3LCPC

Crystal structure of the carbohydrate recognition domain of lman1 in complex with mcfd2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
68
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Crystal structure of the LMAN1-CRD/MCFD2 transport receptor complex provides insight into combined deficiency of factor V and factor VIII.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 68
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lcpC00
1PULA 2LCPA 2WORA 2KFHA 4XYNA 2L4IA 2CCMA 4PHJA 1UHHA 1UHNA 1B7TY 1SW8A 1BU3A 1YUTA 1CDNA 1S6CA 4GUKA 3BUXB 1PVBA 3TDUA 1RK9A 3BOWB 1GGWA 2F2PA 3I5GB 1RFJA 1S1EA 3DVKA 3LK0A 5K89A 1HT9A 2BE6A 1CM4A 2L51A 1JBAA 3TDIA 1K94A 1OE9B 2EC6B 4M2PA 3JTDC 3DVMA 1AUIB 4PE1A 4WRIA 3EVRA 1PK0D 1K93D 2JQ6A 3FWCA 4U8DA 1NCXA 1OZSA 2PMYA 1LKJA 2JT0A 1SPYA 4PHKA 3OX5A 1DTLA 2COLB 2SASA 3RLZA 2JC2A 3BOWA 1SBJA 3DD4A 1U5IB 1YVHA 4MRYA 4UPGA 1DJXA 1CDPA 2KBMA 1QTXA 1KFXL 1NX0A 1C7VA 4PDZA 5TNCA 1DGVA 2K61A 1NCYA 1TNPA 1DT7B 1M39A 5CSIA 5PALA 3CR5X 5HYDA 1IRJA 1KQMC 4FTGA 2LVJA 3KF9A 1ZFSA 3M0WA 1R2UA 1U5IA 2HQWA 2KI4C 2I94A 4MZKA 1J7QA 1LA3A 1KK7Y 1BF5A 1DMOA 4YI9A 1G8IA 1E8AA 1IH0A 2JTZA 2K7DA 1XFYO 4NQGA 1WLMA 1F4QA 5D69A 1NX2A 1KK8B 5G08A 1YTZC 4PE0A 3PN7B 3TUYC 4MBEA 1ZUZA 3SG4A 5HLOA 1WDCC 1AHRA 1AJ5A 3AAKA 1CMFA 3BXKA 3CTNA 1X02A 5I2LA 2M7LA 1B8LA 1XK4C 2JWWA 2L0PA 2L4HA 2LMTA 2JOJA 2ZKMX 2OS8C 4N1GA 1A75B 1B4CA 3ZNIA 1KFUL 3SG7A 4JWQA 1NSHA 4P5OE 1VRKA 2LANA 2E6WA 3OP0A 5AANA 4C0JA 1K96A 3PLFB 4MVFA 3ZWHA 1KQVA 1TCFA 3GOFA 2KYCA 2FOTA 2KNEA 1QV1A 1LXFC 1UUSA 5HKWA 2EHBA 2LNKA 3OHMB 2Y1NA 1W7IB 3EK7A 4N5XA 1NX3A 1NX1A 1GJYA 2LLSA 2SCPA 1J7RA 1GQMA 2H61C 2OPOA 2BCAA 1Y6WA 1A75A 1CLMA 1NWDA 3DVEA 5HLVA 2LHIA 2BKIB 4GBAA 1B9AA 1L2OC 2E30A 2LVKA 1UHJA 1OMVA 1UURA 1YUSA 4GGFC 3DVJA 1ODBA 4GGNA 2PALA 2ISDA 1IJ6A 1C07A 1SR6B 2AMIA 1PSBA 1A4PA 3D0YB 1EG4A 5HKZA 3WXAA 4YGAA 2KI6D 1BJFA 1XVJA 2K7BA 1BMOA 1SCMB 1TCOB 2MRDA 5JJGA 1A03A 1DJIA 1QLKA 4ZCVA 4OV2A 4USLA 5BPJA 3FIAA 1K9PA 1JWDA 4YGBB 3BUNB 2LV7A 4DUQA 3PM8A 3LCPC 2V53A 2ZNDA 2A4JA 2P6BB 1V1FA 1XFXO 2WCFA 3WHTB 3BQ3A 2KYFA 5ER5A 2Y1MA 2M3WA 4HRGA 3VROA 3D0YA 1UHKA 1RROA 3CS1A 1M63B 1XFVO 2M0RA 4MSPA 4QJ3B 1OMRA 1N65A 2M97A 3I5HB 1N0YA 1H4BA 2M1UA 2F3YA 4I5JA 4YGEB 1SRAA 2PRUA 2WCBA 3ICBA 1Y1UA 5CSJA 4OCIA 1KCYA 1YUUA 1EJ3A 3SIBA 2JXLA 2F8PA 2HPSA 3EVUA 4PE4A 3TS5C 1OSAA 1QX5B 1FW4A 2FJUB 1SNLA 2OTGC 3CR2A 4ORAB 1M46A 2MJWB 1QATA 1XFZO 1G33A 1SL8A 2KSPA 2IS9A 1PSRA 1EXRA 2JXCA 3NSKA 1K9KA 4QJ5B 1KSOA 3HX4A 4MLWA 1B7TZ 1JF2A 5I2QA 1UWOA 4ETOA 1IQ3A 3I5FC 2ZN9A 1Q80A 2LUXA 1XO5A 3C1VA 1LA0A 1TRFA 3MSEB 3IQQA 2LAPA 1LINA 1R6PA 2JT3A 2I18A 1CLLA 3BYAA 1IWQA 1S5GY 5I2OA 2JU0A 2KQ6A 1NP8A 2KAYA 1RWYA 3JVTB 2NCOA 2PVBA 3LLEA 3AAJA 3CWGA 2BL0C 1W7JB 1C7WA 2KFGA 4GAOA 1FBVA 1CLBA 5CSFA 2D8NA 2K7OA 2KGBC 2KFFA 4NDCA 4OKHA 2R2IA 3I5IC 2LVVA 4PHNA 2O5GA 3GK4X 3KO0A 1KFUS 2WC8A 3QRXA 1QX2A 2LMUA 2MBXA 1CB1A 1AJ4A 1SK6D 3OB1B 3JTDB 1CFCA 1KWOC 4C0LA 2BCBA 2F2OA 2GGZA 1K9UA 3IF7A 2HF5A 1B47A 2ZRSA 1G4YR 1EG3A 2O60A 1OQPA 3VRNA 1KSMA 1S6JA 1WY9A 4NDBA 1ALWA 4JPZB 4CIDA 1A29A 3NXAA 1JF0A 4A4CA 1YRUB 3VRQA 1BR1B 1EL4A 3NSIA 2BBNA 2KQYA 1SYMA 2LUCA 5HKYA 1BLQA 2LMVA 2LP3A 3TDZA 1QIVA 4JQ0D 1BR4B 2LLTA 1KK7Z 2MA2A 3O78A 5JOLA 1MXLC 4CFRA 2K7CA 1S3PA 2NCPA 4E68A 3K21A 1B8CA 2BECA 3A4UB 4YGCB 2BBMA 1QV0A 2QACA 5IBWA 4A4BA 1YRTB 3EKHA 4GNKB 4HREE 4XJKB 1FPWA 1F54A 4ICBA 3KEVA 1KQMB 2B1UA 3KHEA 5AFPA 4HSZA 3PALA 1BODA 1WRLA 1QIWA 1TN4A 4N1FA 1F71A 3FWBA 4L9MA 2CBLA 1CNPA 1LVCD 3AKBA 4MRXA 5GQQC 2KI4B 4TNCA 3OB2B 5D7FA 3IQOA 2NZ0A 1XA5A 1MUXA 1DGUA 3SG5A 2F33A 1BT6A 2Y5IA 2L2EA 5KTYA 3I5GC 1JFKA 2M8UA 1QVIY 4AQIA 2JRFA 2EGDA 3TUYB 4XJKA 2F3ZA 2FCEA 3SG2A 2ZFDA 1QJTA 2EC6C 2MLEC 1WDCB 2NLNA 2G2BA 1TNWA 1J7PA 3VRRA 2NXQA 1DF0B 1WLZA 1WRZA 1ZMZA 1V1GA 3RM1A 2DOQA 1F8HA 1CM1A 4DCKA 1A2XA 2OS8B 1JFJA 3WHUB 2LC5A 2JNXA 2M7NA 4WQ3A 5B8IB 1CFPA 1M31A 2KDHA 1CMGA 3BUMB 1DJWA 1SL9A 3PFVA 5AERA 4ORBB 5DKNA 1SY9A 2L50A 1XFUO 1TOPA 1F55A 4YBHB 4YRUA 2K0JA 1DF0A 3CGAA 2ZN8A 1XK4A 1QX7A 1OOJA 3D10A 1J1DA 1DJZA 4GFTA 1UHIA 1MWNA 1L2OB 5CPVA 2BE4A 3CZTX 4CLNA 2M1KB 1FI5A 3GK1A 1CDMA 1KFXS 1NUBA 2LE9B 3TZ1A 1MR8A 2FCDA 1K90D 4HRHA 3SIAA 1XFWO 2H2KA 1EH2A 5KSZA 4PCWA 2GV5A 1QS7A 1ALVA 1KK8C 3SG6A 1TNQA 2KGRA 3PN7C 2H61A 4ORCB 2ZRTA 1SL7A 1K8UA 1CKKA 3H4SE 1UP5A 1AP4A 2QPTA 1GGZA 1YR5A 1CDLA 2JTTA 3EK8A 4PALA 3O2PA 1M45A 2AUCA 5DKQA 2K2FA 3PSRA 1DVIA 1DJYA 4DS7A 2CTNA 5I8NA 4GGFA 4QJ4B 3VGOA 3O4YA 1MF8B 2KBIA 4MEWA 1DJGA 3GK2A 1J55A 4YI8A 3BUWB 3O6BA 1ZACA 4Q04A 2JNFA 1TTXA 1QASA 2LM5A 2L98A 2M49B 4DRWA 1MHOA 1AK8A 2JZIA 3PATA 1CFFA 3HCMA 1PALA 3NSOA 2KAVA 4M2OA 2ZNEA 1PRWA 4MZJA 2TN4A 3A8RA 3OX6A 1JC2A 4D1EA 1CFDA 4MN0A 3TS5B 4CPVA 4F0ZB 2K8MB 2Y4QA 3LL8B 2OTGB 2L5XB 2M9GA 3EKJA 5AXIA 1IQ5A 1QLSA 2KI6C 1S5GZ 1WRKA 1Y1AA 2RGIA 1JUOA 4BY4A 1H8BA 2KHNA 4I5NB 2PSRA 1S26D 1D1OA 4PHMA 4MZLA 2WCEA 1SR6C 3NSLA 2LP2A 2KOTA 2BKHB 4WQ2A 4BY5A 3BUOB 1FF1A 1SKTA 1S36A 3I5FB 1SCMC 1FI6A 1SMGA 4C0KA 3KPXA 4AQJA 1HQVA 1IG5A 1OMDA 2HQ8A 2BCXA 2G9BA 1YX7A 2KAXA 2LVIA 1S6IA 2AAOA 1YVLA 1NPQA 2LLUA 3VRPA 4I5KA 5KU1A 2JPTA 4P2YB 1J1EA 1RTP1 3AKAA 1TIZA 4NDDA 2CT9A 3DF0B 3SJSA 2BL0B 1K95A 1YX8A 2MLFC 1B1GA 1SCVA 4DIRA 1NIWA 1NYAA 2PASA 1AVSA 1MXEA 1QXPA 5AEQA 4M2QA 1BOCA 1N2DA 1MQ1A 1Y0VH 3I5IB 3I5HC 5ER4X 2MAZA 2MHHA 4ZCUA 3CR4X 4OVNF 4YGDB 2VRGA 1DJHA 2M29A 1L7ZA 2WOSA 1KWOB 4AOMA 2LHLA 2JULA 1IGVA 4CFQA 1CTRA 2GGMA 1YURA 2Q4UA 3DF0A 1XYDA 1RECA 3E3RA 4PE7A 2I2RE 2WNDA 2K2AA 4IL1A 3EVVA 2HETA 1K2HA 3SG3A 1OZOA 1PVAA 2I7AA 1IKUA 3LK1A 4GPLB 3CLNA 1Y1XA 5CSNA 5DKRA 4OR9B 1ZOTB 1F70A 3WNXB 1TNXA 4I5LB 1F4OA 1IJ5A 5F6TA 3EK4A 4FQOA 1QVIZ 2CNPA 3FS7A 1BG1A 1JSAA 2JT8A 3F45A 5FYXA 1B8RA 2Q91A 1J7OA 5J3XA 2CXJA 4R1EA 1RJVA 1NCZA 3JVTC
