1NX1A

Calpain domain vi complexed with calpastatin inhibitory domain c (dic)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx1A00
3HCMA 1C7WA 4GGFA 2ZN9A 3RLZA 1TIZA 1QX7A 1RROA 3F45A 4ORCB 1JC2A 5D7FA 2HF5A 2JNFA 1AP4A 2PRUA 2MLFC 1RJVA 5K89A 2M29A 1QXPA 1CDMA 1J1EA 1CM4A 1QATA 1X02A 2JRFA 1DGVA 2KHNA 2VRGA 1FI5A 1TNPA 1WRKA 1NYAA 3BOWA 4WQ3A 2PALA 3KO0A 3LL8B 2OTGB 4C0KA 3FIAA 2V53A 2JNXA 1PVBA 2LLSA 2COLB 1CDPA 3PN7B 2KAYA 2GGMA 3PFVA 4AOMA 3VRRA 1A2XA 3BUWB 4Q04A 2MHHA 2LVJA 3OX6A 3EK4A 4MLWA 1EXRA 2FOTA 4M2OA 3EK8A 1M31A 1R6PA 1DJHA 1SL9A 5B8IB 2BCXA 2LMUA 2BCBA 1TOPA 1UHNA 3KF9A 3VRQA 3WHTB 1SYMA 3I5IC 3O78A 1C07A 2OS8C 2M7LA 1S5GZ 1XFXO 2LCPA 4YGCB 1D1OA 5CSNA 1A4PA 4P5OE 1UHIA 4I5JA 1BF5A 4ICBA 1WRZA 1KFUS 4ZCUA 1B9AA 4C0JA 1UHKA 1CFDA 1ZOTB 4NQGA 1RWYA 1J7RA 2F2PA 1JFKA 1SR6C 4CFRA 1KQVA 3I5IB 2OS8B 3BUNB 1K95A 1Y6WA 1Y1AA 4HRGA 4QJ4B 2L4HA 1KWOC 1TN4A 1NUBA 3MSEB 1OZSA 3EVRA 1LVCD 2I2RE 1XVJA 4MVFA 2K7OA 1DJZA 1YR5A 1SR6B 3SIAA 2JULA 2FJUB 2EC6C 3CTNA 1IH0A 1CTRA 5I2QA 1S6IA 2MLEC 1NSHA 1IQ3A 2WCEA 1U5IA 2F3YA 3I5FC 4HRHA 1SRAA 1CMGA 2KGRA 5AFPA 5HLOA 1YURA 1MQ1A 1LINA 1UP5A 1F55A 3BUOB 2L51A 3NSIA 1MXEA 1A03A 1EG3A 2LV7A 3I5GC 4YBHB 1VRKA 2EC6B 3D0YA 1OQPA 5DKQA 4XJKB 1SK6D 3TUYB 3M0WA 1V1FA 1SCMB 1CFFA 3D10A 4DS7A 2ZNDA 2EHBA 2Y1MA 1NWDA 1QJTA 2WNDA 3ZWHA 4I5KA 2JC2A 3SG4A 4AQJA 1W7JB 2Y1NA 4MEWA 3EVVA 3FWCA 1ZACA 2L0PA 1XFUO 3I5GB 1LA0A 2KQYA 2K2FA 4GNKB 1JWDA 2F3ZA 3LCPC 1RTP1 2PVBA 2K2AA 3JVTB 4N1FA 5CSJA 1DT7B 1S36A 1PVAA 2PSRA 1F4OA 4PDZA 2GV5A 2H61A 2KQ6A 2LMVA 4FTGA 3O4YA 2KFHA 1BG1A 1CLMA 2M7NA 1R2UA 1XFVO 2I18A 4IL1A 2L5XB 1XA5A 2K7CA 2KYFA 1QLSA 2K61A 4FQOA 4F0ZB 3EKHA 4MBEA 1F70A 2NLNA 1WDCB 1XFWO 2ZFDA 1CDNA 1Y0VH 5GQQC 3TDIA 1PRWA 1UHHA 4OVNF 1A75A 1ALVA 3OHMB 5I8NA 4I5NB 1DJXA 1NX0A 3TS5C 2H2KA 1MWNA 2OTGC 2KNEA 4JPZB 3JTDC 1EJ3A 1AJ5A 3PN7C 4NDCA 1W7IB 2JQ6A 2KFFA 1NPQA 3CLNA 2LANA 2Q4UA 3AAKA 2BE6A 1Y1UA 1SKTA 1NP8A 3E3RA 3TDZA 1S1EA 3EKJA 4N5XA 1M45A 1KQMC 3OP0A 1ZMZA 4PE4A 1LA3A 1QTXA 3K21A 4MN0A 5AEQA 4OKHA 3TS5B 1IJ6A 3TZ1A 1AVSA 1QVIY 2CTNA 3JTDB 2F8PA 1J7QA 1MR8A 1JFJA 2I7AA 2CT9A 3VGOA 1UUSA 2HQWA 2TN4A 2JOJA 2SASA 1F8HA 3EVUA 1EL4A 3VRNA 1M39A 3BUMB 1KSMA 1K96A 1KQMB 2IS9A 5ER5A 2CBLA 1TCOB 1F71A 3C1VA 1XO5A 1BOCA 1MUXA 5KSZA 2RGIA 2WOSA 5IBWA 3RM1A 3DVJA 2M0RA 1B1GA 5BPJA 1DF0B 3CS1A 2LHIA 4MZJA 3LK0A 4WRIA 5CPVA 5HKWA 4MZKA 5I2LA 1NCXA 2G9BA 1LXFC 1G33A 4TNCA 1B4CA 1GGZA 1UURA 3EK7A 3NSLA 3AAJA 4OV2A 4CFQA 3NSOA 5HYDA 1OMRA 3TDUA 1GJYA 1K9UA 2JT3A 3CGAA 3QRXA 3WNXB 1H4BA 1S3PA 3KPXA 4XYNA 1KFXL 2KI6D 2ZNEA 1YUTA 2R2IA 4YI8A 2KI6C 5I2OA 5KTYA 4YI9A 2LP2A 3PATA 4PE0A 1EG4A 5TNCA 2M8UA 3DVMA 4DIRA 1SCVA 3IF7A 2M49B 2BL0B 4GBAA 4XJKA 1PK0D 2LAPA 4P2YB 4A4CA 1IGVA 3WXAA 2MBXA 1NCYA 2LVIA 1TCFA 2NZ0A 4OR9B 2B1UA 1NX1A 5G08A 1JUOA 2QACA 2M9GA 3TUYC 1MXLC 1UHJA 2AAOA 1DGUA 1SCMC 2BBNA 1QIVA 2LVKA 2JTZA 1L7ZA 1WLMA 2KBIA 3OB1B 3HX4A 2K7DA 2F33A 4DUQA 2LM5A 3I5HB 2JWWA 2JPTA 1DVIA 3GK2A 3H4SE 1TNQA 1WLZA 5JOLA 1B8RA 2EGDA 2JTTA 1S26D 3CZTX 1FW4A 2DOQA 1QV1A 3JVTC 2PASA 2WORA 4CIDA 1IQ5A 1XYDA 1FPWA 1K9KA 2Y4QA 2BBMA 4D1EA 2FCDA 1OOJA 2O5GA 1QS7A 3FWBA 4PHMA 1J7PA 2MAZA 2HPSA 4MSPA 3OX5A 1RFJA 3O2PA 1HT9A 1IJ5A 1QV0A 1MF8B 2NCOA 1WDCC 3SIBA 1FBVA 3CWGA 2KYCA 1KK7Y 3DF0B 2A4JA 1OZOA 3LLEA 1YUSA 1B7TY 2LC5A 4GPLB 1BT6A 1AK8A 2NCPA 1H8BA 2KI4C 1N0YA 1Q80A 2F2OA 4USLA 1DJIA 2KGBC 2BE4A 1S6CA 2G2BA 3GK4X 1KK8B 4PE1A 5ER4X 5AANA 2M1UA 3AKBA 3CR2A 1AUIB 5HLVA 1E8AA 1L2OB 2FCEA 1DTLA 1JF2A 4NDBA 3PM8A 4R1EA 2L50A 5AERA 2L4IA 1Y1XA 2KI4B 2CXJA 3CR5X 4QJ5B 1NIWA 2KAVA 1SPYA 2AUCA 2NXQA 4BY4A 2SCPA 1PULA 4ZCVA 5CSFA 5DKRA 2CNPA 2KSPA 1V1GA 2Y5IA 4ETOA 2BKIB 1EH2A 1NX3A 4N1GA 4YRUA 1DF0A 1BJFA 4CLNA 2HETA 2I94A 2Q91A 1ODBA 1B47A 1YRTB 5HKYA 1BODA 5JJGA 4MRYA 2K0JA 2LHLA 1CB1A 1QX2A 2OPOA 1BR4B 2ISDA 1XFYO 4YGAA 1J55A 4QJ3B 1CNPA 2LNKA 1BU3A 1IG5A 1MHOA 4GGFC 2WCBA 4JQ0D 2LVVA 3DD4A 4M2PA 5J3XA 4PCWA 4NDDA 5HKZA 1QX5B 3IQOA 2M97A 3SG5A 1F4QA 1NX2A 1K2HA 1YX7A 3GOFA 4HREE 2LLUA 1SBJA 1QIWA 1UWOA 2M1KB 3BUXB 1S5GY 5DKNA 1CKKA 1AHRA 1WRLA 1OE9B 2BECA 1A75B 4MZLA 1K94A 5D69A 1BMOA 4BY5A 3A8RA 1QVIZ 2JT0A 1N65A 2KBMA 3BQ3A 1B8LA 1KFUL 1TTXA 1B8CA 4ORAB 1QASA 1OMVA 3GK1A 1J7OA 1SMGA 1HQVA 1CLBA 1SW8A 2MA2A 2BL0C 1LKJA 2CCMA 1C7VA 2K8MB 1GGWA 1QLKA 5CSIA 1K90D 2LMTA 4PHKA 3SG7A 1YVHA 4YGBB 1J1DA 3BOWB 3DVKA 4PE7A 2JZIA 3OB2B 1IWQA 2E6WA 4PALA 2MRDA 3IQQA 1RK9A 1SNLA 1ZFSA 1TNXA 1DJYA 1IKUA 4U8DA 1YUUA 3I5HC 2ZRTA 2L2EA 1RECA 2JT8A 4UPGA 1ZUZA 1G4YR 1M63B 1TRFA 2KAXA 4L9MA 1OMDA 1PALA 3BYAA 4AQIA 1FF1A 4OCIA 1XFZO 2BKHB 3NXAA 2ZKMX 2WCFA 2AMIA 2ZN8A 2KDHA 2K7BA 1KFXS 3DF0A 3PALA 1NCZA 3KEVA 2MJWB 1CLLA 3BXKA 4I5LB 1ALWA 1GQMA 2JXLA 2PMYA 5AXIA 2WC8A 4MRXA 1CDLA 1AJ4A 3PLFB 2ZRSA 3O6BA 2LE9B 4CPVA 1DMOA 1K9PA 1WY9A 1K93D 3KHEA 3WHUB 1KWOB 1KK8C 1JSAA 1JF0A 1KSOA 1PSRA 2JU0A 4M2QA 2E30A 3VRPA 1JBAA 1L2OC 3DVEA 2O60A 2LLTA 4PHJA 2JXCA 4GUKA 2KOTA 3CR4X 1TNWA 1YRUB 1YTZC 1A29A 4DRWA 2LUCA 4PHNA 4DCKA 4YGEB 4GAOA 3SJSA 1XK4A 1N2DA 1DJGA 1G8IA 3I5FB 1KCYA 3ICBA 1CFPA 2QPTA 3VROA 1IRJA 1DJWA 1CMFA 5KU1A 2M3WA 1CM1A 1YVLA 1BR1B 1XK4C 3PSRA 5FYXA 3SG6A 4A4BA 1U5IB 4YGDB 1BLQA 4ORBB 1CFCA 3FS7A 3LK1A 2D8NA 4WQ2A 1K8UA 4HSZA 1SY9A 3SG3A 1FI6A 1OSAA 1S6JA 5F6TA 3AKAA 4GFTA 1M46A 1YX8A 2BCAA 1KK7Z 1PSBA 2LP3A 2P6BB 2LUXA 1SL7A 3D0YB 1SL8A 1B7TZ 2KFGA 3NSKA 4GGNA 4JWQA 2H61C 2L98A 1F54A 3ZNIA 4E68A 2HQ8A 5PALA 3SG2A 4C0LA 2GGZA 3A4UB
