1QWVA

Solution structure of antheraea polyphemus pheromone binding protein (apolpbp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title The Solution NMR Structure of Antheraea polyphemus PBP Provides New Insight into Pheromone Recognition by Pheromone-binding Proteins
pubmed doi rcsb
source organism Antheraea polyphemus
molecule tags Transport protein
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1qwvA00
1OOGA 2WCMA 1XFRA 2KPHA 3FE9A 3S0EA 2JPOA 1C3ZA 3CZ1A 3B86A 2QEVA 2WCHA 2ERBA 4INXA 3OGNA 3DXLA 3BFHA 3D76A 3R1VA 3L4LA 3NGVA 4F7FA 3B7AA 2QEBA 4PT1A 1T14A 3BFBA 2GTEA 3CZ2A 1OW4A 3N7HA 1DQEA 3D77A 3S0AA 3DZTA 3NHIA 1GM0A 4FQTA 2PQLA 2WCJA 2FJYA 2L2CA 1OOHA 3CZ0A 3R72A 3L4AA 4OZDA 1OOIX 3RZSA 2P71A 2P70A 2H8VA 2WCLA 3R1OA 1OOFA 3CABA 3FE8A 1TWOA 3L47A 3CYZA 5EL2A 3NHTA 2WC6A 3K1EA 3S0BA 3VB1A 1LS8A 3BFAA 3B88A 4JD9A 4INWA 3PJIA 1ORGA 3R1PA 3CDNA 3DYEA 3S0GA 3B87A 1P28A 2QEOA 3B6XA 2QDIA 3S0FA 2WCKA 1QWVA 3D73A 3DY9A 2WC5A 3S0DA 3Q8IA 3D74A 3D78A 3D75A 1TUJA 3FE6A 3QMEA 3BJHA 5DICA 3V2LA 1C3YA 2QEHA
chains in the Genus database with same CATH superfamily
3QRXA 2KQ6A 1S5GY 3PM8A 2MHHA 1QV0A 4MSPA 1UUSA 3K21A 2I18A 1UHHA 1V1GA 1ZMZA 3FE9A 2LC5A 3CZ1A 3LL8B 1TNPA 2BL0C 3JVTB 1K95A 3ZNIA 2OTGC 1QLSA 2ZNDA 4PE4A 1QASA 1NX3A 1ZOTB 4ZCVA 3SG3A 5B8IB 2WCBA 1PVAA 1M39A 1DGVA 5I8NA 5AFPA 1PALA 1S6JA 2K2AA 2LVJA 1K93D 2LMVA 4P2YB 3BXKA 2KNEA 1LKJA 2LLSA 4PHNA 5I94A 1M31A 2QEBA 1SR6B 1D1OA 4MRXA 1CNPA 3KPXA 1LINA 3PN7B 2HF5A 4DRWA 2HETA 3O78A 3BFBA 3KEVA 2JPTA 4JWQA 2M0RA 1GJYA 3EG5B 4DUQA 1QJTA 3NSKA 3PFVA 1OW4A 2KI6D 1V1FA 3VRPA 2GV5A 3I5HC 1BT6A 1A75A 1QIWA 1TOPA 2LHLA 4FQTA 2K7DA 2KFHA 1KSMA 4YGDB 2L2EA 1SK6D 4YGEB 4ORBB 1YRUB 3PLFB 5D69A 3SIBA 4IJ7A 2HQ8A 1DF0A 1IG5A 1NPQA 2KHNA 4BY4A 4GBAA 4XJKB 3IQOA 2MLFC 1BF5A 1DJYA 1MXEA 1OOHA 3OX6A 4FTGA 1J7OA 1WLZA 2JT3A 2KI4C 1OZSA 4U8DA 4CLNA 2BCAA 1IGVA 1K90D 2M8UA 2WORA 3VGOA 3TDUA 1B7TY 1TIZA 3BYAA 1KK7Z 4MVFA 1FI5A 3ICBA 2P71A 1EG4A 3E3RA 2TN4A 4M2QA 1WRKA 1EXRA 2WCLA 2WOSA 4PE7A 4ETOA 4GGNA 3TZ1A 1KCYA 1JC2A 1NCZA 3SS5A 4A4BA 1OE9B 3GK1A 1WLMA 4P5OE 1TNXA 4DS7A 1SBJA 2BBMA 1XA5A 4HREE 2BBNA 3SG7A 3VB1A 2LCPA 3BFAA 4YRUA 4JQ0D 3IF7A 2CXJA 2GGZA 3BOWA 4GPLB 1CM4A 2H2KA 1DT7B 2L51A 1CB1A 5CSFA 4HRHA 5FI7A 2JRFA 2QDIA 1QS7A 5CSJA 4HSZA 1RK9A 2AAOA 1EJ3A 2WC5A 1F70A 4L9MA 5K89A 1J7QA 4YGBB 4MEWA 1G8IA 3S0DA 1S6IA 1WRLA 4CFQA 1TCOB 