chains in the Genus database with same CATH superfamily
1PULA 2LCPA 2WORA 2KFHA 4XYNA 2L4IA 2CCMA 4PHJA 1UHHA 1UHNA 1B7TY 1SW8A 1BU3A 1YUTA 3R1VA 1CDNA 1S6CA 4GUKA 3BUXB 1PVBA 3TDUA 1IIOA 1RK9A 3BOWB 1GGWA 2F2PA 3I5GB 1RFJA 1S1EA 2KLEA 3DVKA 3LK0A 5K89A 1HT9A 2BE6A 3CZ1A 1CM4A 2L51A 1JBAA 3NHTA 1K94A 3TDIA 1OE9B 2EC6B 4M2PA 3JTDC 3DVMA 1AUIB 4PE1A 4WRIA 3EVRA 1PK0D 1SSEB 1K93D 2JQ6A 3FWCA 4U8DA 1NCXA 1OZSA 2PMYA 1LKJA 2JT0A 2FJYA 1SPYA 4PHKA 3D74A 3OX5A 1DTLA 2COLB 2SASA 3RLZA 2JC2A 3BOWA 1SBJA 3DD4A 2YGUA 1U5IB 1YVHA 4MRYA 4UPGA 1DJXA 1CDPA 2KBMA 2QEHA 1QTXA 1KFXL 1NX0A 1C7VA 4PDZA 1OOGA 5TNCA 1DGVA 2K61A 1NCYA 1TNPA 1DT7B 1M39A 5CSIA 5PALA 3CR5X 5HYDA 1IRJA 1KQMC 4FTGA 2LVJA 3KF9A 1ZFSA 5EL2A 3M0WA 1R2UA 1U5IA 2HQWA 2KI4C 2I94A 3B87A 4MZKA 1J7QA 1LA3A 1KK7Y 1BF5A 1DMOA 4YI9A 1G8IA 2WC6A 1E8AA 1IH0A 1Z2CB 2JTZA 1XFYO 2K7DA 4NQGA 1WLMA 1F4QA 5D69A 1NX2A 1KK8B 5G08A 1YTZC 4PE0A 3PN7B 3TUYC 4MBEA 1ZUZA 3PJIA 3SG4A 5HLOA 1WDCC 1AHRA 1AJ5A 3AAKA 1CMFA 3BXKA 3CTNA 1X02A 5I2LA 2M7LA 1B8LA 1XK4C 2JWWA 2L0PA 2L4HA 2LMTA 2JOJA 2ZKMX 2OS8C 4N1GA 1A75B 1B4CA 3ZNIA 1KFUL 3SG7A 4JWQA 1NSHA 4P5OE 1VRKA 2LANA 2E6WA 2PYQA 3FE8A 3OP0A 5AANA 1K96A 3FE9A 4C0JA 3PLFB 4MVFA 3ZWHA 3SS4A 1KQVA 1TCFA 3GOFA 3R1OA 2KYCA 2FOTA 2KNEA 1QV1A 1LXFC 1UUSA 5HKWA 3RZSA 2EHBA 2LNKA 3OHMB 3EG5B 2Y1NA 1W7IB 3EK7A 4N5XA 1NX3A 1NX1A 1GJYA 2LLSA 2SCPA 1J7RA 1GQMA 2H61C 2OPOA 2BCAA 3BFHA 1Y6WA 1A75A 1CLMA 1NWDA 3DVEA 5HLVA 2LHIA 2BKIB 4GBAA 1B9AA 1L2OC 3L4AA 2E30A 2LVKA 1P28A 1LS8A 1UHJA 1OOIX 1OMVA 1UURA 1YUSA 4GGFC 3DVJA 1ODBA 4GGNA 2PALA 2ISDA 1IJ6A 1C07A 1SR6B 2AMIA 1PSBA 1A4PA 3D0YB 1EG4A 3FE6A 5HKZA 3WXAA 1DEKA 4YGAA 2KI6D 1BJFA 1XVJA 2K7BA 3IVTA 1BMOA 1SCMB 1TCOB 2MRDA 5JJGA 1A03A 1DJIA 1QLKA 4ZCVA 3D75A 4OV2A 4USLA 5BPJA 3FIAA 3VB1A 5FI7A 1K9PA 1JWDA 4YGBB 3BUNB 2LV7A 4DUQA 3PM8A 1C3YA 3DY9A 3LCPC 2V53A 2ZNDA 2A4JA 2P6BB 1V1FA 1XFXO 2WCFA 1ORGA 3BQ3A 3WHTB 2KYFA 5ER5A 2Y1MA 2M3WA 4HRGA 3VROA 3D0YA 1UHKA 1RROA 3CS1A 1M63B 1XFVO 2M0RA 3S0AA 4MSPA 3BFBA 3CYZA 4QJ3B 1OMRA 1N65A 2M97A 3I5HB 5FI6A 1N0YA 1H4BA 2M1UA 2F3YA 4I5JA 4YGEB 1SRAA 2PRUA 2WCBA 3ICBA 1Y1UA 5CSJA 2WCKA 4OCIA 1YUUA 1EJ3A 3SIBA 1KCYA 2JXLA 2F8PA 2HPSA 3EVUA 4PE4A 3TS5C 1OSAA 1QX5B 2P70A 1FW4A 2FJUB 1SNLA 2OTGC 3CR2A 4ORAB 1M46A 2MJWB 1QATA 1XFZO 1G33A 1SL8A 2KSPA 2IS9A 3S0FA 1PSRA 1EXRA 2JXCA 3NSKA 1K9KA 4QJ5B 1KSOA 3HX4A 4MLWA 1B7TZ 1JF2A 3R1PA 1UWOA 4ETOA 5I2QA 1IQ3A 3I5FC 2ZN9A 1Q80A 2LUXA 1XO5A 3C1VA 1LA0A 1TRFA 3MSEB 3K1EA 3IQQA 3L47A 2LAPA 1LINA 1R6PA 2JT3A 2I18A 1CLLA 3BYAA 1IWQA 1S5GY 5I2OA 2JU0A 2KQ6A 2K60A 1NP8A 2KAYA 1RWYA 3JVTB 2NCOA 2PVBA 3CDNA 3AAJA 3LLEA 3CWGA 4IJ7A 2BL0C 1W7JB 1C7WA 2KFGA 4GAOA 1FBVA 5D3OA 1CLBA 5CSFA 2D8NA 2K7OA 2KGBC 2KFFA 2WCMA 4NDCA 4OKHA 2R2IA 3I5IC 2LVVA 4PHNA 1OOHA 2O5GA 3GK4X 3KO0A 1KFUS 2WC8A 3QRXA 1QX2A 2LMUA 2MBXA 1CB1A 1AJ4A 1SK6D 3OB1B 3JTDB 3S0EA 1KWOC 1CFCA 4C0LA 2BCBA 2F2OA 2GGZA 1K9UA 3IF7A 2HF5A 1B47A 2ZRSA 1G4YR 1EG3A 2O60A 1OQPA 3D76A 1KSMA 1S6JA 1WY9A 4NDBA 1ALWA 4JPZB 3VRNA 4CIDA 1A29A 3NXAA 1JF0A 3D77A 4A4CA 1YRUB 3VRQA 1BR1B 1EL4A 3NSIA 2BBNA 2KQYA 1SYMA 2LUCA 5HKYA 1BLQA 2LMVA 2LP3A 3CABA 3SS3A 3TDZA 1QIVA 4JQ0D 1BR4B 2WCLA 3NGVA 2LLTA 1KK7Z 2MA2A 2PQLA 2QDIA 3O78A 5JOLA 1MXLC 4CFRA 2K7CA 1S3PA 2NCPA 2WC5A 4E68A 3K21A 1B8CA 2BECA 3A4UB 4YGCB 2BBMA 1QV0A 1TUZA 3R72A 2QACA 5IBWA 1OW4A 1DQEA 4A4BA 1YRTB 3EKHA 4GNKB 4HREE 4XJKB 1FPWA 1F54A 4ICBA 3KEVA 1KQMB 2B1UA 3KHEA 5AFPA 4HSZA 3PALA 1BODA 1WRLA 1QIWA 1TN4A 4N1FA 1F71A 3FWBA 4L9MA 2CBLA 4FQTA 1CNPA 1LVCD 3AKBA 4MRXA 5GQQC 2KI4B 4TNCA 3OB2B 4JD9A 5D7FA 3IQOA 2NZ0A 1XA5A 1MUXA 1DGUA 3SG5A 2ERBA 2F33A 1BT6A 2Y5IA 2L2EA 5KTYA 3I5GC 1JFKA 2M8UA 5HL1A 1QVIY 4AQIA 2JRFA 2EGDA 3O4XA 2QEVA 3TUYB 4XJKA 2F3ZA 2FCEA 3SG2A 4PT1A 2ZFDA 1QJTA 2EC6C 2WCJA 2MLEC 1WDCB 2NLNA 2G2BA 1TNWA 1J7PA 3VRRA 2NXQA 1DF0B 1WLZA 1WRZA 1ZMZA 1V1GA 2L5YA 3RM1A 2DOQA 5DICA 1F8HA 1CM1A 4DCKA 1A2XA 3S0DA 2OS8B 1JFJA 3WHUB 2LC5A 2JNXA 2M7NA 3OGNA 4WQ3A 3NHIA 5B8IB 1M31A 1CFPA 2KDHA 1CMGA 3BUMB 1DJWA 1C3ZA 1SL9A 3PFVA 5AERA 4ORBB 5DKNA 3SS5A 1SY9A 2L50A 1XFUO 1TOPA 3D78A 1F55A 3B86A 4YBHB 3B88A 4YRUA 2K0JA 1DF0A 3CGAA 2ZN8A 1XK4A 3PM2A 1QX7A 1OOJA 3D10A 1W9ZA 1J1DA 2BNXA 3QMEA 1DJZA 4GFTA 1UHIA 4JKTA 1MWNA 1L2OB 5CPVA 3UNWA 2BE4A 3CZTX 4CLNA 2M1KB 1FI5A 3GK1A 4INXA 1CDMA 1KFXS 1NUBA 2LE9B 3TZ1A 1MR8A 2FCDA 1K90D 4HRHA 3SIAA 1XFWO 2H2KA 1DELA 1EH2A 5KSZA 4PCWA 2GV5A 2BAPA 1QS7A 3OBVA 1ALVA 1KK8C 3SG6A 1TNQA 2KGRA 3PN7C 2H61A 4ORCB 2ZRTA 1SL7A 1K8UA 3V2LA 3H4SE 1CKKA 1UP5A 1AP4A 2QPTA 2H8VA 3S0BA 1GGZA 1YR5A 1CDLA 2JTTA 3EK8A 4PALA 1TWOA 3CZ0A 3O2PA 1M45A 2AUCA 5DKQA 2K2FA 3PSRA 1DVIA 3N7HA 1DJYA 3CZ2A 4DS7A 2CTNA 5I8NA 4GGFA 4QJ4B 3VGOA 3O4YA 1MF8B 2KBIA 4MEWA 1DJGA 3GK2A 1J55A 4YI8A 3BUWB 3O6BA 1ZACA 3Q8IA 4Q04A 2JNFA 1TTXA 1QASA 2LM5A 2L98A 2M49B 2QEBA 1MHOA 4DRWA 2JZIA 1AK8A 3PATA 1CFFA 1GM0A 3HCMA 1PALA 1QWVA 3NSOA 