HKZ A;  3SIA A;  1LXF C;  3PJI A;  1PSB A;  1ZFS A;  2LVI A;  4INX A;  1C3Y A;  2JZI A;  2L50 A;  2JT8 A;  1SR6 C;  1YX7 A;  4P2Y B;  5I8N A;  4JQ0 D;  3VRQ A;  2KFH A;  1AK8 A;  3WNX B;  2LMU A;  1W7I B;  2CTN A;  1QAT A;  1M39 A;  2BL0 B;  1SCM C;  2M8U A;  3N7H A;  4A4B A;  3QRX A;  1OOJ A;  3R1P A;  1IGV A;  3NGV A;  1GJY A;  1K2H A;  1JC2 A;  1DF0 B;  4I5L B;  5D3O A;  3TDI A;  2L98 A;  3L4A A;  1WRK A;  1PVB A;  3BUO B;  4DUQ A;  3UNW A;  4FTG A;  2FJU B;  1DF0 A;  1XFU O;  4PHM A;  3SJS A;  2F8P A;  1Y1X A;  2P71 A;  3DD4 A;  5KTY A;  2ZKM X;  2FCE A;  4OCI A;  4P5O E;  3EK8 A;  1RTP 1;  2JOJ A;  2OPO A;  1CFC A;  1M63 B;  3I5H C;  2KYF A;  1MXE A;  2BKI B;  5GQQ C;  1K95 A;  1YX8 A;  1S6J A;  2YGU A;  1KQM B;  1Y0V H;  3V2L A;  3CWG A;  2LHL A;  4DIR A;  3K1E A;  4UPG A;  2CBL A;  3NSO A;  3VRP A;  4MN0 A;  3DZT A;  5CSI A;  1B9A A;  1FI6 A;  1YUS A;  2H8V A;  1OQP A;  1S3P A;  1SNL A;  3EG5 B;  3L47 A;  2KNE A;  1MWN A;  1PRW A;  4HRE E;  1Z2C B;  3ICB A;  4A4C A;  3NSI A;  1XFZ O;  2KOT A;  2WCK A;  4Q04 A;  2LNK A;  4MRY A;  4I5N B;  1NIW A;  3B86 A;  3K21 A;  4PDZ A;  1QLK A;  4INW A;  5D69 A;  1KFU S;  2LUC A;  3CR5 X;  1XFX O;  3OB2 B;  1CDL A;  1BT6 A;  3CGA A;  1XYD A;  4FQT A;  4OKH A;  1TCO B;  2L4H A;  3LLE A;  4WRI A;  2K7D A;  3WHT B;  1TUZ A;  1SL9 A;  1J7R A;  2LVJ A;  2M1K B;  4CFQ A;  3TUY B;  2LMT A;  3BJH A;  4JD9 A;  1W7J B;  1XO5 A;  3BQ3 A;  2L4I A;  1A2X A;  1DGU A;  5FYX A;  4AQJ A;  2HF5 A;  4PHJ A;  1UP5 A;  1ALW A;  2F2P A;  1NX2 A;  1CTR A;  1C7V A;  2KI6 C;  1X02 A;  4NDB A;  1Y6W A;  1Y1A A;  2MRD A;  1WDC C;  1ODB A;  2CT9 A;  3B88 A;  1JF2 A;  1TTX A;  2M7N A;  3D77 A;  2WOS A;  4YGE B;  3VGO A;  3PAT A;  2NCP A;  2WCF A;  2LCP A;  5ER5 A;  1FPW A;  5ER4 X;  2NCO A;  1S6C A;  2ZNE A;  1B8C A;  2Y4Q A;  3O78 A;  4PE0 A;  1WLM A;  4CLN A;  1FF1 A;  4CPV A;  2KGR A;  2KLD A;  1PVA A;  2LC5 A;  2KI4 B;  2WCJ A;  3FS7 A;  4I5J A;  4TNC A;  4AQI A;  2KHN A;  2Y1M A;  