1QWVA

Solution structure of antheraea polyphemus pheromone binding protein (apolpbp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone-binding protein
publication title The Solution NMR Structure of Antheraea polyphemus PBP Provides New Insight into Pheromone Recognition by Pheromone-binding Proteins
pubmed doi rcsb
source organism Antheraea polyphemus
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1qwvA00
3CZ0A 3V2LA 3L47A 3S0BA 4FQTA 1OOHA 3D75A 2FJYA 1QWVA 3B7AA 2WCHA 2P70A 3CZ1A 1OOFA 2H8VA 3NHTA 3CYZA 3B88A 2QEHA 2JPOA 3BJHA 3R1PA 4OZDA 3DYEA 3S0AA 2PQLA 1LS8A 3B87A 3Q8IA 2QEOA 3DXLA 3FE6A 3D76A 3FE8A 5EL2A 2WC5A 2WCLA 3QMEA 4F7FA 1P28A 3VB1A 1T14A 1ORGA 1DQEA 3B6XA 3CDNA 4INWA 2WCJA 2L2CA 2KPHA 3N7HA 2ERBA 3RZSA 2QEBA 3R72A 2WCMA 3L4LA 1GM0A 3R1VA 3CZ2A 3OGNA 3DZTA 2WCKA 3S0FA 1OW4A 2QEVA 3S0GA 3BFHA 3S0DA 3B86A 3D73A 3L4AA 2P71A 1OOIX 3PJIA 2GTEA 4JD9A 1XFRA 3K1EA 5DICA 3CABA 3NHIA 1TUJA 3D77A 4PT1A 3BFBA 3D74A 1OOGA 2WC6A 3D78A 3S0EA 3R1OA 4INXA 3FE9A 1C3ZA 1TWOA 2QDIA 3BFAA 1C3YA 3NGVA 3DY9A
chains in the Genus database with same CATH superfamily
4WQ2A 4JKTA 2WNDA 3DVKA 1XFWO 1YUTA 3S0BA 2K61A 2PSRA 3BUOB 5B8IB 1F70A 3SG7A 2JNXA 2M29A 1OMDA 2F2PA 2KFGA 2ZRTA 1QWVA 2P70A 3EVVA 3AAKA 3PSRA 1WLMA 2KHNA 5ER4X 2JULA 2LLTA 2VRGA 5AEQA 3WNXB 4YRUA 3PFVA 1SL7A 4ICBA 3R1PA 1XK4A 2JPOA 4PDZA 1K95A 2O5GA 4ZCVA 1OZSA 1QLSA 5HKYA 2ZN8A 1NSHA 3QRXA 1WRKA 4PE0A 1GQMA 1XFVO 1JBAA 5DKNA 1NCXA 2QEOA 1BLQA 3D76A 4GGFA 1IG5A 1UHHA 1F54A 3F45A 2LVIA 1IWQA 2WCLA 1WY9A 4L9MA 4OR9B 5I94A 4HSZA 1NX3A 3O4XA 1D1OA 3DD4A 1MHOA 3FS7A 1DJYA 2AMIA 1T14A 3HX4A 1JWDA 2KGRA 4GUKA 3NSKA 1U5IA 3AAJA 4P5OE 1CDLA 1W9ZA 3CDNA 1M31A 1TRFA 1C7VA 3HCMA 4YI9A 4R1EA 4INWA 3CWGA 1MXLC 2WCJA 2H61A 2L2CA 4N5XA 4QJ4B 3JVTC 3RZSA 5ER5A 1A75B 1Z4HA 3L4LA 2MLFC 1GM0A 2K7DA 3CGAA 1YVLA 3CR4X 4GNKB 2KNEA 1BODA 2KYCA 3CZ2A 3JVTB 4TNCA 3TDUA 3NXAA 3IF7A 1DGUA 1F71A 1DJWA 2I94A 3KHEA 4MLWA 1K9PA 2AAOA 3AKBA 3DZTA 3BOWB 1QTXA 1QX2A 3S0FA 2LP3A 3OB2B 3UNWA 1PVBA 1OW4A 4MZJA 4MVFA 4DS7A 3TDZA 3TS5C 2LC5A 3NSLA 5D7FA 3BUWB 2M97A 2LUXA 4OKHA 1L7ZA 2EHBA 4A4BA 1RJVA 1YUUA 5GQQC 3TS5B 4NQGA 4DRWA 2WOSA 4CLNA 3D73A 2LNKA 1F4OA 4YGEB 4DCKA 5IBWA 1CFPA 1QATA 4WRIA 1L2OC 2QPTA 2LHLA 3NSIA 1Y1XA 1SL9A 1SCMC 1XFRA 4MEWA 4MBEA 2BL0C 3EKHA 3SIBA 1ALWA 2BKHB 2PALA 1L2OB 1AHRA 1LA0A 1M45A 3IVTA 1XFXO 3A4UB 4IJ7A 2KSPA 3SS4A 3WHTB 