2KAVA 4M2OA 2ZNEA 1Z4HA 1PRWA 4MZJA 2TN4A 3A8RA 3OX6A 1JC2A 4D1EA 1CFDA 4MN0A 3TS5B 4CPVA 4F0ZB 2K8MB 2Y4QA 3LL8B 2OTGB 2L5XB 2M9GA 3EKJA 5AXIA 1IQ5A 5I94A 3BFAA 1QLSA 2KI6C 4KYNA 1S5GZ 1WRKA 1Y1AA 2KPHA 2RGIA 1JUOA 4BY4A 1H8BA 2GTEA 2KHNA 2PSRA 4I5NB 1S26D 1DC1A 1D1OA 4PHMA 4MZLA 2WCEA 1SR6C 3NSLA 2LP2A 2KOTA 2BKHB 4WQ2A 4BY5A 3BUOB 1FF1A 1SKTA 1S36A 3I5FB 1SCMC 1FI6A 1SMGA 4C0KA 3KPXA 4AQJA 1HQVA 1IG5A 1OMDA 2HQ8A 2JPOA 3DXLA 2BCXA 2G9BA 1YX7A 2KAXA 2LVIA 3UO9A 1S6IA 2AAOA 1YVLA 1NPQA 2LLUA 3VRPA 4I5KA 5KU1A 2JPTA 4P2YB 1J1EA 1RTP1 3AKAA 1TIZA 4NDDA 2CT9A 3DF0B 3SJSA 2BL0B 3S0GA 1K95A 1YX8A 2MLFC 1B1GA 1SCVA 4DIRA 1NIWA 1NYAA 2PASA 2L2CA 1AVSA 1MXEA 1QXPA 3DYEA 5AEQA 4M2QA 2P71A 1BOCA 1N2DA 1MQ1A 1Y0VH 3I5IB 3I5HC 5ER4X 2MAZA 2MHHA 4ZCUA 3CR4X 3DZTA 1TUJA 4OVNF 4YGDB 2VRGA 1DJHA 2M29A 2QEOA 3D73A 1L7ZA 2WOSA 1KWOB 4AOMA 2LHLA 2JULA 1IGVA 4CFQA 1CTRA 2GGMA 1YURA 2WCHA 2Q4UA 3DF0A 1XYDA 1RECA 3E3RA 3B7AA 2I2RE 3L4LA 4PE7A 1OOFA 2WNDA 2K2AA 4IL1A 2KLDA 3EVVA 2HETA 4INWA 1K2HA 3SG3A 4OZDA 1OZOA 1PVAA 2I7AA 3BJHA 3LK1A 1IKUA 4GPLB 3CLNA 1Y1XA 5CSNA 5FI2A 5DKRA 4OR9B 1ZOTB 4F7FA 1F70A 3WNXB 1TNXA 1XFRA 4I5LB 1T14A 1F4OA 1IJ5A 5F6TA 3EK4A 4FQOA 1QVIZ 2CNPA 3FS7A 1BG1A 1JSAA 2JT8A 3F45A 5FYXA 1B8RA 2Q91A 1J7OA 5J3XA 2CXJA 4R1EA 1RJVA 3B6XA 1NCZA 3JVTC
chains in the Genus database with same CATH topology
1PULA 2LCPA 2WORA 2KFHA 4XYNA 2L4IA 2CCMA 4PHJA 1UHHA 1UHNA 1B7TY 1SW8A 1BU3A 1YUTA 1CDNA 1S6CA 4GUKA 3BUXB 1PVBA 3TDUA 1RK9A 3BOWB 1GGWA 2F2PA 3I5GB 1RFJA 1S1EA 3DVKA 3LK0A 5K89A 1HT9A 2BE6A 1CM4A 2L51A 1JBAA 3TDIA 1K94A 1OE9B 2EC6B 4M2PA 3JTDC 3DVMA 1AUIB 4PE1A 4WRIA 3EVRA 1PK0D 1K93D 2JQ6A 3FWCA 4U8DA 1NCXA 1OZSA 2PMYA 1LKJA 2JT0A 1SPYA 4PHKA 3OX5A 1DTLA 2COLB 2SASA 3RLZA 2JC2A 3BOWA 1SBJA 3DD4A 1U5IB 1YVHA 4MRYA 4UPGA 1DJXA 1CDPA 2KBMA 1QTXA 1KFXL 1NX0A 1C7VA 4PDZA 5TNCA 1DGVA 2K61A 1NCYA 1TNPA 1DT7B 1M39A 5CSIA 5PALA 3CR5X 5HYDA 1IRJA 1KQMC 4FTGA 2LVJA 3KF9A 1ZFSA 3M0WA 1R2UA 1U5IA 2HQWA 2KI4C 2I94A 4MZKA 1J7QA 1LA3A 1KK7Y 1BF5A 1DMOA 4YI9A 1G8IA 1E8AA 1IH0A 2JTZA 2K7DA 1XFYO 4NQGA 1WLMA 1F4QA 5D69A 1NX2A 1KK8B 5G08A 1YTZC 4PE0A 3PN7B 3TUYC 4MBEA 1ZUZA 3SG4A 5HLOA 1WDCC 1AHRA 1AJ5A 3AAKA 1CMFA 3BXKA 3CTNA 1X02A 5I2LA 2M7LA 1B8LA 1XK4C 2JWWA 2L0PA 2L4HA 2LMTA 2JOJA 2ZKMX 2OS8C 4N1GA 1A75B 1B4CA 3ZNIA 1KFUL 3SG7A 4JWQA 1NSHA 4P5OE 1VRKA 2LANA 2E6WA 3OP0A 5AANA 4C0JA 1K96A 3PLFB 4MVFA 3ZWHA 1KQVA 1TCFA 3GOFA 2KYCA 2FOTA 2KNEA 1QV1A 1LXFC 1UUSA 5HKWA 2EHBA 2LNKA 3OHMB 2Y1NA 1W7IB 3EK7A 4N5XA 1NX3A 1NX1A 1GJYA 2LLSA 2SCPA 1J7RA 1GQMA 2H61C 2OPOA 2BCAA 1Y6WA 1A75A 1CLMA 1NWDA 3DVEA 5HLVA 2LHIA 2BKIB 4GBAA 1B9AA 1L2OC 2E30A 2LVKA 1UHJA 1OMVA 1UURA 1YUSA 4GGFC 3DVJA 1ODBA 4GGNA 2PALA 2ISDA 1IJ6A 1C07A 1SR6B 2AMIA 1PSBA 1A4PA 3D0YB 1EG4A 5HKZA 3WXAA 4YGAA 2KI6D 1BJFA 1XVJA 2K7BA 1BMOA 1SCMB 1TCOB 2MRDA 5JJGA 1A03A 1DJIA 1QLKA 4ZCVA 4OV2A 4USLA 5BPJA 3FIAA 1K9PA 1JWDA 4YGBB 3BUNB 2LV7A 4DUQA 3PM8A 3LCPC 2V53A 2ZNDA 2A4JA 2P6BB 1V1FA 1XFXO 2WCFA 3WHTB 3BQ3A 2KYFA 5ER5A 2Y1MA 2M3WA 4HRGA 3VROA 3D0YA 1UHKA 1RROA 3CS1A 1M63B 1XFVO 2M0RA 4MSPA 4QJ3B 1OMRA 1N65A 2M97A 3I5HB 1N0YA 1H4BA 2M1UA 2F3YA 4I5JA 4YGEB 1SRAA 2PRUA 2WCBA 3ICBA 1Y1UA 5CSJA 4OCIA 1KCYA 1YUUA 1EJ3A 3SIBA 2JXLA 2F8PA 2HPSA 3EVUA 4PE4A 3TS5C 1OSAA 1QX5B 1FW4A 2FJUB 1SNLA 2OTGC 3CR2A 4ORAB 1M46A 2MJWB 1QATA 1XFZO 1G33A 1SL8A 2KSPA 2IS9A 1PSRA 1EXRA 2JXCA 3NSKA 1K9KA 4QJ5B 1KSOA 3HX4A 4MLWA 1B7TZ 1JF2A 5I2QA 1UWOA 4ETOA 1IQ3A 3I5FC 2ZN9A 1Q80A 2LUXA 1XO5A 3C1VA 1LA0A 1TRFA 3MSEB 3IQQA 2LAPA 1LINA 1R6PA 2JT3A 2I18A 1CLLA 3BYAA 1IWQA 1S5GY 5I2OA 2JU0A 2KQ6A 1NP8A 2KAYA 1RWYA 3JVTB 2NCOA 2PVBA 3LLEA 3AAJA 3CWGA 2BL0C 1W7JB 1C7WA 2KFGA 4GAOA 1FBVA 1CLBA 5CSFA 2D8NA 2K7OA 2KGBC 2KFFA 4NDCA 4OKHA 2R2IA 3I5IC 2LVVA 4PHNA 2O5GA 3GK4X 3KO0A 1KFUS 2WC8A 3QRXA 1QX2A 2LMUA 2MBXA 1CB1A 1AJ4A 1SK6D 3OB1B 3JTDB 1CFCA 1KWOC 4C0LA 2BCBA 2F2OA 2GGZA 1K9UA 3IF7A 2HF5A 1B47A 2ZRSA 1G4YR 1EG3A 2O60A 1OQPA 3VRNA 1KSMA 1S6JA 1WY9A 4NDBA 1ALWA 4JPZB 4CIDA 1A29A 3NXAA 1JF0A 4A4CA 1YRUB 3VRQA 1BR1B 1EL4A 3NSIA 2BBNA 2KQYA 1SYMA 2LUCA 5HKYA 1BLQA 2LMVA 2LP3A 3TDZA 1QIVA 4JQ0D 1BR4B 2LLTA 1KK7Z 2MA2A 3O78A 5JOLA 1MXLC 4CFRA 2K7CA 1S3PA 2NCPA 4E68A 3K21A 1B8CA 2BECA 3A4UB 4YGCB 2BBMA 1QV0A 2QACA 5IBWA 4A4BA 1YRTB 3EKHA 4GNKB 4HREE 4XJKB 1FPWA 1F54A 4ICBA 3KEVA 1KQMB 2B1UA 3KHEA 5AFPA 4HSZA 3PALA 1BODA 1WRLA 1QIWA 1TN4A 4N1FA 1F71A 3FWBA 4L9MA 2CBLA 1CNPA 1LVCD 3AKBA 4MRXA 5GQQC 2KI4B 4TNCA 3OB2B 5D7FA 3IQOA 2NZ0A 1XA5A 1MUXA 1DGUA 3SG5A 2F33A 1BT6A 2Y5IA 2L2EA 5KTYA 3I5GC 1JFKA 2M8UA 1QVIY 4AQIA 2JRFA 2EGDA 3TUYB 4XJKA 2F3ZA 2FCEA 3SG2A 2ZFDA 1QJTA 2EC6C 2MLEC 1WDCB 2NLNA 2G2BA 1TNWA 1J7PA 3VRRA 2NXQA 1DF0B 1WLZA 1WRZA 1ZMZA 1V1GA 3RM1A 2DOQA 1F8HA 1CM1A 4DCKA 1A2XA 2OS8B 1JFJA 3WHUB 2LC5A 2JNXA 2M7NA 4WQ3A 5B8IB 1CFPA 1M31A 2KDHA 1CMGA 3BUMB 1DJWA 1SL9A 3PFVA 5AERA 4ORBB 5DKNA 1SY9A 2L50A 1XFUO 1TOPA 1F55A 4YBHB 4YRUA 2K0JA 1DF0A 3CGAA 2ZN8A 1XK4A 1QX7A 1OOJA 3D10A 1J1DA 1DJZA 4GFTA 1UHIA 1MWNA 1L2OB 5CPVA 2BE4A 3CZTX 4CLNA 2M1KB 1FI5A 3GK1A 1CDMA 1KFXS 1NUBA 2LE9B 3TZ1A 1MR8A 2FCDA 1K90D 4HRHA 3SIAA 1XFWO 2H2KA 1EH2A 5KSZA 4PCWA 2GV5A 1QS7A 1ALVA 1KK8C 3SG6A 1TNQA 2KGRA 3PN7C 2H61A 4ORCB 2ZRTA 1SL7A 1K8UA 1CKKA 3H4SE 1UP5A 1AP4A 2QPTA 1GGZA 1YR5A 1CDLA 2JTTA 3EK8A 4PALA 3O2PA 1M45A 2AUCA 5DKQA 2K2FA 3PSRA 1DVIA 