3I5G B;  2BCX A;  2OS8 C;  3KPX A;  2CNP A;  1DQE A;  1PUL A;  1KK8 B;  2MA2 A;  4YGD B;  1L2O C;  1BG1 A;  3SG5 A;  4PHK A;  1N0Y A;  1EH2 A;  2A4J A;  1JFJ A;  4GUK A;  1D1O A;  2QPT A;  2PSR A;  1IQ3 A;  5K89 A;  4ORB B;  3FWB A;  1GGZ A;  1SMG A;  3CR2 A;  4ORA B;  4CID A;  2JPO A;  3PAL A;  5IBW A;  1HT9 A;  4GBA A;  4E68 A;  1CM1 A;  2HPS A;  1B4C A;  1FW4 A;  3D76 A;  5HKY A;  2KYC A;  1JFK A;  4GPL B;  5CPV A;  3ZWH A;  1YUU A;  1OOG A;  4MEW A;  3AAJ A;  1QIW A;  3DY9 A;  4GGN A;  1XFV O;  4PT1 A;  2LE9 B;  1WLZ A;  3B6X A;  2SCP A;  3KHE A;  3SG6 A;  3EKJ A;  1XK4 A;  2L5X B;  2BCB A;  3DYE A;  4ZCV A;  1KCY A;  2LLT A;  2K2F A;  4ORC B;  1E8A A;  1SKT A;  1G8I A;  1F55 A;  5CSJ A;  1T14 A;  1KSO A;  1K9U A;  2BL0 C;  4PHN A;  2LUX A;  1LA3 A;  1MQ1 A;  1IWQ A;  1R2U A;  1UHH A;  2QEB A;  1UHJ A;  2O5G A;  1IJ6 A;  4BY4 A;  4JKT A;  2JQ6 A;  1PK0 D;  2LLU A;  1VRK A;  3BUN B;  2KFF A;  3JTD B;  5DIC A;  2JPT A;  1K8U A;  1N2D A;  1MHO A;  2GTE A;  3HX4 A;  5JJG A;  2DOQ A;  4IL1 A;  1OSA A;  1CDP A;  1QTX A;  1Z4H A;  1DJZ A;  1JBA A;  2JUL A;  1QLS A;  1UUS A;  2NLN A;  2H61 A;  3EK7 A;  4QJ4 B;  1YUR A;  1KQM C;  1QJT A;  3TS5 B;  1XFR A;  1OZS A;  2AMI A;  3FIA A;  4MZK A;  1SRA A;  2M49 B;  1CFP A;  1DEL A;  4F7F A;  4YGB B;  4NDD A;  1F70 A;  1KWO C;  3I5F B;  1SL8 A;  1LA0 A;  1ZOT B;  2G9B A;  2BNX A;  3A8R A;  1C07 A;  3JVT B;  3OGN A;  1WRL A;  1UUR A;  2K8M B;  2KDH A;  3O4Y A;  4PE1 A;  2JNX A;  2KI6 D;  1DJY A;  2KQY A;  3NXA A;  4QJ3 B;  3S0F A;  4YRU A;  1OW4 A;  1YRT B;  3A4U B;  1CDN A;  3BYA A;  4MLW A;  1K96 A;  3CR4 X;  1GQM A;  3BUM B;  1S36 A;  3I5I B;  5EL2 A;  3AKA A;  1J7Q A;  2FJY A;  2B1U A;  5AEQ A;  2PRU A;  1DT7 B;  2H2K A;  4C0L A;  4ZCU A;  2KSP A;  1B8L A;  3SG3 A;  2JTZ A;  3CZ2 A;  3TUY C;  1JSA A;  3R72 A;  2BAP A;  3CZT X;  3FE9 A;  3PFV A;  1ALV A;  1QV1 A;  3GK1 A;  4GGF A;  1CLM A;  5HKW A;  1G33 A;  2ISD A;  5HL1 A;  1OOI X;  3RZS A;  2K60 A;  5I2L A;  