1OOGA

Complex of drosophila odorant binding protein lush with propanol
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 45
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1oogA00
3OGNA 3CZ2A 4FQTA 3L4LA 3B86A 3Q8IA 2QDIA 2QEHA 3DXLA 3FE8A 2WC6A 1C3YA 2L2CA 3BFHA 3S0AA 3RZSA 2WCKA 2QEBA 3CYZA 2WCJA 2KPHA 2P71A 3S0DA 3S0FA 1TUJA 2WCMA 3D75A 1OOHA 3PJIA 3D74A 3CDNA 1C3ZA 4INXA 1LS8A 3B87A 3BJHA 3NGVA 1GM0A 3B88A 3BFBA 4F7FA 3D77A 2GTEA 3DYEA 1OOGA 2WC5A 2WCHA 3B7AA 3D73A 3DZTA 2QEVA 3B6XA 3FE9A 2QEOA 3DY9A 4JD9A 3R72A 1P28A 3D76A 3QMEA 2P70A 1T14A 3N7HA 4INWA 1QWVA 3L4AA 3V2LA 3FE6A 3CZ0A 4OZDA 3K1EA 3S0EA 1OOFA 3R1VA 2FJYA 3CZ1A 2H8VA 3S0BA 3NHIA 1OW4A 5EL2A 1DQEA 2PQLA 1XFRA 3L47A 3D78A 2ERBA 3NHTA 3VB1A 1TWOA 3R1OA 3CABA 4PT1A 2WCLA 2JPOA 1OOIX 3BFAA 1ORGA 3S0GA 5DICA 3R1PA
chains in the Genus database with same CATH superfamily
2D8NA 1NUBA 1S5GZ 3LK1A 2M1UA 1WY9A 2LP3A 2JT8A 1S5GY 1XK4C 2LC5A 3FIAA 2CCMA 1AUIB 1LKJA 1GGZA 4CLNA 3PATA 5TNCA 1J7RA 3L4LA 3B86A 3GOFA 2WC8A 3AKAA 3VRPA 5KSZA 2OPOA 2QEHA 1HT9A 2F8PA 1TNXA 2KDHA 1OSAA 3OX6A 4C0LA 2H2KA 1F54A 3LK0A 1J7PA 3JTDB 3BOWB 2WCEA 4WRIA 3I5HB 2KHNA 2WCKA 1XVJA 2QEBA 3CYZA 4BY4A 1L7ZA 1SL7A 1TTXA 4ETOA 3NSOA 5HLVA 4AQJA 1S6CA 1WLMA 4JQ0D 5I2OA 1KWOB 2P71A 3WNXB 1F8HA 3S0DA 1QV1A 1F70A 1N0YA 1B8LA 1AK8A 3CWGA 1XFXO 3UNWA 1C07A 4DRWA 1UHHA 1LA0A 1K8UA 1OOHA 2NLNA 1SSEB 3JTDC 1H8BA 4D1EA 3ZWHA 1SW8A 2HQWA 2BCBA 2MLEC 2KSPA 3I5HC 2M3WA 1JFJA 2ZNDA 3DF0B 3CDNA 1KQMB 1OZSA 1KK8B 2LVKA 1G8IA 3GK4X 1LS8A 2F2OA 2P6BB 2KOTA 1KWOC 2LE9B 4MBEA 3QRXA 4I5LB 2LLSA 2LMTA 1TRFA 1XFWO 1TNQA 3D77A 2OS8B 4GNKB 3TDIA 1UHNA 2GTEA 1AVSA 2AUCA 1OOGA 3TDUA 1A75B 1FBVA 2BBMA 1DJIA 1IG5A 2B1UA 2LAPA 2Y4QA 4FTGA 3C1VA 1KK8C 1AHRA 1BT6A 1SBJA 1KSMA 2LHIA 2Y1MA 3BUOB 3OX5A 1YVLA 3FE9A 1U5IA 1Z2CB 4CPVA 2L98A 2LUCA 4JD9A 4GBAA 1BMOA 1AJ4A 3NSIA 2M1KB 3TDZA 4DUQA 4GUKA 2K7BA 2LHLA 2K2AA 3WHTB 1IRJA 1T14A 1NX1A 2OS8C 2M97A 2JC2A 2ZRSA 2JTTA 1BOCA 2KYFA 3GK1A 4MZLA 1JFKA 3D0YB 3SIAA 1JF0A 1WRZA 3OB2B 3EVUA 2HF5A 3VRQA 1DELA 4M2QA 2EGDA 3S0EA 2KQYA 1SK6D 4PHJA 4CIDA 1WDCC 1LA3A 2MAZA 4ORAB 4A4CA 4A4BA 2L51A 3NHIA 3PN7B 4OKHA 3CGAA 1DTLA 4MZJA 5DKNA 4HREE 4ICBA 1UHJA 3TUYB 1SRAA 3SIBA 4BY5A 4NDDA 1H4BA 1EXRA 2KFFA 3D78A 1K9UA 1NX2A 2LMUA 1Q80A 2K7OA 3BUMB 1SCVA 4HRGA 4I5KA 1QJTA 3SG5A 1A29A 3E3RA 1TOPA 1XFZO 1QS7A 1DGVA 1EL4A 