1SCMB 1B8CA 1PULA 3O6BA 1SK6D 2BL0B 2B1UA 1IRJA 1TNPA 1BT6A 3I5GC 3SG4A 1AVSA 1NX1A 1TUZA 2YGUA 4WQ3A 1IQ5A 3LLEA 2LUCA 2F8PA 2L4IA 1OSAA 1JF0A 2CXJA 1SYMA 2K0JA 1BOCA 4M2OA 1NPQA 1OOGA 2BCBA 3I5GB 1CFDA 4C0LA 5HKWA 3AKAA 2ZKMX 4YI8A 5J3XA 1KCYA 3OB1B 1S6JA 1TWOA 1BU3A 4QJ5B 2QDIA 3CR5X 1KK8B 2JOJA 2LMVA 3KF9A 4GBAA 1UURA 1ZACA 2KI6D 2L2EA 2OPOA 1C3YA 4CPVA 1MQ1A 4MRYA 2MAZA 3I5FC 2JQ6A 3FWBA 1KFXL 1FI5A 4AOMA 5HLVA 1TCOB 2KQ6A 4A4CA 5CSIA 1XA5A 3I5FB 1BF5A 1IIOA 5D3OA 1EXRA 5G08A 2H8VA 2F3YA 1J55A 1V1FA 4OVNF 2NCPA 3BJHA 4OZDA 4XYNA 1QJTA 1UHNA 2M0RA 1B4CA 1FPWA 1DJZA 5CSJA 3S0AA 1UP5A 3PM8A 1X02A 4MRXA 4YGDB 2KGBC 3RLZA 4D1EA 1CMFA 3D0YA 3DXLA 1DT7B 2BECA 1YR5A 1YRUB 4XJKB 1YRTB 2Y5IA 5EL2A 2MBXA 1MR8A 1P28A 2LLSA 3VB1A 3GOFA 4PCWA 4MZKA 2MHHA 2TN4A 1ORGA 2KBMA 2JWWA 4FTGA 1DQEA 3GK4X 3CS1A 1KFUL 4GGNA 3JTDC 2I7AA 4HRHA 1G8IA 1UWOA 1SY9A 1FI6A 1LXFC 1OOJA 2GGZA 1RFJA 2KPHA 1M46A 2ZNDA 3JTDB 2QEBA 4YGBB 1F8HA 1XK4C 1GJYA 1MXEA 1SNLA 3PM2A 1S6IA 1H8BA 1G33A 1SBJA 1JUOA 1QS7A 5AERA 3OBVA 3CTNA 1B8LA 1HT9A 2K7OA 2HF5A 4GGFC 1PK0D 1AK8A 5FYXA 2Y1MA 2JT8A 3WXAA 3E3RA 1MUXA 2KAVA 1B7TY 1QXPA 3OX6A 1KQVA 1J7OA 2BE4A 3OP0A 1NIWA 2BE6A 3VRPA 1R2UA 2EGDA 2FJUB 3BFHA 2M49B 2NCOA 3B86A 3KO0A 2PASA 3S0DA 2HQWA 3TZ1A 1BG1A 2DOQA 1SSEB 3EK8A 2H61C 2M3WA 1U5IB 3SS3A 1B7TZ 1KWOC 1OOIX 2CBLA 1CLLA 2GTEA 4JD9A 1DC1A 1N0YA 2JTZA 2E30A 3DVEA 1YX8A 2BAPA 1W7JB 5KTYA 1CTRA 2MRDA 4N1GA 3K1EA 1KWOB 1FBVA 3I5HB 2KYFA 2KQYA 4ORAB 4NDBA 3MSEB 1BJFA 1QLKA 3VRRA 5JOLA 1LA3A 3I5IC 5HL1A 1IJ5A 5CPVA 4DIRA 2EC6C 1TUJA 2OS8C 4PE7A 3D77A 1OMRA 3BFBA 2WC8A 4ETOA 1UHKA 3GK1A 2BBNA 3I5IB 4HREE 2WC6A 2L5YA 2HPSA 1DMOA 2EC6B 1PSBA 2E6WA 2L0PA 2OS8B 2G9BA 3EK7A 1CB1A 1M63B 4OV2A 3TDIA 1JF2A 2ZRSA 1KFXS 4I5LB 1XYDA 3EK4A 1DELA 1MWNA 1NX2A 1A4PA 1UUSA 2JXLA 2OTGB 3O78A 4KYNA 1S6CA 1OMVA 3V2LA 3FIAA 3L47A 4IL1A 5K89A 3PN7B 2Y4QA 4JPZB 1WRLA 2LVJA 3D75A 2L5XB 2MJWB 2FJYA 2MLEC 2WCHA 3CZ1A 1NP8A 2K60A 2L98A 2F2OA 2LCPA 2LVKA 3CYZA 1J1EA 2F3ZA 1F4QA 1W7IB 2QEHA 1K9KA 1KK8C 2FCDA 4M2QA 3DYEA 3KPXA 1N65A 2M7NA 3IQQA 3SS5A 2JC2A 1LKJA 1RECA 2WCEA 3B87A 1Q80A 3Q8IA 1J1DA 3VRNA 2P6BB 1QV0A 1IKUA 3FE6A 2CT9A 2I18A 4QJ3B 1CM1A 2JTTA 2WCBA 2Q4UA 3FE8A 2WC5A 1MF8B 3IQOA 1OQPA 1RROA 4FQOA 1TNXA 1DEKA 2WCFA 3SIAA 5AXIA 3DF0A 3PALA 2BBMA 2HETA 4Q04A 2MA2A 2JNFA 1K8UA 4CFQA 3B6XA 1CLBA 1QV1A 1EH2A 1OE9B 1NCYA 3KEVA 1M39A 2A4JA 1CMGA 