3S0G A;  2KBI A;  2RGI A;  1QX7 A;  3PSR A;  2CXJ A;  1S6I A;  2M9G A;  4GNK B;  2LP2 A;  1C7W A;  1UHK A;  3Q8I A;  1IRJ A;  4WQ3 A;  5BPJ A;  1NYA A;  3CDN A;  3VB1 A;  1H4B A;  2D8N A;  3AKB A;  3BFB A;  3OBV A;  2ZN9 A;  1KK7 Y;  2F33 A;  1BOC A;  1EL4 A;  2WC8 A;  1S1E A;  1CB1 A;  5FI7 A;  2PMY A;  3B7A A;  1DMO A;  1QXP A;  2KBM A;  3VRN A;  3CLN A;  2KI4 C;  3EVU A;  4YGC B;  5I2Q A;  1J7O A;  2LHI A;  3FE8 A;  1OOH A;  1AHR A;  1KFX L;  2JRF A;  2M1U A;  3LCP C;  3O4X A;  2ZFD A;  1ZMZ A;  3AAK A;  4PE7 A;  2JT3 A;  3PM8 A;  2ZN8 A;  1KK7 Z;  4HSZ A;  1A29 A;  2L2C A;  1AJ5 A;  3IQQ A;  1KK8 C;  2I18 A;  4PAL A;  3S0E A;  5DKR A;  1TRF A;  3O6B A;  2LVV A;  2GGM A;  3OX5 A;  1DVI A;  1IKU A;  2BBM A;  2F2O A;  2MAZ A;  2K7C A;  5AAN A;  5AFP A;  1BR1 B;  1PAL A;  2EC6 B;  1R6P A;  1IJ5 A;  4AOM A;  2BEC A;  1CLB A;  1F8H A;  1GM0 A;  1B7T Y;  3KEV A;  1K9P A;  3DVJ A;  2GV5 A;  3LK1 A;  2QAC A;  2R2I A;  1BU3 A;  2KAV A;  2AUC A;  3NHT A;  5PAL A;  1NCY A;  1P28 A;  5J3X A;  2PAL A;  3NHI A;  4MSP A;  3UO9 A;  5I2O A;  3DXL A;  1JF0 A;  2PYQ A;  2VRG A;  1SBJ A;  1TIZ A;  1B7T Z;  5AXI A;  3RM1 A;  1XK4 C;  2BKH B;  2NZ0 A;  3RLZ A;  3SG4 A;  1CLL A;  1DTL A;  2F3Y A;  2K2A A;  2LMV A;  4FQO A;  5DKN A;  4DRW A;  1TNP A;  2OTG B;  1J55 A;  1CMF A;  3R1O A;  2K0J A;  4MVF A;  1EG4 A;  1CM4 A;  1RRO A;  1SCV A;  3IQO A;  2LAN A;  1EXR A;  3DVE A;  1V1F A;  2WCM A;  5D7F A;  2LLS A;  1UHN A;  1LKJ A;  2E30 A;  3PN7 B;  1M45 A;  2KAY A;  2WCE A;  4JPZ B;  4KYN A;  3VRO A;  1AVS A;  1MF8 B;  3JTD C;  1Q80 A;  2MBX A;  2BBN A;  4JWQ A;  1K93 D;  1M31 A;  1Y1U A;  2I7A A;  2Y1N A;  1BJF A;  1TCF A;  2M97 A;  1SW8 A;  4XJK B;  4F0Z B;  4YI8 A;  3NSK A;  1RWY A;  1SY9 A;  3D10 A;  1TNX A;  1YVL A;  2WC6 A;  3BFA A;  1NCX A;  4XJK A;  2NXQ A;  3GK4 X;  3TS5 C;  1QVI Y;  1TN4 A;  2V53 A;  1L2O B;  4OR9 B;  1AP4 A;  4QJ5 B;  2KQ6 A;  1QV0 A;  2G2B A;  2M3W A;  3QME A;  3NSL A;  3PM2 A;  5DKQ A;  3I5F C;  1NSH