1DJYA 4DS7A 2CTNA 5I8NA 4GGFA 4QJ4B 3VGOA 3O4YA 1MF8B 2KBIA 4MEWA 1DJGA 3GK2A 1J55A 4YI8A 3BUWB 3O6BA 1ZACA 4Q04A 2JNFA 1TTXA 1QASA 2LM5A 2L98A 2M49B 4DRWA 1MHOA 1AK8A 2JZIA 3PATA 1CFFA 3HCMA 1PALA 3NSOA 2KAVA 4M2OA 2ZNEA 1PRWA 4MZJA 2TN4A 3A8RA 3OX6A 1JC2A 4D1EA 1CFDA 4MN0A 3TS5B 4CPVA 4F0ZB 2K8MB 2Y4QA 3LL8B 2OTGB 2L5XB 2M9GA 3EKJA 5AXIA 1IQ5A 1QLSA 2KI6C 1S5GZ 1WRKA 1Y1AA 2RGIA 1JUOA 4BY4A 1H8BA 2KHNA 4I5NB 2PSRA 1S26D 1D1OA 4PHMA 4MZLA 2WCEA 1SR6C 3NSLA 2LP2A 2KOTA 2BKHB 4WQ2A 4BY5A 3BUOB 1FF1A 1SKTA 1S36A 3I5FB 1SCMC 1FI6A 1SMGA 4C0KA 3KPXA 4AQJA 1HQVA 1IG5A 1OMDA 2HQ8A 2BCXA 2G9BA 1YX7A 2KAXA 2LVIA 1S6IA 2AAOA 1YVLA 1NPQA 2LLUA 3VRPA 4I5KA 5KU1A 2JPTA 4P2YB 1J1EA 1RTP1 3AKAA 1TIZA 4NDDA 2CT9A 3DF0B 3SJSA 2BL0B 1K95A 1YX8A 2MLFC 1B1GA 1SCVA 4DIRA 1NIWA 1NYAA 2PASA 1AVSA 1MXEA 1QXPA 5AEQA 4M2QA 1BOCA 1N2DA 1MQ1A 1Y0VH 3I5IB 3I5HC 5ER4X 2MAZA 2MHHA 4ZCUA 3CR4X 4OVNF 4YGDB 2VRGA 1DJHA 2M29A 1L7ZA 2WOSA 1KWOB 4AOMA 2LHLA 2JULA 1IGVA 4CFQA 1CTRA 2GGMA 1YURA 2Q4UA 3DF0A 1XYDA 1RECA 3E3RA 4PE7A 2I2RE 2WNDA 2K2AA 4IL1A 3EVVA 2HETA 1K2HA 3SG3A 1OZOA 1PVAA 2I7AA 1IKUA 3LK1A 4GPLB 3CLNA 1Y1XA 5CSNA 5DKRA 4OR9B 1ZOTB 1F70A 3WNXB 1TNXA 4I5LB 1F4OA 1IJ5A 5F6TA 3EK4A 4FQOA 1QVIZ 2CNPA 3FS7A 1BG1A 1JSAA 2JT8A 3F45A 5FYXA 1B8RA 2Q91A 1J7OA 5J3XA 2CXJA 4R1EA 1RJVA 1NCZA 3JVTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUL A;  2LCP A;  2WOR A;  2KFH A;  4XYN A;  2L4I A;  2CCM A;  4PHJ A;  1UHH A;  1UHN A;  1B7T Y;  1SW8 A;  1BU3 A;  1YUT A;  1CDN A;  1S6C A;  4GUK A;  3BUX B;  1PVB A;  3TDU A;  1RK9 A;  3BOW B;  1GGW A;  2F2P A;  3I5G B;  1RFJ A;  1S1E A;  3DVK A;  3LK0 A;  5K89 A;  1HT9 A;  2BE6 A;  1CM4 A;  2L51 A;  1JBA A;  3TDI A;  1K94 A;  1OE9 B;  2EC6 B;  4M2P A;  3JTD C;  3DVM A;  1AUI B;  4PE1 A;  4WRI A;  3EVR A;  1PK0 D;  1K93 D;  2JQ6 A;  3FWC A;  4U8D A;  1NCX A;  1OZS A;  2PMY A;  1LKJ A;  2JT0 A;  1SPY A;  4PHK A;  3OX5 A;  1DTL A;  2COL B;  2SAS A;  3RLZ A;  2JC2 A;  3BOW A;  1SBJ A;  3DD4 A;  1U5I B;  1YVH A;  4MRY A;  4UPG A;  1DJX A;  1CDP A;  2KBM A;  1QTX A;  1KFX L;  1NX0 A;  1C7V A;  4PDZ A;  5TNC A;  1DGV A;  2K61 A;  1NCY A;  1TNP A;  1DT7 B;  1M39 A;  5CSI A;  5PAL A;  3CR5 X;  5HYD A;  1IRJ A;  1KQM C;  4FTG A;  2LVJ A;  3KF9 A;  1ZFS A;  3M0W A;  1R2U A;  1U5I A;  2HQW A;  2KI4 C;  2I94 A;  4MZK A;  1J7Q A;  1LA3 A;  1KK7 Y;  1BF5 A;  1DMO A;  4YI9 A;  1G8I A;  1E8A A;  1IH0 A;  2JTZ A;  2K7D A;  1XFY O;  4NQG A;  1WLM A;  1F4Q A;  5D69 A;  1NX2 A;  1KK8 B;  5G08 A;  1YTZ C;  4PE0 A;  3PN7 B;  3TUY C;  4MBE A;  1ZUZ A;  3SG4 A;  5HLO A;  1WDC C;  1AHR A;  1AJ5 A;  3AAK A;  1CMF A;  3BXK A;  3CTN A;  1X02 A;  5I2L A;  2M7L A;  1B8L A;  1XK4 C;  2JWW A;  2L0P A;  2L4H A;  2LMT A;  2JOJ A;  2ZKM X;  2OS8 C;  4N1G A;  1A75 B;  1B4C A;  3ZNI A;  1KFU L;  3SG7 A;  4JWQ A;  1NSH A;  4P5O E;  1VRK A;  2LAN A;  2E6W A;  3OP0 A;  5AAN A;  4C0J A;  1K96 A;  3PLF B;  4MVF A;  3ZWH A;  1KQV A;  1TCF A;  3GOF A;  2KYC A;  2FOT A;  2KNE A;  1QV1 A;  1LXF C;  1UUS A;  5HKW A;  2EHB A;  2LNK A;  3OHM B;  2Y1N A;  1W7I B;  3EK7 A;  4N5X A;  1NX3 A;  1NX1 A;  1GJY A;  2LLS A;  2SCP A;  1J7R A;  1GQM A;  2H61 C;  2OPO A;  2BCA A;  1Y6W A;  1A75 A;  1CLM A;  1NWD A;  3DVE A;  5HLV A;  2LHI A;  2BKI B;  4GBA A;  1B9A A;  1L2O C;  2E30 A;  2LVK A;  1UHJ A;  1OMV A;  1UUR A;  1YUS A;  4GGF C;  3DVJ A;  1ODB A;  4GGN A;  2PAL A;  2ISD A;  1IJ6 A;  1C07 A;  1SR6 B;  2AMI A;  1PSB A;  1A4P A;  3D0Y B;  1EG4 A;  5HKZ A;  3WXA A;  4YGA A;  2KI6 D;  1BJF A;  1XVJ A;  2K7B A;  1BMO A;  1SCM B;  1TCO B;  2MRD A;  5JJG A;  1A03 A;  1DJI A;  1QLK A;  4ZCV A;  4OV2 A;  4USL A;  5BPJ A;  3FIA A;  1K9P A;  1JWD A;  4YGB B;  3BUN B;  2LV7 A;  4DUQ A;  3PM8 A;  3LCP C;  2V53 A;  2ZND A;  2A4J A;  2P6B B;  1V1F A;  1XFX O;  2WCF A;  3WHT B;  3BQ3 A;  2KYF A;  5ER5 A;  2Y1M A;  2M3W A;  4HRG A;  3VRO A;  3D0Y A;  1UHK A;  1RRO A;  3CS1 A;  1M63 B;  1XFV O;  2M0R A;  4MSP A;  4QJ3 B;  1OMR A;  1N65 A;  2M97 A;  3I5H B;  1N0Y A;  1H4B A;  2M1U A;  2F3Y A;  4I5J A;  4YGE B;  1SRA A;  2PRU A;  2WCB A;  3ICB A;  1Y1U A;  5CSJ A;  4OCI A;  1KCY A;  1YUU A;  1EJ3 A;  3SIB A;  2JXL A;  2F8P A;  2HPS A;  3EVU A;  4PE4 A;  3TS5 C;  1OSA A;  1QX5 B;  1FW4 A;  2FJU B;  1SNL A;  2OTG C;  3CR2 A;  4ORA B;  1M46 A;  2MJW B;  1QAT A;  1XFZ O;  1G33 A;  1SL8 A;  2KSP A;  2IS9 A;  1PSR A;  1EXR A;  2JXC A;  3NSK A;  1K9K A;  4QJ5 B;  1KSO A;  3HX4 A;  4MLW A;  1B7T Z;  1JF2 A;  5I2Q A;  1UWO A;  4ETO A;  1IQ3 A;  3I5F C;  2ZN9 A;  1Q80 A;  2LUX A;  1XO5 A;  3C1V A;  1LA0 A;  1TRF A;  3MSE B;  3IQQ A;  2LAP A;  1LIN A;  1R6P A;  2JT3 A;  2I18 A;  1CLL A;  3BYA A;  1IWQ A;  1S5G Y;  5I2O A;  2JU0 A;  2KQ6 A;  1NP8 A;  2KAY A;  1RWY A;  3JVT B;  2NCO A;  2PVB A;  3LLE A;  3AAJ A;  3CWG A;  2BL0 C;  1W7J B;  1C7W A;  2KFG A;  4GAO A;  1FBV A;  1CLB A;  5CSF A;  2D8N A;  2K7O A;  2KGB C;  2KFF A;  4NDC A;  4OKH A;  2R2I A;  3I5I C;  2LVV A;  4PHN A;  2O5G A;  3GK4 X;  3KO0 A;  1KFU S;  2WC8 A;  3QRX A;  1QX2 A;  2LMU A;  2MBX A;  1CB1 A;  1AJ4 A;  1SK6 D;  3OB1 B;  3JTD B;  1CFC A;  1KWO C;  4C0L A;  2BCB A;  2F2O A;  2GGZ A;  1K9U A;  3IF7 A;  2HF5 A;  1B47 A;  2ZRS A;  1G4Y R;  1EG3 A;  2O60 A;  1OQP A;  3VRN A;  1KSM A;  1S6J A;  1WY9 A;  4NDB A;  1ALW A;  4JPZ B;  4CID A;  