1A29A 2KI4C 2BNXA 2LLUA 2ERBA 4GPLB 2IS9A 2KI6C 3R72A 2WCMA 2WORA 2JZIA 4I5NB 2LM5A 5D69A 1CNPA 5KSZA 3SJSA 2KI4B 1CDPA 1K94A 1UHJA 1ODBA 1SPYA 3D10A 1DGVA 2HQ8A 3NSOA 3SG2A 1IQ3A 2Y1NA 1AJ4A 1WDCC 3OGNA 4PHJA 4YBHB 1NUBA 2PYQA 1ALVA 1HQVA 2LANA 3OX5A 4YGCB 1SRAA 3D0YB 4JQ0D 4USLA 1KK7Z 2K7BA 3VROA 1WDCB 1WLZA 1Y1AA 1QVIZ 1YUSA 2M1UA 1S26D 3CLNA 2JT3A 2PRUA 1DF0A 3BYAA 4AQJA 3FWCA 1TOPA 5FI7A 2H2KA 3S0GA 5FI6A 1VRKA 3BUMB 3TUYB 1SW8A 1DJHA 3L4AA 2NLNA 3BQ3A 3BXKA 4NDCA 1JFKA 2KFHA 3LK0A 1S36A 5DKRA 3VGOA 1QIWA 2L50A 2KOTA 2KDHA 1CKKA 1DJIA 5I8NA 4ORBB 1B47A 3RM1A 1Y0VH 1TTXA 2GV5A 2JXCA 4C0KA 5DKQA 2K7CA 1IH0A 3OHMB 1SR6C 3GK2A 4PE4A 1A03A 4NDDA 3SG6A 3EKJA 1GGWA 1EG4A 1EJ3A 3CABA 1XFZO 1NYAA 3O4YA 1TIZA 1S1EA 2ZFDA 1TCFA 1YTZC 2K2AA 1SR6B 5I2QA 2GGMA 1YURA 1R6PA 3D78A 3S0EA 2QACA 1YX7A 5FI2A 2LP2A 4INXA 3FE9A 1G4YR 1Y6WA 1C3ZA 1FW4A 1EL4A 2PVBA 3I5HC 2M1KB 1TNWA 1ZFSA 2COLB 1S3PA 3LK1A 4MZLA 4HRGA 4PALA 1PSRA 3PLFB 1SMGA 1XVJA 3DY9A 2SASA 2LE9B 3CZ0A 1QIVA 1J7PA 1AP4A 3UO9A 2PMYA 4FQTA 1A75A 1UHIA 1OOHA 3B7AA 1PRWA 3EVUA 1RTP1 1OOFA 3H4SE 1KSOA 2JPTA 2CNPA 3NHTA 3B88A 4GAOA 1C7WA 1B1GA 1K2HA 2LAPA 1CM4A 3ZNIA 2PQLA 5HLOA 3BOWA 1LS8A 5I2LA 5F6TA 1KSMA 4ZCUA 1BMOA 1TN4A 2OTGC 2FOTA 3A8RA 1DVIA 1NWDA 1B9AA 2F33A 2LMUA 2LHIA 3PN7C 1SL8A 4I5KA 1B8RA 1DJGA 3QMEA 1BR1B 1XFUO 4F7FA 4UPGA 1K93D 3CZTX 3K21A 4ORCB 5PALA 1FF1A 3SG3A 1SKTA 2FCEA 2Q91A 1YVHA 1CFFA 4PE1A 1DJXA 1OZOA 4P2YB 1SCVA 3BUNB 2R2IA 1XO5A 2ZN9A 4GFTA 2JT0A 4F0ZB 1BR4B 4BY4A 2KAXA 2V53A 3N7HA 4AQIA 4PHKA 5I2OA 4CFRA 1CDMA 3C1VA 3BUXB 1CDNA 1S5GY 4MN0A 1KQMC 5AFPA 5KU1A 3R1VA 3DVMA 3M0WA 2AUCA 1E8AA 3CR2A 1AUIB 2BCAA 1Z2CB 5TNCA 1NCZA 5CSNA 1KQMB 2I2RE 1CFCA 1KFUS 2KBIA 2WCKA 3ZWHA 4OCIA 2ISDA 1S5GZ 3PATA 3EVRA 3LL8B 1H4BA 1F55A 2BCXA 1RK9A 5CSFA 2CTNA 2G2BA 2M8UA 1JC2A 1DTLA 1QASA 2QEVA 1RWYA 2CCMA 4M2PA 4N1FA 1JFJA 1J7QA 4DUQA 4U8DA 1K90D 1PVAA 1V1GA 2LVVA 3DF0B 1C07A 2K8MB 2O60A 1JSAA 1XFYO 1N2DA 2KFFA 2P71A 3PJIA 1K9UA 1J7RA 1LVCD 3ICBA 5JJGA 1WRZA 5HKZA 1KK7Y 4E68A 1CLMA 2D8NA 5HYDA 4PHNA 1Y1UA 1QVIY 2KAYA 2LMTA 3DVJA 4JWQA 1IJ6A 4C0JA 5BPJA 2JU0A 1ZMZA 2L4HA 3WHUB 4PHMA 1PALA 5AANA 1ZOTB 2ZNEA 5DICA 4CIDA 3NHIA 3LCPC 2M9GA 2SCPA 4PT1A 3TUYC 1ZUZA 4YGAA 3D74A 2M7LA 2L51A 3O2PA 1QX5B 2K2FA 4MSPA 4XJKA 2KLDA 1NX0A 3EG5B 3R1OA 4BY5A 1EG3A 1AJ5A 1GGZA 4I5JA 1LINA 2NXQA 1A2XA 1IGVA 3BFAA 1K96A 1TNQA 3VRQA 1DF0B 2RGIA 3SG5A 2BKIB 2KLEA 3NGVA 2JRFA 2NZ0A 2LV7A 1QX7A