A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 2FOT A;  2IS9 A;  5TNC A;  3JVT C;  1U5I B;  3EVV A;  5F6T A;  3CTN A;  3E3R A;  3VRR A;  4D1E A;  3DVM A;  2JXC A;  1GGW A;  1MXL C;  1U5I A;  1YR5 A;  2GGZ A;  2JNF A;  5CSN A;  3OB1 B;  5HYD A;  4C0J A;  1MR8 A;  1NPQ A;  3H4S E;  3M0W A;  5HLV A;  3TDZ A;  2HET A;  4HRG A;  1S5G Y;  4GGF C;  2M29 A;  1BOD A;  1B8R A;  4M2P A;  4L9M A;  3D0Y B;  1AJ4 A;  1HQV A;  4I5K A;  1KFX S;  1F4Q A;  3TZ1 A;  1OZO A;  3D0Y A;  4GFT A;  2WCB A;  4ICB A;  3LL8 B;  3OX6 A;  1S5G Z;  1QAS A;  2F3Z A;  1CFF A;  1CNP A;  1A03 A;  1G4Y R;  5KU1 A;  1BF5 A;  2BE4 A;  1CMG A;  2P6B B;  3MSE B;  1YTZ C;  2EGD A;  2HQW A;  1J7P A;  1BR4 B;  3IF7 A;  3SG2 A;  4N1G A;  4BY5 A;  1SR6 B;  1N65 A;  1J1E A;  1UHI A;  2WOR A;  1IG5 A;  1JUO A;  2MLE C;  3C1V A;  1JWD A;  1QIV A;  2KAX A;  2KFG A;  4PE4 A;  4DCK A;  1KSM A;  1SCM B;  1QS7 A;  3PLF B;  4YI9 A;  2PAS A;  4CFR A;  1LIN A;  4OVN F;  1BMO A;  2LAP A;  4MRX A;  3FWC A;  3GOF A;  2L0P A;  1KWO B;  2EC6 C;  1F71 A;  1A4P A;  2EHB A;  1NCZ A;  3GK2 A;  1FI5 A;  3I5G C;  3I5H B;  3DVK A;  1PSR A;  4PCW A;  1TOP A;  4GAO A;  2I94 A;  2L2E A;  2Q4U A;  4XYN A;  2FCD A;  1DGV A;  1K9K A;  2AAO A;  4WQ2 A;  1OMV A;  2E6W A;  3EVR A;  2ZRT A;  3OP0 A;  1XVJ A;  1YVH A;  2LVK A;  1V1G A;  3WXA A;  2JT0 A;  1NX3 A;  1XFY O;  2OTG C;  1KQV A;  3EK4 A;  1A75 B;  1ZUZ A;  1ZAC A;  3O2P A;  1DJI A;  5AER A;  1RK9 A;  4NQG A;  2MJW B;  5B8I B;  4DS7 A;  4M2O A;  1A75 A;  1LVC D;  3TDU A;  4R1E A;  1M46 A;  3KF9 A;  1BLQ A;  1OE9 B;  3PN7 C;  3BUX B;  1DJH A;  1REC A;  2JC2 A;  2HQ8 A;  5G08 A;  2BE6 A;  3BXK A;  5CSF A;  3LK0 A;  2M0R A;  1EG3 A;  1B1G A;  2PVB A;  2LV7 A;  1MUX A;  2JWW A;  2ZRS A;  1FBV A;  1IQ5 A;  1OMD A;  1CFD A;  1K94 A;  1NUB A;  1NWD A;  2MLF C;  5JOL A;  2SAS A;  2JTT A;  2LM5 A;  3BOW B;  1WRZ A;  1K90 D;  4MZJ A;  1WY9 A;  2JXL A;  2MHH A;  2CCM A;  1WDC B;  3BUW B;  1SPY A;  3BOW A;  1KFU L;  3DF0 