1Y1AA 5CSNA 1WRZA 3EVVA 1YVHA 2L98A 1B1GA 3BQ3A 1YURA 2JNXA 3D78A 5D3OA 1OMDA 2F2PA 2O60A 3VRRA 1YUSA 1RTP1 3D75A 2JU0A 1TUJA 4MLWA 2L5YA 1SCVA 3O4YA 4I5KA 1F71A 1FW4A 1KQMC 2BAPA 2Y1NA 1C3YA 2Y1MA 1XK4C 1K9UA 2A4JA 3CWGA 3GOFA 2EHBA 2K0JA 1OOGA 4NQGA 3TUYC 1L2OB 2L50A 2MLEC 3PALA 3NXAA 4M2PA 1SCMB 1A03A 3I5IB 3EKJA 3S0EA 1RJVA 2LP2A 2SCPA 1OMRA 3EKHA 1KQMB 2WCHA 2ERBA 2JQ6A 1IWQA 1NX0A 2BE6A 3UO9A 2KI6C 4BY5A 1C7VA 5ER5A 5HKYA 1TNQA 3OB1B 2NXQA 4KYNA 1S6CA 1SY9A 1YX8A 2KGBC 5DKQA 2OS8B 2LANA 1UWOA 4ICBA 4MZKA 4YI8A 2PYQA 1BJFA 3I5GB 1NCXA 2PALA 3D0YB 2EC6B 2JT8A 3JVTC 1ALWA 1AP4A 1JSAA 4A4CA 4I5LB 4JKTA 4GNKB 1NCYA 1S36A 3BUNB 4D1EA 5I2LA 1KFUL 3WXAA 2KLDA 4OR9B 1S5GZ 1S26D 3HX4A 2KOTA 1S3PA 1UP5A 2BKIB 2G2BA 3TDZA 2JOJA 3I5FC 3FS7A 1DQEA 1M63B 1MQ1A 4QJ4B 2JTTA 1AK8A 3CR4X 1SR6C 3NHIA 2M97A 1FBVA 1DC1A 4MBEA 1N0YA 2LVVA 1QXPA 2LUXA 3PN7C 2H61A 1ZACA 1X02A 2M7LA 2NCOA 4XYNA 4PALA 4QJ3B 2F2OA 1CDLA 1QATA 3I5FB 1FPWA 4WRIA 1WY9A 2CBLA 2KAVA 2KAYA 1UHKA 2R2IA 1OOIX 3RZSA 1CM1A 2KQYA 2Q4UA 1KK8C 1C7WA 5JOLA 2M3WA 3WNXB 1JUOA 4WQ2A 4PCWA 1NYAA 3FIAA 1K8UA 2H8VA 2I94A 5HYDA 3R1OA 4NDDA 3BOWB 3WHTB 1OOFA 2BE4A 2QPTA 3AAJA 3CABA 2OPOA 4NDBA 3L47A 1KWOB 2FCDA 1ALVA 3CYZA 5EL2A 1KK8B 4C0JA 2PSRA 3H4SE 2MJWB 1QV1A 1TCFA 3OB2B 1XK4A 2F33A 3OHMB 3PJIA 1KFXS 1J7RA 1SL7A 2AMIA 3DF0A 3R1PA 5G08A 3CDNA 2NLNA 3KO0A 1JBAA 1J7PA 3S0GA 2JULA 1B4CA 2KBIA 1XFXO 2WCFA 3OX5A 4MRYA 3B6XA 1CMGA 1LVCD 2BNXA 2VRGA 3EK4A 1CKKA 2Q91A 1K2HA 4PHJA 4E68A 4GAOA 1B7TZ 4Q04A 1F4QA 1J1EA 2JXLA 2DOQA 1MF8B 1SRAA 2L5XB 5HKZA 2JT0A 2M1UA 4PHKA 4F0ZB 5FI6A 1DJZA 3CS1A 1IJ6A 2RGIA 3VRQA 4DIRA 1SNLA 1NSHA 1KSOA 1Z2CB 3LK1A 1XFYO 2AUCA 2E30A 1YR5A 3NSLA 3O4XA 4YGAA 1AVSA 1XO5A 4PHMA 3QMEA 3CZTX 3O2PA 5DICA 1TUZA 1XFZO 1R6PA 1B8CA 2QEHA 1DEKA 1TTXA 3V2LA 2L4HA 1AJ4A 2F3YA 1TN4A 4IL1A 4OV2A 2KYFA 1B47A 1CFFA 5TNCA 2HQWA 2LMTA 2PRUA 1A4PA 1C3ZA 3CGAA 1CFPA 1DJWA 3B86A 1OMVA 3OGNA 3AKBA 4GGFC 1RECA 2ZN8A 3A8RA 1G4YR 3DXLA 4I5JA 1JFKA 1SSEB 1JF2A 3CR5X 4YGCB 1BODA 2G9BA 1TRFA 3OBVA 1RFJA 1BR4B 1L2OC 2JC2A 2K2FA 3L4LA 3NGVA 2LM5A 1SCMC 2LHIA 4F7FA 1B8RA 1OZOA 2LVIA 3B7AA 3I5IC 4FQOA 2CNPA 5AEQA 4CIDA 5IBWA 2PMYA 2BCBA 5PALA 1N65A 1QLKA 3PSRA 4XJKA 1ODBA 1W7IB 2K7OA 2OS8C 3IQQA 4AQJA 2JWWA 3DD4A 1DJIA 3I5GC 2L0PA 4YI9A 2EC6C 1XVJA 1CDMA 3S0AA 1NX1A 2Y4QA 1HT9A 3CTNA 1DELA 2ZN9A 3GK2A 1RROA 3PM2A 2PQLA 1MXLC 2LNKA 1DJHA 1SW8A 1U5IA 