chains in the Genus database with same CATH topology
3CZ0A 3V2LA 3L47A 3S0BA 4FQTA 1OOHA 3D75A 2FJYA 1QWVA 3B7AA 2WCHA 2P70A 3CZ1A 1OOFA 2H8VA 3NHTA 3CYZA 3B88A 2QEHA 2JPOA 3BJHA 3R1PA 4OZDA 3DYEA 3S0AA 2PQLA 1LS8A 3B87A 3Q8IA 2QEOA 3DXLA 3FE6A 3D76A 3FE8A 5EL2A 2WC5A 2WCLA 3QMEA 4F7FA 1P28A 3VB1A 1T14A 1ORGA 1DQEA 3B6XA 3CDNA 4INWA 2WCJA 2L2CA 2KPHA 3N7HA 2ERBA 3RZSA 2QEBA 3R72A 2WCMA 3L4LA 1GM0A 3R1VA 3CZ2A 3OGNA 3DZTA 2WCKA 3S0FA 1OW4A 2QEVA 3S0GA 3BFHA 3S0DA 3B86A 3D73A 3L4AA 2P71A 1OOIX 3PJIA 2GTEA 4JD9A 1XFRA 3K1EA 5DICA 3CABA 3NHIA 1TUJA 3D77A 4PT1A 3BFBA 3D74A 1OOGA 2WC6A 3D78A 3S0EA 3R1OA 4INXA 3FE9A 1C3ZA 1TWOA 2QDIA 3BFAA 1C3YA 3NGVA 3DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  3V2L A;  3L47 A;  3S0B A;  4FQT A;  1OOH A;  3D75 A;  2FJY A;  1QWV A;  3B7A A;  2WCH A;  2P70 A;  3CZ1 A;  1OOF A;  2H8V A;  3NHT A;  3CYZ A;  3B88 A;  2QEH A;  2JPO A;  3BJH A;  3R1P A;  4OZD A;  3DYE A;  3S0A A;  2PQL A;  1LS8 A;  3B87 A;  3Q8I A;  2QEO A;  3DXL A;  3FE6 A;  3D76 A;  3FE8 A;  5EL2 A;  2WC5 A;  2WCL A;  3QME A;  4F7F A;  1P28 A;  3VB1 A;  1T14 A;  1ORG A;  1DQE A;  3B6X A;  3CDN A;  4INW A;  2WCJ A;  2L2C A;  2KPH A;  3N7H A;  2ERB A;  3RZS A;  2QEB A;  3R72 A;  2WCM A;  3L4L A;  1GM0 A;  3R1V A;  3CZ2 A;  3OGN A;  3DZT A;  2WCK A;  3S0F A;  1OW4 A;  2QEV A;  3S0G A;  3BFH A;  3S0D A;  3B86 A;  3D73 A;  3L4A A;  2P71 A;  1OOI X;  3PJI A;  2GTE A;  4JD9 A;  1XFR A;  3K1E A;  5DIC A;  3CAB A;  3NHI A;  1TUJ A;  3D77 A;  4PT1 A;  3BFB A;  3D74 A;  1OOG A;  2WC6 A;  3D78 A;  3S0E A;  3R1O A;  4INX A;  3FE9 A;  1C3Z A;  1TWO A;  2QDI A;  3BFA A;  1C3Y A;  3NGV A;  3DY9 A; 
#chains in the Genus database with same CATH topology
 4WQ2 A;  4JKT A;  2WND A;  3DVK A;  1XFW O;  1YUT A;  3S0B A;  2K61 A;  2PSR A;  3BUO B;  5B8I B;  1F70 A;  3SG7 A;  2JNX A;  2M29 A;  1OMD A;  2F2P A;  2KFG A;  2ZRT A;  1QWV A;  2P70 A;  3EVV A;  3AAK A;  3PSR A;  1WLM A;  2KHN A;  5ER4 X;  2JUL A;  2LLT A;  2VRG A;  5AEQ A;  3WNX B;  4YRU A;  3PFV A;  1SL7 A;  4ICB A;  3R1P A;  1XK4 A;  2JPO A;  4PDZ A;  1K95 A;  2O5G A;  4ZCV A;  1OZS A;  1QLS A;  5HKY A;  2ZN8 A;  1NSH A;  3QRX A;  1WRK A;  4PE0 A;  1GQM A;  1XFV O;  1JBA A;  5DKN A;  1NCX A;  2QEO A;  1BLQ A;  3D76 A;  4GGF A;  1IG5 A;  1UHH A;  1F54 A;  3F45 A;  2LVI A;  1IWQ A;  2WCL A;  