1A29 A;  3NXA A;  1JF0 A;  4A4C A;  1YRU B;  3VRQ A;  1BR1 B;  1EL4 A;  3NSI A;  2BBN A;  2KQY A;  1SYM A;  2LUC A;  5HKY A;  1BLQ A;  2LMV A;  2LP3 A;  3TDZ A;  1QIV A;  4JQ0 D;  1BR4 B;  2LLT A;  1KK7 Z;  2MA2 A;  3O78 A;  5JOL A;  1MXL C;  4CFR A;  2K7C A;  1S3P A;  2NCP A;  4E68 A;  3K21 A;  1B8C A;  2BEC A;  3A4U B;  4YGC B;  2BBM A;  1QV0 A;  2QAC A;  5IBW A;  4A4B A;  1YRT B;  3EKH A;  4GNK B;  4HRE E;  4XJK B;  1FPW A;  1F54 A;  4ICB A;  3KEV A;  1KQM B;  2B1U A;  3KHE A;  5AFP A;  4HSZ A;  3PAL A;  1BOD A;  1WRL A;  1QIW A;  1TN4 A;  4N1F A;  1F71 A;  3FWB A;  4L9M A;  2CBL A;  1CNP A;  1LVC D;  3AKB A;  4MRX A;  5GQQ C;  2KI4 B;  4TNC A;  3OB2 B;  5D7F A;  3IQO A;  2NZ0 A;  1XA5 A;  1MUX A;  1DGU A;  3SG5 A;  2F33 A;  1BT6 A;  2Y5I A;  2L2E A;  5KTY A;  3I5G C;  1JFK A;  2M8U A;  1QVI Y;  4AQI A;  2JRF A;  2EGD A;  3TUY B;  4XJK A;  2F3Z A;  2FCE A;  3SG2 A;  2ZFD A;  1QJT A;  2EC6 C;  2MLE C;  1WDC B;  2NLN A;  2G2B A;  1TNW A;  1J7P A;  3VRR A;  2NXQ A;  1DF0 B;  1WLZ A;  1WRZ A;  1ZMZ A;  1V1G A;  3RM1 A;  2DOQ A;  1F8H A;  1CM1 A;  4DCK A;  1A2X A;  2OS8 B;  1JFJ A;  3WHU B;  2LC5 A;  2JNX A;  2M7N A;  4WQ3 A;  5B8I B;  1CFP A;  1M31 A;  2KDH A;  1CMG A;  3BUM B;  1DJW A;  1SL9 A;  3PFV A;  5AER A;  4ORB B;  5DKN A;  1SY9 A;  2L50 A;  1XFU O;  1TOP A;  1F55 A;  4YBH B;  4YRU A;  2K0J A;  1DF0 A;  3CGA A;  2ZN8 A;  1XK4 A;  1QX7 A;  1OOJ A;  3D10 A;  1J1D A;  1DJZ A;  4GFT A;  1UHI A;  1MWN A;  1L2O B;  5CPV A;  2BE4 A;  3CZT X;  4CLN A;  2M1K B;  1FI5 A;  3GK1 A;  1CDM A;  1KFX S;  1NUB A;  2LE9 B;  3TZ1 A;  1MR8 A;  2FCD A;  1K90 D;  4HRH A;  3SIA A;  1XFW O;  2H2K A;  1EH2 A;  5KSZ A;  4PCW A;  2GV5 A;  1QS7 A;  1ALV A;  1KK8 C;  3SG6 A;  1TNQ A;  2KGR A;  3PN7 C;  2H61 A;  4ORC B;  2ZRT A;  1SL7 A;  1K8U A;  1CKK A;  3H4S E;  1UP5 A;  1AP4 A;  2QPT A;  1GGZ A;  1YR5 A;  1CDL A;  2JTT A;  3EK8 A;  4PAL A;  3O2P A;  1M45 A;  2AUC A;  5DKQ A;  2K2F A;  3PSR A;  1DVI A;  1DJY A;  4DS7 A;  2CTN A;  5I8N A;  4GGF A;  4QJ4 B;  3VGO A;  3O4Y A;  1MF8 B;  2KBI A;  4MEW A;  1DJG A;  3GK2 A;  1J55 A;  4YI8 A;  3BUW B;  3O6B A;  1ZAC A;  4Q04 A;  2JNF A;  1TTX A;  1QAS A;  2LM5 A;  2L98 A;  2M49 B;  4DRW A;  1MHO A;  1AK8 A;  2JZI A;  3PAT A;  1CFF A;  3HCM A;  1PAL A;  3NSO A;  2KAV A;  4M2O A;  2ZNE A;  1PRW A;  4MZJ A;  2TN4 A;  3A8R A;  3OX6 A;  1JC2 A;  4D1E A;  1CFD A;  4MN0 A;  3TS5 B;  4CPV A;  4F0Z B;  2K8M B;  2Y4Q A;  3LL8 B;  2OTG B;  2L5X B;  2M9G A;  3EKJ A;  5AXI A;  1IQ5 A;  1QLS A;  2KI6 C;  1S5G Z;  1WRK A;  1Y1A A;  2RGI A;  1JUO A;  4BY4 A;  1H8B A;  2KHN A;  4I5N B;  2PSR A;  1S26 D;  1D1O A;  4PHM A;  4MZL A;  2WCE A;  1SR6 C;  3NSL A;  2LP2 A;  2KOT A;  2BKH B;  4WQ2 A;  4BY5 A;  3BUO B;  1FF1 A;  1SKT A;  1S36 A;  3I5F B;  1SCM C;  1FI6 A;  1SMG A;  4C0K A;  3KPX A;  4AQJ A;  1HQV A;  1IG5 A;  1OMD A;  2HQ8 A;  2BCX A;  2G9B A;  1YX7 A;  2KAX A;  2LVI A;  1S6I A;  2AAO A;  1YVL A;  1NPQ A;  2LLU A;  3VRP A;  4I5K A;  5KU1 A;  2JPT A;  4P2Y B;  1J1E A;  1RTP 1;  3AKA A;  1TIZ A;  4NDD A;  2CT9 A;  3DF0 B;  3SJS A;  2BL0 B;  1K95 A;  1YX8 A;  2MLF C;  1B1G A;  1SCV A;  4DIR A;  1NIW A;  1NYA A;  2PAS A;  1AVS A;  1MXE A;  1QXP A;  5AEQ A;  4M2Q A;  1BOC A;  1N2D A;  1MQ1 A;  1Y0V H;  3I5I B;  3I5H C;  5ER4 X;  2MAZ A;  2MHH A;  4ZCU A;  3CR4 X;  4OVN F;  4YGD B;  2VRG A;  1DJH A;  2M29 A;  1L7Z A;  2WOS A;  1KWO B;  4AOM A;  2LHL A;  2JUL A;  1IGV A;  4CFQ A;  1CTR A;  2GGM A;  1YUR A;  2Q4U A;  3DF0 A;  1XYD A;  1REC A;  3E3R A;  4PE7 A;  2I2R E;  2WND A;  2K2A A;  4IL1 A;  3EVV A;  2HET A;  1K2H A;  3SG3 A;  1OZO A;  1PVA A;  2I7A A;  1IKU A;  3LK1 A;  4GPL B;  3CLN A;  1Y1X A;  5CSN A;  5DKR A;  4OR9 B;  1ZOT B;  1F70 A;  3WNX B;  1TNX A;  4I5L B;  1F4O A;  1IJ5 A;  5F6T A;  3EK4 A;  4FQO A;  1QVI Z;  2CNP A;  3FS7 A;  1BG1 A;  1JSA A;  2JT8 A;  3F45 A;  5FYX A;  1B8R A;  2Q91 A;  1J7O A;  5J3X A;  2CXJ A;  4R1E A;  1RJV A;  1NCZ A;  3JVT C; 
#chains in the Genus database with same CATH topology
 1PUL A;  2LCP A;  2WOR A;  2KFH A;  4XYN A;  2L4I A;  2CCM A;  4PHJ A;  1UHH A;  1UHN A;  1B7T Y;  1SW8 A;  1BU3 A;  1YUT A;  3R1V A;  1CDN A;  1S6C A;  4GUK A;  3BUX B;  1PVB A;  3TDU A;  1IIO A;  1RK9 A;  3BOW B;  1GGW A;  2F2P A;  3I5G B;  1RFJ A;  1S1E A;  2KLE A;  3DVK A;  3LK0 A;  5K89 A;  1HT9 A;  2BE6 A;  3CZ1 A;  1CM4 A;  2L51 A;  1JBA A;  3NHT A;  1K94 A;  3TDI A;  1OE9 B;  2EC6 B;  4M2P A;  3JTD C;  3DVM A;  1AUI B;  4PE1 A;  4WRI A;  3EVR A;  1PK0 D;  1SSE B;  1K93 D;  2JQ6 A;  3FWC A;  4U8D A;  1NCX A;  1OZS A;  2PMY A;  1LKJ A;  2JT0 A;  2FJY A;  1SPY A;  4PHK A;  3D74 A;  3OX5 A;  1DTL A;  2COL B;  2SAS A;  3RLZ A;  2JC2 A;  3BOW A;  1SBJ A;  3DD4 A;  2YGU A;  1U5I B;  1YVH A;  4MRY A;  4UPG A;  1DJX A;  1CDP A;  2KBM A;  2QEH A;  1QTX A;  1KFX L;  1NX0 A;  1C7V A;  4PDZ A;  1OOG A;  5TNC A;  1DGV A;  2K61 A;  1NCY A;  1TNP A;  1DT7 B;  1M39 A;  5CSI A;  5PAL A;  3CR5 X;  5HYD A;  1IRJ A;  1KQM C;  4FTG A;  2LVJ A;  3KF9 A;  1ZFS A;  5EL2 A;  3M0W A;  1R2U A;  1U5I A;  2HQW A;  2KI4 C;  2I94 A;  3B87 A;  4MZK A;  1J7Q A;  1LA3 A;  1KK7 Y;  1BF5 A;  1DMO A;  4YI9 A;  1G8I A;  2WC6 A;  1E8A A;  1IH0 A;  1Z2C B;  2JTZ A;  1XFY O;  2K7D A;  4NQG A;  1WLM A;  1F4Q A;  5D69 A;  1NX2 A;  1KK8 B;  5G08 A;  