2GGMA 4AOMA 3CR2A 4MZJA 4OKHA 1NIWA 1LA0A 2F3ZA 3EK7A 1CTRA 2WCJA 2FJYA 2I7AA 4UPGA 5BPJA 1AUIB 1EH2A 2K7CA 3LCPC 2M49B 3CZ0A 1K94A 2E6WA 5D7FA 3R72A 2JXCA 1B9AA 1QX5B 2ZRSA 3L4AA 2P6BB 2WCEA 4OZDA 1TNWA 1CFDA 1HQVA 2Y5IA 2B1UA 5AANA 1OOJA 1QX7A 1A75B 2CCMA 1WDCB 2PASA 3DVEA 5CSIA 5CPVA 2P70A 2HPSA 3EK8A 3KF9A 4PE0A 1DF0B 1GGWA 1M46A 2MA2A 1QTXA 5HLOA 3A4UB 5DKNA 1TWOA 1SMGA 1BMOA 1SL8A 2KFFA 1DMOA 1YUUA 1YVLA 1S1EA 2BKHB 1W7JB 1L7ZA 3NHTA 1SKTA 3K1EA 1BU3A 2COLB 1SL9A 4ORAB 4N5XA 3JTDC 3SJSA 4JD9A 4PE1A 5I2QA 1AJ5A 1OQPA 2ZKMX 2LAPA 5I2OA 2ZRTA 1IQ5A 1NWDA 1PRWA 1YX7A 3DYEA 3BUWB 1IKUA 1CLBA 1P28A 2QEOA 1MUXA 3UNWA 1IH0A 1KWOC 2FOTA 1K9KA 3CLNA 1PULA 2LP3A 4GGFA 3JTDB 2CT9A 2KLEA 4R1EA 1UHJA 3SG4A 4C0LA 2MRDA 1OSAA 4OVNF 1K9PA 1Z4HA 2FCEA 3DVMA 3SS4A 2NZ0A 1BOCA 2CTNA 5FYXA 3F45A 2BL0B 1J1DA 5KU1A 3SG2A 2LV7A 5HKWA 1A29A 1XFUO 2OTGB 1R2UA 3FE6A 4NDCA 1EL4A 3VROA 3BJHA 2KBMA 4AQIA 1AHRA 3NSOA 3LK0A 5HL1A 3SS3A 2M9GA 1QVIY 5KSZA 4TNCA 1JFJA 2L4IA 1PSRA 1QVIZ 4JPZB 2BECA 1CLLA 1PSBA 4M2OA 3D0YA 2EGDA 2WCMA 1XFRA 2JNFA 1W9ZA 2KPHA 2PVBA 2JPOA 1EG3A 1NX2A 4I5NB 2QEVA 4INXA 1NP8A 1H8BA 3FWCA 5ER4X 1DTLA 2M1KB 5DKRA 2MAZA 2YGUA 3BFHA 4MZLA 5FI2A 2LMUA 2F8PA 4PDZA 1F55A 1Y1UA 3D76A 3R1VA 3RM1A 2LE9B 3TS5C 2IS9A 2KYCA 3EVUA 4OCIA 1MWNA 2I2RE 1Y0VH 4MN0A 1DJXA 1KFXL 1IIOA 4PT1A 1LA3A 3I5HB 3RLZA 4QJ5B 1G33A 1XYDA 1Y6WA 2BCXA 4GUKA 1CMFA 1KK7Y 1CLMA 4ORCB 1FF1A 1N2DA 4N1GA 1UHIA 1T14A 2LVKA 3C1VA 1JF0A 3TS5B 2GTEA 1C07A 1U5IB 3PATA 1YTZC 3EVRA 3CZ2A 1MHOA 3MSEB 2KFGA 2KI4B 3N7HA 5GQQC 3D77A 4GFTA 2LLTA 1CDNA 3DZTA 1LXFC 3DVJA 4ZCUA 1JWDA 1GM0A 2M29A 2K7BA 1UURA 2KGRA 1ZUZA 2JZIA 4YBHB 2ZNEA 5HLVA 4CFRA 1A2XA 3WHUB 2FJUB 3AAKA 3SG6A 3ZWHA 1SPYA 2L2CA 5AXIA 2H61C 1YUTA 1PK0D 4N1FA 3LLEA 2WC8A 3FWBA 1CFCA 3IVTA 5F6TA 3SIAA 4C0KA 5J3XA 3KHEA 1GQMA 3VRNA 1M45A 1DVIA 5JJGA 3M0WA 1F54A 3BUOB 1XFWO 3BUXB 4CPVA 1DGUA 1BR1B 2WNDA 3FE8A 2JTZA 3BUMB 2MBXA 4DCKA 1J55A 2LLUA 2WC6A 2ZFDA 2K61A 1CDPA 1H4BA 3S0BA 1E8AA 1LS8A 1SYMA 1WDCC 1K96A 2V53A 3B88A 3GK4X 3O6BA 4INWA 4WQ3A 1DJGA 1FI6A 1ORGA 1PVBA 5AERA 1KQVA 3DVKA 1RWYA 3AKAA 3SG5A 4USLA 2ISDA 3B87A 1XFVO 1KFUS 2KSPA 1QX2A 3OP0A 1IQ3A 1BG1A 3S0FA 2WCKA 1QWVA 3D73A 2KAXA 1VRKA 2LUCA 1F4OA 3DY9A 1ZFSA 2NCPA 3D10A 3Q8IA 1NUBA 3D74A 3TDIA 2SASA 2K8MB 2KDHA 1B8LA 1QIVA 2QACA 3DF0B 3TUYB 3NSIA 1GGZA 2D8NA 1MR8A 1Q80A 2O5GA 3HCMA 2M7NA 4HRGA 5KTYA 1F8HA 1YRTB 2K60A 1BLQA 1IJ5A 1UHNA 1IRJA 1Y1XA