1Y1XA 4PT1A 4GAOA 1PSRA 1UUSA 1XFVO 2LMVA 3KEVA 2QPTA 4YI9A 5IBWA 2L5XB 1PSBA 2LNKA 3BFAA 3S0GA 1J7OA 3PALA 1RWYA 5ER4X 2LVVA 2KI6C 1PVAA 2G9BA 5JJGA 4PE1A 4GFTA 2K60A 1GGWA 1XO5A 1MXEA 4JWQA 2LVJA 1QATA 1FF1A 1SYMA 1SCMB 2F3YA 1RTP1 1SL9A 3IQQA 1SMGA 1DF0B 3PFVA 3EK8A 4PALA 1YX8A 3I5FC 1W7JB 4ORCB 2CTNA 1MF8B 1DJXA 1YRTB 1QIWA 2KFHA 1MHOA 3SG6A 5I2LA 4E68A 2L4IA 4Q04A 1J1EA 2KBMA 1WRKA 3FE8A 4PCWA 5HKZA 4PHKA 3BUXB 1HQVA 4QJ5B 1IH0A 1M63B 3F45A 3O6BA 5FI2A 1PRWA 4MEWA 1FPWA 1JUOA 1OZOA 1GJYA 2JU0A 3FWCA 1OOJA 1BG1A 4JKTA 2L2EA 1NWDA 1QXPA 4OVNF 2JQ6A 4YGBB 4ZCVA 3CR5X 1DJHA 1C7WA 1IWQA 3D75A 3EVVA 1BR4B 2ZN8A 5DKQA 2L5YA 2WNDA 3AKBA 1Y1UA 3CZTX 2JT0A 3PJIA 1B9AA 3CLNA 4M2OA 1TNPA 1LVCD 3BYAA 4HRHA 2SCPA 2OTGC 5FI7A 2E6WA 4M2PA 1SPYA 4N1FA 5CSJA 4NDCA 1K94A 5AANA 5CSFA 5HLOA 1Y6WA 3PSRA 1JBAA 1X02A 3NGVA 2KLEA 2MBXA 2EC6C 3PLFB 3VRRA 1GM0A 4R1EA 1W9ZA 2VRGA 3GK2A 3NXAA 3MSEB 1IIOA 1AP4A 1EG3A 2L4HA 1UURA 1RFJA 1M31A 2ZN9A 1ODBA 1TUZA 3FWBA 1RK9A 3DZTA 1QVIY 5G08A 1E8AA 3A4UB 1YUTA 2QEVA 4I5JA 2LLTA 5HL1A 3WHUB 1G33A 1M39A 3EG5B 2BE4A 4WQ3A 2ISDA 4C0JA 1JSAA 1EG4A 3PM8A 1J1DA 2G2BA 1P28A 2TN4A 1WRLA 3HX4A 3R72A 1OQPA 1S26D 1SNLA 3EK4A 4IL1A 2DOQA 4WQ2A 2BE6A 4CFQA 2BKHB 3DVJA 2L0PA 1XFUO 3CTNA 5I8NA 1NX3A 3RM1A 1QWVA 3L4AA 1F71A 3JVTC 2BAPA 3CZ0A 1YUUA 2LM5A 1K90D 3OHMB 1DJGA 3EK7A 1OOFA 1MWNA 1Z4HA 3AAJA 1DEKA 1U5IB 2F3ZA 1VRKA 3S0BA 1DJWA 1OW4A 2GGZA 2I2RE 4XYNA 2M7NA 2EHBA 1XFRA 2JWWA 3O4XA 3L47A 2MA2A 1CM4A 2ERBA 1WDCB 4PE4A 1TN4A 1ZMZA 4TNCA 1KCYA 3OP0A 2M29A 2KQ6A 1TIZA 1TWOA 1QV0A 2SASA 1QX7A 1WLZA 2AMIA 2FOTA 3SS4A 1B1GA 2H61A 1QTXA 2K7CA 1G4YR 2JPOA 1CMFA 1CLLA 2CBLA 5I2QA 1BU3A 1ORGA 3VROA 1ALVA 2Y5IA 1N2DA 1JC2A 2PMYA 2H61C 1Y1AA 1B7TY 4XJKA 2BBNA 2RGIA 5J3XA 1M46A 4PE0A 1JWDA 2LANA 3OGNA 4PE7A 1M45A 1A03A 1MXLC 2KI4C 1CLMA 2LP2A 4AQIA 4N5XA 1K95A 3EKHA 1CKKA 3DXLA 4CFRA 2V53A 4MRXA 2NCOA 3BUWB 5AEQA 1IJ6A 3A8RA 3EVRA 5KTYA 1DJYA 1PK0D 1S3PA 2QACA 1KFUL 3BFHA 3I5FB 1CNPA 4JPZB 1SR6C 1QASA 3RZSA 2ZKMX 4AOMA 3H4SE 3M0WA 3OB1B 2KGBC 1YTZC 1B8CA 1KQVA 4ZCUA 2KPHA 1CDNA 3DVKA 4MZKA 3ZNIA 1Y0VH 1J7QA 2FJUB 2FCDA 4MVFA 3ICBA 1SY9A 2WCMA 1KFUS 4GGNA 2Q4UA 2O60A 1RECA 3SS3A 3DVMA 1TCOB 5GQQC 1F4QA 5D69A 2LUXA 1IGVA 3D10A 5HYDA 3TS5C 1R6PA 2K61A 3BXKA 1MR8A 4U8DA 1EJ3A 1C3ZA 4MN0A 3B87A 3SG2A 3BJHA 2KAXA 1K9KA 1D1OA 4OV2A 1DJZA 1CTRA 1TCFA 3SS5A 3BFBA 1B8RA 2MLFC 4F7FA 2OTGB 5AERA 2AAOA 3NSLA 1S36A 1IQ5A 3DYEA 4OCIA 1A4PA 2EC6B 2WCHA 1GQMA 2BKIB 3B7AA 4QJ4B 4YI8A 5FI6A 1LINA 2MHHA 1MQ1A 1IJ5A 5KU1A 2LV7A 1CFFA 1QLSA 1KSOA 2JXLA 2KBIA 1N65A 5AFPA 1NSHA 4IJ7A 1ZACA 2I94A 1QX5B 2BECA 2GV5A 3QMEA 4YGEB 4PHMA 3SG4A 2HPSA 3SG7A 5K89A 2P70A 2BL0C 1QX2A 2KAYA 2WCFA 3N7HA 1K2HA 4PHNA 5D7FA 2BNXA 2JTZA 2KLDA 2KI6D 4PDZA 4OR9B 2PASA 5BPJA 3CR2A 2PSRA 4MLWA 1L2OC 1QLKA 3K1EA 4OZDA 3SG3A 2O5GA 3EKJA 3CZ1A 2H8VA 1ZFSA 1CB1A 1DQEA 3JVTB 1SL8A 1QVIZ 1JF2A 2FCEA 1YVHA 1OMDA 5CPVA 2A4JA 1K96A 1DGUA 2KFGA 1UP5A 3VGOA 1NCYA 4KYNA 2I18A 3CABA 5CSIA 2I7AA 1DVIA 3IQOA 2WCLA 4DCKA 4USLA 4ORBB 2JRFA 3PM2A 4QJ3B 1IQ3A 3R1PA 3KHEA 1V1GA 1ZOTB 2K2FA 4C0KA 1IKUA 2F2PA 5ER5A 3BOWA 3LCPC 1YRUB 1YR5A 3CZ2A 1OMVA 4FQTA 5PALA 4MSPA 2PALA 1XFYO 3Q8IA 1BLQA 2QDIA 1BR1B 2JPTA 4FQOA 1TNWA 1RJVA 1B4CA 1PALA 2K0JA 5D3OA 4XJKB 1FW4A 1QIVA 2KI4B 2WC6A 1CM1A 1C3YA 3DD4A 1CDMA 2L2CA 1NYAA 1UHKA 2IS9A 1S6IA 3CS1A 3S0AA 1FI5A 5DKRA 3O4YA 1S1EA 2CXJA 3I5GB 2WCJA 2JT3A 1B7TZ 2ZFDA 3DF0A 3IVTA 1XA5A 3AAKA 1ALWA 4YGAA 1SR6B 1ZUZA 3S0FA 3LLEA 4P2YB 1TUJA 2WORA 1PULA 3O2PA 4YGDB 1UHIA 1OMRA 1KQMC 2CT9A 3LL8B 2Y1NA 3RLZA 4GGFA 2ZNEA 1V1FA 4GPLB 2Q91A 3D74A 5F6TA 1CFDA 2M0RA 1NP8A 2M8UA 1A75A 2JOJA 3CR4X 4GGFC 4INXA 3I5GC 4L9MA 1BJFA 2JNFA 1XYDA 4UPGA 2KNEA 3TS5B 3B88A 1C7VA 1KFXL 1S6JA 2CNPA 1FI6A 1NCZA 2KAVA 2GGMA 3K21A 1LXFC 1J55A 2NCPA 2HETA 2COLB 2M9GA 3IF7A 2KYCA 2LCPA 3UO9A 1NPQA 1CFCA 2K8MB 2JNXA 2WC5A 3TZ1A 2E30A 3VRNA 4P5OE 5HKYA 2NXQA 2ZRTA 3D0YA 3D73A 2M49B 3I5IB 1DT7B 1DC1A 1YX7A 3B6XA 5B8IB 4HSZA 1KFXS 4DIRA 2NZ0A 1UWOA 2JZIA 2QEOA 3DY9A 1CDPA 2YGUA 2JULA 1CDLA 1YUSA 3D76A 2F33A 1K93D 2K7DA 2KGRA 2PYQA 3FS7A 5HKWA 1AJ5A 1K9PA 4MRYA 3O78A 3DVEA 1DMOA 1R2UA 3OBVA 4INWA 3PN7C 1YURA 3SJSA 1KK7Z 2HQ8A 3V2LA 1OE9B 5FYXA 3FE6A 1KK7Y 2MRDA 3TUYC 1NX0A 2LVIA 4I5NB 3I5IC 2M7LA 4DS7A 2BL0B 3R1VA 2L50A 2MJWB 2FJYA 1BF5A 3KPXA 4YRUA 1MUXA 1CLBA 1SKTA 1NIWA 4NDBA 1PVBA 5EL2A 2R2IA 1W7IB 2JXCA 2LLUA 2PQLA 2WOSA 1L2OB 5JOLA 4YGCB 1NCXA 3NSKA 2PVBA 3KF9A 1BODA 2PRUA 3WXAA 1RROA 3NHTA 4YBHB 3VB1A 5I94A 3HCMA 3R1OA 4F0ZB 3BUNB 1CFPA 5AXIA 1F4OA 2WCBA 1B47A 5CSNA 4N1GA 3BQ3A 1A2XA 1DF0A 4NQGA 3KO0A 1CMGA 1OOIX 1F55A 1EH2A 2BCAA 1SCMC 5DICA 1XK4A 2BCXA
chains in the Genus database with same CATH topology