1WY9 A;  4L9M A;  4OR9 B;  5I94 A;  4HSZ A;  1NX3 A;  3O4X A;  1D1O A;  3DD4 A;  1MHO A;  3FS7 A;  1DJY A;  2AMI A;  1T14 A;  3HX4 A;  1JWD A;  2KGR A;  4GUK A;  3NSK A;  1U5I A;  3AAJ A;  4P5O E;  1CDL A;  1W9Z A;  3CDN A;  1M31 A;  1TRF A;  1C7V A;  3HCM A;  4YI9 A;  4R1E A;  4INW A;  3CWG A;  1MXL C;  2WCJ A;  2H61 A;  2L2C A;  4N5X A;  4QJ4 B;  3JVT C;  3RZS A;  5ER5 A;  1A75 B;  1Z4H A;  3L4L A;  2MLF C;  1GM0 A;  2K7D A;  3CGA A;  1YVL A;  3CR4 X;  4GNK B;  2KNE A;  1BOD A;  2KYC A;  3CZ2 A;  3JVT B;  4TNC A;  3TDU A;  3NXA A;  3IF7 A;  1DGU A;  1F71 A;  1DJW A;  2I94 A;  3KHE A;  4MLW A;  1K9P A;  2AAO A;  3AKB A;  3DZT A;  3BOW B;  1QTX A;  1QX2 A;  3S0F A;  2LP3 A;  3OB2 B;  3UNW A;  1PVB A;  1OW4 A;  4MZJ A;  4MVF A;  4DS7 A;  3TDZ A;  3TS5 C;  2LC5 A;  3NSL A;  5D7F A;  3BUW B;  2M97 A;  2LUX A;  4OKH A;  1L7Z A;  2EHB A;  4A4B A;  1RJV A;  1YUU A;  5GQQ C;  3TS5 B;  4NQG A;  4DRW A;  2WOS A;  4CLN A;  3D73 A;  2LNK A;  1F4O A;  4YGE B;  4DCK A;  5IBW A;  1CFP A;  1QAT A;  4WRI A;  1L2O C;  2QPT A;  2LHL A;  3NSI A;  1Y1X A;  1SL9 A;  1SCM C;  1XFR A;  4MEW A;  4MBE A;  2BL0 C;  3EKH A;  3SIB A;  1ALW A;  2BKH B;  2PAL A;  1L2O B;  1AHR A;  1LA0 A;  1M45 A;  3IVT A;  1XFX O;  3A4U B;  4IJ7 A;  2KSP A;  3SS4 A;  3WHT B;  1SCM B;  1B8C A;  1PUL A;  3O6B A;  1SK6 D;  2BL0 B;  2B1U A;  1IRJ A;  1TNP A;  1BT6 A;  3I5G C;  3SG4 A;  1AVS A;  1NX1 A;  1TUZ A;  2YGU A;  4WQ3 A;  1IQ5 A;  3LLE A;  2LUC A;  2F8P A;  2L4I A;  1OSA A;  1JF0 A;  2CXJ A;  1SYM A;  2K0J A;  1BOC A;  4M2O A;  1NPQ A;  1OOG A;  2BCB A;  3I5G B;  1CFD A;  4C0L A;  5HKW A;  3AKA A;  2ZKM X;  4YI8 A;  5J3X A;  1KCY A;  3OB1 B;  1S6J A;  1TWO A;  1BU3 A;  4QJ5 B;  2QDI A;  3CR5 X;  1KK8 B;  2JOJ A;  2LMV A;  3KF9 A;  4GBA A;  1UUR A;  1ZAC A;  2KI6 D;  2L2E A;  2OPO A;  1C3Y A;  4CPV A;  1MQ1 A;  4MRY A;  2MAZ A;  3I5F C;  2JQ6 A;  3FWB A;  1KFX L;  1FI5 A;  4AOM A;  5HLV A;  1TCO B;  2KQ6 A;  4A4C A;  5CSI A;  1XA5 A;  3I5F B;  1BF5 A;  1IIO A;  5D3O A;  1EXR A;  5G08 A;  2H8V A;  2F3Y A;  1J55 A;  1V1F A;  4OVN F;  2NCP A;  3BJH A;  4OZD A;  4XYN A;  1QJT A;  1UHN A;  2M0R A;  1B4C A;  1FPW A;  1DJZ A;  5CSJ A;  3S0A A;  1UP5 A;  3PM8 A;  1X02 A;  4MRX A;  4YGD B;  2KGB C;  3RLZ A;  4D1E A;  1CMF A;  3D0Y A;  3DXL A;  1DT7 B;  2BEC A;  1YR5 A;  1YRU B;  4XJK B;  1YRT B;  2Y5I A;  5EL2 A;  2MBX A;  1MR8 A;  