chains in the Genus database with same CATH topology
1OOGA 2WCMA 1XFRA 2KPHA 3FE9A 3S0EA 2JPOA 1C3ZA 3CZ1A 3B86A 2QEVA 2WCHA 2ERBA 4INXA 3OGNA 3DXLA 3BFHA 3D76A 3R1VA 3L4LA 3NGVA 4F7FA 3B7AA 2QEBA 4PT1A 1T14A 3BFBA 2GTEA 3CZ2A 1OW4A 3N7HA 1DQEA 3D77A 3S0AA 3DZTA 3NHIA 1GM0A 4FQTA 2PQLA 2WCJA 2FJYA 2L2CA 1OOHA 3CZ0A 3R72A 3L4AA 4OZDA 1OOIX 3RZSA 2P71A 2P70A 2H8VA 2WCLA 3R1OA 1OOFA 3CABA 3FE8A 1TWOA 3L47A 3CYZA 5EL2A 3NHTA 2WC6A 3K1EA 3S0BA 3VB1A 1LS8A 3BFAA 3B88A 4JD9A 4INWA 3PJIA 1ORGA 3R1PA 3CDNA 3DYEA 3S0GA 3B87A 1P28A 2QEOA 3B6XA 2QDIA 3S0FA 2WCKA 1QWVA 3D73A 3DY9A 2WC5A 3S0DA 3Q8IA 3D74A 3D78A 3D75A 1TUJA 3FE6A 3QMEA 3BJHA 5DICA 3V2LA 1C3YA 2QEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOG A;  2WCM A;  1XFR A;  2KPH A;  3FE9 A;  3S0E A;  2JPO A;  1C3Z A;  3CZ1 A;  3B86 A;  2QEV A;  2WCH A;  2ERB A;  4INX A;  3OGN A;  3DXL A;  3BFH A;  3D76 A;  3R1V A;  3L4L A;  3NGV A;  4F7F A;  3B7A A;  2QEB A;  4PT1 A;  1T14 A;  3BFB A;  2GTE A;  3CZ2 A;  1OW4 A;  3N7H A;  1DQE A;  3D77 A;  3S0A A;  3DZT A;  3NHI A;  1GM0 A;  4FQT A;  2PQL A;  2WCJ A;  2FJY A;  2L2C A;  1OOH A;  3CZ0 A;  3R72 A;  3L4A A;  4OZD A;  1OOI X;  3RZS A;  2P71 A;  2P70 A;  2H8V A;  2WCL A;  3R1O A;  1OOF A;  3CAB A;  3FE8 A;  1TWO A;  3L47 A;  3CYZ A;  5EL2 A;  3NHT A;  2WC6 A;  3K1E A;  3S0B A;  3VB1 A;  1LS8 A;  3BFA A;  3B88 A;  4JD9 A;  4INW A;  3PJI A;  1ORG A;  3R1P A;  3CDN A;  3DYE A;  3S0G A;  3B87 A;  1P28 A;  2QEO A;  3B6X A;  2QDI A;  3S0F A;  2WCK A;  1QWV A;  3D73 A;  3DY9 A;  2WC5 A;  3S0D A;  3Q8I A;  3D74 A;  3D78 A;  3D75 A;  1TUJ A;  3FE6 A;  3QME A;  3BJH A;  5DIC A;  3V2L A;  1C3Y A;  2QEH A; 
#chains in the Genus database with same CATH topology
 3QRX A;  2KQ6 A;  1S5G Y;  3PM8 A;  2MHH A;  1QV0 A;  4MSP A;  1UUS A;  3K21 A;  2I18 A;  1UHH A;  1V1G A;  1ZMZ A;  3FE9 A;  2LC5 A;  3CZ1 A;  3LL8 B;  1TNP A;  2BL0 C;  3JVT B;  1K95 A;  3ZNI A;  2OTG C;  1QLS A;  2ZND A;  4PE4 A;  1QAS A;  1NX3 A;  1ZOT B;  4ZCV A;  3SG3 A;  5B8I B;  2WCB A;  1PVA A;  1M39 A;  1DGV A;  5I8N A;  5AFP A;  1PAL A;  1S6J A;  2K2A A;  2LVJ A;  1K93 D;  2LMV A;  4P2Y B;  3BXK A;  2KNE A;  1LKJ A;  2LLS A;  4PHN A;  5I94 A;  1M31 A;  2QEB A;  1SR6 B;  1D1O A;  4MRX A;  1CNP A;  3KPX A;  1LIN A;  3PN7 B;  2HF5 A;  4DRW A;  2HET A;  3O78 A;  3BFB A;  3KEV A;  2JPT A;  4JWQ A;  2M0R A;  1GJY A;  3EG5 B;  4DUQ A;  1QJT A;  3NSK A;  3PFV A;  1OW4 A;  2KI6 D;  1V1F A;  3VRP A;  2GV5 A;  3I5H C;  1BT6 A;  1A75 A;  1QIW A;  1TOP A;  2LHL A;  4FQT A;  2K7D A;  2KFH A;  1KSM A;  4YGD B;  2L2E A;  1SK6 D;  4YGE B;  4ORB B;  1YRU B;  3PLF B;  5D69 A;  3SIB A;  4IJ7 A;  2HQ8 A;  1DF0 A;  1IG5 A;  1NPQ A;  2KHN A;  4BY4 A;  4GBA A;  4XJK B;  3IQO A;  2MLF C;  1BF5 A;  1DJY A;  1MXE A;  1OOH A;  3OX6 A;  4FTG A;  1J7O A;  1WLZ A;  2JT3 A;  2KI4 C;  1OZS A;  4U8D A;  4CLN A;  2BCA A;  1IGV A;  1K90 D;  2M8U A;  2WOR A;  3VGO A;  3TDU A;  1B7T Y;  1TIZ A;  3BYA A;  1KK7 Z;  4MVF A;  1FI5 A;  3ICB A;  2P71 A;  1EG4 A;  3E3R A;  2TN4 A;  4M2Q A;  1WRK A;  1EXR A;  2WCL A;  2WOS A;  4PE7 A;  4ETO A;  4GGN A;  3TZ1 A;  1KCY A;  1JC2 A;  1NCZ A;  3SS5 A;  4A4B A;  1OE9 B;  3GK1 A;  1WLM A;  4P5O E;  1TNX A;  4DS7 A;  1SBJ A;  2BBM A;  1XA5 A;  4HRE E;  2BBN A;  3SG7 A;  3VB1 A;  2LCP A;  3BFA A;  4YRU A;  4JQ0 D;  3IF7 A;  2CXJ A;  2GGZ A;  3BOW A;  4GPL B;  1CM4 A;  2H2K A;  1DT7 B;  2L51 A;  1CB1 A;  5CSF A;  4HRH A;  5FI7 A;  2JRF A;  2QDI A;  1QS7 A;  5CSJ A;  4HSZ A;  1RK9 A;  2AAO A;  1EJ3 A;  2WC5 A;  1F70 A;  4L9M A;  5K89 A;  1J7Q A;  4YGB B;  4MEW A;  1G8I A;  3S0D A;  1S6I A;  1WRL A;  4CFQ A;  1TCO B;  1Y1A A;  5CSN A;  1WRZ A;  3EVV A;  1YVH A;  2L98 A;  1B1G A;  3BQ3 A;  1YUR A;  2JNX A;  3D78 A;  5D3O A;  1OMD A;  2F2P A;  2O60 A;  3VRR A;  1YUS A;  1RTP 1;  3D75 A;  2JU0 A;  1TUJ A;  4MLW A;  2L5Y A;  1SCV A;  3O4Y A;  4I5K A;  1F71 A;  1FW4 A;  1KQM C;  2BAP A;  2Y1N A;  1C3Y A;  2Y1M A;  1XK4 C;  1K9U A;  2A4J A;  3CWG A;  3GOF A;  2EHB A;  2K0J A;  1OOG A;  4NQG A;  3TUY C;  1L2O B;  2L50 A;  2MLE C;  3PAL A;  3NXA A;  4M2P A;  1SCM B;  1A03 A;  3I5I B;  3EKJ A;  3S0E A;  1RJV A;  2LP2 A;  2SCP A;  1OMR A;  3EKH A;  1KQM B;  2WCH A;  2ERB A;  2JQ6 A;  1IWQ A;  1NX0 A;  2BE6 A;  3UO9 A;  2KI6 C;  4BY5 A;  1C7V A;  5ER5 A;  5HKY A;  1TNQ A;  3OB1 B;  2NXQ A;  4KYN A;  1S6C A;  1SY9 A;  1YX8 A;  2KGB C;  5DKQ A;  2OS8 B;  2LAN A;  1UWO A;  4ICB A;  4MZK A;  4YI8 A;  2PYQ A;  1BJF A;  3I5G B;  1NCX A;  2PAL A;  3D0Y B;  2EC6 B;  2JT8 A;  3JVT C;  1ALW A;  1AP4 A;  1JSA A;  4A4C A;  4I5L B;  4JKT A;  4GNK B;  1NCY A;  1S36 A;  3BUN B;  4D1E A;  5I2L A;  1KFU L;  3WXA A;  2KLD A;  4OR9 B;  1S5G Z;  1S26 D;  3HX4 A;  2KOT A;  1S3P A;  1UP5 A;  2BKI B;  2G2B