B;  1NP8 A;  1B47 A;  4M2Q A;  4ETO A;  1SK6 D;  4MBE A;  1TNW A;  3CS1 A;  2ZND A;  4U8D A;  3F45 A;  1S26 D;  3DF0 A;  1QX2 A;  4N5X A;  1DJW A;  4YBH B;  1TNQ A;  2KGB C;  2O60 A;  1NX1 A;  2H61 C;  2I2R E;  4OV2 A;  1J1D A;  2TN4 A;  1SYM A;  1XFW O;  2OS8 B;  3WHU B;  3SG7 A;  2BCA A;  5HLO A;  1RFJ A;  1DJX A;  2Q91 A;  3SIB A;  1EJ3 A;  2K7O A;  2Y5I A;  4N1F A;  1CDM A;  3KO0 A;  1L7Z A;  1XA5 A;  2COL B;  3HCM A;  3ZNI A;  4C0K A;  1YRU B;  1F4O A;  1NX0 A;  3EKH A;  1DJG A;  1RJV A;  1QX5 B;  2K7B A;  1F54 A;  1UWO A;  1QVI Z;  4HRH A;  2M7L A;  1OMR A;  4NDC A;  3OHM B;  2L51 A;  1H8B A;  1YUT A;  2WND A;  1CKK A;  3I5I C;  4YGA A;  2JU0 A;  2LP3 A;  4USL A;  1IH0 A;  2K61 A;  4MZL A;  1AUI B;  5HKZ A;  3SIA A;  1LXF C;  1PSB A;  1ZFS A;  2LVI A;  2JZI A;  2L50 A;  2JT8 A;  1SR6 C;  1YX7 A;  4P2Y B;  5I8N A;  4JQ0 D;  3VRQ A;  2KFH A;  1AK8 A;  3WNX B;  2LMU A;  1W7I B;  2CTN A;  1QAT A;  1M39 A;  2BL0 B;  1SCM C;  2M8U A;  4A4B A;  3QRX A;  1OOJ A;  1IGV A;  1K2H A;  1GJY A;  1JC2 A;  1DF0 B;  4I5L B;  3TDI A;  2L98 A;  1WRK A;  1PVB A;  3BUO B;  4DUQ A;  4FTG A;  2FJU B;  1DF0 A;  1XFU O;  4PHM A;  3SJS A;  2F8P A;  1Y1X A;  3DD4 A;  5KTY A;  2ZKM X;  2FCE A;  4OCI A;  4P5O E;  3EK8 A;  1RTP 1;  2JOJ A;  2OPO A;  1CFC A;  1M63 B;  3I5H C;  2KYF A;  1MXE A;  2BKI B;  5GQQ C;  1K95 A;  1YX8 A;  1S6J A;  1KQM B;  1Y0V H;  3CWG A;  2LHL A;  4DIR A;  4UPG A;  2CBL A;  3NSO A;  3VRP A;  4MN0 A;  5CSI A;  1B9A A;  1FI6 A;  1YUS A;  1OQP A;  1S3P A;  1SNL A;  2KNE A;  1MWN A;  1PRW A;  4HRE E;  3ICB A;  4A4C A;  3NSI A;  1XFZ O;  2KOT A;  4Q04 A;  2LNK A;  4MRY A;  4I5N B;  1NIW A;  3K21 A;  4PDZ A;  1QLK A;  5D69 A;  1KFU S;  2LUC A;  3CR5 X;  1XFX O;  3OB2 B;  1CDL A;  1BT6 A;  3CGA A;  1XYD A;  4OKH A;  1TCO B;  2L4H A;  3LLE A;  4WRI A;  2K7D A;  3WHT B;  4CFQ A;  1SL9 A;  1J7R A;  2LVJ A;  2M1K B;  3TUY B;  2LMT A;  1W7J B;  1XO5 A;  3BQ3 A;  2L4I A;  1A2X A;  1DGU A;  5FYX A;  4AQJ A;  2HF5 A;  