3OGNA 3CZ2A 4FQTA 3L4LA 3B86A 3Q8IA 2QDIA 2QEHA 3DXLA 3FE8A 2WC6A 1C3YA 2L2CA 3BFHA 3S0AA 3RZSA 2WCKA 2QEBA 3CYZA 2WCJA 2KPHA 2P71A 3S0DA 3S0FA 1TUJA 2WCMA 3D75A 1OOHA 3PJIA 3D74A 3CDNA 1C3ZA 4INXA 1LS8A 3B87A 3BJHA 3NGVA 1GM0A 3B88A 3BFBA 4F7FA 3D77A 2GTEA 3DYEA 1OOGA 2WC5A 2WCHA 3B7AA 3D73A 3DZTA 2QEVA 3B6XA 3FE9A 2QEOA 3DY9A 4JD9A 3R72A 1P28A 3D76A 3QMEA 2P70A 1T14A 3N7HA 4INWA 1QWVA 3L4AA 3V2LA 3FE6A 3CZ0A 4OZDA 3K1EA 3S0EA 1OOFA 3R1VA 2FJYA 3CZ1A 2H8VA 3S0BA 3NHIA 1OW4A 5EL2A 1DQEA 2PQLA 1XFRA 3L47A 3D78A 2ERBA 3NHTA 3VB1A 1TWOA 3R1OA 3CABA 4PT1A 2WCLA 2JPOA 1OOIX 3BFAA 1ORGA 3S0GA 5DICA 3R1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGN A;  3CZ2 A;  4FQT A;  3L4L A;  3B86 A;  3Q8I A;  2QDI A;  2QEH A;  3DXL A;  3FE8 A;  2WC6 A;  1C3Y A;  2L2C A;  3BFH A;  3S0A A;  3RZS A;  2WCK A;  2QEB A;  3CYZ A;  2WCJ A;  2KPH A;  2P71 A;  3S0D A;  3S0F A;  1TUJ A;  2WCM A;  3D75 A;  1OOH A;  3PJI A;  3D74 A;  3CDN A;  1C3Z A;  4INX A;  1LS8 A;  3B87 A;  3BJH A;  3NGV A;  1GM0 A;  3B88 A;  3BFB A;  4F7F A;  3D77 A;  2GTE A;  3DYE A;  1OOG A;  2WC5 A;  2WCH A;  3B7A A;  3D73 A;  3DZT A;  2QEV A;  3B6X A;  3FE9 A;  2QEO A;  3DY9 A;  4JD9 A;  3R72 A;  1P28 A;  3D76 A;  3QME A;  2P70 A;  1T14 A;  3N7H A;  4INW A;  1QWV A;  3L4A A;  3V2L A;  3FE6 A;  3CZ0 A;  4OZD A;  3K1E A;  3S0E A;  1OOF A;  3R1V A;  2FJY A;  3CZ1 A;  2H8V A;  3S0B A;  3NHI A;  1OW4 A;  5EL2 A;  1DQE A;  2PQL A;  1XFR A;  3L47 A;  3D78 A;  2ERB A;  3NHT A;  3VB1 A;  1TWO A;  3R1O A;  3CAB A;  4PT1 A;  2WCL A;  2JPO A;  1OOI X;  3BFA A;  1ORG A;  3S0G A;  5DIC A;  3R1P A; 
#chains in the Genus database with same CATH topology
 2D8N A;  1NUB A;  1S5G Z;  3LK1 A;  2M1U A;  1WY9 A;  2LP3 A;  2JT8 A;  1S5G Y;  1XK4 C;  2LC5 A;  3FIA A;  2CCM A;  1AUI B;  1LKJ A;  1GGZ A;  4CLN A;  3PAT A;  5TNC A;  1J7R A;  3L4L A;  3B86 A;  3GOF A;  2WC8 A;  3AKA A;  3VRP A;  5KSZ A;  2OPO A;  2QEH A;  1HT9 A;  2F8P A;  1TNX A;  2KDH A;  1OSA A;  3OX6 A;  4C0L A;  2H2K A;  1F54 A;  3LK0 A;  1J7P A;  3JTD B;  3BOW B;  2WCE A;  4WRI A;  3I5H B;  2KHN A;  2WCK A;  1XVJ A;  2QEB A;  3CYZ A;  4BY4 A;  1L7Z A;  1SL7 A;  1TTX A;  4ETO A;  3NSO A;  5HLV A;  4AQJ A;  1S6C A;  1WLM A;  4JQ0 D;  5I2O A;  1KWO B;  2P71 A;  3WNX B;  1F8H A;  3S0D A;  1QV1 A;  1F70 A;  1N0Y A;  1B8L A;  1AK8 A;  3CWG A;  1XFX O;  3UNW A;  1C07 A;  4DRW A;  1UHH A;  1LA0 A;  1K8U A;  1OOH