3LCPC

Crystal structure of the carbohydrate recognition domain of lman1 in complex with mcfd2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
68
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Crystal structure of the LMAN1-CRD/MCFD2 transport receptor complex provides insight into combined deficiency of factor V and factor VIII.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 68
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lcpC00
4YGCB 4FTGA 3DVJA 4PDZA 5BPJA 1JBAA 5GQQC 2MBXA 1MF8B 3C1VA 1SY9A 1CKKA 2ZN9A 4MRXA 4PE7A 1DMOA 3EK7A 1R2UA 1YVLA 2M97A 2MRDA 2WOSA 1B9AA 4OR9B 4QJ3B 1R6PA 1PULA 4C0JA 1B8CA 1TIZA 2GV5A 1QJTA 3QRXA 4PHMA 2R2IA 2M29A 2JTTA 1BODA 4NDCA 2Y1MA 3LK0A 1RJVA 4C0LA 1IWQA 4MN0A 3I5FC 1WRZA 3DF0A 3EVRA 1YTZC 3BXKA 1J7OA 4HREE 3D0YB 4UPGA 1GQMA 1LVCD 2LVVA 2EGDA 2ZN8A 2ZKMX 4PHNA 3SJSA 1KCYA 1K93D 1MWNA 2JULA 5HKYA 1CM4A 1SR6C 2ZNEA 1GGZA 2JNXA 1DJIA 1PVBA 2KYCA 4P2YB 4ETOA 1K8UA 2ISDA 1QVIZ 1W7JB 1NSHA 3JVTC 1X02A 2KNEA 5DKRA 4DS7A 1KFXS 1DT7B 1ODBA 2I2RE 2NCPA 2PALA 4CFQA 2L51A 3FIAA 3TDIA 1IJ6A 2K8MB 2JQ6A 3TDUA 1RROA 4YRUA 4NQGA 1KFXL 1J1DA 1J7PA 1IKUA 1IQ5A 3AAKA 5I8NA 2BKHB 2LANA 1HT9A 3EKJA 2LE9B 1CDMA 4R1EA 1AJ5A 5ER5A 3VROA 1WDCC 2JXLA 1CB1A 3I5FB 1N2DA 1XFXO 2L0PA 2LV7A 3BOWB 1TNXA 1YRUB 1B7TY 1A29A 1YUTA 2H61A 4CPVA 3VRNA 2KAYA 1UHJA 1RTP1 1CM1A 1K94A 1TRFA 2JNFA 3TZ1A 4DUQA 2M49B 3BUNB 4DIRA 1DJHA 2ZRSA 3IF7A 5KSZA 2KGBC 2I7AA 5CSJA 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 2BE4A 4OVNF 1C7WA 1PRWA 4PE4A 1K9PA 2BKIB 2WCFA 4GPLB 1V1GA 3EK8A 2JPTA 3O78A 2F33A 5HYDA 1S5GY 5AEQA 1MR8A 3BOWA 5CSNA 4IL1A 4CFRA 3VGOA 2NXQA 1TCOB 2CCMA 3FWBA 3MSEB 2GGMA 3PALA 3LL8B 4C0KA 3DVKA 3PATA 4XYNA 2F8PA 1CMGA 1Y0VH 5D7FA 5D69A 4MBEA 3D10A 1B8LA 4YGEB 1CLBA 1WDCB 2L4IA 1DF0B 1C07A 1UP5A 2M0RA 1WRKA 3O4YA 2M1UA 4YI9A 1SNLA 1UHIA 2O5GA 3RLZA 3OB2B 2HPSA 2Q4UA 2KAXA 3I5IC 1UWOA 2BBNA 1J1EA 4MZJA 4HRHA 4QJ5B 3TUYC 1BG1A 2LM5A 1F4OA 2D8NA 4I5JA 4PCWA 4YBHB 3CR4X 4DRWA 2KFFA 1VRKA 1M63B 2QACA 1RECA 1CLLA 1ZOTB 2SCPA 1DJXA 5CSFA 3DD4A 1F70A 1K90D 3KO0A 2IS9A 2JWWA 1C7VA 3WHUB 1DJGA 1SYMA 4YGBB 2I18A 4MZLA 1YX7A 5HKWA 5AFPA 2LMVA 1UHHA 3H4SE 1K9UA 1CTRA 1SL8A 2Y1NA 1KQMC 1NCXA 5AERA 1JFJA 1M46A 1QATA 2LLUA 1B8RA 5AANA 5HLVA 3WNXB 4E68A 1DJYA 4YGAA 1SRAA 3GK4X 1DGUA 2WC8A 2FCEA 4AOMA 1FI5A 2LUXA 1MXEA 4GBAA 1QX2A 3I5IB 1JF0A 3TUYB 4GUKA 1WRLA 3AKAA 1PSBA 3K21A 4N1GA 5F6TA 4GGFC 2EC6C 3ICBA 3VRPA 4PALA 1JC2A 1OMVA 2JU0A 1EL4A 2HETA 1OOJA 2QPTA 5DKNA 2MHHA 1XO5A 2JOJA 3TDZA 4JPZB 3I5GC 1XK4A 3NSLA 1NX2A 1CNPA 2NLNA 1NCZA 2ZNDA 2K7DA 2LVIA 3F45A 4Q04A 1OMDA 4AQJA 1H4BA 1KWOC 4NDBA 2MLEC 5I2OA 1EJ3A 1PVAA 1KQMB 1OE9B 2Y5IA 3AAJA 3NXAA 1FPWA 1CDLA 1ALWA 2BE6A 2KYFA 2KI6C 3CWGA 3D0YA 3EKHA 3PFVA 4OV2A 1AJ4A 1JUOA 1Y1XA 2CTNA 2MA2A 3ZWHA 2P6BB 3CS1A 1A03A 1KSOA 1NX3A 1LKJA 1NX1A 2JTZA 3CLNA 1FI6A 1KK7Y 2DOQA 3IQQA 4ZCVA 4GAOA 1M39A 1MHOA 1RK9A 1OZOA 1UURA 2KDHA 1CFCA 1QTXA 1LA0A 1RFJA 1PALA 3O6BA 2JC2A 2KOTA 5JOLA 2EC6B 1WLZA 4GGNA 1LINA 1EG3A 4YI8A 5B8IB 3A4UB 1FW4A 1NUBA 1XFYO 1QX7A 3GK2A 3OHMB 2OPOA 1TNQA 1MUXA 3I5GB 5JJGA 3NSKA 1H8BA 2K61A 1WY9A 3OP0A 1XA5A 1SMGA 1A75B 3BYAA 3GK1A 4I5LB 1MQ1A 1KWOB 1BU3A 1TNPA 2JRFA 1IRJA 2LVJA 1SW8A 1BLQA 3SG2A 5I2QA 4P5OE 2AAOA 2MAZA 3BUOB 1Y1UA 4GGFA 2COLB 1S26D 2M9GA 2E30A 2WCEA 3PSRA 2WORA 3DVEA 2BCBA 2KSPA 2L4HA 1F8HA 1JFKA 2LP2A 1DJWA 2WCBA 3JTDC 1YURA 3NSIA 2JXCA 1L7ZA 1WLMA 2L50A 5J3XA 1CDNA 2LLSA 4JWQA 2K7CA 2KHNA 1SPYA 1Y6WA 1M45A 1SCMB 4CIDA 3IQOA 1CFPA 1U5IB 2LVKA 4ICBA 4USLA 1S6JA 1FBVA 1XFUO 2BBMA 1DTLA 3BUMB 5HLOA 2ZRTA 