chains in the Genus database with same CATH superfamily
3BFBA 3HCMA 1C7WA 1DEKA 4GGFA 2ZN9A 3RLZA 1TUZA 1TIZA 1QX7A 1RROA 3F45A 4ORCB 1JC2A 5D7FA 2HF5A 2JNFA 1AP4A 2PRUA 2MLFC 1RJVA 5K89A 2M29A 1QXPA 1CDMA 3B88A 1J1EA 1CM4A 1QATA 1X02A 2JRFA 1DGVA 2KHNA 2VRGA 3B7AA 1FI5A 1TNPA 1WRKA 3OGNA 1OW4A 1NYAA 1Z2CB 3BOWA 3UNWA 4WQ3A 2PALA 3KO0A 1IIOA 3LL8B 2OTGB 4C0KA 3FIAA 2V53A 3D77A 2JNXA 1PVBA 2LLSA 2COLB 1CDPA 1TWOA 2KAYA 3PN7B 2GGMA 3PFVA 4AOMA 3VRRA 1A2XA 3BUWB 4Q04A 2MHHA 4INWA 2LVJA 3OX6A 3DYEA 3EK4A 4MLWA 1EXRA 2FOTA 4M2OA 3EK8A 1M31A 1R6PA 1DJHA 1SL9A 5B8IB 2BCXA 2LMUA 2BCBA 1TOPA 1UHNA 3KF9A 3VRQA 2YGUA 4IJ7A 3WHTB 1SYMA 2QEVA 3I5IC 3O78A 1C07A 2OS8C 2M7LA 1S5GZ 1XFXO 2LCPA 4YGCB 1D1OA 5CSNA 3B87A 3S0FA 1A4PA 4P5OE 1P28A 1UHIA 4I5JA 5FI7A 4ICBA 1BF5A 1WRZA 1KFUS 4ZCUA 1B9AA 4C0JA 1UHKA 1CFDA 1ZOTB 4NQGA 1RWYA 1J7RA 2F2PA 2KPHA 5FI6A 1JFKA 1SR6C 1SSEB 4CFRA 1KQVA 3I5IB 2OS8B 3BUNB 1K95A 1Y6WA 1Y1AA 4HRGA 4QJ4B 2L4HA 1KWOC 3UO9A 1TN4A 1NUBA 3MSEB 1OZSA 2L5YA 3EVRA 1LVCD 2I2RE 1XVJA 3D73A 4MVFA 1DELA 1DQEA 4FQTA 2K7OA 1DJZA 1YR5A 1SR6B 3SIAA 2JULA 2FJUB 2EC6C 3CTNA 1IH0A 2QDIA 3VB1A 1CTRA 5I2QA 1S6IA 2MLEC 1XFRA 1NSHA 1IQ3A 2WCEA 3FE8A 1U5IA 3K1EA 2F3YA 3I5FC 4HRHA 1SRAA 1CMGA 2KGRA 2L2CA 5AFPA 5HLOA 1YURA 1MQ1A 1LINA 1UP5A 1F55A 3BUOB 2L51A 3NSIA 1MXEA 1A03A 1EG3A 2LV7A 3I5GC 4YBHB 1VRKA 5I94A 2EC6B 3D0YA 1OQPA 5DKQA 4XJKB 1SK6D 3TUYB 3M0WA 1V1FA 1SCMB 1CFFA 3D10A 4DS7A 2ZNDA 2EHBA 2Y1MA 1NWDA 1QJTA 2WNDA 3ZWHA 4JD9A 2PYQA 4I5KA 2JC2A 3SG4A 1OOGA 4AQJA 1W7JB 2Y1NA 4MEWA 3EVVA 3FWCA 3SS5A 1ZACA 2L0PA 1XFUO 3I5GB 1LA0A 2KQYA 2K2FA 4GNKB 1JWDA 2F3ZA 3LCPC 1RTP1 2PVBA 2K2AA 3JVTB 4N1FA 5CSJA 1DT7B 1S36A 1PVAA 2PSRA 1F4OA 4PDZA 2GV5A 2H61A 2KQ6A 2LMVA 4FTGA 1ORGA 2KFHA 3O4YA 1BG1A 1CLMA 2M7NA 1R2UA 1XFVO 2I18A 4IL1A 2L5XB 1XA5A 2K7CA 2KYFA 4OZDA 1QLSA 2K61A 4FQOA 4F0ZB 3EKHA 3CZ1A 4MBEA 1OOHA 1F70A 2NLNA 1WDCB 3R1OA 1XFWO 2ZFDA 1CDNA 1Y0VH 5GQQC 3EG5B 3TDIA 1PRWA 1UHHA 4OVNF 1A75A 3OBVA 1ALVA 3OHMB 5I8NA 2P71A 4I5NB 1DJXA 1NX0A 1W9ZA 3TS5C 2H2KA 1MWNA 1OOIX 2OTGC 2KNEA 4JPZB 3JTDC 1EJ3A 1AJ5A 2WC5A 3PN7C 4NDCA 1W7IB 2JQ6A 2KFFA 1NPQA 3CLNA 2LANA 2Q4UA 3AAKA 2BE6A 3D76A 1Y1UA 1SKTA 1NP8A 3E3RA 3TDZA 4KYNA 3RZSA 1S1EA 3EKJA 4N5XA 1M45A 1KQMC 3OP0A 1ZMZA 3L4AA 4PE4A 1LA3A 1QTXA 3K21A 4MN0A 5AEQA 4OKHA 3TS5B 1IJ6A 3TZ1A 1AVSA 1QVIY 2CTNA 3JTDB 2F8PA 1J7QA 3CYZA 1MR8A 1JFJA 2I7AA 2CT9A 3VGOA 1UUSA 2HQWA 2TN4A 2JOJA 2SASA 1F8HA 3EVUA 1EL4A 3VRNA 1M39A 3BUMB 1KSMA 1K96A 1KQMB 2IS9A 3S0BA 5ER5A 2CBLA 1TCOB 1F71A 3C1VA 1XO5A 1BOCA 3CABA 1MUXA 5KSZA 2RGIA 2WOSA 5IBWA 3QMEA 3RM1A 3DVJA 2M0RA 1B1GA 5BPJA 1DF0B 3CS1A 2LHIA 4MZJA 3LK0A 4WRIA 5CPVA 5HKWA 4MZKA 4PT1A 5I2LA 1NCXA 3PJIA 2G9BA 1LXFC 1G33A 4TNCA 1B4CA 1GGZA 1UURA 2QEOA 3EK7A 3NSLA 3AAJA 4OV2A 2P70A 3NSOA 4CFQA 1OMRA 5HYDA 3TDUA 1GJYA 1C3YA 2JPOA 1K9UA 2JT3A 3CGAA 3QRXA 3WNXB 1H4BA 1S3PA 3KPXA 4XYNA 1KFXL 2KI6D 2ZNEA 1YUTA 2R2IA 4YI8A 2KI6C 5I2OA 5KTYA 4YI9A 2LP2A 3PATA 4PE0A 1EG4A 5TNCA 2M8UA 2WCMA 3DVMA 4DIRA 1SCVA 3IF7A 2WCHA 3IVTA 2M49B 2BL0B 4GBAA 4XJKA 1PK0D 2LAPA 4P2YB 4A4CA 3B6XA 1IGVA 3WXAA 2MBXA 3NGVA 1NCYA 2LVIA 3FE6A 1TCFA 2NZ0A 4OR9B 2B1UA 1NX1A 5G08A 1JUOA 3DZTA 2QACA 2M9GA 3CDNA 1MXLC 3TUYC 1UHJA 2AAOA 1DGUA 1SCMC 2BBNA 1QIVA 2LVKA 2JTZA 1L7ZA 1WLMA 2KBIA 1DC1A 3OB1B 3HX4A 2K7DA 2F33A 4DUQA 2LM5A 3I5HB 2JWWA 1C3ZA 1DVIA 2JPTA 3GK2A 3H4SE 1TNQA 1WLZA 2GTEA 1B8RA 2EGDA 5JOLA 3SS4A 2JTTA 1S26D 3CZTX 1FW4A 2DOQA 1QV1A 2H8VA 3JVTC 2PASA 2WORA 4CIDA 1IQ5A 1XYDA 1FPWA 3O4XA 1K9KA 2Y4QA 2BBMA 4D1EA 2FCDA 1OOJA 2O5GA 1QS7A 3FWBA 4PHMA 1J7PA 2MAZA 2HPSA 4MSPA 3OX5A 1RFJA 3O2PA 1HT9A 1IJ5A 1QV0A 1MF8B 2NCOA 1WDCC 2BNXA 1FBVA 3CWGA 1OOFA 2KLEA 3DY9A 3SIBA 2KYCA 1KK7Y 3DF0B 2A4JA 3BFAA 1OZOA 3LLEA 3SS3A 1YUSA 1B7TY 2LC5A 3NHIA 1BT6A 4GPLB 2NCPA 1AK8A 1H8BA 2KI4C 1N0YA 1Q80A 2F2OA 4USLA 1DJIA 2KGBC 2BE4A 1S6CA 2G2BA 3GK4X 1KK8B 4PE1A 5ER4X 5AANA 2M1UA 3AKBA 3CR2A 1AUIB 5HLVA 1E8AA 1L2OB 2FCEA 1DTLA 1JF2A 4NDBA 3PM8A 4INXA 4R1EA 2L50A 5AERA 2L4IA 1Y1XA 2KI4B 2CXJA 3CR5X 5D3OA 4QJ5B 1TUJA 1NIWA 2KAVA 1SPYA 2AUCA 2NXQA 2FJYA 4BY4A 2SCPA 1PULA 3CZ0A 5CSFA 4ZCVA 5DKRA 2CNPA 2KSPA 1V1GA 2Y5IA 4ETOA 2BKIB 1EH2A 1NX3A 4N1GA 4YRUA 1DF0A 1BJFA 4CLNA 2HETA 2I94A 2Q91A 1ODBA 3BFHA 1B47A 1YRTB 5HKYA 1BODA 5JJGA 4MRYA 3S0EA 2K0JA 2LHLA 1CB1A 1QX2A 2OPOA 1BR4B 2ISDA 1XFYO 4YGAA 1J55A 4QJ3B 1CNPA 1Z4HA 2LNKA 3L4LA 1BU3A 1IG5A 1MHOA 4GGFC 2WCBA 4JQ0D 2LVVA 3DD4A 4M2PA 5J3XA 4PCWA 2WCJA 5EL2A 3DXLA 4NDDA 5HKZA 1QX5B 3IQOA 2M97A 5HL1A 3SG5A 3D78A 2QEBA 1F4QA 1NX2A 1K2HA 1YX7A 3GOFA 4HREE 2LLUA 1SBJA 1QIWA 1UWOA 2M1KB 3BUXB 1S5GY 5DKNA 4F7FA 1CKKA 1AHRA 1WRLA 1OE9B 2BECA 1A75B 4MZLA 1K94A 5D69A 1BMOA 4BY5A 3A8RA 3FE9A 1QVIZ 2JT0A 1N65A 2KBMA 3BQ3A 1B8LA 1KFUL 1TTXA 1B8CA 4ORAB 1QASA 3L47A 1OMVA 3GK1A 1J7OA 1SMGA 1HQVA 1CLBA 1SW8A 2MA2A 2BL0C 2ERBA 1LKJA 2CCMA 1C7VA 2K8MB 1GGWA 1QLKA 5CSIA 3R72A 2BAPA 1K90D 2KLDA 2LMTA 4PHKA 1YVHA 3SG7A 1GM0A 4YGBB 1J1DA 3BOWB 1QWVA 3DVKA 4PE7A 2JZIA 3OB2B 1IWQA 2E6WA 2WC6A 4PALA 3Q8IA 3S0AA 2MRDA 3IQQA 1RK9A 1SNLA 1ZFSA 1TNXA 1DJYA 5FI2A 1IKUA 4U8DA 1YUUA 3I5HC 2ZRTA 2L2EA 1RECA 4JKTA 5DICA 2JT8A 