A;  2NLN A;  1SSE B;  3JTD C;  1H8B A;  4D1E A;  3ZWH A;  1SW8 A;  2HQW A;  2BCB A;  2MLE C;  2KSP A;  3I5H C;  2M3W A;  1JFJ A;  2ZND A;  3DF0 B;  3CDN A;  1KQM B;  1OZS A;  1KK8 B;  2LVK A;  1G8I A;  3GK4 X;  1LS8 A;  2F2O A;  2P6B B;  2KOT A;  1KWO C;  2LE9 B;  4MBE A;  3QRX A;  4I5L B;  2LLS A;  2LMT A;  1TRF A;  1XFW O;  1TNQ A;  3D77 A;  2OS8 B;  4GNK B;  3TDI A;  1UHN A;  2GTE A;  1AVS A;  2AUC A;  1OOG A;  3TDU A;  1A75 B;  1FBV A;  2BBM A;  1DJI A;  1IG5 A;  2B1U A;  2LAP A;  2Y4Q A;  4FTG A;  3C1V A;  1KK8 C;  1AHR A;  1BT6 A;  1SBJ A;  1KSM A;  2LHI A;  2Y1M A;  3BUO B;  3OX5 A;  1YVL A;  3FE9 A;  1U5I A;  1Z2C B;  4CPV A;  2L98 A;  2LUC A;  4JD9 A;  4GBA A;  1BMO A;  1AJ4 A;  3NSI A;  2M1K B;  3TDZ A;  4DUQ A;  4GUK A;  2K7B A;  2LHL A;  2K2A A;  3WHT B;  1IRJ A;  1T14 A;  1NX1 A;  2OS8 C;  2M97 A;  2JC2 A;  2ZRS A;  2JTT A;  1BOC A;  2KYF A;  3GK1 A;  4MZL A;  1JFK A;  3D0Y B;  3SIA A;  1JF0 A;  1WRZ A;  3OB2 B;  3EVU A;  2HF5 A;  3VRQ A;  1DEL A;  4M2Q A;  2EGD A;  3S0E A;  2KQY A;  1SK6 D;  4PHJ A;  4CID A;  1WDC C;  1LA3 A;  2MAZ A;  4ORA B;  4A4C A;  4A4B A;  2L51 A;  3NHI A;  3PN7 B;  4OKH A;  3CGA A;  1DTL A;  4MZJ A;  5DKN A;  4HRE E;  4ICB A;  1UHJ A;  3TUY B;  1SRA A;  3SIB A;  4BY5 A;  4NDD A;  1H4B A;  1EXR A;  2KFF A;  3D78 A;  1K9U A;  1NX2 A;  2LMU A;  1Q80 A;  2K7O A;  3BUM B;  1SCV A;  4HRG A;  4I5K A;  1QJT A;  3SG5 A;  1A29 A;  3E3R A;  1TOP A;  1XFZ O;  1QS7 A;  1DGV A;  1EL4 A;  1Y1X A;  4PT1 A;  4GAO A;  1PSR A;  1UUS A;  1XFV O;  2LMV A;  3KEV A;  2QPT A;  4YI9 A;  5IBW A;  2L5X B;  1PSB A;  2LNK A;  3BFA A;  3S0G A;  1J7O A;  3PAL A;  1RWY A;  5ER4 X;  2LVV A;  2KI6 C;  1PVA A;  2G9B A;  5JJG A;  4PE1 A;  4GFT A;  2K60 A;  1GGW A;  1XO5 A;  1MXE A;  4JWQ A;  2LVJ A;  1QAT A;  1FF1 A;  1SYM A;  1SCM B;  2F3Y A;  1RTP 1;  1SL9 A;  3IQQ A;  1SMG A;  1DF0 B;  3PFV A;  3EK8 A;  4PAL A;  1YX8 A;  3I5F C;  1W7J B;  4ORC B;  2CTN A;  1MF8 B;  1DJX A;  1YRT B;  1QIW A;  2KFH A;  1MHO A;  3SG6 A;  5I2L A;  4E68 A;  2L4I A;  4Q04 A;  1J1E A;  2KBM A;  1WRK A;  3FE8 A;  4PCW A;  5HKZ A;  4PHK A;  3BUX B;  1HQV A;  4QJ5 B;  1IH0 A;  1M63 B;  3F45 A;  3O6B A;  5FI2 A;  1PRW A;  4MEW A;  1FPW A;  1JUO A;  1OZO A;  1GJY A;  2JU0 A;  3FWC A;  1OOJ A;  1BG1 A;  4JKT A;  2L2E A;  1NWD A;  1QXP A;  4OVN F;  2JQ6 A;  4YGB B;  4ZCV A;  