4PHJ A;  1UP5 A;  1ALW A;  2F2P A;  1NX2 A;  1CTR A;  1C7V A;  2KI6 C;  1X02 A;  4NDB A;  1Y6W A;  1Y1A A;  2MRD A;  1WDC C;  1ODB A;  2CT9 A;  1JF2 A;  1TTX A;  2M7N A;  2WOS A;  4YGE B;  3VGO A;  3PAT A;  2NCP A;  2WCF A;  2LCP A;  5ER5 A;  1FPW A;  5ER4 X;  2NCO A;  1S6C A;  2ZNE A;  1B8C A;  2Y4Q A;  3O78 A;  4PE0 A;  1WLM A;  4CLN A;  1FF1 A;  4CPV A;  2KGR A;  1PVA A;  2LC5 A;  2KI4 B;  3FS7 A;  4I5J A;  4TNC A;  4AQI A;  2KHN A;  2Y1M A;  3I5G B;  2BCX A;  2OS8 C;  3KPX A;  2CNP A;  1PUL A;  1KK8 B;  2MA2 A;  4YGD B;  1L2O C;  1BG1 A;  3SG5 A;  4PHK A;  1N0Y A;  1EH2 A;  2A4J A;  1JFJ A;  4GUK A;  1D1O A;  2QPT A;  2PSR A;  1IQ3 A;  5K89 A;  4ORB B;  3FWB A;  1GGZ A;  1SMG A;  3CR2 A;  4ORA B;  4CID A;  3PAL A;  5IBW A;  1HT9 A;  4GBA A;  4E68 A;  1CM1 A;  2HPS A;  1B4C A;  1FW4 A;  5HKY A;  2KYC A;  1JFK A;  4GPL B;  5CPV A;  3ZWH A;  1YUU A;  4MEW A;  3AAJ A;  1QIW A;  4GGN A;  1XFV O;  2LE9 B;  1WLZ A;  3KHE A;  2SCP A;  3SG6 A;  3EKJ A;  1XK4 A;  2L5X B;  2BCB A;  4ZCV A;  1KCY A;  2LLT A;  2K2F A;  4ORC B;  1E8A A;  1SKT A;  1G8I A;  1F55 A;  5CSJ A;  1KSO A;  1K9U A;  2BL0 C;  4PHN A;  2LUX A;  1LA3 A;  1MQ1 A;  1IWQ A;  1R2U A;  1UHH A;  1UHJ A;  2O5G A;  1IJ6 A;  4BY4 A;  2JQ6 A;  1PK0 D;  2LLU A;  1VRK A;  3BUN B;  2KFF A;  3JTD B;  2JPT A;  1K8U A;  1N2D A;  1MHO A;  3HX4 A;  5JJG A;  2DOQ A;  4IL1 A;  1OSA A;  1CDP A;  1QTX A;  1DJZ A;  1JBA A;  2JUL A;  1QLS A;  1UUS A;  2NLN A;  2H61 A;  3EK7 A;  4QJ4 B;  1YUR A;  1KQM C;  1QJT A;  3TS5 B;  1OZS A;  2AMI A;  3FIA A;  4MZK A;  1SRA A;  2M49 B;  1CFP A;  4YGB B;  4NDD A;  1F70 A;  1KWO C;  3I5F B;  1SL8 A;  1LA0 A;  1ZOT B;  2G9B A;  3A8R A;  1C07 A;  3JVT B;  1WRL A;  1UUR A;  2K8M B;  2KDH A;  3O4Y A;  4PE1 A;  2JNX A;  2KI6 D;  1DJY A;  2KQY A;  3NXA A;  4QJ3 B;  4YRU A;  1YRT B;  1CDN A;  3A4U B;  3BYA A;  4MLW A;  1K96 A;  3CR4 X;  1GQM A;  3BUM B;  1S36 A;  3I5I B;  3AKA A;  1J7Q A;  2B1U A;  5AEQ A;  2PRU A;  1DT7 B;  2H2K A;  