3WHTB 1N0YA 2FJUB 2H2KA 3E3RA 3KF9A 3SG7A 1UUSA 1SL7A 2KFHA 4MSPA 4M2OA 1S36A 2JT8A 1QVIY 2CBLA 1IGVA 2KQYA 4XJKB 1IQ3A 2ZFDA 2V53A 4JQ0D 1K2HA 4GNKB 4WQ2A 2LHIA 1F54A 3TS5C 1OZSA 1J55A 3BUXB 1DF0A 2B1UA 2JT3A 3LK1A 1E8AA 1S6CA 1U5IA 4QJ4B 2M7LA 2F2OA 1CFDA 4FQOA 4PHJA 5HKZA 1QS7A 1IJ5A 3HCMA 5TNCA 3SG3A 2K7BA 3CR5X 1L2OB 3JTDB 2NCOA 1G8IA 1B7TZ 3O2PA 4U8DA 1KK8C 4D1EA 4OKHA 3PN7C 2L5XB 1QIWA 2AUCA 1S3PA 1QV0A 3KPXA 4I5NB 2BECA 2GGZA 1B47A 2G2BA 1BR4B 5KTYA 5KU1A 2PVBA 4M2PA 2I94A 3BQ3A 4A4CA 1MXLC 1CMFA 1G33A 2LMTA 3M0WA 3DF0B 4PE1A 3CZTX 4MZKA 2H61C 1A2XA 3CGAA 1XVJA 1HQVA 1SL9A 5AXIA 1D1OA 2CNPA 4WRIA 1NP8A 3PM8A 1S5GZ 3DVMA 4OCIA 2BCXA 1NIWA 3FWCA 3RM1A 2KAVA 2WNDA 2LHLA 4DCKA 3ZNIA 3TS5B 2BCAA 1KFUS 3LLEA 2LMUA 1S6IA 1SK6D 5IBWA 4ORAB 1F55A 1TNWA 2LAPA 2MJWB 2VRGA 4MLWA 1DVIA 1ALVA 2M3WA 2K7OA 2KI4C 4N1FA 1PSRA 2LP3A 2TN4A 1UHNA 1RWYA 2PSRA 2RGIA 1A4PA 5ER4X 5G08A 1LA3A 5I2LA 2PASA 3PLFB 1KK8B 1NPQA 1BR1B 1KFUL 3BUWB 3PN7B 2OTGB 2F3ZA 2OS8B 3AKBA 1NWDA 4MVFA 2M1KB 1EH2A 1F4QA 3SIBA 1JF2A 2HF5A 5CPVA 3OB1B 1SCMC 3NSOA 1B1GA 3OX6A 1J7QA 1CDPA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 3SG6A 1F71A 4ZCUA 1XYDA 3A8RA 4BY5A 5DKQA 1K96A 1Q80A 1IG5A 1K95A 1XFWO 2CXJA 2F3YA 2O60A 2PMYA 4PE0A 1OQPA 3VRQA 4F0ZB 1J7RA 2A4JA 1UHKA 2EHBA 2LNKA 2MLFC 2BL0C 1KQVA 4ORBB 5K89A 1IH0A 3GOFA 4N5XA 3EK4A 2KBMA 3EVUA 2LC5A 1ZACA 1JWDA 1QLKA 1V1FA 5FYXA 3VRRA 1CFFA 2KI4B 1ZFSA 3SIAA 1EXRA 2LCPA 4I5KA 3SG4A 3CTNA 4L9MA 2JZIA 2SASA 1BMOA 1ZMZA 2KI6D 2NZ0A 1OMRA 1SR6B 4M2QA 1KSMA 1L2OC 1ZUZA 2FCDA 4NDDA 1PK0D 4TNCA 1BF5A 3KEVA 2F2PA 4ORCB 4A4BA 1A75A 2KFGA 2L98A 2LLTA 1G4YR 3JVTB 4WQ3A 1QV1A 1YUUA 1TCFA 3SG5A 3KHEA 3I5HC 2G9BA 1AUIB 1AP4A 4MEWA 2L2EA 1AK8A 1N65A 2M8UA 2JT0A 5PALA 1XFZO 3FS7A 1Y1AA 2BL0B 3CR2A 4HSZA 2K2AA 1JSAA 2LUCA 4BY4A 2HQWA 1B4CA 1QASA 1YRTB 1XK4C 1BJFA 1AVSA 1BOCA 1W7IB 1XFVO 1EG4A 4CLNA 4GFTA 4MRYA 1YUSA 1NCYA 2K0JA 2HQ8A 1DGVA 1S1EA 2Q91A 4AQIA 2K2FA 4YGDB 1KK7Z 1K9KA 1YVHA 2PRUA 1AHRA 1M31A 2CT9A 1QIVA 4PHKA 2KGRA 1OSAA 1TN4A 1YR5A 1GGWA 1SCVA 1DJZA 1LXFC 1QX5B 1TTXA 3HX4A 3EVVA 2OTGC 2E6WA 1CLMA 2OS8C 2KQ6A 1GJYA 4XJKA 2FOTA 2Y4QA 3WXAA 1SBJA 2M7NA 5CSIA 3I5HB 1NX0A 1BT6A
chains in the Genus database with same CATH superfamily
4YGCB 4FTGA 3DVJA 4PDZA 5BPJA 1JBAA 5GQQC 2MBXA 1MF8B 3C1VA 1SY9A 1CKKA 2ZN9A 4MRXA 4PE7A 1TUZA 1DMOA 3B6XA 3DXLA 3EK7A 1R2UA 1YVLA 2M97A 2MRDA 2JPOA 1B9AA 2WOSA 3BFBA 1R6PA 1PULA 4OR9B 1B8CA 4QJ3B 4C0JA 1TIZA 4INWA 5D3OA 2GV5A 3Q8IA 1QJTA 3QRXA 4PHMA 2R2IA 2M29A 2JTTA 3NHIA 1BODA 4NDCA 3NHTA 2Y1MA 3LK0A 1RJVA 4C0LA 1IWQA 4MN0A 3I5FC 1WRZA 3DF0A 3EVRA 1YTZC 3BXKA 1J7OA 4HREE 3S0GA 3D0YB 4UPGA 1GQMA 1LVCD 2LVVA 2EGDA 2ZN8A 1DQEA 2ZKMX 3L4AA 4PHNA 3OBVA 3SJSA 1KCYA 1K93D 1OOIX 1MWNA 2JULA 5HKYA 1CM4A 1SR6C 2ZNEA 5FI7A 1GGZA 3B87A 2JNXA 2K60A 1DJIA 1PVBA 2KYCA 4P2YB 3B86A 4ETOA 1K8UA 2ISDA 1QVIZ 1W7JB 1NSHA 5EL2A 3JVTC 1X02A 2KNEA 5DKRA 4DS7A 1KFXS 2KLDA 1DT7B 1ODBA 2I2RE 2NCPA 2PALA 4CFQA 2L51A 1XFRA 3FIAA 3TDIA 1IJ6A 2K8MB 2JQ6A 3TDUA 1RROA 4YRUA 4NQGA 1KFXL 1J1DA 1J7PA 1IKUA 1IQ5A 3AAKA 5I8NA 1P28A 2BKHB 2LANA 1HT9A 3EKJA 2LE9B 1CDMA 4R1EA 1AJ5A 5ER5A 3VROA 1WDCC 2JXLA 1CB1A 3I5FB 1N2DA 1XFXO 2L0PA 2LV7A 3BOWB 1SSEB 1TNXA 1YRUB 1B7TY 1A29A 1QWVA 1YUTA 2H61A 4CPVA 3VRNA 2QEBA 2KAYA 1UHJA 1GM0A 1RTP1 1CM1A 1K94A 1TRFA 2JNFA 3TZ1A 4DUQA 2M49B 3BUNB 4DIRA 1DJHA 2ZRSA 3IF7A 5KSZA 2KGBC 2I7AA 5CSJA 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 2BE4A 2P70A 1C7WA 1PRWA 4OVNF 1K9PA 2BKIB 2WCFA 4GPLB 1V1GA 1BG1A 3CZ0A 2KPHA 3EK8A 2JPTA 3O78A 2F33A 5HL1A 5HYDA 1S5GY 5AEQA 