A;  3TDZ A;  2JOJ A;  3I5F C;  3FS7 A;  1DQE A;  1M63 B;  1MQ1 A;  4QJ4 B;  2JTT A;  1AK8 A;  3CR4 X;  1SR6 C;  3NHI A;  2M97 A;  1FBV A;  1DC1 A;  4MBE A;  1N0Y A;  2LVV A;  1QXP A;  2LUX A;  3PN7 C;  2H61 A;  1ZAC A;  1X02 A;  2M7L A;  2NCO A;  4XYN A;  4PAL A;  4QJ3 B;  2F2O A;  1CDL A;  1QAT A;  3I5F B;  1FPW A;  4WRI A;  1WY9 A;  2CBL A;  2KAV A;  2KAY A;  1UHK A;  2R2I A;  1OOI X;  3RZS A;  1CM1 A;  2KQY A;  2Q4U A;  1KK8 C;  1C7W A;  5JOL A;  2M3W A;  3WNX B;  1JUO A;  4WQ2 A;  4PCW A;  1NYA A;  3FIA A;  1K8U A;  2H8V A;  2I94 A;  5HYD A;  3R1O A;  4NDD A;  3BOW B;  3WHT B;  1OOF A;  2BE4 A;  2QPT A;  3AAJ A;  3CAB A;  2OPO A;  4NDB A;  3L47 A;  1KWO B;  2FCD A;  1ALV A;  3CYZ A;  5EL2 A;  1KK8 B;  4C0J A;  2PSR A;  3H4S E;  2MJW B;  1QV1 A;  1TCF A;  3OB2 B;  1XK4 A;  2F33 A;  3OHM B;  3PJI A;  1KFX S;  1J7R A;  1SL7 A;  2AMI A;  3DF0 A;  3R1P A;  5G08 A;  3CDN A;  2NLN A;  3KO0 A;  1JBA A;  1J7P A;  3S0G A;  2JUL A;  1B4C A;  2KBI A;  1XFX O;  2WCF A;  3OX5 A;  4MRY A;  3B6X A;  1CMG A;  1LVC D;  2BNX A;  2VRG A;  3EK4 A;  1CKK A;  2Q91 A;  1K2H A;  4PHJ A;  4E68 A;  4GAO A;  1B7T Z;  4Q04 A;  1F4Q A;  1J1E A;  2JXL A;  2DOQ A;  1MF8 B;  1SRA A;  2L5X B;  5HKZ A;  2JT0 A;  2M1U A;  4PHK A;  4F0Z B;  5FI6 A;  1DJZ A;  3CS1 A;  1IJ6 A;  2RGI A;  3VRQ A;  4DIR A;  1SNL A;  1NSH A;  1KSO A;  1Z2C B;  3LK1 A;  1XFY O;  2AUC A;  2E30 A;  1YR5 A;  3NSL A;  3O4X A;  4YGA A;  1AVS A;  1XO5 A;  4PHM A;  3QME A;  3CZT X;  3O2P A;  5DIC A;  1TUZ A;  1XFZ O;  1R6P A;  1B8C A;  2QEH A;  1DEK A;  1TTX A;  3V2L A;  2L4H A;  1AJ4 A;  2F3Y A;  1TN4 A;  4IL1 A;  4OV2 A;  2KYF A;  1B47 A;  1CFF A;  5TNC A;  2HQW A;  2LMT A;  2PRU A;  1A4P A;  1C3Z A;  3CGA A;  1CFP A;  1DJW A;  3B86 A;  1OMV A;  3OGN A;  3AKB A;  4GGF C;  1REC A;  2ZN8 A;  3A8R A;  1G4Y R;  3DXL A;  4I5J A;  1JFK A;  1SSE B;  1JF2 A;  3CR5 X;  4YGC B;  1BOD A;  2G9B A;  1TRF A;  3OBV A;  1RFJ A;  1BR4 B;  1L2O C;  2JC2 A;  2K2F A;  3L4L A;  3NGV A;  2LM5 A;  1SCM C;  2LHI A;  4F7F A;  1B8R A;  1OZO A;  2LVI A;  3B7A A;  3I5I C;  4FQO A;  2CNP A;  5AEQ A;  4CID A;  5IBW A;  2PMY A;  2BCB A;  5PAL A;  1N65 A;  1QLK A;  3PSR A;  4XJK A;  1ODB A;  1W7I B;  2K7O A;  2OS8 C;  3IQQ A;  4AQJ A;  2JWW A;  3DD4 A;  1DJI A;  3I5G C;  2L0P A;  4YI9 A;  2EC6 C;  1XVJ A;  1CDM A;  3S0A A;  1NX1 A;  2Y4Q A;  1HT9 A;  3CTN A;  1DEL A;  