1P28 A;  2LLS A;  3VB1 A;  3GOF A;  4PCW A;  4MZK A;  2MHH A;  2TN4 A;  1ORG A;  2KBM A;  2JWW A;  4FTG A;  1DQE A;  3GK4 X;  3CS1 A;  1KFU L;  4GGN A;  3JTD C;  2I7A A;  4HRH A;  1G8I A;  1UWO A;  1SY9 A;  1FI6 A;  1LXF C;  1OOJ A;  2GGZ A;  1RFJ A;  2KPH A;  1M46 A;  2ZND A;  3JTD B;  2QEB A;  4YGB B;  1F8H A;  1XK4 C;  1GJY A;  1MXE A;  1SNL A;  3PM2 A;  1S6I A;  1H8B A;  1G33 A;  1SBJ A;  1JUO A;  1QS7 A;  5AER A;  3OBV A;  3CTN A;  1B8L A;  1HT9 A;  2K7O A;  2HF5 A;  4GGF C;  1PK0 D;  1AK8 A;  5FYX A;  2Y1M A;  2JT8 A;  3WXA A;  3E3R A;  1MUX A;  2KAV A;  1B7T Y;  1QXP A;  3OX6 A;  1KQV A;  1J7O A;  2BE4 A;  3OP0 A;  1NIW A;  2BE6 A;  3VRP A;  1R2U A;  2EGD A;  2FJU B;  3BFH A;  2M49 B;  2NCO A;  3B86 A;  3KO0 A;  2PAS A;  3S0D A;  2HQW A;  3TZ1 A;  1BG1 A;  2DOQ A;  1SSE B;  3EK8 A;  2H61 C;  2M3W A;  1U5I B;  3SS3 A;  1B7T Z;  1KWO C;  1OOI X;  2CBL A;  1CLL A;  2GTE A;  4JD9 A;  1DC1 A;  1N0Y A;  2JTZ A;  2E30 A;  3DVE A;  1YX8 A;  2BAP A;  1W7J B;  5KTY A;  1CTR A;  2MRD A;  4N1G A;  3K1E A;  1KWO B;  1FBV A;  3I5H B;  2KYF A;  2KQY A;  4ORA B;  4NDB A;  3MSE B;  1BJF A;  1QLK A;  3VRR A;  5JOL A;  1LA3 A;  3I5I C;  5HL1 A;  1IJ5 A;  5CPV A;  4DIR A;  2EC6 C;  1TUJ A;  2OS8 C;  4PE7 A;  3D77 A;  1OMR A;  3BFB A;  2WC8 A;  4ETO A;  1UHK A;  3GK1 A;  2BBN A;  3I5I B;  4HRE E;  2WC6 A;  2L5Y A;  2HPS A;  1DMO A;  2EC6 B;  1PSB A;  2E6W A;  2L0P A;  2OS8 B;  2G9B A;  3EK7 A;  1CB1 A;  1M63 B;  4OV2 A;  3TDI A;  1JF2 A;  2ZRS A;  1KFX S;  4I5L B;  1XYD A;  3EK4 A;  1DEL A;  1MWN A;  1NX2 A;  1A4P A;  1UUS A;  2JXL A;  2OTG B;  3O78 A;  4KYN A;  1S6C A;  1OMV A;  3V2L A;  3FIA A;  3L47 A;  4IL1 A;  5K89 A;  3PN7 B;  2Y4Q A;  4JPZ B;  1WRL A;  2LVJ A;  3D75 A;  2L5X B;  2MJW B;  2FJY A;  2MLE C;  2WCH A;  3CZ1 A;  1NP8 A;  2K60 A;  2L98 A;  2F2O A;  2LCP A;  2LVK A;  3CYZ A;  1J1E A;  2F3Z A;  1F4Q A;  1W7I B;  2QEH A;  1K9K A;  1KK8 C;  2FCD A;  4M2Q A;  3DYE A;  3KPX A;  1N65 A;  2M7N A;  3IQQ A;  3SS5 A;  2JC2 A;  1LKJ A;  1REC A;  2WCE A;  3B87 A;  1Q80 A;  3Q8I A;  1J1D A;  3VRN A;  2P6B B;  1QV0 A;  1IKU A;  3FE6 A;  2CT9 A;  2I18 A;  4QJ3 B;  1CM1 A;  2JTT A;  2WCB A;  2Q4U A;  3FE8 A;  2WC5 A;  1MF8 B;  3IQO A;  1OQP A;  1RRO A;  4FQO A;  1TNX A;  1DEK A;  2WCF A;  3SIA A;  5AXI A;  3DF0 A;  3PAL A;  2BBM A;  2HET A;  4Q04 A;  2MA2 A;  2JNF A;  1K8U A;  4CFQ A;  3B6X