3S0EA 1MR8A 3BOWA 4OZDA 5CSNA 4IL1A 4CFRA 3D78A 3VGOA 2H8VA 3R72A 2NXQA 1TCOB 2CCMA 3FWBA 2PYQA 3NGVA 3MSEB 2GGMA 3PALA 3LL8B 4C0KA 3BFHA 3DVKA 3PATA 4XYNA 2F8PA 3UNWA 1CMGA 1Y0VH 5D7FA 5D69A 4MBEA 3D10A 1B8LA 4YGEB 3UO9A 3SS4A 1WDCB 1OW4A 2L4IA 1DF0B 1C07A 1UP5A 1OOFA 1CLBA 2M0RA 3N7HA 1WRKA 3O4YA 2M1UA 3PJIA 4YI9A 1SNLA 1UHIA 2O5GA 3RLZA 3OB2B 2HPSA 2Q4UA 2KAXA 3I5IC 1UWOA 2BBNA 1J1EA 2KLEA 3R1VA 4HRHA 4MZJA 4QJ5B 3TUYC 2LM5A 1F4OA 2D8NA 4I5JA 3BJHA 4PCWA 4YBHB 3CR4X 4DRWA 4KYNA 2KFFA 1VRKA 1M63B 2QACA 1RECA 1CLLA 1ZOTB 1OOHA 2SCPA 1DJXA 5CSFA 3DD4A 1F70A 1K90D 3KO0A 2IS9A 2JWWA 1C7VA 3WHUB 1DJGA 1SYMA 4YGBB 2I18A 4MZLA 1YX7A 5HKWA 2QEVA 2LMVA 5AFPA 1UHHA 2WCJA 1K9UA 1CTRA 1SL8A 3H4SE 2Y1NA 1KQMC 1NCXA 5AERA 1IIOA 1JFJA 1M46A 1QATA 2QEHA 3S0DA 2LLUA 1B8RA 5AANA 5HLVA 3WNXB 4F7FA 4E68A 1DJYA 4YGAA 1SRAA 3GK4X 1DGUA 2WC8A 3VRQA 1TUJA 2FCEA 4AOMA 1LS8A 2LUXA 1FI5A 1MXEA 4GBAA 1QX2A 4JKTA 3I5IB 1JF0A 3TUYB 4GUKA 1WRLA 3AKAA 1PSBA 3K21A 4N1GA 5F6TA 4GGFC 2EC6C 3ICBA 3VRPA 4PALA 1JC2A 1OMVA 1OOGA 2JU0A 1EL4A 2HETA 1OOJA 2QPTA 3OGNA 5DKNA 2MHHA 1XO5A 2JOJA 3TDZA 4JPZB 3I5GC 1XK4A 3S0FA 3NSLA 1NX2A 1CNPA 2NLNA 1NCZA 2ZNDA 2K7DA 2LVIA 3F45A 4Q04A 1OMDA 4AQJA 1H4BA 1TWOA 1KWOC 4NDBA 2MLEC 5I2OA 3QMEA 1EJ3A 1PVAA 1KQMB 1OE9B 2WCLA 2Y5IA 3AAJA 3NXAA 3R1PA 1FPWA 1CDLA 1ALWA 2BE6A 2KYFA 2KI6C 3CWGA 3D0YA 3EKHA 3PFVA 4OV2A 3CABA 3FE8A 1AJ4A 1JUOA 1Y1XA 2CTNA 2MA2A 3PM2A 3ZWHA 2P6BB 3CS1A 1A03A 1KSOA 1NX3A 1LKJA 1NX1A 2JTZA 3CLNA 3FE9A 1FI6A 1KK7Y 1DEKA 2DOQA 3IQQA 4ZCVA 4GAOA 1M39A 1MHOA 1RK9A 1OZOA 1UURA 2KDHA 1CFCA 1QTXA 1LA0A 1RFJA 1PALA 3O6BA 2JC2A 2KOTA 5JOLA 2EC6B 2BNXA 1WLZA 4GGNA 1LINA 1EG3A 4YI8A 2BAPA 5B8IB 3A4UB 1FW4A 1NUBA 1XFYO 1QX7A 3GK2A 3OHMB 2OPOA 1TNQA 2QEOA 1MUXA 3I5GB 5JJGA 3NSKA 1H8BA 2K61A 1WY9A 3OP0A 1XA5A 2WCKA 1SMGA 1A75B 3BYAA 3GK1A 4I5LB 1MQ1A 1KWOB 1BU3A 1TNPA 2JRFA 1IRJA 2LVJA 1SW8A 1BLQA 2YGUA 3SG2A 5I2QA 3VB1A 4P5OE 2AAOA 2MAZA 3BUOB 1Y1UA 4GGFA 2COLB 1S26D 2M9GA 2E30A 2WCEA 3PSRA 2WORA 3DVEA 2BCBA 2KSPA 2L4HA 4PE4A 1F8HA 1JFKA 2LP2A 1DJWA 2WCBA 3JTDC 1YURA 3NSIA 2JXCA 1L7ZA 1WLMA 2L50A 5J3XA 1CDNA 2LLSA 4JWQA 2K7CA 2KHNA 1SPYA 1Y6WA 1M45A 1SCMB 4CIDA 3IQOA 1CFPA 1U5IB 3IVTA 2LVKA 1C3YA 3B88A 4ICBA 1S6JA 1FBVA 1XFUO 2BBMA 4USLA 1DTLA 3BUMB 5HLOA 2ZRTA 3WHTB 1N0YA 2FJUB 2H2KA 3E3RA 1DC1A 3KF9A 3SG7A 1UUSA 1SL7A 2KFHA 4MSPA 4M2OA 4PT1A 1S36A 2JT8A 3CZ2A 5I94A 1QVIY 2CBLA 1IGVA 2KQYA 4XJKB 3DY9A 2ZFDA 2V53A 4JQ0D 1IQ3A 4GNKB 1K2HA 4WQ2A 2LHIA 1F54A 3CZ1A 3TS5C 3RZSA 1OZSA 1J55A 3BUXB 1DF0A 2B1UA 2JT3A 3LK1A 1E8AA 1S6CA 1U5IA 4QJ4B 2M7LA 2F2OA 3L47A 1CFDA 4FQOA 4PHJA 5HKZA 1QS7A 1IJ5A 3HCMA 5TNCA 3SG3A 2K7BA 3SS3A 3CR5X 1L2OB 3JTDB 2NCOA 1T14A 1G8IA 1B7TZ 3O2PA 4U8DA 1KK8C 4D1EA 4OKHA 3PN7C 2L5XB 1QIWA 2AUCA 1S3PA 1QV0A 3KPXA 2L5YA 4I5NB 2BECA 2GGZA 1B47A 2G2BA 1BR4B 5KTYA 5KU1A 4JD9A 2PVBA 4M2PA 2I94A 3BQ3A 4A4CA 1MXLC 1CMFA 1G33A 2LMTA 3BFAA 3DF0B 3M0WA 3CZTX 4PE1A 3SS5A 4MZKA 2H61C 1A2XA 3CGAA 1XVJA 1HQVA 1SL9A 5AXIA 1D1OA 2CNPA 4WRIA 1NP8A 3PM8A 1S5GZ 3DVMA 4OCIA 2BCXA 1NIWA 3FWCA 3RM1A 2KAVA 1W9ZA 2WNDA 2LHLA 4DCKA 4INXA 3ZNIA 3TS5B 2BCAA 1KFUS 3LLEA 2LMUA 1S6IA 1SK6D 5IBWA 4ORAB 1F55A 1TNWA 2LAPA 2MJWB 2VRGA 4MLWA 1DVIA 3O4XA 1ALVA 2M3WA 2K7OA 2KI4C 4N1FA 1PSRA 2LP3A 2TN4A 1UHNA 1RWYA 2PSRA 2RGIA 1A4PA 3B7AA 5ER4X 5G08A 1LA3A 5I2LA 2PASA 2WC5A 3PLFB 1KK8B 1NPQA 1BR1B 1KFUL 3BUWB 3PN7B 2OTGB 2F3ZA 2OS8B 2WCHA 1DELA 3AKBA 1NWDA 2PQLA 4MVFA 5FI6A 3CYZA 2M1KB 1EH2A 1F4QA 3L4LA 3SIBA 1JF2A 2HF5A 5CPVA 3OB1B 1SCMC 3NSOA 1B1GA 3OX6A 1J7QA 1CDPA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 