2ZN9 A;  3GK2 A;  1RRO A;  3PM2 A;  2PQL A;  1MXL C;  2LNK A;  1DJH A;  1SW8 A;  1U5I A;  2GGM A;  4AOM A;  3CR2 A;  4MZJ A;  4OKH A;  1NIW A;  1LA0 A;  2F3Z A;  3EK7 A;  1CTR A;  2WCJ A;  2FJY A;  2I7A A;  4UPG A;  5BPJ A;  1AUI B;  1EH2 A;  2K7C A;  3LCP C;  2M49 B;  3CZ0 A;  1K94 A;  2E6W A;  5D7F A;  3R72 A;  2JXC A;  1B9A A;  1QX5 B;  2ZRS A;  3L4A A;  2P6B B;  2WCE A;  4OZD A;  1TNW A;  1CFD A;  1HQV A;  2Y5I A;  2B1U A;  5AAN A;  1OOJ A;  1QX7 A;  1A75 B;  2CCM A;  1WDC B;  2PAS A;  3DVE A;  5CSI A;  5CPV A;  2P70 A;  2HPS A;  3EK8 A;  3KF9 A;  4PE0 A;  1DF0 B;  1GGW A;  1M46 A;  2MA2 A;  1QTX A;  5HLO A;  3A4U B;  5DKN A;  1TWO A;  1SMG A;  1BMO A;  1SL8 A;  2KFF A;  1DMO A;  1YUU A;  1YVL A;  1S1E A;  2BKH B;  1W7J B;  1L7Z A;  3NHT A;  1SKT A;  3K1E A;  1BU3 A;  2COL B;  1SL9 A;  4ORA B;  4N5X A;  3JTD C;  3SJS A;  4JD9 A;  4PE1 A;  5I2Q A;  1AJ5 A;  1OQP A;  2ZKM X;  2LAP A;  5I2O A;  2ZRT A;  1IQ5 A;  1NWD A;  1PRW A;  1YX7 A;  3DYE A;  3BUW B;  1IKU A;  1CLB A;  1P28 A;  2QEO A;  1MUX A;  3UNW A;  1IH0 A;  1KWO C;  2FOT A;  1K9K A;  3CLN A;  1PUL A;  2LP3 A;  4GGF A;  3JTD B;  2CT9 A;  2KLE A;  4R1E A;  1UHJ A;  3SG4 A;  4C0L A;  2MRD A;  1OSA A;  4OVN F;  1K9P A;  1Z4H A;  2FCE A;  3DVM A;  3SS4 A;  2NZ0 A;  1BOC A;  2CTN A;  5FYX A;  3F45 A;  2BL0 B;  1J1D A;  5KU1 A;  3SG2 A;  2LV7 A;  5HKW A;  1A29 A;  1XFU O;  2OTG B;  1R2U A;  3FE6 A;  4NDC A;  1EL4 A;  3VRO A;  3BJH A;  2KBM A;  4AQI A;  1AHR A;  3NSO A;  3LK0 A;  5HL1 A;  3SS3 A;  2M9G A;  1QVI Y;  5KSZ A;  4TNC A;  1JFJ A;  2L4I A;  1PSR A;  1QVI Z;  4JPZ B;  2BEC A;  1CLL A;  1PSB A;  4M2O A;  3D0Y A;  2EGD A;  2WCM A;  1XFR A;  2JNF A;  1W9Z A;  2KPH A;  2PVB A;  2JPO A;  1EG3 A;  1NX2 A;  4I5N B;  2QEV A;  4INX A;  1NP8 A;  1H8B A;  3FWC A;  5ER4 X;  1DTL A;  2M1K B;  5DKR A;  2MAZ A;  2YGU A;  3BFH A;  4MZL A;  5FI2 A;  2LMU A;  2F8P A;  4PDZ A;  1F55 A;  1Y1U A;  3D76 A;  3R1V A;  3RM1 A;  2LE9 B;  3TS5 C;  2IS9 A;  2KYC A;  3EVU A;  4OCI A;  1MWN A;  2I2R E;  1Y0V H;  4MN0 A;  1DJX A;  1KFX L;  1IIO A;  4PT1 A;  1LA3 A;  3I5H B;  3RLZ A;  4QJ5 B;  1G33 A;  1XYD A;  1Y6W A;  2BCX A;  4GUK A;  1CMF A;  1KK7 Y;  1CLM A;  4ORC B;  1FF1 A;  1N2D A;  4N1G A;  1UHI A;  1T14 A;  2LVK A;  3C1V A;  1JF0 A;  3TS5 B;  2GTE A;  1C07 A;  1U5I B;  3PAT A;  1YTZ C;  3EVR A;  3CZ2 A;  1MHO A;  3MSE B;  2KFG A;  2KI4 B;  