3CR5 X;  1DJH A;  1C7W A;  1IWQ A;  3D75 A;  3EVV A;  1BR4 B;  2ZN8 A;  5DKQ A;  2L5Y A;  2WND A;  3AKB A;  1Y1U A;  3CZT X;  2JT0 A;  3PJI A;  1B9A A;  3CLN A;  4M2O A;  1TNP A;  1LVC D;  3BYA A;  4HRH A;  2SCP A;  2OTG C;  5FI7 A;  2E6W A;  4M2P A;  1SPY A;  4N1F A;  5CSJ A;  4NDC A;  1K94 A;  5AAN A;  5CSF A;  5HLO A;  1Y6W A;  3PSR A;  1JBA A;  1X02 A;  3NGV A;  2KLE A;  2MBX A;  2EC6 C;  3PLF B;  3VRR A;  1GM0 A;  4R1E A;  1W9Z A;  2VRG A;  3GK2 A;  3NXA A;  3MSE B;  1IIO A;  1AP4 A;  1EG3 A;  2L4H A;  1UUR A;  1RFJ A;  1M31 A;  2ZN9 A;  1ODB A;  1TUZ A;  3FWB A;  1RK9 A;  3DZT A;  1QVI Y;  5G08 A;  1E8A A;  3A4U B;  1YUT A;  2QEV A;  4I5J A;  2LLT A;  5HL1 A;  3WHU B;  1G33 A;  1M39 A;  3EG5 B;  2BE4 A;  4WQ3 A;  2ISD A;  4C0J A;  1JSA A;  1EG4 A;  3PM8 A;  1J1D A;  2G2B A;  1P28 A;  2TN4 A;  1WRL A;  3HX4 A;  3R72 A;  1OQP A;  1S26 D;  1SNL A;  3EK4 A;  4IL1 A;  2DOQ A;  4WQ2 A;  2BE6 A;  4CFQ A;  2BKH B;  3DVJ A;  2L0P A;  1XFU O;  3CTN A;  5I8N A;  1NX3 A;  3RM1 A;  1QWV A;  3L4A A;  1F71 A;  3JVT C;  2BAP A;  3CZ0 A;  1YUU A;  2LM5 A;  1K90 D;  3OHM B;  1DJG A;  3EK7 A;  1OOF A;  1MWN A;  1Z4H A;  3AAJ A;  1DEK A;  1U5I B;  2F3Z A;  1VRK A;  3S0B A;  1DJW A;  1OW4 A;  2GGZ A;  2I2R E;  4XYN A;  2M7N A;  2EHB A;  1XFR A;  2JWW A;  3O4X A;  3L47 A;  2MA2 A;  1CM4 A;  2ERB A;  1WDC B;  4PE4 A;  1TN4 A;  1ZMZ A;  4TNC A;  1KCY A;  3OP0 A;  2M29 A;  2KQ6 A;  1TIZ A;  1TWO A;  1QV0 A;  2SAS A;  1QX7 A;  1WLZ A;  2AMI A;  2FOT A;  3SS4 A;  1B1G A;  2H61 A;  1QTX A;  2K7C A;  1G4Y R;  2JPO A;  1CMF A;  1CLL A;  2CBL A;  5I2Q A;  1BU3 A;  1ORG A;  3VRO A;  1ALV A;  2Y5I A;  1N2D A;  1JC2 A;  2PMY A;  2H61 C;  1Y1A A;  1B7T Y;  4XJK A;  2BBN A;  2RGI A;  5J3X A;  1M46 A;  4PE0 A;  1JWD A;  2LAN A;  3OGN A;  4PE7 A;  1M45 A;  1A03 A;  1MXL C;  2KI4 C;  1CLM A;  2LP2 A;  4AQI A;  4N5X A;  1K95 A;  3EKH A;  1CKK A;  3DXL A;  4CFR A;  2V53 A;  4MRX A;  2NCO A;  3BUW B;  5AEQ A;  1IJ6 A;  3A8R A;  3EVR A;  5KTY A;  1DJY A;  1PK0 D;  1S3P A;  2QAC A;  1KFU L;  3BFH A;  3I5F B;  1CNP A;  4JPZ B;  1SR6 C;  1QAS A;  3RZS A;  2ZKM X;  4AOM A;  3H4S E;  3M0W A;  3OB1 B;  2KGB C;  1YTZ C;  1B8C A;  1KQV A;  4ZCU A;  2KPH A;  1CDN A;  3DVK A;  4MZK A;  3ZNI A;  1Y0V H;  1J7Q A;  2FJU B;  2FCD A;  4MVF A;  3ICB A;  1SY9 A;  2WCM A;  1KFU S;  4GGN A;  2Q4U A;  2O60 