3SG6A 3D76A 1F71A 4ZCUA 1XYDA 3A8RA 4BY5A 5DKQA 1K96A 1Q80A 1IG5A 1K95A 1XFWO 2CXJA 2F3YA 2O60A 2PMYA 4FQTA 1OQPA 3D77A 4PE0A 4F0ZB 1J7RA 2A4JA 1UHKA 2EHBA 2LNKA 2MLFC 2BL0C 1KQVA 2L2CA 4ORBB 3S0BA 5K89A 3K1EA 1IH0A 3GOFA 4N5XA 3EK4A 3D75A 2KBMA 1ORGA 2LC5A 1ZACA 3EVUA 1QLKA 1V1FA 4IJ7A 5FYXA 3VRRA 2KI4B 1CFFA 1JWDA 1ZFSA 3SIAA 2WCMA 1EXRA 2LCPA 4I5KA 3SG4A 2GTEA 3CTNA 4L9MA 2JZIA 2SASA 1BMOA 1ZMZA 2KI6D 2NZ0A 1OMRA 1SR6B 4M2QA 3V2LA 1KSMA 1L2OC 1ZUZA 2P71A 2FCDA 4NDDA 1PK0D 4TNCA 1BF5A 3KEVA 2F2PA 4ORCB 4A4BA 3EG5B 1A75A 2KFGA 2L98A 2LLTA 1G4YR 5FI2A 1C3ZA 3JVTB 3D73A 4WQ3A 1QV1A 1YUUA 1TCFA 3SG5A 3KHEA 3I5HC 2G9BA 1AUIB 1AP4A 4MEWA 2L2EA 1AK8A 1N65A 2M8UA 2JT0A 5DICA 5PALA 1XFZO 3FS7A 1Z2CB 1Y1AA 2BL0B 3CR2A 4HSZA 1Z4HA 2K2AA 1JSAA 2LUCA 4BY4A 2HQWA 1B4CA 1QASA 1YRTB 1XK4C 1BJFA 1AVSA 1BOCA 1W7IB 1XFVO 1EG4A 2QDIA 3DZTA 4CLNA 4GFTA 4MRYA 1YUSA 1NCYA 2K0JA 2HQ8A 1DGVA 1S1EA 2Q91A 3FE6A 2K2FA 3R1OA 4YGDB 4AQIA 1KK7Z 1K9KA 1YVHA 2PRUA 1AHRA 1M31A 2CT9A 1QIVA 4PHKA 3D74A 2KGRA 1OSAA 1TN4A 1YR5A 2WC6A 1GGWA 1SCVA 1DJZA 2ERBA 2FJYA 1LXFC 1QX5B 1TTXA 3HX4A 3EVVA 3DYEA 2OTGC 2E6WA 1CLMA 2OS8C 2KQ6A 1GJYA 4XJKA 2FOTA 2Y4QA 3WXAA 3S0AA 1SBJA 2M7NA 3CDNA 5CSIA 3I5HB 1NX0A 1BT6A
chains in the Genus database with same CATH topology
4YGCB 4FTGA 3DVJA 4PDZA 5BPJA 1JBAA 5GQQC 2MBXA 1MF8B 3C1VA 1SY9A 1CKKA 2ZN9A 4MRXA 4PE7A 1DMOA 3EK7A 1R2UA 1YVLA 2M97A 2MRDA 2WOSA 1B9AA 4OR9B 4QJ3B 1R6PA 1PULA 4C0JA 1B8CA 1TIZA 2GV5A 1QJTA 3QRXA 4PHMA 2R2IA 2M29A 2JTTA 1BODA 4NDCA 2Y1MA 3LK0A 1RJVA 4C0LA 1IWQA 4MN0A 3I5FC 1WRZA 3DF0A 3EVRA 1YTZC 3BXKA 1J7OA 4HREE 3D0YB 4UPGA 1GQMA 1LVCD 2LVVA 2EGDA 2ZN8A 2ZKMX 4PHNA 3SJSA 1KCYA 1K93D 1MWNA 2JULA 5HKYA 1CM4A 1SR6C 2ZNEA 1GGZA 2JNXA 1DJIA 1PVBA 2KYCA 4P2YB 4ETOA 1K8UA 2ISDA 1QVIZ 1W7JB 1NSHA 3JVTC 1X02A 2KNEA 5DKRA 4DS7A 1KFXS 1DT7B 1ODBA 2I2RE 2NCPA 2PALA 4CFQA 2L51A 3FIAA 3TDIA 1IJ6A 2K8MB 2JQ6A 3TDUA 1RROA 4YRUA 4NQGA 1KFXL 1J1DA 1J7PA 1IKUA 1IQ5A 3AAKA 5I8NA 2BKHB 2LANA 1HT9A 3EKJA 2LE9B 1CDMA 4R1EA 1AJ5A 5ER5A 3VROA 1WDCC 2JXLA 1CB1A 3I5FB 1N2DA 1XFXO 2L0PA 2LV7A 3BOWB 1TNXA 1YRUB 1B7TY 1A29A 1YUTA 2H61A 4CPVA 3VRNA 2KAYA 1UHJA 1RTP1 1CM1A 1K94A 1TRFA 2JNFA 3TZ1A 4DUQA 2M49B 3BUNB 4DIRA 1DJHA 2ZRSA 3IF7A 5KSZA 2KGBC 2I7AA 5CSJA 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 2BE4A 4OVNF 1C7WA 1PRWA 4PE4A 1K9PA 2BKIB 2WCFA 4GPLB 1V1GA 3EK8A 2JPTA 3O78A 2F33A 5HYDA 1S5GY 5AEQA 1MR8A 3BOWA 5CSNA 4IL1A 4CFRA 3VGOA 2NXQA 1TCOB 2CCMA 3FWBA 3MSEB 2GGMA 3PALA 3LL8B 4C0KA 3DVKA 3PATA 4XYNA 2F8PA 1CMGA 1Y0VH 5D7FA 5D69A 4MBEA 3D10A 1B8LA 4YGEB 1CLBA 1WDCB 2L4IA 1DF0B 1C07A 1UP5A 2M0RA 1WRKA 3O4YA 2M1UA 4YI9A 1SNLA 1UHIA 2O5GA 3RLZA 3OB2B 2HPSA 2Q4UA 2KAXA 3I5IC 1UWOA 2BBNA 1J1EA 4MZJA 4HRHA 4QJ5B 3TUYC 1BG1A 2LM5A 1F4OA 2D8NA 4I5JA 4PCWA 4YBHB 3CR4X 4DRWA 2KFFA 1VRKA 1M63B 2QACA 1RECA 1CLLA 1ZOTB 2SCPA 1DJXA 5CSFA 3DD4A 1F70A 1K90D 3KO0A 2IS9A 2JWWA 1C7VA 3WHUB 1DJGA 1SYMA 4YGBB 2I18A 4MZLA 1YX7A 5HKWA 5AFPA 2LMVA 1UHHA 3H4SE 1K9UA 1CTRA 1SL8A 2Y1NA 1KQMC 1NCXA 5AERA 1JFJA 1M46A 1QATA 2LLUA 1B8RA 5AANA 5HLVA 3WNXB 4E68A 1DJYA 4YGAA 1SRAA 3GK4X 1DGUA 2WC8A 2FCEA 4AOMA 1FI5A 2LUXA 1MXEA 4GBAA 1QX2A 3I5IB 1JF0A 3TUYB 4GUKA 1WRLA 3AKAA 1PSBA 3K21A 4N1GA 5F6TA 4GGFC 2EC6C 3ICBA 3VRPA 4PALA 1JC2A 1OMVA 2JU0A 1EL4A 2HETA 1OOJA 2QPTA 5DKNA 2MHHA 1XO5A 2JOJA 3TDZA 4JPZB 3I5GC 1XK4A 3NSLA 1NX2A 1CNPA 2NLNA 1NCZA 2ZNDA 2K7DA 2LVIA 3F45A 4Q04A 1OMDA 4AQJA 1H4BA 1KWOC 4NDBA 2MLEC 5I2OA 1EJ3A 1PVAA 1KQMB 1OE9B 2Y5IA 3AAJA 3NXAA 1FPWA 1CDLA 1ALWA 2BE6A 2KYFA 2KI6C 3CWGA 3D0YA 3EKHA 3PFVA 4OV2A 