1YTZ C;  4PE0 A;  3PN7 B;  3TUY C;  4MBE A;  1ZUZ A;  3PJI A;  3SG4 A;  5HLO A;  1WDC C;  1AHR A;  1AJ5 A;  3AAK A;  1CMF A;  3BXK A;  3CTN A;  1X02 A;  5I2L A;  2M7L A;  1B8L A;  1XK4 C;  2JWW A;  2L0P A;  2L4H A;  2LMT A;  2JOJ A;  2ZKM X;  2OS8 C;  4N1G A;  1A75 B;  1B4C A;  3ZNI A;  1KFU L;  3SG7 A;  4JWQ A;  1NSH A;  4P5O E;  1VRK A;  2LAN A;  2E6W A;  2PYQ A;  3FE8 A;  3OP0 A;  5AAN A;  1K96 A;  3FE9 A;  4C0J A;  3PLF B;  4MVF A;  3ZWH A;  3SS4 A;  1KQV A;  1TCF A;  3GOF A;  3R1O A;  2KYC A;  2FOT A;  2KNE A;  1QV1 A;  1LXF C;  1UUS A;  5HKW A;  3RZS A;  2EHB A;  2LNK A;  3OHM B;  3EG5 B;  2Y1N A;  1W7I B;  3EK7 A;  4N5X A;  1NX3 A;  1NX1 A;  1GJY A;  2LLS A;  2SCP A;  1J7R A;  1GQM A;  2H61 C;  2OPO A;  2BCA A;  3BFH A;  1Y6W A;  1A75 A;  1CLM A;  1NWD A;  3DVE A;  5HLV A;  2LHI A;  2BKI B;  4GBA A;  1B9A A;  1L2O C;  3L4A A;  2E30 A;  2LVK A;  1P28 A;  1LS8 A;  1UHJ A;  1OOI X;  1OMV A;  1UUR A;  1YUS A;  4GGF C;  3DVJ A;  1ODB A;  4GGN A;  2PAL A;  2ISD A;  1IJ6 A;  1C07 A;  1SR6 B;  2AMI A;  1PSB A;  1A4P A;  3D0Y B;  1EG4 A;  3FE6 A;  5HKZ A;  3WXA A;  1DEK A;  4YGA A;  2KI6 D;  1BJF A;  1XVJ A;  2K7B A;  3IVT A;  1BMO A;  1SCM B;  1TCO B;  2MRD A;  5JJG A;  1A03 A;  1DJI A;  1QLK A;  4ZCV A;  3D75 A;  4OV2 A;  4USL A;  5BPJ A;  3FIA A;  3VB1 A;  5FI7 A;  1K9P A;  1JWD A;  4YGB B;  3BUN B;  2LV7 A;  4DUQ A;  3PM8 A;  1C3Y A;  3DY9 A;  3LCP C;  2V53 A;  2ZND A;  2A4J A;  2P6B B;  1V1F A;  1XFX O;  2WCF A;  1ORG A;  3BQ3 A;  3WHT B;  2KYF A;  5ER5 A;  2Y1M A;  2M3W A;  4HRG A;  3VRO A;  3D0Y A;  1UHK A;  1RRO A;  3CS1 A;  1M63 B;  1XFV O;  2M0R A;  3S0A A;  4MSP A;  3BFB A;  3CYZ A;  4QJ3 B;  1OMR A;  1N65 A;  2M97 A;  3I5H B;  5FI6 A;  1N0Y A;  1H4B A;  2M1U A;  2F3Y A;  4I5J A;  4YGE B;  1SRA A;  2PRU A;  2WCB A;  3ICB A;  1Y1U A;  5CSJ A;  2WCK A;  4OCI A;  1YUU A;  1EJ3 A;  3SIB A;  1KCY A;  2JXL A;  2F8P A;  2HPS A;  3EVU A;  4PE4 A;  3TS5 C;  1OSA A;  1QX5 B;  2P70 A;  1FW4 A;  2FJU B;  1SNL A;  2OTG C;  3CR2 A;  4ORA B;  1M46 A;  2MJW B;  1QAT A;  1XFZ O;  1G33 A;  1SL8 A;  2KSP A;  2IS9 A;  3S0F A;  1PSR A;  1EXR A;  2JXC A;  3NSK A;  1K9K A;  4QJ5 B;  1KSO A;  3HX4 A;  4MLW A;  1B7T Z;  1JF2 A;  3R1P A;  1UWO A;  4ETO A;  5I2Q A;  1IQ3 A;  3I5F C;  2ZN9 A;  1Q80 A;  2LUX A;  1XO5 A;  3C1V A;  1LA0 A;  1TRF A;  3MSE B;  3K1E A;  3IQQ A;  3L47 A;  2LAP A;  1LIN A;  1R6P A;  2JT3 A;  2I18 A;  1CLL A;  3BYA A;  1IWQ A;  1S5G Y;  5I2O A;  2JU0 A;  2KQ6 A;  2K60 A;  1NP8 A;  2KAY A;  1RWY A;  3JVT B;  2NCO A;  2PVB A;  3CDN A;  3AAJ A;  3LLE A;  3CWG A;  4IJ7 A;  2BL0 C;  1W7J B;  1C7W A;  2KFG A;  4GAO A;  1FBV A;  5D3O A;  1CLB A;  5CSF A;  2D8N A;  2K7O A;  2KGB C;  2KFF A;  2WCM A;  4NDC A;  4OKH A;  2R2I A;  3I5I C;  2LVV A;  4PHN A;  1OOH A;  2O5G A;  3GK4 X;  3KO0 A;  1KFU S;  2WC8 A;  3QRX A;  1QX2 A;  2LMU A;  2MBX A;  1CB1 A;  1AJ4 A;  1SK6 D;  3OB1 B;  3JTD B;  3S0E A;  1KWO C;  1CFC A;  4C0L A;  2BCB A;  2F2O A;  2GGZ A;  1K9U A;  3IF7 A;  2HF5 A;  1B47 A;  2ZRS A;  1G4Y R;  1EG3 A;  2O60 A;  1OQP A;  3D76 A;  1KSM A;  1S6J A;  1WY9 A;  4NDB A;  1ALW A;  4JPZ B;  3VRN A;  4CID A;  1A29 A;  3NXA A;  1JF0 A;  3D77 A;  4A4C A;  1YRU B;  3VRQ A;  1BR1 B;  1EL4 A;  3NSI A;  2BBN A;  2KQY A;  1SYM A;  2LUC A;  5HKY A;  1BLQ A;  2LMV A;  2LP3 A;  3CAB A;  3SS3 A;  3TDZ A;  1QIV A;  4JQ0 D;  1BR4 B;  2WCL A;  3NGV A;  2LLT A;  1KK7 Z;  2MA2 A;  2PQL A;  2QDI A;  3O78 A;  5JOL A;  1MXL C;  4CFR A;  2K7C A;  1S3P A;  2NCP A;  2WC5 A;  4E68 A;  3K21 A;  1B8C A;  2BEC A;  3A4U B;  4YGC B;  2BBM A;  1QV0 A;  1TUZ A;  3R72 A;  2QAC A;  5IBW A;  1OW4 A;  1DQE A;  4A4B A;  1YRT B;  3EKH A;  4GNK B;  4HRE E;  4XJK B;  1FPW A;  1F54 A;  4ICB A;  3KEV A;  1KQM B;  2B1U A;  3KHE A;  5AFP A;  4HSZ A;  3PAL A;  1BOD A;  1WRL A;  1QIW A;  1TN4 A;  4N1F A;  1F71 A;  3FWB A;  4L9M A;  2CBL A;  4FQT A;  1CNP A;  1LVC D;  3AKB A;  4MRX A;  5GQQ C;  2KI4 B;  4TNC A;  3OB2 B;  4JD9 A;  5D7F A;  3IQO A;  2NZ0 A;  1XA5 A;  1MUX A;  1DGU A;  3SG5 A;  2ERB A;  2F33 A;  1BT6 A;  2Y5I A;  2L2E A;  5KTY A;  3I5G C;  1JFK A;  2M8U A;  5HL1 A;  1QVI Y;  4AQI A;  2JRF A;  2EGD A;  3O4X A;  2QEV A;  3TUY B;  4XJK A;  2F3Z A;  2FCE A;  3SG2 A;  4PT1 A;  2ZFD A;  1QJT A;  2EC6 C;  2WCJ A;  2MLE C;  1WDC B;  2NLN A;  2G2B A;  1TNW A;  1J7P A;  3VRR A;  2NXQ A;  1DF0 B;  1WLZ A;  1WRZ A;  1ZMZ A;  1V1G A;  2L5Y A;  3RM1 A;  2DOQ A;  5DIC A;  1F8H A;  1CM1 A;  4DCK A;  1A2X A;  3S0D A;  2OS8 B;  1JFJ A;  3WHU B;  2LC5 A;  2JNX A;  2M7N A;  3OGN A;  4WQ3 A;  3NHI A;  5B8I B;  1M31 A;  1CFP A;  2KDH A;  1CMG A;  3BUM B;  1DJW A;  1C3Z A;  1SL9 A;  3PFV A;  5AER A;  4ORB B;  5DKN A;  3SS5 A;  1SY9 A;  2L50 A;  1XFU O;  1TOP A;  3D78 A;  1F55 A;  3B86 A;  4YBH B;  3B88 A;  4YRU A;  2K0J A;  1DF0 A;  3CGA A;  2ZN8 A;  1XK4 A;  3PM2 A;  1QX7 A;  1OOJ A;  3D10 A;  1W9Z A;  1J1D A;  2BNX A;  3QME A;  1DJZ A;  4GFT A;  1UHI A;  4JKT A;  1MWN A;  1L2O B;  5CPV A;  3UNW A;  2BE4 A;  3CZT X;  4CLN A;  2M1K B;  1FI5 A;  3GK1 A;  4INX A;  1CDM A;  1KFX S;  1NUB A;  2LE9 B;  3TZ1 A;  1MR8 A;  2FCD A;  1K90 D;  4HRH A;  3SIA A;  1XFW O;  2H2K A;  1DEL A;  1EH2 A;  5KSZ A;  4PCW A;  2GV5 A;  2BAP A;  1QS7 A;  3OBV A;  1ALV A;  1KK8 C;  3SG6 A;  1TNQ A;  2KGR A;  3PN7 C;  