4UPGA 1ZUZA 1G4YR 1M63B 1TRFA 2KAXA 4L9MA 1OMDA 1PALA 3BYAA 2WCKA 4AQIA 1FF1A 4OCIA 3N7HA 1XFZO 2BKHB 3NXAA 2ZKMX 2WCFA 2AMIA 2ZN8A 3NHTA 2KDHA 2K7BA 1KFXS 3DF0A 3PALA 1NCZA 1T14A 3KEVA 2MJWB 1CLLA 3BXKA 4I5LB 1ALWA 1GQMA 2JXLA 2PMYA 5AXIA 2WCLA 2WC8A 4MRXA 1CDLA 2PQLA 1AJ4A 3PLFB 2ZRSA 3O6BA 2LE9B 4CPVA 1DMOA 1K9PA 1WY9A 1K93D 3KHEA 3WHUB 3CZ2A 1KWOB 1KK8C 3S0DA 1JSAA 1JF0A 1KSOA 1PSRA 2JU0A 3D74A 4M2QA 2E30A 2QEHA 3B86A 3VRPA 1JBAA 1L2OC 3DVEA 2O60A 2LLTA 4PHJA 2JXCA 4GUKA 2KOTA 3CR4X 1TNWA 1YRUB 1YTZC 1A29A 4DRWA 2LUCA 4PHNA 4DCKA 4YGEB 4GAOA 3SJSA 1XK4A 1N2DA 1DJGA 1G8IA 3PM2A 3I5FB 1KCYA 3ICBA 1CFPA 2QPTA 2K60A 3D75A 3VROA 1IRJA 1DJWA 1CMFA 5KU1A 2M3WA 1CM1A 1YVLA 3S0GA 1BR1B 3R1VA 1XK4C 3PSRA 5FYXA 3SG6A 4A4BA 1U5IB 3BJHA 4YGDB 1BLQA 4ORBB 1CFCA 3FS7A 3LK1A 3V2LA 2D8NA 3R1PA 1K8UA 1LS8A 1SY9A 4HSZA 4WQ2A 3SG3A 1FI6A 1OSAA 1S6JA 5F6TA 3AKAA 4GFTA 1M46A 1YX8A 2BCAA 1KK7Z 1PSBA 2LP3A 2P6BB 2LUXA 1SL7A 3D0YB 1SL8A 1B7TZ 2KFGA 3NSKA 4GGNA 4JWQA 2H61C 2L98A 1F54A 3ZNIA 4E68A 2HQ8A 5PALA 3SG2A 4C0LA 2GGZA 3A4UB
chains in the Genus database with same CATH topology
3HCMA 1C7WA 4GGFA 2ZN9A 3RLZA 1TIZA 1QX7A 1RROA 3F45A 4ORCB 1JC2A 5D7FA 2HF5A 2JNFA 1AP4A 2PRUA 2MLFC 1RJVA 5K89A 2M29A 1QXPA 1CDMA 1J1EA 1CM4A 1QATA 1X02A 2JRFA 1DGVA 2KHNA 2VRGA 1FI5A 1TNPA 1WRKA 1NYAA 3BOWA 4WQ3A 2PALA 3KO0A 3LL8B 2OTGB 4C0KA 3FIAA 2V53A 2JNXA 1PVBA 2LLSA 2COLB 1CDPA 3PN7B 2KAYA 2GGMA 3PFVA 4AOMA 3VRRA 1A2XA 3BUWB 4Q04A 2MHHA 2LVJA 3OX6A 3EK4A 4MLWA 1EXRA 2FOTA 4M2OA 3EK8A 1M31A 1R6PA 1DJHA 1SL9A 5B8IB 2BCXA 2LMUA 2BCBA 1TOPA 1UHNA 3KF9A 3VRQA 3WHTB 1SYMA 3I5IC 3O78A 1C07A 2OS8C 2M7LA 1S5GZ 1XFXO 2LCPA 4YGCB 1D1OA 5CSNA 1A4PA 4P5OE 1UHIA 4I5JA 1BF5A 4ICBA 1WRZA 1KFUS 4ZCUA 1B9AA 4C0JA 1UHKA 1CFDA 1ZOTB 4NQGA 1RWYA 1J7RA 2F2PA 1JFKA 1SR6C 4CFRA 1KQVA 3I5IB 2OS8B 3BUNB 1K95A 1Y6WA 1Y1AA 4HRGA 4QJ4B 2L4HA 1KWOC 1TN4A 1NUBA 3MSEB 1OZSA 3EVRA 1LVCD 2I2RE 1XVJA 4MVFA 2K7OA 1DJZA 1YR5A 1SR6B 3SIAA 2JULA 2FJUB 2EC6C 3CTNA 1IH0A 1CTRA 5I2QA 1S6IA 2MLEC 1NSHA 1IQ3A 2WCEA 1U5IA 2F3YA 3I5FC 4HRHA 1SRAA 1CMGA 2KGRA 5AFPA 5HLOA 1YURA 1MQ1A 1LINA 1UP5A 1F55A 3BUOB 2L51A 3NSIA 1MXEA 1A03A 1EG3A 2LV7A 3I5GC 4YBHB 1VRKA 2EC6B 3D0YA 1OQPA 5DKQA 4XJKB 1SK6D 3TUYB 3M0WA 1V1FA 1SCMB 1CFFA 3D10A 4DS7A 2ZNDA 2EHBA 2Y1MA 1NWDA 1QJTA 2WNDA 3ZWHA 4I5KA 2JC2A 3SG4A 4AQJA 1W7JB 2Y1NA 4MEWA 3EVVA 3FWCA 1ZACA 2L0PA 1XFUO 3I5GB 1LA0A 2KQYA 2K2FA 4GNKB 1JWDA 2F3ZA 3LCPC 1RTP1 2PVBA 2K2AA 3JVTB 4N1FA 5CSJA 1DT7B 1S36A 1PVAA 2PSRA 1F4OA 4PDZA 2GV5A 2H61A 2KQ6A 2LMVA 4FTGA 3O4YA 2KFHA 1BG1A 1CLMA 2M7NA 1R2UA 1XFVO 2I18A 4IL1A 2L5XB 1XA5A 2K7CA 2KYFA 1QLSA 2K61A 4FQOA 4F0ZB 3EKHA 4MBEA 1F70A 2NLNA 1WDCB 1XFWO 2ZFDA 1CDNA 1Y0VH 5GQQC 3TDIA 1PRWA 1UHHA 4OVNF 1A75A 1ALVA 3OHMB 5I8NA 4I5NB 1DJXA 1NX0A 3TS5C 2H2KA 1MWNA 2OTGC 2KNEA 4JPZB 3JTDC 1EJ3A 1AJ5A 3PN7C 4NDCA 1W7IB 2JQ6A 2KFFA 1NPQA 3CLNA 2LANA 2Q4UA 3AAKA 2BE6A 1Y1UA 1SKTA 1NP8A 3E3RA 3TDZA 1S1EA 3EKJA 4N5XA 1M45A 1KQMC 3OP0A 1ZMZA 4PE4A 1LA3A 1QTXA 3K21A 4MN0A 5AEQA 4OKHA 3TS5B 1IJ6A 3TZ1A 1AVSA 1QVIY 2CTNA 3JTDB 2F8PA 1J7QA 1MR8A 1JFJA 2I7AA 2CT9A 3VGOA 1UUSA 2HQWA 2TN4A 2JOJA 2SASA 1F8HA 3EVUA 1EL4A 3VRNA 1M39A 3BUMB 1KSMA 1K96A 1KQMB 2IS9A 5ER5A 2CBLA 1TCOB 1F71A 3C1VA 1XO5A 1BOCA 1MUXA 5KSZA 2RGIA 2WOSA 5IBWA 3RM1A 3DVJA 2M0RA 1B1GA 5BPJA 1DF0B 3CS1A 2LHIA 4MZJA 3LK0A 4WRIA 5CPVA 5HKWA 4MZKA 5I2LA 1NCXA 2G9BA 1LXFC 1G33A 4TNCA 1B4CA 1GGZA 1UURA 3EK7A 3NSLA 3AAJA 4OV2A 4CFQA 3NSOA 5HYDA 1OMRA 3TDUA 1GJYA 1K9UA 2JT3A 3CGAA 3QRXA 3WNXB 1H4BA 1S3PA 3KPXA 4XYNA 1KFXL 2KI6D 2ZNEA 1YUTA 2R2IA 4YI8A 2KI6C 5I2OA 5KTYA 4YI9A 2LP2A 3PATA 4PE0A 1EG4A 5TNCA 2M8UA 3DVMA 4DIRA 1SCVA 3IF7A 2M49B 2BL0B 4GBAA 4XJKA 1PK0D 2LAPA 4P2YB 4A4CA 1IGVA 3WXAA 2MBXA 1NCYA 2LVIA 1TCFA 2NZ0A 4OR9B 2B1UA 1NX1A 5G08A 1JUOA 2QACA 2M9GA 3TUYC 1MXLC 1UHJA 2AAOA 1DGUA 1SCMC 2BBNA 1QIVA 2LVKA 2JTZA 1L7ZA 1WLMA 2KBIA 3OB1B 3HX4A 2K7DA 2F33A 4DUQA 2LM5A 3I5HB 2JWWA 2JPTA 1DVIA 3GK2A 3H4SE 1TNQA 1WLZA 5JOLA 1B8RA 2EGDA 2JTTA 1S26D 3CZTX 1FW4A 2DOQA 1QV1A 3JVTC 2PASA 2WORA 4CIDA 1IQ5A 1XYDA 1FPWA 1K9KA 2Y4QA 2BBMA 4D1EA 2FCDA 1OOJA 2O5GA 1QS7A 3FWBA 4PHMA 1J7PA 2MAZA 2HPSA 4MSPA 3OX5A 1RFJA 3O2PA 1HT9A 1IJ5A 1QV0A 1MF8B 2NCOA 1WDCC 3SIBA 1FBVA 3CWGA 2KYCA 1KK7Y 3DF0B 2A4JA 1OZOA 3LLEA 1YUSA 1B7TY 2LC5A 4GPLB 1BT6A 1AK8A 2NCPA 1H8BA 2KI4C 1N0YA 1Q80A 2F2OA 4USLA 1DJIA 2KGBC 2BE4A 1S6CA 2G2BA 3GK4X 1KK8B 4PE1A 5ER4X 5AANA 2M1UA 3AKBA 3CR2A 1AUIB 5HLVA 1E8AA 1L2OB 2FCEA 1DTLA 1JF2A 4NDBA 3PM8A 4R1EA 2L50A 5AERA 2L4IA 1Y1XA 2KI4B 2CXJA 3CR5X 4QJ5B 1NIWA 2KAVA 1SPYA 2AUCA 2NXQA 4BY4A 2SCPA 1PULA 4ZCVA 5CSFA 5DKRA 2CNPA 2KSPA 1V1GA 2Y5IA 4ETOA 2BKIB 1EH2A 1NX3A 4N1GA 4YRUA 1DF0A 1BJFA 4CLNA 2HETA 2I94A 2Q91A 1ODBA 1B47A 1YRTB 5HKYA 1BODA 5JJGA 4MRYA 2K0JA 2LHLA 1CB1A 1QX2A 2OPOA 1BR4B 2ISDA 1XFYO 4YGAA 1J55A 4QJ3B 1CNPA 2LNKA 1BU3A 1IG5A 1MHOA 4GGFC 2WCBA 4JQ0D 2LVVA 3DD4A 4M2PA 5J3XA 4PCWA 4NDDA 5HKZA 1QX5B 3IQOA 2M97A 3SG5A 1F4QA 1NX2A 1K2HA 1YX7A 3GOFA 4HREE 2LLUA 1SBJA 1QIWA 1UWOA 2M1KB 3BUXB 1S5GY 5DKNA 1CKKA 1AHRA 1WRLA 1OE9B 2BECA 1A75B 4MZLA 1K94A 5D69A 1BMOA 4BY5A 3A8RA 1QVIZ 2JT0A 1N65A 2KBMA 3BQ3A 1B8LA 1KFUL 1TTXA 1B8CA 4ORAB 1QASA 1OMVA 3GK1A 1J7OA 1SMGA 1HQVA 1CLBA 1SW8A 2MA2A 2BL0C 1LKJA 2CCMA 1C7VA 2K8MB 1GGWA 1QLKA 5CSIA 1K90D 