1AJ4A 1JUOA 1Y1XA 2CTNA 2MA2A 3ZWHA 2P6BB 3CS1A 1A03A 1KSOA 1NX3A 1LKJA 1NX1A 2JTZA 3CLNA 1FI6A 1KK7Y 2DOQA 3IQQA 4ZCVA 4GAOA 1M39A 1MHOA 1RK9A 1OZOA 1UURA 2KDHA 1CFCA 1QTXA 1LA0A 1RFJA 1PALA 3O6BA 2JC2A 2KOTA 5JOLA 2EC6B 1WLZA 4GGNA 1LINA 1EG3A 4YI8A 5B8IB 3A4UB 1FW4A 1NUBA 1XFYO 1QX7A 3GK2A 3OHMB 2OPOA 1TNQA 1MUXA 3I5GB 5JJGA 3NSKA 1H8BA 2K61A 1WY9A 3OP0A 1XA5A 1SMGA 1A75B 3BYAA 3GK1A 4I5LB 1MQ1A 1KWOB 1BU3A 1TNPA 2JRFA 1IRJA 2LVJA 1SW8A 1BLQA 3SG2A 5I2QA 4P5OE 2AAOA 2MAZA 3BUOB 1Y1UA 4GGFA 2COLB 1S26D 2M9GA 2E30A 2WCEA 3PSRA 2WORA 3DVEA 2BCBA 2KSPA 2L4HA 1F8HA 1JFKA 2LP2A 1DJWA 2WCBA 3JTDC 1YURA 3NSIA 2JXCA 1L7ZA 1WLMA 2L50A 5J3XA 1CDNA 2LLSA 4JWQA 2K7CA 2KHNA 1SPYA 1Y6WA 1M45A 1SCMB 4CIDA 3IQOA 1CFPA 1U5IB 2LVKA 4ICBA 4USLA 1S6JA 1FBVA 1XFUO 2BBMA 1DTLA 3BUMB 5HLOA 2ZRTA 3WHTB 1N0YA 2FJUB 2H2KA 3E3RA 3KF9A 3SG7A 1UUSA 1SL7A 2KFHA 4MSPA 4M2OA 1S36A 2JT8A 1QVIY 2CBLA 1IGVA 2KQYA 4XJKB 1IQ3A 2ZFDA 2V53A 4JQ0D 1K2HA 4GNKB 4WQ2A 2LHIA 1F54A 3TS5C 1OZSA 1J55A 3BUXB 1DF0A 2B1UA 2JT3A 3LK1A 1E8AA 1S6CA 1U5IA 4QJ4B 2M7LA 2F2OA 1CFDA 4FQOA 4PHJA 5HKZA 1QS7A 1IJ5A 3HCMA 5TNCA 3SG3A 2K7BA 3CR5X 1L2OB 3JTDB 2NCOA 1G8IA 1B7TZ 3O2PA 4U8DA 1KK8C 4D1EA 4OKHA 3PN7C 2L5XB 1QIWA 2AUCA 1S3PA 1QV0A 3KPXA 4I5NB 2BECA 2GGZA 1B47A 2G2BA 1BR4B 5KTYA 5KU1A 2PVBA 4M2PA 2I94A 3BQ3A 4A4CA 1MXLC 1CMFA 1G33A 2LMTA 3M0WA 3DF0B 4PE1A 3CZTX 4MZKA 2H61C 1A2XA 3CGAA 1XVJA 1HQVA 1SL9A 5AXIA 1D1OA 2CNPA 4WRIA 1NP8A 3PM8A 1S5GZ 3DVMA 4OCIA 2BCXA 1NIWA 3FWCA 3RM1A 2KAVA 2WNDA 2LHLA 4DCKA 3ZNIA 3TS5B 2BCAA 1KFUS 3LLEA 2LMUA 1S6IA 1SK6D 5IBWA 4ORAB 1F55A 1TNWA 2LAPA 2MJWB 2VRGA 4MLWA 1DVIA 1ALVA 2M3WA 2K7OA 2KI4C 4N1FA 1PSRA 2LP3A 2TN4A 1UHNA 1RWYA 2PSRA 2RGIA 1A4PA 5ER4X 5G08A 1LA3A 5I2LA 2PASA 3PLFB 1KK8B 1NPQA 1BR1B 1KFUL 3BUWB 3PN7B 2OTGB 2F3ZA 2OS8B 3AKBA 1NWDA 4MVFA 2M1KB 1EH2A 1F4QA 3SIBA 1JF2A 2HF5A 5CPVA 3OB1B 1SCMC 3NSOA 1B1GA 3OX6A 1J7QA 1CDPA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 3SG6A 1F71A 4ZCUA 1XYDA 3A8RA 4BY5A 5DKQA 1K96A 1Q80A 1IG5A 1K95A 1XFWO 2CXJA 2F3YA 2O60A 2PMYA 4PE0A 1OQPA 3VRQA 4F0ZB 1J7RA 2A4JA 1UHKA 2EHBA 2LNKA 2MLFC 2BL0C 1KQVA 4ORBB 5K89A 1IH0A 3GOFA 4N5XA 3EK4A 2KBMA 3EVUA 2LC5A 1ZACA 1JWDA 1QLKA 1V1FA 5FYXA 3VRRA 1CFFA 2KI4B 1ZFSA 3SIAA 1EXRA 2LCPA 4I5KA 3SG4A 3CTNA 4L9MA 2JZIA 2SASA 1BMOA 1ZMZA 2KI6D 2NZ0A 1OMRA 1SR6B 4M2QA 1KSMA 1L2OC 1ZUZA 2FCDA 4NDDA 1PK0D 4TNCA 1BF5A 3KEVA 2F2PA 4ORCB 4A4BA 1A75A 2KFGA 2L98A 2LLTA 1G4YR 3JVTB 4WQ3A 1QV1A 1YUUA 1TCFA 3SG5A 3KHEA 3I5HC 2G9BA 1AUIB 1AP4A 4MEWA 2L2EA 1AK8A 1N65A 2M8UA 2JT0A 5PALA 1XFZO 3FS7A 1Y1AA 2BL0B 3CR2A 4HSZA 2K2AA 1JSAA 2LUCA 4BY4A 2HQWA 1B4CA 1QASA 1YRTB 1XK4C 1BJFA 1AVSA 1BOCA 1W7IB 1XFVO 1EG4A 4CLNA 4GFTA 4MRYA 1YUSA 1NCYA 2K0JA 2HQ8A 1DGVA 1S1EA 2Q91A 4AQIA 2K2FA 4YGDB 1KK7Z 1K9KA 1YVHA 2PRUA 1AHRA 1M31A 2CT9A 1QIVA 4PHKA 2KGRA 1OSAA 1TN4A 1YR5A 1GGWA 1SCVA 1DJZA 1LXFC 1QX5B 1TTXA 3HX4A 3EVVA 2OTGC 2E6WA 1CLMA 2OS8C 2KQ6A 1GJYA 4XJKA 2FOTA 2Y4QA 3WXAA 1SBJA 2M7NA 5CSIA 3I5HB 1NX0A 1BT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGC B;  4FTG A;  3DVJ A;  4PDZ A;  5BPJ A;  1JBA A;  5GQQ C;  2MBX A;  1MF8 B;  3C1V A;  1SY9 A;  1CKK A;  2ZN9 A;  4MRX A;  4PE7 A;  1DMO A;  3EK7 A;  1R2U A;  1YVL A;  2M97 A;  2MRD A;  2WOS A;  1B9A A;  4OR9 B;  4QJ3 B;  1R6P A;  1PUL A;  4C0J A;  1B8C A;  1TIZ A;  2GV5 A;  1QJT A;  3QRX A;  4PHM A;  2R2I A;  2M29 A;  2JTT A;  1BOD A;  4NDC A;  2Y1M A;  3LK0 A;  1RJV A;  4C0L A;  1IWQ A;  4MN0 A;  3I5F C;  1WRZ A;  3DF0 A;  3EVR A;  1YTZ C;  3BXK A;  1J7O A;  4HRE E;  3D0Y B;  4UPG A;  1GQM A;  1LVC