A;  1REC A;  3SS3 A;  3DVM A;  1TCO B;  5GQQ C;  1F4Q A;  5D69 A;  2LUX A;  1IGV A;  3D10 A;  5HYD A;  3TS5 C;  1R6P A;  2K61 A;  3BXK A;  1MR8 A;  4U8D A;  1EJ3 A;  1C3Z A;  4MN0 A;  3B87 A;  3SG2 A;  3BJH A;  2KAX A;  1K9K A;  1D1O A;  4OV2 A;  1DJZ A;  1CTR A;  1TCF A;  3SS5 A;  3BFB A;  1B8R A;  2MLF C;  4F7F A;  2OTG B;  5AER A;  2AAO A;  3NSL A;  1S36 A;  1IQ5 A;  3DYE A;  4OCI A;  1A4P A;  2EC6 B;  2WCH A;  1GQM A;  2BKI B;  3B7A A;  4QJ4 B;  4YI8 A;  5FI6 A;  1LIN A;  2MHH A;  1MQ1 A;  1IJ5 A;  5KU1 A;  2LV7 A;  1CFF A;  1QLS A;  1KSO A;  2JXL A;  2KBI A;  1N65 A;  5AFP A;  1NSH A;  4IJ7 A;  1ZAC A;  2I94 A;  1QX5 B;  2BEC A;  2GV5 A;  3QME A;  4YGE B;  4PHM A;  3SG4 A;  2HPS A;  3SG7 A;  5K89 A;  2P70 A;  2BL0 C;  1QX2 A;  2KAY A;  2WCF A;  3N7H A;  1K2H A;  4PHN A;  5D7F A;  2BNX A;  2JTZ A;  2KLD A;  2KI6 D;  4PDZ A;  4OR9 B;  2PAS A;  5BPJ A;  3CR2 A;  2PSR A;  4MLW A;  1L2O C;  1QLK A;  3K1E A;  4OZD A;  3SG3 A;  2O5G A;  3EKJ A;  3CZ1 A;  2H8V A;  1ZFS A;  1CB1 A;  1DQE A;  3JVT B;  1SL8 A;  1QVI Z;  1JF2 A;  2FCE A;  1YVH A;  1OMD A;  5CPV A;  2A4J A;  1K96 A;  1DGU A;  2KFG A;  1UP5 A;  3VGO A;  1NCY A;  4KYN A;  2I18 A;  3CAB A;  5CSI A;  2I7A A;  1DVI A;  3IQO A;  2WCL A;  4DCK A;  4USL A;  4ORB B;  2JRF A;  3PM2 A;  4QJ3 B;  1IQ3 A;  3R1P A;  3KHE A;  1V1G A;  1ZOT B;  2K2F A;  4C0K A;  1IKU A;  2F2P A;  5ER5 A;  3BOW A;  3LCP C;  1YRU B;  1YR5 A;  3CZ2 A;  1OMV A;  4FQT A;  5PAL A;  4MSP A;  2PAL A;  1XFY O;  3Q8I A;  1BLQ A;  2QDI A;  1BR1 B;  2JPT A;  4FQO A;  1TNW A;  1RJV A;  1B4C A;  1PAL A;  2K0J A;  5D3O A;  4XJK B;  1FW4 A;  1QIV A;  2KI4 B;  2WC6 A;  1CM1 A;  1C3Y A;  3DD4 A;  1CDM A;  2L2C A;  1NYA A;  1UHK A;  2IS9 A;  1S6I A;  3CS1 A;  3S0A A;  1FI5 A;  5DKR A;  3O4Y A;  1S1E A;  2CXJ A;  3I5G B;  2WCJ A;  2JT3 A;  1B7T Z;  2ZFD A;  3DF0 A;  3IVT A;  1XA5 A;  3AAK A;  1ALW A;  4YGA A;  1SR6 B;  1ZUZ A;  3S0F A;  3LLE A;  4P2Y B;  1TUJ A;  2WOR A;  1PUL A;  3O2P A;  4YGD B;  1UHI A;  1OMR A;  1KQM C;  2CT9 A;  3LL8 B;  2Y1N A;  3RLZ A;  4GGF A;  2ZNE A;  1V1F A;  4GPL B;  2Q91 A;  3D74 A;  5F6T A;  1CFD A;  2M0R A;  1NP8 A;  2M8U A;  1A75 A;  2JOJ A;  3CR4 X;  4GGF C;  4INX A;  3I5G C;  4L9M A;  1BJF A;  2JNF A;  1XYD A;  4UPG A;  2KNE A;  3TS5 B;  3B88 A;  1C7V A;  1KFX L;  1S6J A;  2CNP A;  1FI6 A;  1NCZ A;  2KAV A;  