2LMTA 4PHKA 3SG7A 1YVHA 4YGBB 1J1DA 3BOWB 3DVKA 4PE7A 2JZIA 3OB2B 1IWQA 2E6WA 4PALA 2MRDA 3IQQA 1RK9A 1SNLA 1ZFSA 1TNXA 1DJYA 1IKUA 4U8DA 1YUUA 3I5HC 2ZRTA 2L2EA 1RECA 2JT8A 4UPGA 1ZUZA 1G4YR 1M63B 1TRFA 2KAXA 4L9MA 1OMDA 1PALA 3BYAA 4AQIA 1FF1A 4OCIA 1XFZO 2BKHB 3NXAA 2ZKMX 2WCFA 2AMIA 2ZN8A 2KDHA 2K7BA 1KFXS 3DF0A 3PALA 1NCZA 3KEVA 2MJWB 1CLLA 3BXKA 4I5LB 1ALWA 1GQMA 2JXLA 2PMYA 5AXIA 2WC8A 4MRXA 1CDLA 1AJ4A 3PLFB 2ZRSA 3O6BA 2LE9B 4CPVA 1DMOA 1K9PA 1WY9A 1K93D 3KHEA 3WHUB 1KWOB 1KK8C 1JSAA 1JF0A 1KSOA 1PSRA 2JU0A 4M2QA 2E30A 3VRPA 1JBAA 1L2OC 3DVEA 2O60A 2LLTA 4PHJA 2JXCA 4GUKA 2KOTA 3CR4X 1TNWA 1YRUB 1YTZC 1A29A 4DRWA 2LUCA 4PHNA 4DCKA 4YGEB 4GAOA 3SJSA 1XK4A 1N2DA 1DJGA 1G8IA 3I5FB 1KCYA 3ICBA 1CFPA 2QPTA 3VROA 1IRJA 1DJWA 1CMFA 5KU1A 2M3WA 1CM1A 1YVLA 1BR1B 1XK4C 3PSRA 5FYXA 3SG6A 4A4BA 1U5IB 4YGDB 1BLQA 4ORBB 1CFCA 3FS7A 3LK1A 2D8NA 4WQ2A 1K8UA 4HSZA 1SY9A 3SG3A 1FI6A 1OSAA 1S6JA 5F6TA 3AKAA 4GFTA 1M46A 1YX8A 2BCAA 1KK7Z 1PSBA 2LP3A 2P6BB 2LUXA 1SL7A 3D0YB 1SL8A 1B7TZ 2KFGA 3NSKA 4GGNA 4JWQA 2H61C 2L98A 1F54A 3ZNIA 4E68A 2HQ8A 5PALA 3SG2A 4C0LA 2GGZA 3A4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCM A;  1C7W A;  4GGF A;  2ZN9 A;  3RLZ A;  1TIZ A;  1QX7 A;  1RRO A;  3F45 A;  4ORC B;  1JC2 A;  5D7F A;  2HF5 A;  2JNF A;  1AP4 A;  2PRU A;  2MLF C;  1RJV A;  5K89 A;  2M29 A;  1QXP A;  1CDM A;  1J1E A;  1CM4 A;  1QAT A;  1X02 A;  2JRF A;  1DGV A;  2KHN A;  2VRG A;  1FI5 A;  1TNP A;  1WRK A;  1NYA A;  3BOW A;  4WQ3 A;  2PAL A;  3KO0 A;  3LL8 B;  2OTG B;  4C0K A;  3FIA A;  2V53 A;  2JNX A;  1PVB A;  2LLS A;  2COL B;  1CDP A;  3PN7 B;  2KAY A;  2GGM A;  3PFV A;  4AOM A;  3VRR A;  1A2X A;  3BUW B;  4Q04 A;  2MHH A;  2LVJ A;  3OX6 A;  3EK4 A;  4MLW A;  1EXR A;  2FOT A;  4M2O A;  3EK8 A;  1M31 A;  1R6P A;  1DJH A;  1SL9 A;  5B8I B;  2BCX A;  2LMU A;  2BCB A;  1TOP A;  1UHN A;  3KF9 A;  3VRQ A;  3WHT B;  1SYM A;  3I5I C;  3O78 A;  1C07 A;  2OS8 C;  2M7L A;  1S5G Z;  1XFX O;  2LCP A;  4YGC B;  1D1O A;  5CSN A;  1A4P A;  4P5O E;  1UHI A;  4I5J A;  1BF5 A;  4ICB A;  1WRZ A;  1KFU S;  4ZCU A;  1B9A A;  4C0J A;  1UHK A;  1CFD A;  1ZOT B;  4NQG A;  1RWY A;  1J7R A;  2F2P A;  1JFK A;  1SR6 C;  4CFR A;  1KQV A;  3I5I B;  2OS8 B;  3BUN B;  1K95 A;  1Y6W A;  1Y1A A;  4HRG A;  4QJ4 B;  2L4H A;  1KWO C;  1TN4 A;  1NUB A;  3MSE B;  1OZS A;  3EVR A;  1LVC D;  2I2R E;  1XVJ A;  4MVF A;  2K7O A;  1DJZ A;  1YR5 A;  1SR6 B;  3SIA A;  2JUL A;  2FJU B;  2EC6 C;  3CTN A;  1IH0 A;  1CTR A;  5I2Q A;  1S6I A;  2MLE C;  1NSH A;  1IQ3 A;  2WCE A;  1U5I A;  2F3Y A;  3I5F C;  4HRH A;  1SRA A;  1CMG A;  2KGR A;  5AFP A;  5HLO A;  1YUR A;  1MQ1 A;  1LIN A;  1UP5 A;  1F55 A;  3BUO B;  2L51 A;  3NSI A;  1MXE A;  1A03 A;  1EG3 A;  2LV7 A;  3I5G C;  4YBH B;  1VRK A;  2EC6 B;  3D0Y A;  1OQP A;  5DKQ A;  4XJK B;  1SK6 D;  3TUY B;  3M0W A;  1V1F A;  1SCM B;  1CFF A;  3D10 A;  4DS7 A;  2ZND A;  2EHB A;  2Y1M A;  1NWD A;  1QJT A;  2WND A;  3ZWH A;  4I5K A;  2JC2 A;  3SG4 A;  4AQJ A;  1W7J B;  2Y1N A;  4MEW A;  3EVV A;  3FWC A;  1ZAC A;  2L0P A;  1XFU O;  3I5G B;  1LA0 A;  2KQY A;  2K2F A;  4GNK B;  1JWD A;  2F3Z A;  3LCP C;  1RTP 1;  2PVB A;  2K2A A;  3JVT B;  4N1F A;  5CSJ A;  1DT7 B;  1S36 A;  1PVA A;  2PSR A;  1F4O A;  4PDZ A;  2GV5 A;  2H61 A;  2KQ6 A;  2LMV A;  4FTG A;  3O4Y A;  2KFH A;  1BG1 A;  1CLM A;  2M7N A;  1R2U A;  1XFV O;  2I18 A;  4IL1 A;  2L5X B;  1XA5 A;  2K7C A;  2KYF A;  1QLS A;  2K61 A;  4FQO A;  4F0Z B;  3EKH A;  4MBE A;  1F70 A;  2NLN A;  1WDC B;  1XFW O;  2ZFD A;  1CDN A;  1Y0V H;  5GQQ C;  3TDI A;  1PRW A;  1UHH A;  4OVN F;  1A75 A;  1ALV A;  3OHM B;  5I8N A;  4I5N B;  1DJX A;  1NX0 A;  3TS5 C;  2H2K A;  1MWN A;  2OTG C;  2KNE A;  4JPZ B;  3JTD C;  1EJ3 A;  1AJ5 A;  3PN7 C;  4NDC A;  1W7I B;  2JQ6 A;  2KFF A;  1NPQ A;  3CLN A;  2LAN A;  2Q4U A;  3AAK A;  2BE6 A;  1Y1U A;  1SKT A;  1NP8 A;  3E3R A;  3TDZ A;  1S1E A;  3EKJ A;  4N5X A;  1M45 A;  1KQM C;  3OP0 A;  1ZMZ A;  4PE4 A;  1LA3 A;  1QTX A;  3K21 A;  4MN0 A;  5AEQ A;  4OKH A;  3TS5 B;  1IJ6 A;  3TZ1 A;  1AVS A;  1QVI Y;  2CTN A;  3JTD B;  2F8P A;  1J7Q A;  1MR8 A;  1JFJ A;  2I7A A;  2CT9 A;  3VGO A;  1UUS A;  2HQW A;  2TN4 A;  2JOJ A;  2SAS A;  1F8H A;  3EVU A;  1EL4 A;  3VRN A;  1M39 A;  3BUM B;  1KSM A;  1K96 A;  1KQM B;  2IS9 A;  5ER5 A;  2CBL A;  1TCO B;  1F71 A;  3C1V A;  1XO5 A;  1BOC A;  1MUX A;  5KSZ A;  2RGI A;  2WOS A;  5IBW A;  3RM1 A;  3DVJ A;  2M0R A;  1B1G A;  5BPJ A;  1DF0 B;  3CS1 A;  2LHI A;  4MZJ A;  3LK0 A;  4WRI A;  5CPV A;  5HKW A;  4MZK A;  5I2L A;  1NCX A;  2G9B A;  1LXF C;  1G33 A;  4TNC A;  1B4C A;  1GGZ A;  1UUR A;  3EK7 A;  3NSL A;  3AAJ A;  4OV2 A;  4CFQ A;  3NSO A;  5HYD A;  1OMR A;  3TDU A;  1GJY A;  1K9U A;  2JT3 A;  3CGA A;  3QRX A;  3WNX B;  1H4B A;  1S3P A;  3KPX A;  4XYN A;  1KFX L;  2KI6 D;  2ZNE A;  1YUT A;  2R2I A;  4YI8 A;  2KI6 C;  5I2O A;  5KTY A;  4YI9 A;  2LP2 A;  3PAT A;  4PE0 A;  1EG4 A;  5TNC A;  2M8U A;  3DVM A;  4DIR A;  1SCV A;  3IF7 A;  2M49 B;  2BL0 B;  4GBA A;  4XJK A;  1PK0 D;  2LAP A;  4P2Y B;  4A4C A;  1IGV A;  3WXA A;  2MBX A;  1NCY A;  2LVI A;  1TCF A;  2NZ0 A;  4OR9 B;  2B1U A;  1NX1 A;  5G08 A;  1JUO A;  2QAC A;  2M9G A;  3TUY C;  1MXL C;  1UHJ A;  2AAO A;  1DGU A;  1SCM C;  2BBN A;  1QIV A;  