2H61 A;  4ORC B;  2ZRT A;  1SL7 A;  1K8U A;  3V2L A;  3H4S E;  1CKK A;  1UP5 A;  1AP4 A;  2QPT A;  2H8V A;  3S0B A;  1GGZ A;  1YR5 A;  1CDL A;  2JTT A;  3EK8 A;  4PAL A;  1TWO A;  3CZ0 A;  3O2P A;  1M45 A;  2AUC A;  5DKQ A;  2K2F A;  3PSR A;  1DVI A;  3N7H A;  1DJY A;  3CZ2 A;  4DS7 A;  2CTN A;  5I8N A;  4GGF A;  4QJ4 B;  3VGO A;  3O4Y A;  1MF8 B;  2KBI A;  4MEW A;  1DJG A;  3GK2 A;  1J55 A;  4YI8 A;  3BUW B;  3O6B A;  1ZAC A;  3Q8I A;  4Q04 A;  2JNF A;  1TTX A;  1QAS A;  2LM5 A;  2L98 A;  2M49 B;  2QEB A;  1MHO A;  4DRW A;  2JZI A;  1AK8 A;  3PAT A;  1CFF A;  1GM0 A;  3HCM A;  1PAL A;  1QWV A;  3NSO A;  2KAV A;  4M2O A;  2ZNE A;  1Z4H A;  1PRW A;  4MZJ A;  2TN4 A;  3A8R A;  3OX6 A;  1JC2 A;  4D1E A;  1CFD A;  4MN0 A;  3TS5 B;  4CPV A;  4F0Z B;  2K8M B;  2Y4Q A;  3LL8 B;  2OTG B;  2L5X B;  2M9G A;  3EKJ A;  5AXI A;  1IQ5 A;  5I94 A;  3BFA A;  1QLS A;  2KI6 C;  4KYN A;  1S5G Z;  1WRK A;  1Y1A A;  2KPH A;  2RGI A;  1JUO A;  4BY4 A;  1H8B A;  2GTE A;  2KHN A;  2PSR A;  4I5N B;  1S26 D;  1DC1 A;  1D1O A;  4PHM A;  4MZL A;  2WCE A;  1SR6 C;  3NSL A;  2LP2 A;  2KOT A;  2BKH B;  4WQ2 A;  4BY5 A;  3BUO B;  1FF1 A;  1SKT A;  1S36 A;  3I5F B;  1SCM C;  1FI6 A;  1SMG A;  4C0K A;  3KPX A;  4AQJ A;  1HQV A;  1IG5 A;  1OMD A;  2HQ8 A;  2JPO A;  3DXL A;  2BCX A;  2G9B A;  1YX7 A;  2KAX A;  2LVI A;  3UO9 A;  1S6I A;  2AAO A;  1YVL A;  1NPQ A;  2LLU A;  3VRP A;  4I5K A;  5KU1 A;  2JPT A;  4P2Y B;  1J1E A;  1RTP 1;  3AKA A;  1TIZ A;  4NDD A;  2CT9 A;  3DF0 B;  3SJS A;  2BL0 B;  3S0G A;  1K95 A;  1YX8 A;  2MLF C;  1B1G A;  1SCV A;  4DIR A;  1NIW A;  1NYA A;  2PAS A;  2L2C A;  1AVS A;  1MXE A;  1QXP A;  3DYE A;  5AEQ A;  4M2Q A;  2P71 A;  1BOC A;  1N2D A;  1MQ1 A;  1Y0V H;  3I5I B;  3I5H C;  5ER4 X;  2MAZ A;  2MHH A;  4ZCU A;  3CR4 X;  3DZT A;  1TUJ A;  4OVN F;  4YGD B;  2VRG A;  1DJH A;  2M29 A;  2QEO A;  3D73 A;  1L7Z A;  2WOS A;  1KWO B;  4AOM A;  2LHL A;  2JUL A;  1IGV A;  4CFQ A;  1CTR A;  2GGM A;  1YUR A;  2WCH A;  2Q4U A;  3DF0 A;  1XYD A;  1REC A;  3E3R A;  3B7A A;  2I2R E;  3L4L A;  4PE7 A;  1OOF A;  2WND A;  2K2A A;  4IL1 A;  2KLD A;  3EVV A;  2HET A;  4INW A;  1K2H A;  3SG3 A;  4OZD A;  1OZO A;  1PVA A;  2I7A A;  3BJH A;  3LK1 A;  1IKU A;  4GPL B;  3CLN A;  1Y1X A;  5CSN A;  5FI2 A;  5DKR A;  4OR9 B;  1ZOT B;  4F7F A;  1F70 A;  3WNX B;  1TNX A;  1XFR A;  4I5L B;  1T14 A;  1F4O A;  1IJ5 A;  5F6T A;  3EK4 A;  4FQO A;  1QVI Z;  2CNP A;  3FS7 A;  1BG1 A;  1JSA A;  2JT8 A;  3F45 A;  5FYX A;  1B8R A;  2Q91 A;  1J7O A;  5J3X A;  2CXJ A;  4R1E A;  1RJV A;  3B6X A;  1NCZ A;  3JVT C; 
#chains in the Genus database with same CATH homology
 1PUL A;  2LCP A;  2WOR A;  2KFH A;  4XYN A;  2L4I A;  2CCM A;  4PHJ A;  1UHH A;  1UHN A;  1B7T Y;  1SW8 A;  1BU3 A;  1YUT A;  1CDN A;  1S6C A;  4GUK A;  3BUX B;  1PVB A;  3TDU A;  1RK9 A;  3BOW B;  1GGW A;  2F2P A;  3I5G B;  1RFJ A;  1S1E A;  3DVK A;  3LK0 A;  5K89 A;  1HT9 A;  2BE6 A;  1CM4 A;  2L51 A;  1JBA A;  3TDI A;  1K94 A;  1OE9 B;  2EC6 B;  4M2P A;  3JTD C;  3DVM A;  1AUI B;  4PE1 A;  4WRI A;  3EVR A;  1PK0 D;  1K93 D;  2JQ6 A;  3FWC A;  4U8D A;  1NCX A;  1OZS A;  2PMY A;  1LKJ A;  2JT0 A;  1SPY A;  4PHK A;  3OX5 A;  1DTL A;  2COL B;  2SAS A;  3RLZ A;  2JC2 A;  3BOW A;  1SBJ A;  3DD4 A;  1U5I B;  1YVH A;  4MRY A;  4UPG A;  1DJX A;  1CDP A;  2KBM A;  1QTX A;  1KFX L;  1NX0 A;  1C7V A;  4PDZ A;  5TNC A;  1DGV A;  2K61 A;  1NCY A;  1TNP A;  1DT7 B;  1M39 A;  5CSI A;  5PAL A;  3CR5 X;  5HYD A;  1IRJ A;  1KQM C;  4FTG A;  2LVJ A;  3KF9 A;  1ZFS A;  3M0W A;  1R2U A;  1U5I A;  2HQW A;  2KI4 C;  2I94 A;  4MZK A;  1J7Q A;  1LA3 A;  1KK7 Y;  1BF5 A;  1DMO A;  4YI9 A;  1G8I A;  1E8A A;  1IH0 A;  2JTZ A;  2K7D A;  1XFY O;  4NQG A;  1WLM A;  1F4Q A;  5D69 A;  1NX2 A;  1KK8 B;  5G08 A;  1YTZ C;  4PE0 A;  3PN7 B;  3TUY C;  4MBE A;  1ZUZ A;  3SG4 A;  5HLO A;  1WDC C;  1AHR A;  1AJ5 A;  3AAK A;  1CMF A;  3BXK A;  3CTN A;  1X02 A;  5I2L A;  2M7L A;  1B8L A;  1XK4 C;  2JWW A;  2L0P A;  2L4H A;  2LMT A;  2JOJ A;  2ZKM X;  2OS8 C;  4N1G A;  1A75 B;  1B4C A;  3ZNI A;  1KFU L;  3SG7 A;  4JWQ A;  1NSH A;  4P5O E;  1VRK A;  2LAN A;  2E6W A;  3OP0 A;  5AAN A;  4C0J A;  1K96 A;  3PLF B;  4MVF A;  3ZWH A;  1KQV A;  1TCF A;  3GOF A;  2KYC A;  2FOT A;  2KNE A;  1QV1 A;  1LXF C;  1UUS A;  5HKW A;  2EHB A;  2LNK A;  3OHM B;  2Y1N A;  1W7I B;  3EK7 A;  4N5X A;  1NX3 A;  1NX1 A;  1GJY A;  2LLS A;  2SCP A;  1J7R A;  1GQM A;  2H61 C;  2OPO A;  2BCA A;  1Y6W A;  1A75 A;  1CLM A;  1NWD A;  3DVE A;  5HLV A;  2LHI A;  2BKI B;  4GBA A;  1B9A A;  1L2O C;  2E30 A;  2LVK A;  1UHJ A;  1OMV A;  1UUR A;  1YUS A;  4GGF C;  3DVJ A;  1ODB A;  4GGN A;  2PAL A;  2ISD A;  1IJ6 A;  1C07 A;  1SR6 B;  2AMI A;  1PSB A;  1A4P A;  3D0Y B;  1EG4 A;  5HKZ A;  3WXA A;  4YGA A;  2KI6 D;  1BJF A;  1XVJ A;  2K7B A;  1BMO A;  1SCM B;  1TCO B;  2MRD A;  5JJG A;  1A03 A;  1DJI A;  1QLK A;  4ZCV A;  4OV2 A;  4USL A;  5BPJ A;  3FIA A;  1K9P A;  1JWD A;  4YGB B;  3BUN B;  2LV7 A;  4DUQ A;  3PM8 A;  3LCP C;  2V53 A;  2ZND A;  2A4J A;  2P6B B;  1V1F A;  1XFX O;  2WCF A;  3WHT B;  3BQ3 A;  2KYF A;  5ER5 A;  2Y1M A;  2M3W A;  4HRG A;  3VRO A;  3D0Y A;  1UHK A;  1RRO A;  3CS1 A;  1M63 B;  1XFV O;  2M0R A;  4MSP A;  4QJ3 B;  1OMR A;  1N65 A;  2M97 A;  3I5H B;  1N0Y A;  1H4B A;  2M1U