D;  2LVV A;  2EGD A;  2ZN8 A;  2ZKM X;  4PHN A;  3SJS A;  1KCY A;  1K93 D;  1MWN A;  2JUL A;  5HKY A;  1CM4 A;  1SR6 C;  2ZNE A;  1GGZ A;  2JNX A;  1DJI A;  1PVB A;  2KYC A;  4P2Y B;  4ETO A;  1K8U A;  2ISD A;  1QVI Z;  1W7J B;  1NSH A;  3JVT C;  1X02 A;  2KNE A;  5DKR A;  4DS7 A;  1KFX S;  1DT7 B;  1ODB A;  2I2R E;  2NCP A;  2PAL A;  4CFQ A;  2L51 A;  3FIA A;  3TDI A;  1IJ6 A;  2K8M B;  2JQ6 A;  3TDU A;  1RRO A;  4YRU A;  4NQG A;  1KFX L;  1J1D A;  1J7P A;  1IKU A;  1IQ5 A;  3AAK A;  5I8N A;  2BKH B;  2LAN A;  1HT9 A;  3EKJ A;  2LE9 B;  1CDM A;  4R1E A;  1AJ5 A;  5ER5 A;  3VRO A;  1WDC C;  2JXL A;  1CB1 A;  3I5F B;  1N2D A;  1XFX O;  2L0P A;  2LV7 A;  3BOW B;  1TNX A;  1YRU B;  1B7T Y;  1A29 A;  1YUT A;  2H61 A;  4CPV A;  3VRN A;  2KAY A;  1UHJ A;  1RTP 1;  1CM1 A;  1K94 A;  1TRF A;  2JNF A;  3TZ1 A;  4DUQ A;  2M49 B;  3BUN B;  4DIR A;  1DJH A;  2ZRS A;  3IF7 A;  5KSZ A;  2KGB C;  2I7A A;  5CSJ A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  2BE4 A;  4OVN F;  1C7W A;  1PRW A;  4PE4 A;  1K9P A;  2BKI B;  2WCF A;  4GPL B;  1V1G A;  3EK8 A;  2JPT A;  3O78 A;  2F33 A;  5HYD A;  1S5G Y;  5AEQ A;  1MR8 A;  3BOW A;  5CSN A;  4IL1 A;  4CFR A;  3VGO A;  2NXQ A;  1TCO B;  2CCM A;  3FWB A;  3MSE B;  2GGM A;  3PAL A;  3LL8 B;  4C0K A;  3DVK A;  3PAT A;  4XYN A;  2F8P A;  1CMG A;  1Y0V H;  5D7F A;  5D69 A;  4MBE A;  3D10 A;  1B8L A;  4YGE B;  1CLB A;  1WDC B;  2L4I A;  1DF0 B;  1C07 A;  1UP5 A;  2M0R A;  1WRK A;  3O4Y A;  2M1U A;  4YI9 A;  1SNL A;  1UHI A;  2O5G A;  3RLZ A;  3OB2 B;  2HPS A;  2Q4U A;  2KAX A;  3I5I C;  1UWO A;  2BBN A;  1J1E A;  4MZJ A;  4HRH A;  4QJ5 B;  3TUY C;  1BG1 A;  2LM5 A;  1F4O A;  2D8N A;  4I5J A;  4PCW A;  4YBH B;  3CR4 X;  4DRW A;  2KFF A;  1VRK A;  1M63 B;  2QAC A;  1REC A;  1CLL A;  1ZOT B;  2SCP A;  1DJX A;  5CSF A;  3DD4 A;  1F70 A;  1K90 D;  3KO0 A;  2IS9 A;  2JWW A;  1C7V A;  3WHU B;  1DJG A;  1SYM A;  4YGB B;  2I18 A;  4MZL A;  1YX7 A;  5HKW A;  5AFP A;  2LMV A;  1UHH A;  3H4S E;  1K9U A;  1CTR A;  1SL8 A;  2Y1N A;  1KQM C;  1NCX A;  5AER A;  1JFJ A;  1M46 A;  1QAT A;  2LLU A;  1B8R A;  5AAN A;  5HLV A;  3WNX B;  4E68 A;  1DJY A;  4YGA A;  1SRA A;  3GK4 X;  1DGU A;  2WC8 A;  2FCE A;  4AOM A;  1FI5 A;  2LUX A;  1MXE A;  4GBA A;  1QX2 A;  3I5I B;  1JF0 A;  3TUY B;  4GUK A;  1WRL A;  3AKA A;  1PSB A;  3K21 A;  4N1G A;  5F6T A;  4GGF C;  2EC6 C;  3ICB A;  3VRP A;  4PAL A;  1JC2 A;  1OMV A;  2JU0 A;  1EL4 A;  2HET A;  1OOJ A;  2QPT A;  5DKN A;  2MHH A;  1XO5 A;  2JOJ A;  3TDZ A;  4JPZ B;  3I5G C;  1XK4 A;  3NSL A;  1NX2 A;  1CNP A;  2NLN A;  1NCZ A;  2ZND A;  2K7D A;  2LVI A;  3F45 A;  4Q04 A;  1OMD A;  4AQJ A;  1H4B A;  1KWO C;  4NDB A;  2MLE C;  5I2O A;  1EJ3 A;  1PVA A;  1KQM B;  1OE9 B;  2Y5I A;  3AAJ A;  3NXA A;  1FPW A;  1CDL A;  1ALW A;  2BE6 A;  2KYF A;  2KI6 C;  3CWG A;  3D0Y A;  3EKH A;  3PFV A;  4OV2 A;  1AJ4 A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  3ZWH A;  2P6B B;  3CS1 A;  1A03 A;  1KSO A;  1NX3 A;  1LKJ A;  1NX1 A;  2JTZ A;  3CLN A;  1FI6 A;  1KK7 Y;  2DOQ A;  3IQQ A;  4ZCV A;  4GAO A;  1M39 A;  1MHO A;  1RK9 A;  1OZO A;  1UUR A;  2KDH A;  1CFC A;  1QTX A;  1LA0 A;  1RFJ A;  1PAL A;  3O6B A;  2JC2 A;  2KOT A;  5JOL A;  2EC6 B;  1WLZ A;  4GGN A;  1LIN A;  1EG3 A;  4YI8 A;  5B8I B;  3A4U B;  1FW4 A;  1NUB A;  1XFY O;  1QX7 A;  3GK2 A;  3OHM B;  2OPO A;  1TNQ A;  1MUX A;  3I5G B;  5JJG A;  3NSK A;  1H8B A;  2K61 A;  1WY9 A;  3OP0 A;  1XA5 A;  1SMG A;  1A75 B;  3BYA A;  3GK1 A;  4I5L B;  1MQ1 A;  1KWO B;  1BU3 A;  1TNP A;  2JRF A;  1IRJ A;  2LVJ A;  