2LVK A;  2JTZ A;  1L7Z A;  1WLM A;  2KBI A;  3OB1 B;  3HX4 A;  2K7D A;  2F33 A;  4DUQ A;  2LM5 A;  3I5H B;  2JWW A;  2JPT A;  1DVI A;  3GK2 A;  3H4S E;  1TNQ A;  1WLZ A;  5JOL A;  1B8R A;  2EGD A;  2JTT A;  1S26 D;  3CZT X;  1FW4 A;  2DOQ A;  1QV1 A;  3JVT C;  2PAS A;  2WOR A;  4CID A;  1IQ5 A;  1XYD A;  1FPW A;  1K9K A;  2Y4Q A;  2BBM A;  4D1E A;  2FCD A;  1OOJ A;  2O5G A;  1QS7 A;  3FWB A;  4PHM A;  1J7P A;  2MAZ A;  2HPS A;  4MSP A;  3OX5 A;  1RFJ A;  3O2P A;  1HT9 A;  1IJ5 A;  1QV0 A;  1MF8 B;  2NCO A;  1WDC C;  3SIB A;  1FBV A;  3CWG A;  2KYC A;  1KK7 Y;  3DF0 B;  2A4J A;  1OZO A;  3LLE A;  1YUS A;  1B7T Y;  2LC5 A;  4GPL B;  1BT6 A;  1AK8 A;  2NCP A;  1H8B A;  2KI4 C;  1N0Y A;  1Q80 A;  2F2O A;  4USL A;  1DJI A;  2KGB C;  2BE4 A;  1S6C A;  2G2B A;  3GK4 X;  1KK8 B;  4PE1 A;  5ER4 X;  5AAN A;  2M1U A;  3AKB A;  3CR2 A;  1AUI B;  5HLV A;  1E8A A;  1L2O B;  2FCE A;  1DTL A;  1JF2 A;  4NDB A;  3PM8 A;  4R1E A;  2L50 A;  5AER A;  2L4I A;  1Y1X A;  2KI4 B;  2CXJ A;  3CR5 X;  4QJ5 B;  1NIW A;  2KAV A;  1SPY A;  2AUC A;  2NXQ A;  4BY4 A;  2SCP A;  1PUL A;  4ZCV A;  5CSF A;  5DKR A;  2CNP A;  2KSP A;  1V1G A;  2Y5I A;  4ETO A;  2BKI B;  1EH2 A;  1NX3 A;  4N1G A;  4YRU A;  1DF0 A;  1BJF A;  4CLN A;  2HET A;  2I94 A;  2Q91 A;  1ODB A;  1B47 A;  1YRT B;  5HKY A;  1BOD A;  5JJG A;  4MRY A;  2K0J A;  2LHL A;  1CB1 A;  1QX2 A;  2OPO A;  1BR4 B;  2ISD A;  1XFY O;  4YGA A;  1J55 A;  4QJ3 B;  1CNP A;  2LNK A;  1BU3 A;  1IG5 A;  1MHO A;  4GGF C;  2WCB A;  4JQ0 D;  2LVV A;  3DD4 A;  4M2P A;  5J3X A;  4PCW A;  4NDD A;  5HKZ A;  1QX5 B;  3IQO A;  2M97 A;  3SG5 A;  1F4Q A;  1NX2 A;  1K2H A;  1YX7 A;  3GOF A;  4HRE E;  2LLU A;  1SBJ A;  1QIW A;  1UWO A;  2M1K B;  3BUX B;  1S5G Y;  5DKN A;  1CKK A;  1AHR A;  1WRL A;  1OE9 B;  2BEC A;  1A75 B;  4MZL A;  1K94 A;  5D69 A;  1BMO A;  4BY5 A;  3A8R A;  1QVI Z;  2JT0 A;  1N65 A;  2KBM A;  3BQ3 A;  1B8L A;  1KFU L;  1TTX A;  1B8C A;  4ORA B;  1QAS A;  1OMV A;  3GK1 A;  1J7O A;  1SMG A;  1HQV A;  1CLB A;  1SW8 A;  2MA2 A;  2BL0 C;  1LKJ A;  2CCM A;  1C7V A;  2K8M B;  1GGW A;  1QLK A;  5CSI A;  1K90 D;  2LMT A;  4PHK A;  3SG7 A;  1YVH A;  4YGB B;  1J1D A;  3BOW B;  3DVK A;  4PE7 A;  2JZI A;  3OB2 B;  1IWQ A;  2E6W A;  4PAL A;  2MRD A;  3IQQ A;  1RK9 A;  1SNL A;  1ZFS A;  1TNX A;  1DJY A;  1IKU A;  4U8D A;  1YUU A;  3I5H C;  2ZRT A;  2L2E A;  1REC A;  2JT8 A;  4UPG A;  1ZUZ A;  1G4Y R;  1M63 B;  1TRF A;  2KAX A;  4L9M A;  1OMD A;  1PAL A;  3BYA A;  4AQI A;  1FF1 A;  4OCI A;  1XFZ O;  2BKH B;  3NXA A;  2ZKM X;  2WCF A;  2AMI A;  2ZN8 A;  2KDH A;  2K7B A;  1KFX S;  3DF0 A;  3PAL A;  1NCZ A;  3KEV A;  2MJW B;  1CLL A;  3BXK A;  4I5L B;  1ALW A;  1GQM A;  2JXL A;  2PMY A;  5AXI A;  2WC8 A;  4MRX A;  1CDL A;  1AJ4 A;  3PLF B;  2ZRS A;  3O6B A;  2LE9 B;  4CPV A;  1DMO A;  1K9P A;  1WY9 A;  1K93 D;  3KHE A;  3WHU B;  1KWO B;  1KK8 C;  1JSA A;  1JF0 A;  1KSO A;  1PSR A;  2JU0 A;  4M2Q A;  2E30 A;  3VRP A;  1JBA A;  1L2O C;  3DVE A;  2O60 A;  2LLT A;  4PHJ A;  2JXC A;  4GUK A;  2KOT A;  3CR4 X;  1TNW A;  1YRU B;  1YTZ C;  1A29 A;  4DRW A;  2LUC A;  4PHN A;  4DCK A;  4YGE B;  4GAO A;  3SJS A;  1XK4 A;  1N2D A;  1DJG A;  1G8I A;  3I5F B;  1KCY A;  3ICB A;  1CFP A;  2QPT A;  3VRO A;  1IRJ A;  1DJW A;  1CMF A;  5KU1 A;  2M3W A;  1CM1 A;  1YVL A;  1BR1 B;  1XK4 C;  3PSR A;  5FYX A;  3SG6 A;  4A4B A;  1U5I B;  4YGD B;  1BLQ A;  4ORB B;  1CFC A;  3FS7 A;  3LK1 A;  2D8N A;  4WQ2 A;  1K8U A;  4HSZ A;  1SY9 A;  3SG3 A;  1FI6 A;  1OSA A;  1S6J A;  5F6T A;  3AKA A;  4GFT A;  1M46 A;  1YX8 A;  2BCA A;  1KK7 Z;  1PSB A;  2LP3 A;  2P6B B;  2LUX A;  1SL7 A;  3D0Y B;  1SL8 A;  1B7T Z;  2KFG A;  3NSK A;  4GGN A;  4JWQ A;  2H61 C;  2L98 A;  1F54 A;  3ZNI A;  4E68 A;  2HQ8 A;  5PAL A;  3SG2 A;  4C0L A;  2GGZ A;  3A4U B; 
#chains in the Genus database with same CATH topology
 3BFB A;  3HCM A;  1C7W A;  1DEK A;  4GGF A;  2ZN9 A;  3RLZ A;  1TUZ A;  1TIZ A;  1QX7 A;  1RRO A;  3F45 A;  4ORC B;  1JC2 A;  5D7F A;  2HF5 A;  2JNF A;  1AP4 A;  2PRU A;  2MLF C;  1RJV A;  5K89 A;  2M29 A;  1QXP A;  1CDM A;  3B88 A;  1J1E A;  1CM4 A;  1QAT A;  1X02 A;  2JRF A;  1DGV A;  2KHN A;  2VRG A;  3B7A A;  1FI5 A;  1TNP A;  1WRK A;  3OGN A;  1OW4 A;  1NYA A;  1Z2C B;  3BOW A;  3UNW A;  4WQ3 A;  2PAL A;  3KO0 A;  1IIO A;  3LL8 B;  2OTG B;  4C0K A;  3FIA A;  2V53 A;  3D77 A;  2JNX A;  1PVB A;  2LLS A;  2COL B;  1CDP A;  1TWO A;  2KAY A;  3PN7 B;  2GGM A;  3PFV A;  4AOM A;  3VRR A;  1A2X A;  3BUW B;  4Q04 A;  2MHH A;  4INW A;  2LVJ A;  3OX6 A;  3DYE A;  3EK4 A;  4MLW A;  1EXR A;  2FOT A;  4M2O A;  3EK8 A;  1M31 A;  1R6P A;  1DJH A;  1SL9 A;  5B8I B;  2BCX A;  2LMU A;  2BCB A;  1TOP A;  1UHN A;  3KF9 A;  3VRQ A;  2YGU A;  4IJ7 A;  3WHT B;  1SYM A;  2QEV A;  3I5I C;  3O78 A;  1C07 A;  2OS8 C;  2M7L A;  1S5G Z;  1XFX O;  2LCP A;  4YGC B;  1D1O A;  5CSN A;  3B87 A;  3S0F A;  1A4P A;  4P5O E;  1P28 A;  1UHI A;  4I5J A;  5FI7 A;  4ICB A;  1BF5 A;  1WRZ A;  1KFU S;  4ZCU A;  1B9A A;  4C0J A;  1UHK A;  1CFD A;  1ZOT B;  4NQG A;  1RWY A;  1J7R A;  2F2P A;  2KPH A;  5FI6 A;  1JFK A;  1SR6 C;  1SSE B;  4CFR A;  1KQV A;  3I5I B;  2OS8 B;  3BUN B;  1K95 A;  1Y6W A;  1Y1A A;  4HRG A;  4QJ4 B;  2L4H A;  1KWO C;  3UO9 A;  1TN4 A;  1NUB A;  3MSE