4C0L A;  4ZCU A;  2KSP A;  1B8L A;  3SG3 A;  2JTZ A;  3TUY C;  1JSA A;  3CZT X;  3PFV A;  4GGF A;  5KSZ A;  1ALV A;  1QV1 A;  3GK1 A;  5HKW A;  1CLM A;  1G33 A;  2ISD A;  5I2L A;  2KBI A;  2RGI A;  1QX7 A;  3PSR A;  2CXJ A;  1S6I A;  2M9G A;  4GNK B;  2LP2 A;  1C7W A;  1UHK A;  1IRJ A;  4WQ3 A;  5BPJ A;  1NYA A;  1H4B A;  2D8N A;  3AKB A;  1BOC A;  2ZN9 A;  1KK7 Y;  2F33 A;  1EL4 A;  2WC8 A;  1S1E A;  1CB1 A;  2PMY A;  1DMO A;  1QXP A;  2KBM A;  3VRN A;  3CLN A;  2KI4 C;  3EVU A;  4YGC B;  5I2Q A;  1J7O A;  2LHI A;  1AHR A;  1KFX L;  2JRF A;  2M1U A;  3LCP C;  2ZFD A;  1ZMZ A;  3AAK A;  4PE7 A;  2JT3 A;  3PM8 A;  2ZN8 A;  1KK7 Z;  4HSZ A;  1A29 A;  1AJ5 A;  3IQQ A;  1KK8 C;  2I18 A;  4PAL A;  5DKR A;  1TRF A;  3O6B A;  2LVV A;  2GGM A;  3OX5 A;  1DVI A;  1IKU A;  2BBM A;  2F2O A;  2MAZ A;  2K7C A;  5AAN A;  5AFP A;  1BR1 B;  1PAL A;  2EC6 B;  1R6P A;  1IJ5 A;  4AOM A;  2BEC A;  1CLB A;  1F8H A;  1B7T Y;  3KEV A;  1K9P A;  3DVJ A;  2GV5 A;  3LK1 A;  2QAC A;  2R2I A;  1BU3 A;  2KAV A;  2AUC A;  5PAL A;  1NCY A;  5J3X A;  2PAL A;  4MSP A;  5I2O A;  1JF0 A;  2VRG A;  1SBJ A;  1TIZ A;  1B7T Z;  5AXI A;  3RM1 A;  1XK4 C;  2BKH B;  2NZ0 A;  3RLZ A;  3SG4 A;  1CLL A;  1DTL A;  2F3Y A;  2K2A A;  2LMV A;  4FQO A;  5DKN A;  4DRW A;  1TNP A;  2OTG B;  1J55 A;  1CMF A;  2K0J A;  4MVF A;  1EG4 A;  1CM4 A;  1RRO A;  1SCV A;  3IQO A;  2LAN A;  1EXR A;  3DVE A;  1V1F A;  5D7F A;  2LLS A;  1UHN A;  1LKJ A;  2E30 A;  3PN7 B;  1M45 A;  2KAY A;  2WCE A;  4JPZ B;  3VRO A;  1AVS A;  1MF8 B;  3JTD C;  1Q80 A;  2MBX A;  2BBN A;  4JWQ A;  1K93 D;  1M31 A;  1Y1U A;  2I7A A;  2Y1N A;  1BJF A;  1TCF A;  2M97 A;  1SW8 A;  4XJK B;  4F0Z B;  4YI8 A;  3NSK A;  1RWY A;  1SY9 A;  3D10 A;  1TNX A;  1YVL A;  1NCX A;  4XJK A;  2NXQ A;  3GK4 X;  3TS5 C;  1QVI Y;  1TN4 A;  2V53 A;  1L2O B;  4OR9 B;  1AP4 A;  4QJ5 B;  2KQ6 A;  1QV0 A;  2G2B A;  2M3W A;  3NSL A;  5DKQ A;  3I5F C;  1NSH A;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...