A;  1CLB A;  1QV1 A;  1EH2 A;  1OE9 B;  1NCY A;  3KEV A;  1M39 A;  2A4J A;  1CMG A;  1A29 A;  2KI4 C;  2BNX A;  2LLU A;  2ERB A;  4GPL B;  2IS9 A;  2KI6 C;  3R72 A;  2WCM A;  2WOR A;  2JZI A;  4I5N B;  2LM5 A;  5D69 A;  1CNP A;  5KSZ A;  3SJS A;  2KI4 B;  1CDP A;  1K94 A;  1UHJ A;  1ODB A;  1SPY A;  3D10 A;  1DGV A;  2HQ8 A;  3NSO A;  3SG2 A;  1IQ3 A;  2Y1N A;  1AJ4 A;  1WDC C;  3OGN A;  4PHJ A;  4YBH B;  1NUB A;  2PYQ A;  1ALV A;  1HQV A;  2LAN A;  3OX5 A;  4YGC B;  1SRA A;  3D0Y B;  4JQ0 D;  4USL A;  1KK7 Z;  2K7B A;  3VRO A;  1WDC B;  1WLZ A;  1Y1A A;  1QVI Z;  1YUS A;  2M1U A;  1S26 D;  3CLN A;  2JT3 A;  2PRU A;  1DF0 A;  3BYA A;  4AQJ A;  3FWC A;  1TOP A;  5FI7 A;  2H2K A;  3S0G A;  5FI6 A;  1VRK A;  3BUM B;  3TUY B;  1SW8 A;  1DJH A;  3L4A A;  2NLN A;  3BQ3 A;  3BXK A;  4NDC A;  1JFK A;  2KFH A;  3LK0 A;  1S36 A;  5DKR A;  3VGO A;  1QIW A;  2L50 A;  2KOT A;  2KDH A;  1CKK A;  1DJI A;  5I8N A;  4ORB B;  1B47 A;  3RM1 A;  1Y0V H;  1TTX A;  2GV5 A;  2JXC A;  4C0K A;  5DKQ A;  2K7C A;  1IH0 A;  3OHM B;  1SR6 C;  3GK2 A;  4PE4 A;  1A03 A;  4NDD A;  3SG6 A;  3EKJ A;  1GGW A;  1EG4 A;  1EJ3 A;  3CAB A;  1XFZ O;  1NYA A;  3O4Y A;  1TIZ A;  1S1E A;  2ZFD A;  1TCF A;  1YTZ C;  2K2A A;  1SR6 B;  5I2Q A;  2GGM A;  1YUR A;  1R6P A;  3D78 A;  3S0E A;  2QAC A;  1YX7 A;  5FI2 A;  2LP2 A;  4INX A;  3FE9 A;  1G4Y R;  1Y6W A;  1C3Z A;  1FW4 A;  1EL4 A;  2PVB A;  3I5H C;  2M1K B;  1TNW A;  1ZFS A;  2COL B;  1S3P A;  3LK1 A;  4MZL A;  4HRG A;  4PAL A;  1PSR A;  3PLF B;  1SMG A;  1XVJ A;  3DY9 A;  2SAS A;  2LE9 B;  3CZ0 A;  1QIV A;  1J7P A;  1AP4 A;  3UO9 A;  2PMY A;  4FQT A;  1A75 A;  1UHI A;  1OOH A;  3B7A A;  1PRW A;  3EVU A;  1RTP 1;  1OOF A;  3H4S E;  1KSO A;  2JPT A;  2CNP A;  3NHT A;  3B88 A;  4GAO A;  1C7W A;  1B1G A;  1K2H A;  2LAP A;  1CM4 A;  3ZNI A;  2PQL A;  5HLO A;  3BOW A;  1LS8 A;  5I2L A;  5F6T A;  1KSM A;  4ZCU A;  1BMO A;  1TN4 A;  2OTG C;  2FOT A;  3A8R A;  1DVI A;  1NWD A;  1B9A A;  2F33 A;  2LMU A;  2LHI A;  3PN7 C;  1SL8 A;  4I5K A;  1B8R A;  1DJG A;  3QME A;  1BR1 B;  1XFU O;  4F7F A;  4UPG A;  1K93 D;  3CZT X;  3K21 A;  4ORC B;  5PAL A;  1FF1 A;  3SG3 A;  1SKT A;  2FCE A;  2Q91 A;  1YVH A;  1CFF A;  4PE1 A;  1DJX A;  1OZO A;  4P2Y B;  1SCV A;  3BUN B;  2R2I A;  1XO5 A;  2ZN9 A;  4GFT A;  2JT0 A;  4F0Z B;  1BR4 B;  4BY4 A;  2KAX A;  2V53 A;  3N7H A;  4AQI A;  4PHK A;  