B;  1OZS A;  2L5Y A;  3EVR A;  1LVC D;  2I2R E;  1XVJ A;  3D73 A;  4MVF A;  1DEL A;  1DQE A;  4FQT A;  2K7O A;  1DJZ A;  1YR5 A;  1SR6 B;  3SIA A;  2JUL A;  2FJU B;  2EC6 C;  3CTN A;  1IH0 A;  2QDI A;  3VB1 A;  1CTR A;  5I2Q A;  1S6I A;  2MLE C;  1XFR A;  1NSH A;  1IQ3 A;  2WCE A;  3FE8 A;  1U5I A;  3K1E A;  2F3Y A;  3I5F C;  4HRH A;  1SRA A;  1CMG A;  2KGR A;  2L2C A;  5AFP A;  5HLO A;  1YUR A;  1MQ1 A;  1LIN A;  1UP5 A;  1F55 A;  3BUO B;  2L51 A;  3NSI A;  1MXE A;  1A03 A;  1EG3 A;  2LV7 A;  3I5G C;  4YBH B;  1VRK A;  5I94 A;  2EC6 B;  3D0Y A;  1OQP A;  5DKQ A;  4XJK B;  1SK6 D;  3TUY B;  3M0W A;  1V1F A;  1SCM B;  1CFF A;  3D10 A;  4DS7 A;  2ZND A;  2EHB A;  2Y1M A;  1NWD A;  1QJT A;  2WND A;  3ZWH A;  4JD9 A;  2PYQ A;  4I5K A;  2JC2 A;  3SG4 A;  1OOG A;  4AQJ A;  1W7J B;  2Y1N A;  4MEW A;  3EVV A;  3FWC A;  3SS5 A;  1ZAC A;  2L0P A;  1XFU O;  3I5G B;  1LA0 A;  2KQY A;  2K2F A;  4GNK B;  1JWD A;  2F3Z A;  3LCP C;  1RTP 1;  2PVB A;  2K2A A;  3JVT B;  4N1F A;  5CSJ A;  1DT7 B;  1S36 A;  1PVA A;  2PSR A;  1F4O A;  4PDZ A;  2GV5 A;  2H61 A;  2KQ6 A;  2LMV A;  4FTG A;  1ORG A;  2KFH A;  3O4Y A;  1BG1 A;  1CLM A;  2M7N A;  1R2U A;  1XFV O;  2I18 A;  4IL1 A;  2L5X B;  1XA5 A;  2K7C A;  2KYF A;  4OZD A;  1QLS A;  2K61 A;  4FQO A;  4F0Z B;  3EKH A;  3CZ1 A;  4MBE A;  1OOH A;  1F70 A;  2NLN A;  1WDC B;  3R1O A;  1XFW O;  2ZFD A;  1CDN A;  1Y0V H;  5GQQ C;  3EG5 B;  3TDI A;  1PRW A;  1UHH A;  4OVN F;  1A75 A;  3OBV A;  1ALV A;  3OHM B;  5I8N A;  2P71 A;  4I5N B;  1DJX A;  1NX0 A;  1W9Z A;  3TS5 C;  2H2K A;  1MWN A;  1OOI X;  2OTG C;  2KNE A;  4JPZ B;  3JTD C;  1EJ3 A;  1AJ5 A;  2WC5 A;  3PN7 C;  4NDC A;  1W7I B;  2JQ6 A;  2KFF A;  1NPQ A;  3CLN A;  2LAN A;  2Q4U A;  3AAK A;  2BE6 A;  3D76 A;  1Y1U A;  1SKT A;  1NP8 A;  3E3R A;  3TDZ A;  4KYN A;  3RZS A;  1S1E A;  3EKJ A;  4N5X A;  1M45 A;  1KQM C;  3OP0 A;  1ZMZ A;  3L4A A;  4PE4 A;  1LA3 A;  1QTX A;  3K21 A;  4MN0 A;  5AEQ A;  4OKH A;  3TS5 B;  1IJ6 A;  3TZ1 A;  1AVS A;  1QVI Y;  2CTN A;  3JTD B;  2F8P A;  1J7Q A;  3CYZ A;  1MR8 A;  1JFJ A;  2I7A A;  2CT9 A;  3VGO A;  1UUS A;  2HQW A;  2TN4 A;  2JOJ A;  2SAS A;  1F8H A;  3EVU A;  1EL4 A;  3VRN A;  1M39 A;  3BUM B;  1KSM A;  1K96 A;  1KQM B;  2IS9 A;  3S0B A;  5ER5 A;  2CBL A;  1TCO B;  1F71 A;  3C1V A;  1XO5 A;  1BOC A;  3CAB A;  1MUX A;  5KSZ A;  2RGI A;  2WOS A;  5IBW A;  3QME A;  3RM1 A;  3DVJ A;  2M0R A;  1B1G A;  5BPJ A;  1DF0 B;  3CS1 A;  2LHI A;  4MZJ A;  3LK0 A;  4WRI A;  5CPV A;  5HKW A;  4MZK A;  4PT1 A;  5I2L A;  1NCX A;  3PJI A;  2G9B A;  1LXF C;  1G33 A;  4TNC A;  1B4C A;  1GGZ A;  1UUR A;  2QEO A;  3EK7 A;  3NSL A;  3AAJ A;  4OV2 A;  2P70 A;  3NSO A;  4CFQ A;  1OMR A;  5HYD A;  3TDU A;  1GJY A;  1C3Y A;  2JPO A;  1K9U A;  2JT3 A;  3CGA A;  3QRX A;  3WNX B;  1H4B A;  1S3P A;  3KPX A;  4XYN A;  1KFX L;  2KI6 D;  2ZNE A;  1YUT A;  2R2I A;  4YI8 A;  2KI6 C;  5I2O A;  5KTY A;  4YI9 A;  2LP2 A;  3PAT A;  4PE0 A;  1EG4 A;  5TNC A;  2M8U A;  2WCM A;  3DVM A;  4DIR A;  1SCV A;  3IF7 A;  2WCH A;  3IVT A;  2M49 B;  2BL0 B;  4GBA A;  4XJK A;  1PK0 D;  2LAP A;  4P2Y B;  4A4C A;  3B6X A;  1IGV A;  3WXA A;  2MBX A;  3NGV A;  1NCY A;  2LVI A;  3FE6 A;  1TCF A;  2NZ0 A;  4OR9 B;  2B1U A;  1NX1 A;  5G08 A;  1JUO A;  3DZT A;  2QAC A;  2M9G A;  3CDN A;  1MXL C;  3TUY C;  1UHJ A;  2AAO A;  1DGU A;  1SCM C;  2BBN A;  1QIV A;  2LVK A;  2JTZ A;  1L7Z A;  1WLM A;  2KBI A;  1DC1 A;  3OB1 B;  3HX4 A;  2K7D A;  2F33 A;  4DUQ A;  2LM5 A;  3I5H B;  2JWW A;  1C3Z A;  1DVI A;  2JPT A;  3GK2 A;  3H4S E;  1TNQ A;  1WLZ A;  2GTE A;  1B8R A;  2EGD A;  5JOL A;  3SS4 A;  2JTT A;  1S26 D;  3CZT X;  1FW4 A;  2DOQ A;  1QV1 A;  2H8V A;  3JVT C;  2PAS A;  2WOR A;  4CID A;  1IQ5 A;  1XYD A;  1FPW A;  3O4X A;  1K9K A;  2Y4Q A;  2BBM A;  4D1E A;  2FCD A;  1OOJ A;  2O5G A;  1QS7 A;  3FWB A;  4PHM A;  1J7P A;  2MAZ A;  2HPS A;  4MSP A;  3OX5 A;  1RFJ A;  3O2P A;  1HT9 A;  1IJ5 A;  1QV0 A;  1MF8 B;  2NCO A;  1WDC C;  2BNX A;  1FBV A;  3CWG A;  1OOF A;  2KLE A;  3DY9 A;  3SIB A;  2KYC A;  1KK7 Y;  3DF0 B;  2A4J A;  3BFA A;  1OZO A;  3LLE A;  3SS3 A;  1YUS A;  1B7T Y;  2LC5 A;  3NHI A;  1BT6 A;  4GPL B;  2NCP A;  1AK8 A;  1H8B A;  2KI4 C;  1N0Y A;  1Q80 A;  2F2O A;  4USL A;  1DJI A;  2KGB C;  2BE4 A;  1S6C A;  2G2B A;  3GK4 X;  1KK8 B;  4PE1 A;  5ER4 X;  5AAN A;  2M1U A;  3AKB A;  3CR2 A;  1AUI B;  5HLV A;  1E8A A;  1L2O B;  2FCE A;  1DTL A;  1JF2 A;  4NDB A;  3PM8 A;  4INX A;  4R1E A;  2L50 A;  5AER A;  2L4I A;  1Y1X A;  2KI4 B;  2CXJ A;  3CR5 X;  5D3O A;  4QJ5 B;  1TUJ A;  1NIW A;  2KAV A;  1SPY A;  2AUC A;  2NXQ A;  2FJY A;  4BY4 A;  2SCP A;  1PUL A;  3CZ0 A;  5CSF A;  4ZCV A;  5DKR A;  2CNP A;  2KSP A;  1V1G A;  2Y5I A;  4ETO A;  2BKI B;  1EH2 A;  1NX3 A;  4N1G A;  4YRU A;  1DF0 A;  1BJF A;  4CLN A;  2HET A;  2I94 A;  2Q91 A;  1ODB A;  3BFH A;  1B47 A;  1YRT B;  5HKY A;  1BOD A;  5JJG A;  4MRY A;  3S0E A;  2K0J A;  2LHL A;  1CB1 A;  1QX2 A;  2OPO A;  1BR4 B;  2ISD A;  1XFY O;  4YGA A;  1J55 A;  4QJ3 B;  1CNP A;  1Z4H A;  2LNK A;  3L4L A;  1BU3 A;  1IG5 A;  1MHO A;  4GGF C;  2WCB A;  4JQ0 D;  2LVV A;  3DD4 A;  4M2P A;  5J3X A;  4PCW A;  2WCJ A;  5EL2 A;  3DXL A;  4NDD A;  5HKZ A;  1QX5 B;  3IQO A;  2M97 A;  5HL1 A;  3SG5 A;  3D78 