2GGM A;  3K21 A;  1LXF C;  1J55 A;  2NCP A;  2HET A;  2COL B;  2M9G A;  3IF7 A;  2KYC A;  2LCP A;  3UO9 A;  1NPQ A;  1CFC A;  2K8M B;  2JNX A;  2WC5 A;  3TZ1 A;  2E30 A;  3VRN A;  4P5O E;  5HKY A;  2NXQ A;  2ZRT A;  3D0Y A;  3D73 A;  2M49 B;  3I5I B;  1DT7 B;  1DC1 A;  1YX7 A;  3B6X A;  5B8I B;  4HSZ A;  1KFX S;  4DIR A;  2NZ0 A;  1UWO A;  2JZI A;  2QEO A;  3DY9 A;  1CDP A;  2YGU A;  2JUL A;  1CDL A;  1YUS A;  3D76 A;  2F33 A;  1K93 D;  2K7D A;  2KGR A;  2PYQ A;  3FS7 A;  5HKW A;  1AJ5 A;  1K9P A;  4MRY A;  3O78 A;  3DVE A;  1DMO A;  1R2U A;  3OBV A;  4INW A;  3PN7 C;  1YUR A;  3SJS A;  1KK7 Z;  2HQ8 A;  3V2L A;  1OE9 B;  5FYX A;  3FE6 A;  1KK7 Y;  2MRD A;  3TUY C;  1NX0 A;  2LVI A;  4I5N B;  3I5I C;  2M7L A;  4DS7 A;  2BL0 B;  3R1V A;  2L50 A;  2MJW B;  2FJY A;  1BF5 A;  3KPX A;  4YRU A;  1MUX A;  1CLB A;  1SKT A;  1NIW A;  4NDB A;  1PVB A;  5EL2 A;  2R2I A;  1W7I B;  2JXC A;  2LLU A;  2PQL A;  2WOS A;  1L2O B;  5JOL A;  4YGC B;  1NCX A;  3NSK A;  2PVB A;  3KF9 A;  1BOD A;  2PRU A;  3WXA A;  1RRO A;  3NHT A;  4YBH B;  3VB1 A;  5I94 A;  3HCM A;  3R1O A;  4F0Z B;  3BUN B;  1CFP A;  5AXI A;  1F4O A;  2WCB A;  1B47 A;  5CSN A;  4N1G A;  3BQ3 A;  1A2X A;  1DF0 A;  4NQG A;  3KO0 A;  1CMG A;  1OOI X;  1F55 A;  1EH2 A;  2BCA A;  1SCM C;  5DIC A;  1XK4 A;  2BCX A; 
#chains in the Genus database with same CATH homology
 3OGN A;  3CZ2 A;  4FQT A;  3L4L A;  3B86 A;  3Q8I A;  2QDI A;  2QEH A;  3DXL A;  3FE8 A;  2WC6 A;  1C3Y A;  2L2C A;  3BFH A;  3S0A A;  3RZS A;  2WCK A;  2QEB A;  3CYZ A;  2WCJ A;  2KPH A;  2P71 A;  3S0D A;  3S0F A;  1TUJ A;  2WCM A;  3D75 A;  1OOH A;  3PJI A;  3D74 A;  3CDN A;  1C3Z A;  4INX A;  1LS8 A;  3B87 A;  3BJH A;  3NGV A;  1GM0 A;  3B88 A;  3BFB A;  4F7F A;  3D77 A;  2GTE A;  3DYE A;  1OOG A;  2WC5 A;  2WCH A;  3B7A A;  3D73 A;  3DZT A;  2QEV A;  3B6X A;  3FE9 A;  2QEO A;  3DY9 A;  4JD9 A;  3R72 A;  1P28 A;  3D76 A;  3QME A;  2P70 A;  1T14 A;  3N7H A;  4INW A;  1QWV A;  3L4A A;  3V2L A;  3FE6 A;  3CZ0 A;  4OZD A;  3K1E A;  3S0E A;  1OOF A;  3R1V A;  2FJY A;  3CZ1 A;  2H8V A;  3S0B A;  3NHI A;  1OW4 A;  5EL2 A;  1DQE A;  2PQL A;  1XFR A;  3L47 A;  3D78 A;  2ERB A;  3NHT A;  3VB1 A;  1TWO A;  3R1O A;  3CAB A;  4PT1 A;  2WCL A;  2JPO A;  1OOI X;  3BFA A;  1ORG A;  3S0G A;  5DIC A;  3R1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...