5I2O A;  4CFR A;  1CDM A;  3C1V A;  3BUX B;  1CDN A;  1S5G Y;  4MN0 A;  1KQM C;  5AFP A;  5KU1 A;  3R1V A;  3DVM A;  3M0W A;  2AUC A;  1E8A A;  3CR2 A;  1AUI B;  2BCA A;  1Z2C B;  5TNC A;  1NCZ A;  5CSN A;  1KQM B;  2I2R E;  1CFC A;  1KFU S;  2KBI A;  2WCK A;  3ZWH A;  4OCI A;  2ISD A;  1S5G Z;  3PAT A;  3EVR A;  3LL8 B;  1H4B A;  1F55 A;  2BCX A;  1RK9 A;  5CSF A;  2CTN A;  2G2B A;  2M8U A;  1JC2 A;  1DTL A;  1QAS A;  2QEV A;  1RWY A;  2CCM A;  4M2P A;  4N1F A;  1JFJ A;  1J7Q A;  4DUQ A;  4U8D A;  1K90 D;  1PVA A;  1V1G A;  2LVV A;  3DF0 B;  1C07 A;  2K8M B;  2O60 A;  1JSA A;  1XFY O;  1N2D A;  2KFF A;  2P71 A;  3PJI A;  1K9U A;  1J7R A;  1LVC D;  3ICB A;  5JJG A;  1WRZ A;  5HKZ A;  1KK7 Y;  4E68 A;  1CLM A;  2D8N A;  5HYD A;  4PHN A;  1Y1U A;  1QVI Y;  2KAY A;  2LMT A;  3DVJ A;  4JWQ A;  1IJ6 A;  4C0J A;  5BPJ A;  2JU0 A;  1ZMZ A;  2L4H A;  3WHU B;  4PHM A;  1PAL A;  5AAN A;  1ZOT B;  2ZNE A;  5DIC A;  4CID A;  3NHI A;  3LCP C;  2M9G A;  2SCP A;  4PT1 A;  3TUY C;  1ZUZ A;  4YGA A;  3D74 A;  2M7L A;  2L51 A;  3O2P A;  1QX5 B;  2K2F A;  4MSP A;  4XJK A;  2KLD A;  1NX0 A;  3EG5 B;  3R1O A;  4BY5 A;  1EG3 A;  1AJ5 A;  1GGZ A;  4I5J A;  1LIN A;  2NXQ A;  1A2X A;  1IGV A;  3BFA A;  1K96 A;  1TNQ A;  3VRQ A;  1DF0 B;  2RGI A;  3SG5 A;  2BKI B;  2KLE A;  3NGV A;  2JRF A;  2NZ0 A;  2LV7 A;  1QX7 A; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  3V2L A;  3L47 A;  3S0B A;  4FQT A;  1OOH A;  3D75 A;  2FJY A;  1QWV A;  3B7A A;  2WCH A;  2P70 A;  3CZ1 A;  1OOF A;  2H8V A;  3NHT A;  3CYZ A;  3B88 A;  2QEH A;  2JPO A;  3BJH A;  3R1P A;  4OZD A;  3DYE A;  3S0A A;  2PQL A;  1LS8 A;  3B87 A;  3Q8I A;  2QEO A;  3DXL A;  3FE6 A;  3D76 A;  3FE8 A;  5EL2 A;  2WC5 A;  2WCL A;  3QME A;  4F7F A;  1P28 A;  3VB1 A;  1T14 A;  1ORG A;  1DQE A;  3B6X A;  3CDN A;  4INW A;  2WCJ A;  2L2C A;  2KPH A;  3N7H A;  2ERB A;  3RZS A;  2QEB A;  3R72 A;  2WCM A;  3L4L A;  1GM0 A;  3R1V A;  3CZ2 A;  3OGN A;  3DZT A;  2WCK A;  3S0F A;  1OW4 A;  2QEV A;  3S0G A;  3BFH A;  3S0D A;  3B86 A;  3D73 A;  3L4A A;  2P71 A;  1OOI X;  3PJI A;  2GTE A;  4JD9 A;  1XFR A;  3K1E A;  5DIC A;  3CAB A;  3NHI A;  1TUJ A;  3D77 A;  4PT1 A;  3BFB A;  3D74 A;  1OOG A;  2WC6 A;  3D78 A;  3S0E A;  3R1O A;  4INX A;  3FE9 A;  1C3Z A;  1TWO A;  2QDI A;  3BFA A;  1C3Y A;  3NGV A;  3DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...