A;  2QEB A;  1F4Q A;  1NX2 A;  1K2H A;  1YX7 A;  3GOF A;  4HRE E;  2LLU A;  1SBJ A;  1QIW A;  1UWO A;  2M1K B;  3BUX B;  1S5G Y;  5DKN A;  4F7F A;  1CKK A;  1AHR A;  1WRL A;  1OE9 B;  2BEC A;  1A75 B;  4MZL A;  1K94 A;  5D69 A;  1BMO A;  4BY5 A;  3A8R A;  3FE9 A;  1QVI Z;  2JT0 A;  1N65 A;  2KBM A;  3BQ3 A;  1B8L A;  1KFU L;  1TTX A;  1B8C A;  4ORA B;  1QAS A;  3L47 A;  1OMV A;  3GK1 A;  1J7O A;  1SMG A;  1HQV A;  1CLB A;  1SW8 A;  2MA2 A;  2BL0 C;  2ERB A;  1LKJ A;  2CCM A;  1C7V A;  2K8M B;  1GGW A;  1QLK A;  5CSI A;  3R72 A;  2BAP A;  1K90 D;  2KLD A;  2LMT A;  4PHK A;  1YVH A;  3SG7 A;  1GM0 A;  4YGB B;  1J1D A;  3BOW B;  1QWV A;  3DVK A;  4PE7 A;  2JZI A;  3OB2 B;  1IWQ A;  2E6W A;  2WC6 A;  4PAL A;  3Q8I A;  3S0A A;  2MRD A;  3IQQ A;  1RK9 A;  1SNL A;  1ZFS A;  1TNX A;  1DJY A;  5FI2 A;  1IKU A;  4U8D A;  1YUU A;  3I5H C;  2ZRT A;  2L2E A;  1REC A;  4JKT A;  5DIC A;  2JT8 A;  4UPG A;  1ZUZ A;  1G4Y R;  1M63 B;  1TRF A;  2KAX A;  4L9M A;  1OMD A;  1PAL A;  3BYA A;  2WCK A;  4AQI A;  1FF1 A;  4OCI A;  3N7H A;  1XFZ O;  2BKH B;  3NXA A;  2ZKM X;  2WCF A;  2AMI A;  2ZN8 A;  3NHT A;  2KDH A;  2K7B A;  1KFX S;  3DF0 A;  3PAL A;  1NCZ A;  1T14 A;  3KEV A;  2MJW B;  1CLL A;  3BXK A;  4I5L B;  1ALW A;  1GQM A;  2JXL A;  2PMY A;  5AXI A;  2WCL A;  2WC8 A;  4MRX A;  1CDL A;  2PQL A;  1AJ4 A;  3PLF B;  2ZRS A;  3O6B A;  2LE9 B;  4CPV A;  1DMO A;  1K9P A;  1WY9 A;  1K93 D;  3KHE A;  3WHU B;  3CZ2 A;  1KWO B;  1KK8 C;  3S0D A;  1JSA A;  1JF0 A;  1KSO A;  1PSR A;  2JU0 A;  3D74 A;  4M2Q A;  2E30 A;  2QEH A;  3B86 A;  3VRP A;  1JBA A;  1L2O C;  3DVE A;  2O60 A;  2LLT A;  4PHJ A;  2JXC A;  4GUK A;  2KOT A;  3CR4 X;  1TNW A;  1YRU B;  1YTZ C;  1A29 A;  4DRW A;  2LUC A;  4PHN A;  4DCK A;  4YGE B;  4GAO A;  3SJS A;  1XK4 A;  1N2D A;  1DJG A;  1G8I A;  3PM2 A;  3I5F B;  1KCY A;  3ICB A;  1CFP A;  2QPT A;  2K60 A;  3D75 A;  3VRO A;  1IRJ A;  1DJW A;  1CMF A;  5KU1 A;  2M3W A;  1CM1 A;  1YVL A;  3S0G A;  1BR1 B;  3R1V A;  1XK4 C;  3PSR A;  5FYX A;  3SG6 A;  4A4B A;  1U5I B;  3BJH A;  4YGD B;  1BLQ A;  4ORB B;  1CFC A;  3FS7 A;  3LK1 A;  3V2L A;  2D8N A;  3R1P A;  1K8U A;  1LS8 A;  1SY9 A;  4HSZ A;  4WQ2 A;  3SG3 A;  1FI6 A;  1OSA A;  1S6J A;  5F6T A;  3AKA A;  4GFT A;  1M46 A;  1YX8 A;  2BCA A;  1KK7 Z;  1PSB A;  2LP3 A;  2P6B B;  2LUX A;  1SL7 A;  3D0Y B;  1SL8 A;  1B7T Z;  2KFG A;  3NSK A;  4GGN A;  4JWQ A;  2H61 C;  2L98 A;  1F54 A;  3ZNI A;  4E68 A;  2HQ8 A;  5PAL A;  3SG2 A;  4C0L A;  2GGZ A;  3A4U B; 
#chains in the Genus database with same CATH homology
 3HCM A;  1C7W A;  4GGF A;  2ZN9 A;  3RLZ A;  1TIZ A;  1QX7 A;  1RRO A;  3F45 A;  4ORC B;  1JC2 A;  5D7F A;  2HF5 A;  2JNF A;  1AP4 A;  2PRU A;  2MLF C;  1RJV A;  5K89 A;  2M29 A;  1QXP A;  1CDM A;  1J1E A;  1CM4 A;  1QAT A;  1X02 A;  2JRF A;  1DGV A;  2KHN A;  2VRG A;  1FI5 A;  1TNP A;  1WRK A;  1NYA A;  3BOW A;  4WQ3 A;  2PAL A;  3KO0 A;  3LL8 B;  2OTG B;  4C0K A;  3FIA A;  2V53 A;  2JNX A;  1PVB A;  2LLS A;  2COL B;  1CDP A;  3PN7 B;  2KAY A;  2GGM A;  3PFV A;  4AOM A;  3VRR A;  1A2X A;  3BUW B;  4Q04 A;  2MHH A;  2LVJ A;  3OX6 A;  3EK4 A;  4MLW A;  1EXR A;  2FOT A;  4M2O A;  3EK8 A;  1M31 A;  1R6P A;  1DJH A;  1SL9 A;  5B8I B;  2BCX A;  2LMU A;  2BCB A;  1TOP A;  1UHN A;  3KF9 A;  3VRQ A;  3WHT B;  1SYM A;  3I5I C;  3O78 A;  1C07 A;  2OS8 C;  2M7L A;  1S5G Z;  1XFX O;  2LCP A;  4YGC B;  1D1O A;  5CSN A;  1A4P A;  4P5O E;  1UHI A;  4I5J A;  1BF5 A;  4ICB A;  1WRZ A;  1KFU S;  4ZCU A;  1B9A A;  4C0J A;  1UHK A;  1CFD A;  1ZOT B;  4NQG A;  1RWY A;  1J7R A;  2F2P A;  1JFK A;  1SR6 C;  4CFR A;  1KQV A;  3I5I B;  2OS8 B;  3BUN B;  1K95 A;  1Y6W A;  1Y1A A;  4HRG A;  4QJ4 B;  2L4H A;  1KWO C;  1TN4 A;  1NUB A;  3MSE B;  1OZS A;  3EVR A;  1LVC D;  2I2R E;  1XVJ A;  4MVF A;  2K7O A;  1DJZ A;  1YR5 A;  1SR6 B;  3SIA A;  2JUL A;  2FJU B;  2EC6 C;  3CTN A;  1IH0 A;  1CTR A;  5I2Q A;  1S6I A;  2MLE C;  1NSH A;  1IQ3 A;  2WCE A;  1U5I A;  2F3Y A;  3I5F C;  4HRH A;  1SRA A;  1CMG A;  2KGR A;  5AFP A;  5HLO A;  1YUR A;  1MQ1 A;  1LIN A;  1UP5 A;  1F55 A;  3BUO B;  2L51 A;  3NSI A;  1MXE A;  1A03 A;  1EG3 A;  2LV7 A;  3I5G C;  4YBH B;  1VRK A;  2EC6 B;  3D0Y A;  1OQP A;  5DKQ A;  4XJK B;  1SK6 D;  3TUY B;  3M0W A;  1V1F A;  1SCM B;  1CFF A;  3D10 A;  4DS7 A;  2ZND A;  2EHB A;  2Y1M A;  1NWD A;  1QJT A;  2WND A;  3ZWH A;  4I5K A;  2JC2 A;  3SG4 A;  4AQJ A;  1W7J B;  2Y1N A;  4MEW A;  3EVV A;  3FWC A;  1ZAC A;  2L0P A;  1XFU O;  3I5G B;  1LA0 A;  2KQY A;  2K2F A;  4GNK B;  1JWD A;  2F3Z A;  3LCP C;  1RTP 1;  2PVB A;  2K2A A;  3JVT B;  4N1F A;  5CSJ A;  1DT7 B;  1S36 A;  1PVA A;  2PSR A;  1F4O A;  4PDZ A;  2GV5 A;  2H61 A;  2KQ6 A;  2LMV A;  4FTG A;  3O4Y A;  2KFH A;  1BG1 A;  1CLM A;  2M7N A;  1R2U A;  1XFV O;  2I18 A;  4IL1 A;  2L5X B;  1XA5 A;  2K7C A;  2KYF A;  1QLS A;  2K61 A;  4FQO A;  4F0Z B;  3EKH A;  4MBE A;  1F70 A;  2NLN A;  1WDC B;  1XFW O;  2ZFD A;  1CDN A;  1Y0V H;  5GQQ C;  3TDI A;  1PRW A;  1UHH A;  4OVN F;  1A75 A;  1ALV A;  3OHM B;  5I8N A;  4I5N B;  1DJX A;  1NX0 A;  3TS5 C;  2H2K A;  1MWN A;  2OTG C;  2KNE A;  4JPZ B;  3JTD C;  1EJ3 A;  1AJ5 A;  3PN7 C;  4NDC A;  1W7I B;  2JQ6 A;  2KFF A;  1NPQ A;  3CLN A;  2LAN A;  2Q4U A;  3AAK A;  2BE6 A;  1Y1U A;  