3N7H A;  5GQQ C;  3D77 A;  4GFT A;  2LLT A;  1CDN A;  3DZT A;  1LXF C;  3DVJ A;  4ZCU A;  1JWD A;  1GM0 A;  2M29 A;  2K7B A;  1UUR A;  2KGR A;  1ZUZ A;  2JZI A;  4YBH B;  2ZNE A;  5HLV A;  4CFR A;  1A2X A;  3WHU B;  2FJU B;  3AAK A;  3SG6 A;  3ZWH A;  1SPY A;  2L2C A;  5AXI A;  2H61 C;  1YUT A;  1PK0 D;  4N1F A;  3LLE A;  2WC8 A;  3FWB A;  1CFC A;  3IVT A;  5F6T A;  3SIA A;  4C0K A;  5J3X A;  3KHE A;  1GQM A;  3VRN A;  1M45 A;  1DVI A;  5JJG A;  3M0W A;  1F54 A;  3BUO B;  1XFW O;  3BUX B;  4CPV A;  1DGU A;  1BR1 B;  2WND A;  3FE8 A;  2JTZ A;  3BUM B;  2MBX A;  4DCK A;  1J55 A;  2LLU A;  2WC6 A;  2ZFD A;  2K61 A;  1CDP A;  1H4B A;  3S0B A;  1E8A A;  1LS8 A;  1SYM A;  1WDC C;  1K96 A;  2V53 A;  3B88 A;  3GK4 X;  3O6B A;  4INW A;  4WQ3 A;  1DJG A;  1FI6 A;  1ORG A;  1PVB A;  5AER A;  1KQV A;  3DVK A;  1RWY A;  3AKA A;  3SG5 A;  4USL A;  2ISD A;  3B87 A;  1XFV O;  1KFU S;  2KSP A;  1QX2 A;  3OP0 A;  1IQ3 A;  1BG1 A;  3S0F A;  2WCK A;  1QWV A;  3D73 A;  2KAX A;  1VRK A;  2LUC A;  1F4O A;  3DY9 A;  1ZFS A;  2NCP A;  3D10 A;  3Q8I A;  1NUB A;  3D74 A;  3TDI A;  2SAS A;  2K8M B;  2KDH A;  1B8L A;  1QIV A;  2QAC A;  3DF0 B;  3TUY B;  3NSI A;  1GGZ A;  2D8N A;  1MR8 A;  1Q80 A;  2O5G A;  3HCM A;  2M7N A;  4HRG A;  5KTY A;  1F8H A;  1YRT B;  2K60 A;  1BLQ A;  1IJ5 A;  1UHN A;  1IRJ A;  1Y1X A; 
#chains in the Genus database with same CATH homology
 1OOG A;  2WCM A;  1XFR A;  2KPH A;  3FE9 A;  3S0E A;  2JPO A;  1C3Z A;  3CZ1 A;  3B86 A;  2QEV A;  2WCH A;  2ERB A;  4INX A;  3OGN A;  3DXL A;  3BFH A;  3D76 A;  3R1V A;  3L4L A;  3NGV A;  4F7F A;  3B7A A;  2QEB A;  4PT1 A;  1T14 A;  3BFB A;  2GTE A;  3CZ2 A;  1OW4 A;  3N7H A;  1DQE A;  3D77 A;  3S0A A;  3DZT A;  3NHI A;  1GM0 A;  4FQT A;  2PQL A;  2WCJ A;  2FJY A;  2L2C A;  1OOH A;  3CZ0 A;  3R72 A;  3L4A A;  4OZD A;  1OOI X;  3RZS A;  2P71 A;  2P70 A;  2H8V A;  2WCL A;  3R1O A;  1OOF A;  3CAB A;  3FE8 A;  1TWO A;  3L47 A;  3CYZ A;  5EL2 A;  3NHT A;  2WC6 A;  3K1E A;  3S0B A;  3VB1 A;  1LS8 A;  3BFA A;  3B88 A;  4JD9 A;  4INW A;  3PJI A;  1ORG A;  3R1P A;  3CDN A;  3DYE A;  3S0G A;  3B87 A;  1P28 A;  2QEO A;  3B6X A;  2QDI A;  3S0F A;  2WCK A;  1QWV A;  3D73 A;  3DY9 A;  2WC5 A;  3S0D A;  3Q8I A;  3D74 A;  3D78 A;  3D75 A;  1TUJ A;  3FE6 A;  3QME A;  3BJH A;  5DIC A;  3V2L A;  1C3Y A;  2QEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...