1SW8 A;  1BLQ A;  3SG2 A;  5I2Q A;  4P5O E;  2AAO A;  2MAZ A;  3BUO B;  1Y1U A;  4GGF A;  2COL B;  1S26 D;  2M9G A;  2E30 A;  2WCE A;  3PSR A;  2WOR A;  3DVE A;  2BCB A;  2KSP A;  2L4H A;  1F8H A;  1JFK A;  2LP2 A;  1DJW A;  2WCB A;  3JTD C;  1YUR A;  3NSI A;  2JXC A;  1L7Z A;  1WLM A;  2L50 A;  5J3X A;  1CDN A;  2LLS A;  4JWQ A;  2K7C A;  2KHN A;  1SPY A;  1Y6W A;  1M45 A;  1SCM B;  4CID A;  3IQO A;  1CFP A;  1U5I B;  2LVK A;  4ICB A;  4USL A;  1S6J A;  1FBV A;  1XFU O;  2BBM A;  1DTL A;  3BUM B;  5HLO A;  2ZRT A;  3WHT B;  1N0Y A;  2FJU B;  2H2K A;  3E3R A;  3KF9 A;  3SG7 A;  1UUS A;  1SL7 A;  2KFH A;  4MSP A;  4M2O A;  1S36 A;  2JT8 A;  1QVI Y;  2CBL A;  1IGV A;  2KQY A;  4XJK B;  1IQ3 A;  2ZFD A;  2V53 A;  4JQ0 D;  1K2H A;  4GNK B;  4WQ2 A;  2LHI A;  1F54 A;  3TS5 C;  1OZS A;  1J55 A;  3BUX B;  1DF0 A;  2B1U A;  2JT3 A;  3LK1 A;  1E8A A;  1S6C A;  1U5I A;  4QJ4 B;  2M7L A;  2F2O A;  1CFD A;  4FQO A;  4PHJ A;  5HKZ A;  1QS7 A;  1IJ5 A;  3HCM A;  5TNC A;  3SG3 A;  2K7B A;  3CR5 X;  1L2O B;  3JTD B;  2NCO A;  1G8I A;  1B7T Z;  3O2P A;  4U8D A;  1KK8 C;  4D1E A;  4OKH A;  3PN7 C;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  1QV0 A;  3KPX A;  4I5N B;  2BEC A;  2GGZ A;  1B47 A;  2G2B A;  1BR4 B;  5KTY A;  5KU1 A;  2PVB A;  4M2P A;  2I94 A;  3BQ3 A;  4A4C A;  1MXL C;  1CMF A;  1G33 A;  2LMT A;  3M0W A;  3DF0 B;  4PE1 A;  3CZT X;  4MZK A;  2H61 C;  1A2X A;  3CGA A;  1XVJ A;  1HQV A;  1SL9 A;  5AXI A;  1D1O A;  2CNP A;  4WRI A;  1NP8 A;  3PM8 A;  1S5G Z;  3DVM A;  4OCI A;  2BCX A;  1NIW A;  3FWC A;  3RM1 A;  2KAV A;  2WND A;  2LHL A;  4DCK A;  3ZNI A;  3TS5 B;  2BCA A;  1KFU S;  3LLE A;  2LMU A;  1S6I A;  1SK6 D;  5IBW A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2MJW B;  2VRG A;  4MLW A;  1DVI A;  1ALV A;  2M3W A;  2K7O A;  2KI4 C;  4N1F A;  1PSR A;  2LP3 A;  2TN4 A;  1UHN A;  1RWY A;  2PSR A;  2RGI A;  1A4P A;  5ER4 X;  5G08 A;  1LA3 A;  5I2L A;  2PAS A;  3PLF B;  1KK8 B;  1NPQ A;  1BR1 B;  1KFU L;  3BUW B;  3PN7 B;  2OTG B;  2F3Z A;  2OS8 B;  3AKB A;  1NWD A;  4MVF A;  2M1K B;  1EH2 A;  1F4Q A;  3SIB A;  1JF2 A;  2HF5 A;  5CPV A;  3OB1 B;  1SCM C;  3NSO A;  1B1G A;  3OX6 A;  1J7Q A;  1CDP A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  3SG6 A;  1F71 A;  4ZCU A;  1XYD A;  3A8R A;  4BY5 A;  5DKQ A;  1K96 A;  1Q80 A;  1IG5 A;  1K95 A;  1XFW O;  2CXJ A;  2F3Y A;  2O60 A;  2PMY A;  4PE0 A;  1OQP A;  3VRQ A;  4F0Z B;  1J7R A;  2A4J A;  1UHK A;  2EHB A;  2LNK A;  2MLF C;  2BL0 C;  1KQV A;  4ORB B;  5K89 A;  1IH0 A;  3GOF A;  4N5X A;  3EK4 A;  2KBM A;  3EVU A;  2LC5 A;  1ZAC A;  1JWD A;  1QLK A;  1V1F A;  5FYX A;  3VRR A;  1CFF A;  2KI4 B;  1ZFS A;  3SIA A;  1EXR A;  2LCP A;  4I5K A;  3SG4 A;  3CTN A;  4L9M A;  2JZI A;  2SAS A;  1BMO A;  1ZMZ A;  2KI6 D;  2NZ0 A;  1OMR A;  1SR6 B;  4M2Q A;  1KSM A;  1L2O C;  1ZUZ A;  2FCD A;  4NDD A;  1PK0 D;  4TNC A;  1BF5 A;  3KEV A;  2F2P A;  4ORC B;  4A4B A;  1A75 A;  2KFG A;  2L98 A;  2LLT A;  1G4Y R;  3JVT B;  4WQ3 A;  1QV1 A;  1YUU A;  1TCF A;  3SG5 A;  3KHE A;  3I5H C;  2G9B A;  1AUI B;  1AP4 A;  4MEW A;  2L2E A;  1AK8 A;  1N65 A;  2M8U A;  2JT0 A;  5PAL A;  1XFZ O;  3FS7 A;  1Y1A A;  2BL0 B;  3CR2 A;  4HSZ A;  2K2A A;  1JSA A;  2LUC A;  4BY4 A;  2HQW A;  1B4C A;  1QAS A;  1YRT B;  1XK4 C;  1BJF A;  1AVS A;  1BOC A;  1W7I B;  1XFV O;  1EG4 A;  4CLN A;  4GFT A;  4MRY A;  1YUS A;  1NCY A;  2K0J A;  2HQ8 A;  1DGV A;  1S1E A;  2Q91 A;  4AQI A;  2K2F A;  4YGD B;  1KK7 Z;  1K9K A;  1YVH A;  2PRU A;  1AHR A;  1M31 A;  2CT9 A;  1QIV A;  4PHK A;  2KGR A;  1OSA A;  1TN4 A;  1YR5 A;  1GGW A;  1SCV A;  1DJZ A;  1LXF C;  1QX5 B;  1TTX A;  3HX4 A;  3EVV A;  2OTG C;  2E6W A;  1CLM A;  2OS8 C;  2KQ6 A;  1GJY A;  4XJK A;  2FOT A;  2Y4Q A;  3WXA A;  1SBJ A;  2M7N A;  5CSI A;  3I5H B;  1NX0 A;  1BT6 A; 