1SKT A;  1NP8 A;  3E3R A;  3TDZ A;  1S1E A;  3EKJ A;  4N5X A;  1M45 A;  1KQM C;  3OP0 A;  1ZMZ A;  4PE4 A;  1LA3 A;  1QTX A;  3K21 A;  4MN0 A;  5AEQ A;  4OKH A;  3TS5 B;  1IJ6 A;  3TZ1 A;  1AVS A;  1QVI Y;  2CTN A;  3JTD B;  2F8P A;  1J7Q A;  1MR8 A;  1JFJ A;  2I7A A;  2CT9 A;  3VGO A;  1UUS A;  2HQW A;  2TN4 A;  2JOJ A;  2SAS A;  1F8H A;  3EVU A;  1EL4 A;  3VRN A;  1M39 A;  3BUM B;  1KSM A;  1K96 A;  1KQM B;  2IS9 A;  5ER5 A;  2CBL A;  1TCO B;  1F71 A;  3C1V A;  1XO5 A;  1BOC A;  1MUX A;  5KSZ A;  2RGI A;  2WOS A;  5IBW A;  3RM1 A;  3DVJ A;  2M0R A;  1B1G A;  5BPJ A;  1DF0 B;  3CS1 A;  2LHI A;  4MZJ A;  3LK0 A;  4WRI A;  5CPV A;  5HKW A;  4MZK A;  5I2L A;  1NCX A;  2G9B A;  1LXF C;  1G33 A;  4TNC A;  1B4C A;  1GGZ A;  1UUR A;  3EK7 A;  3NSL A;  3AAJ A;  4OV2 A;  4CFQ A;  3NSO A;  5HYD A;  1OMR A;  3TDU A;  1GJY A;  1K9U A;  2JT3 A;  3CGA A;  3QRX A;  3WNX B;  1H4B A;  1S3P A;  3KPX A;  4XYN A;  1KFX L;  2KI6 D;  2ZNE A;  1YUT A;  2R2I A;  4YI8 A;  2KI6 C;  5I2O A;  5KTY A;  4YI9 A;  2LP2 A;  3PAT A;  4PE0 A;  1EG4 A;  5TNC A;  2M8U A;  3DVM A;  4DIR A;  1SCV A;  3IF7 A;  2M49 B;  2BL0 B;  4GBA A;  4XJK A;  1PK0 D;  2LAP A;  4P2Y B;  4A4C A;  1IGV A;  3WXA A;  2MBX A;  1NCY A;  2LVI A;  1TCF A;  2NZ0 A;  4OR9 B;  2B1U A;  1NX1 A;  5G08 A;  1JUO A;  2QAC A;  2M9G A;  3TUY C;  1MXL C;  1UHJ A;  2AAO A;  1DGU A;  1SCM C;  2BBN A;  1QIV A;  2LVK A;  2JTZ A;  1L7Z A;  1WLM A;  2KBI A;  3OB1 B;  3HX4 A;  2K7D A;  2F33 A;  4DUQ A;  2LM5 A;  3I5H B;  2JWW A;  2JPT A;  1DVI A;  3GK2 A;  3H4S E;  1TNQ A;  1WLZ A;  5JOL A;  1B8R A;  2EGD A;  2JTT A;  1S26 D;  3CZT X;  1FW4 A;  2DOQ A;  1QV1 A;  3JVT C;  2PAS A;  2WOR A;  4CID A;  1IQ5 A;  1XYD A;  1FPW A;  1K9K A;  2Y4Q A;  2BBM A;  4D1E A;  2FCD A;  1OOJ A;  2O5G A;  1QS7 A;  3FWB A;  4PHM A;  1J7P A;  2MAZ A;  2HPS A;  4MSP A;  3OX5 A;  1RFJ A;  3O2P A;  1HT9 A;  1IJ5 A;  1QV0 A;  1MF8 B;  2NCO A;  1WDC C;  3SIB A;  1FBV A;  3CWG A;  2KYC A;  1KK7 Y;  3DF0 B;  2A4J A;  1OZO A;  3LLE A;  1YUS A;  1B7T Y;  2LC5 A;  4GPL B;  1BT6 A;  1AK8 A;  2NCP A;  1H8B A;  2KI4 C;  1N0Y A;  1Q80 A;  2F2O A;  4USL A;  1DJI A;  2KGB C;  2BE4 A;  1S6C A;  2G2B A;  3GK4 X;  1KK8 B;  4PE1 A;  5ER4 X;  5AAN A;  2M1U A;  3AKB A;  3CR2 A;  1AUI B;  5HLV A;  1E8A A;  1L2O B;  2FCE A;  1DTL A;  1JF2 A;  4NDB A;  3PM8 A;  4R1E A;  2L50 A;  5AER A;  2L4I A;  1Y1X A;  2KI4 B;  2CXJ A;  3CR5 X;  4QJ5 B;  1NIW A;  2KAV A;  1SPY A;  2AUC A;  2NXQ A;  4BY4 A;  2SCP A;  1PUL A;  4ZCV A;  5CSF A;  5DKR A;  2CNP A;  2KSP A;  1V1G A;  2Y5I A;  4ETO A;  2BKI B;  1EH2 A;  1NX3 A;  4N1G A;  4YRU A;  1DF0 A;  1BJF A;  4CLN A;  2HET A;  2I94 A;  2Q91 A;  1ODB A;  1B47 A;  1YRT B;  5HKY A;  1BOD A;  5JJG A;  4MRY A;  2K0J A;  2LHL A;  1CB1 A;  1QX2 A;  2OPO A;  1BR4 B;  2ISD A;  1XFY O;  4YGA A;  1J55 A;  4QJ3 B;  1CNP A;  2LNK A;  1BU3 A;  1IG5 A;  1MHO A;  4GGF C;  2WCB A;  4JQ0 D;  2LVV A;  3DD4 A;  4M2P A;  5J3X A;  4PCW A;  4NDD A;  5HKZ A;  1QX5 B;  3IQO A;  2M97 A;  3SG5 A;  1F4Q A;  1NX2 A;  1K2H A;  1YX7 A;  3GOF A;  4HRE E;  2LLU A;  1SBJ A;  1QIW A;  1UWO A;  2M1K B;  3BUX B;  1S5G Y;  5DKN A;  1CKK A;  1AHR A;  1WRL A;  1OE9 B;  2BEC A;  1A75 B;  4MZL A;  1K94 A;  5D69 A;  1BMO A;  4BY5 A;  3A8R A;  1QVI Z;  2JT0 A;  1N65 A;  2KBM A;  3BQ3 A;  1B8L A;  1KFU L;  1TTX A;  1B8C A;  4ORA B;  1QAS A;  1OMV A;  3GK1 A;  1J7O A;  1SMG A;  1HQV A;  1CLB A;  1SW8 A;  2MA2 A;  2BL0 C;  1LKJ A;  2CCM A;  1C7V A;  2K8M B;  1GGW A;  1QLK A;  5CSI A;  1K90 D;  2LMT A;  4PHK A;  3SG7 A;  1YVH A;  4YGB B;  1J1D A;  3BOW B;  3DVK A;  4PE7 A;  2JZI A;  3OB2 B;  1IWQ A;  2E6W A;  4PAL A;  2MRD A;  3IQQ A;  1RK9 A;  1SNL A;  1ZFS A;  1TNX A;  1DJY A;  1IKU A;  4U8D A;  1YUU A;  3I5H C;  2ZRT A;  2L2E A;  1REC A;  2JT8 A;  4UPG A;  1ZUZ A;  1G4Y R;  1M63 B;  1TRF A;  2KAX A;  4L9M A;  1OMD A;  1PAL A;  3BYA A;  4AQI A;  1FF1 A;  4OCI A;  1XFZ O;  2BKH B;  3NXA A;  2ZKM X;  2WCF A;  2AMI A;  2ZN8 A;  2KDH A;  2K7B A;  1KFX S;  3DF0 A;  3PAL A;  1NCZ A;  3KEV A;  2MJW B;  1CLL A;  3BXK A;  4I5L B;  1ALW A;  1GQM A;  2JXL A;  2PMY A;  5AXI A;  2WC8 A;  4MRX A;  1CDL A;  1AJ4 A;  3PLF B;  2ZRS A;  3O6B A;  2LE9 B;  4CPV A;  1DMO A;  1K9P A;  1WY9 A;  1K93 D;  3KHE A;  3WHU B;  1KWO B;  1KK8 C;  1JSA A;  1JF0 A;  1KSO A;  1PSR A;  2JU0 A;  4M2Q A;  2E30 A;  3VRP A;  1JBA A;  1L2O C;  3DVE A;  2O60 A;  2LLT A;  4PHJ A;  2JXC A;  4GUK A;  2KOT A;  3CR4 X;  1TNW A;  1YRU B;  1YTZ C;  1A29 A;  4DRW A;  2LUC A;  4PHN A;  4DCK A;  4YGE B;  4GAO A;  3SJS A;  1XK4 A;  1N2D A;  1DJG A;  1G8I A;  3I5F B;  1KCY A;  3ICB A;  1CFP A;  2QPT A;  3VRO A;  1IRJ A;  1DJW A;  1CMF A;  5KU1 A;  2M3W A;  1CM1 A;  1YVL A;  1BR1 B;  1XK4 C;  3PSR A;  5FYX A;  3SG6 A;  4A4B A;  1U5I B;  4YGD B;  1BLQ A;  4ORB B;  1CFC A;  3FS7 A;  3LK1 A;  2D8N A;  4WQ2 A;  1K8U A;  4HSZ A;  1SY9 A;  3SG3 A;  1FI6 A;  1OSA A;  1S6J A;  5F6T A;  3AKA A;  4GFT A;  1M46 A;  1YX8 A;  2BCA A;  1KK7 Z;  1PSB A;  2LP3 A;  2P6B B;  2LUX A;  1SL7 A;  3D0Y B;  1SL8 A;  1B7T Z;  2KFG A;  3NSK A;  4GGN A;  4JWQ A;  2H61 C;  2L98 A;  1F54 A;  3ZNI A;  4E68 A;  2HQ8 A;  5PAL A;  3SG2 A;  4C0L A;  2GGZ A;  3A4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...