A;  2F3Y A;  4I5J A;  4YGE B;  1SRA A;  2PRU A;  2WCB A;  3ICB A;  1Y1U A;  5CSJ A;  4OCI A;  1KCY A;  1YUU A;  1EJ3 A;  3SIB A;  2JXL A;  2F8P A;  2HPS A;  3EVU A;  4PE4 A;  3TS5 C;  1OSA A;  1QX5 B;  1FW4 A;  2FJU B;  1SNL A;  2OTG C;  3CR2 A;  4ORA B;  1M46 A;  2MJW B;  1QAT A;  1XFZ O;  1G33 A;  1SL8 A;  2KSP A;  2IS9 A;  1PSR A;  1EXR A;  2JXC A;  3NSK A;  1K9K A;  4QJ5 B;  1KSO A;  3HX4 A;  4MLW A;  1B7T Z;  1JF2 A;  5I2Q A;  1UWO A;  4ETO A;  1IQ3 A;  3I5F C;  2ZN9 A;  1Q80 A;  2LUX A;  1XO5 A;  3C1V A;  1LA0 A;  1TRF A;  3MSE B;  3IQQ A;  2LAP A;  1LIN A;  1R6P A;  2JT3 A;  2I18 A;  1CLL A;  3BYA A;  1IWQ A;  1S5G Y;  5I2O A;  2JU0 A;  2KQ6 A;  1NP8 A;  2KAY A;  1RWY A;  3JVT B;  2NCO A;  2PVB A;  3LLE A;  3AAJ A;  3CWG A;  2BL0 C;  1W7J B;  1C7W A;  2KFG A;  4GAO A;  1FBV A;  1CLB A;  5CSF A;  2D8N A;  2K7O A;  2KGB C;  2KFF A;  4NDC A;  4OKH A;  2R2I A;  3I5I C;  2LVV A;  4PHN A;  2O5G A;  3GK4 X;  3KO0 A;  1KFU S;  2WC8 A;  3QRX A;  1QX2 A;  2LMU A;  2MBX A;  1CB1 A;  1AJ4 A;  1SK6 D;  3OB1 B;  3JTD B;  1CFC A;  1KWO C;  4C0L A;  2BCB A;  2F2O A;  2GGZ A;  1K9U A;  3IF7 A;  2HF5 A;  1B47 A;  2ZRS A;  1G4Y R;  1EG3 A;  2O60 A;  1OQP A;  3VRN A;  1KSM A;  1S6J A;  1WY9 A;  4NDB A;  1ALW A;  4JPZ B;  4CID A;  1A29 A;  3NXA A;  1JF0 A;  4A4C A;  1YRU B;  3VRQ A;  1BR1 B;  1EL4 A;  3NSI A;  2BBN A;  2KQY A;  1SYM A;  2LUC A;  5HKY A;  1BLQ A;  2LMV A;  2LP3 A;  3TDZ A;  1QIV A;  4JQ0 D;  1BR4 B;  2LLT A;  1KK7 Z;  2MA2 A;  3O78 A;  5JOL A;  1MXL C;  4CFR A;  2K7C A;  1S3P A;  2NCP A;  4E68 A;  3K21 A;  1B8C A;  2BEC A;  3A4U B;  4YGC B;  2BBM A;  1QV0 A;  2QAC A;  5IBW A;  4A4B A;  1YRT B;  3EKH A;  4GNK B;  4HRE E;  4XJK B;  1FPW A;  1F54 A;  4ICB A;  3KEV A;  1KQM B;  2B1U A;  3KHE A;  5AFP A;  4HSZ A;  3PAL A;  1BOD A;  1WRL A;  1QIW A;  1TN4 A;  4N1F A;  1F71 A;  3FWB A;  4L9M A;  2CBL A;  1CNP A;  1LVC D;  3AKB A;  4MRX A;  5GQQ C;  2KI4 B;  4TNC A;  3OB2 B;  5D7F A;  3IQO A;  2NZ0 A;  1XA5 A;  1MUX A;  1DGU A;  3SG5 A;  2F33 A;  1BT6 A;  2Y5I A;  2L2E A;  5KTY A;  3I5G C;  1JFK A;  2M8U A;  1QVI Y;  4AQI A;  2JRF A;  2EGD A;  3TUY B;  4XJK A;  2F3Z A;  2FCE A;  3SG2 A;  2ZFD A;  1QJT A;  2EC6 C;  2MLE C;  1WDC B;  2NLN A;  2G2B A;  1TNW A;  1J7P A;  3VRR A;  2NXQ A;  1DF0 B;  1WLZ A;  1WRZ A;  1ZMZ A;  1V1G A;  3RM1 A;  2DOQ A;  1F8H A;  1CM1 A;  4DCK A;  1A2X A;  2OS8 B;  1JFJ A;  3WHU B;  2LC5 A;  2JNX A;  2M7N A;  4WQ3 A;  5B8I B;  1CFP A;  1M31 A;  2KDH A;  1CMG A;  3BUM B;  1DJW A;  1SL9 A;  3PFV A;  5AER A;  4ORB B;  5DKN A;  1SY9 A;  2L50 A;  1XFU O;  1TOP A;  1F55 A;  4YBH B;  4YRU A;  2K0J A;  1DF0 A;  3CGA A;  2ZN8 A;  1XK4 A;  1QX7 A;  1OOJ A;  3D10 A;  1J1D A;  1DJZ A;  4GFT A;  1UHI A;  1MWN A;  1L2O B;  5CPV A;  2BE4 A;  3CZT X;  4CLN A;  2M1K B;  1FI5 A;  3GK1 A;  1CDM A;  1KFX S;  1NUB A;  2LE9 B;  3TZ1 A;  1MR8 A;  2FCD A;  1K90 D;  4HRH A;  3SIA A;  1XFW O;  2H2K A;  1EH2 A;  5KSZ A;  4PCW A;  2GV5 A;  1QS7 A;  1ALV A;  1KK8 C;  3SG6 A;  1TNQ A;  2KGR A;  3PN7 C;  2H61 A;  4ORC B;  2ZRT A;  1SL7 A;  1K8U A;  1CKK A;  3H4S E;  1UP5 A;  1AP4 A;  2QPT A;  1GGZ A;  1YR5 A;  1CDL A;  2JTT A;  3EK8 A;  4PAL A;  3O2P A;  1M45 A;  2AUC A;  5DKQ A;  2K2F A;  3PSR A;  1DVI A;  1DJY A;  4DS7 A;  2CTN A;  5I8N A;  4GGF A;  4QJ4 B;  3VGO A;  3O4Y A;  1MF8 B;  2KBI A;  4MEW A;  1DJG A;  3GK2 A;  1J55 A;  4YI8 A;  3BUW B;  3O6B A;  1ZAC A;  4Q04 A;  2JNF A;  1TTX A;  1QAS A;  2LM5 A;  2L98 A;  2M49 B;  4DRW A;  1MHO A;  1AK8 A;  2JZI A;  3PAT A;  1CFF A;  3HCM A;  1PAL A;  3NSO A;  2KAV A;  4M2O A;  2ZNE A;  1PRW A;  4MZJ A;  2TN4 A;  3A8R A;  3OX6 A;  1JC2 A;  4D1E A;  1CFD A;  4MN0 A;  3TS5 B;  4CPV A;  4F0Z B;  2K8M B;  2Y4Q A;  3LL8 B;  2OTG B;  2L5X B;  2M9G A;  3EKJ A;  5AXI A;  1IQ5 A;  1QLS A;  2KI6 C;  1S5G Z;  1WRK A;  1Y1A A;  2RGI A;  1JUO A;  4BY4 A;  1H8B A;  2KHN A;  4I5N B;  2PSR A;  1S26 D;  1D1O A;  4PHM A;  4MZL A;  2WCE A;  1SR6 C;  3NSL A;  2LP2 A;  2KOT A;  2BKH B;  4WQ2 A;  4BY5 A;  3BUO B;  1FF1 A;  1SKT A;  1S36 A;  3I5F B;  1SCM C;  1FI6 A;  1SMG A;  4C0K A;  3KPX A;  4AQJ A;  1HQV A;  1IG5 A;  1OMD A;  2HQ8 A;  2BCX A;  2G9B A;  1YX7 A;  2KAX A;  2LVI A;  1S6I A;  2AAO A;  1YVL A;  1NPQ A;  2LLU A;  3VRP A;  4I5K A;  5KU1 A;  2JPT A;  4P2Y B;  1J1E A;  1RTP 1;  3AKA A;  1TIZ A;  4NDD A;  2CT9 A;  3DF0 B;  3SJS A;  2BL0 B;  1K95 A;  1YX8 A;  2MLF C;  1B1G A;  1SCV A;  4DIR A;  1NIW A;  1NYA A;  2PAS A;  1AVS A;  1MXE A;  1QXP A;  5AEQ A;  4M2Q A;  1BOC A;  1N2D A;  1MQ1 A;  1Y0V H;  3I5I B;  3I5H C;  5ER4 X;  2MAZ A;  2MHH A;  4ZCU A;  3CR4 X;  4OVN F;  4YGD B;  2VRG A;  1DJH A;  2M29 A;  1L7Z A;  2WOS A;  1KWO B;  4AOM A;  2LHL A;  2JUL A;  1IGV A;  4CFQ A;  1CTR A;  2GGM A;  1YUR A;  2Q4U A;  3DF0 A;  1XYD A;  1REC A;  3E3R A;  4PE7 A;  2I2R E;  2WND A;  2K2A A;  4IL1 A;  3EVV A;  2HET A;  1K2H A;  3SG3 A;  1OZO A;  1PVA A;  2I7A A;  1IKU A;  3LK1 A;  4GPL B;  3CLN A;  1Y1X A;  5CSN A;  5DKR A;  4OR9 B;  1ZOT B;  1F70 A;  3WNX B;  1TNX A;  4I5L B;  1F4O A;  1IJ5 A;  5F6T A;  3EK4 A;  4FQO A;  1QVI Z;  2CNP A;  3FS7 A;  1BG1 A;  1JSA A;  2JT8 A;  3F45 A;  5FYX A;  1B8R A;  2Q91 A;  1J7O A;  5J3X A;  2CXJ A;  4R1E A;  1RJV A;  1NCZ A;  3JVT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...