#chains in the Genus database with same CATH topology
 4YGC B;  4FTG A;  3DVJ A;  4PDZ A;  5BPJ A;  1JBA A;  5GQQ C;  2MBX A;  1MF8 B;  3C1V A;  1SY9 A;  1CKK A;  2ZN9 A;  4MRX A;  4PE7 A;  1TUZ A;  1DMO A;  3B6X A;  3DXL A;  3EK7 A;  1R2U A;  1YVL A;  2M97 A;  2MRD A;  2JPO A;  1B9A A;  2WOS A;  3BFB A;  1R6P A;  1PUL A;  4OR9 B;  1B8C A;  4QJ3 B;  4C0J A;  1TIZ A;  4INW A;  5D3O A;  2GV5 A;  3Q8I A;  1QJT A;  3QRX A;  4PHM A;  2R2I A;  2M29 A;  2JTT A;  3NHI A;  1BOD A;  4NDC A;  3NHT A;  2Y1M A;  3LK0 A;  1RJV A;  4C0L A;  1IWQ A;  4MN0 A;  3I5F C;  1WRZ A;  3DF0 A;  3EVR A;  1YTZ C;  3BXK A;  1J7O A;  4HRE E;  3S0G A;  3D0Y B;  4UPG A;  1GQM A;  1LVC D;  2LVV A;  2EGD A;  2ZN8 A;  1DQE A;  2ZKM X;  3L4A A;  4PHN A;  3OBV A;  3SJS A;  1KCY A;  1K93 D;  1OOI X;  1MWN A;  2JUL A;  5HKY A;  1CM4 A;  1SR6 C;  2ZNE A;  5FI7 A;  1GGZ A;  3B87 A;  2JNX A;  2K60 A;  1DJI A;  1PVB A;  2KYC A;  4P2Y B;  3B86 A;  4ETO A;  1K8U A;  2ISD A;  1QVI Z;  1W7J B;  1NSH A;  5EL2 A;  3JVT C;  1X02 A;  2KNE A;  5DKR A;  4DS7 A;  1KFX S;  2KLD A;  1DT7 B;  1ODB A;  2I2R E;  2NCP A;  2PAL A;  4CFQ A;  2L51 A;  1XFR A;  3FIA A;  3TDI A;  1IJ6 A;  2K8M B;  2JQ6 A;  3TDU A;  1RRO A;  4YRU A;  4NQG A;  1KFX L;  1J1D A;  1J7P A;  1IKU A;  1IQ5 A;  3AAK A;  5I8N A;  1P28 A;  2BKH B;  2LAN A;  1HT9 A;  3EKJ A;  2LE9 B;  1CDM A;  4R1E A;  1AJ5 A;  5ER5 A;  3VRO A;  1WDC C;  2JXL A;  1CB1 A;  3I5F B;  1N2D A;  1XFX O;  2L0P A;  2LV7 A;  3BOW B;  1SSE B;  1TNX A;  1YRU B;  1B7T Y;  1A29 A;  1QWV A;  1YUT A;  2H61 A;  4CPV A;  3VRN A;  2QEB A;  2KAY A;  1UHJ A;  1GM0 A;  1RTP 1;  1CM1 A;  1K94 A;  1TRF A;  2JNF A;  3TZ1 A;  4DUQ A;  2M49 B;  3BUN B;  4DIR A;  1DJH A;  2ZRS A;  3IF7 A;  5KSZ A;  2KGB C;  2I7A A;  5CSJ A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  2BE4 A;  2P70 A;  1C7W A;  1PRW A;  4OVN F;  1K9P A;  2BKI B;  2WCF A;  4GPL B;  1V1G A;  1BG1 A;  3CZ0 A;  2KPH A;  3EK8 A;  2JPT A;  3O78 A;  2F33 A;  5HL1 A;  5HYD A;  1S5G Y;  5AEQ A;  3S0E A;  1MR8 A;  3BOW A;  4OZD A;  5CSN A;  4IL1 A;  4CFR A;  3D78 A;  3VGO A;  2H8V A;  3R72 A;  2NXQ A;  1TCO B;  2CCM A;  3FWB A;  2PYQ A;  3NGV A;  3MSE B;  2GGM A;  3PAL A;  3LL8 B;  4C0K A;  3BFH A;  3DVK A;  3PAT A;  4XYN A;  2F8P A;  3UNW A;  1CMG A;  1Y0V H;  5D7F A;  5D69 A;  4MBE A;  3D10 A;  1B8L A;  4YGE B;  3UO9 A;  3SS4 A;  1WDC B;  1OW4 A;  2L4I A;  1DF0 B;  1C07 A;  1UP5 A;  1OOF A;  1CLB A;  2M0R A;  3N7H A;  1WRK A;  3O4Y A;  2M1U A;  3PJI A;  4YI9 A;  1SNL A;  1UHI A;  2O5G A;  3RLZ A;  3OB2 B;  2HPS A;  2Q4U A;  2KAX A;  3I5I C;  1UWO A;  2BBN A;  1J1E A;  2KLE A;  3R1V A;  4HRH A;  4MZJ A;  4QJ5 B;  3TUY C;  2LM5 A;  1F4O A;  2D8N A;  4I5J A;  3BJH A;  4PCW A;  4YBH B;  3CR4 X;  4DRW A;  4KYN A;  2KFF A;  1VRK A;  1M63 B;  2QAC A;  1REC A;  1CLL A;  1ZOT B;  1OOH A;  2SCP A;  1DJX A;  5CSF A;  3DD4 A;  1F70 A;  1K90 D;  3KO0 A;  2IS9 A;  2JWW A;  1C7V A;  3WHU B;  1DJG A;  1SYM A;  4YGB B;  2I18 A;  4MZL A;  1YX7 A;  5HKW A;  2QEV A;  2LMV A;  5AFP A;  1UHH A;  2WCJ A;  1K9U A;  1CTR A;  1SL8 A;  3H4S E;  2Y1N A;  1KQM C;  1NCX A;  5AER A;  1IIO A;  1JFJ A;  1M46 A;  1QAT A;  2QEH A;  3S0D A;  2LLU A;  1B8R A;  5AAN A;  5HLV A;  3WNX B;  4F7F A;  4E68 A;  1DJY A;  4YGA A;  1SRA A;  3GK4 X;  1DGU A;  2WC8 A;  3VRQ A;  1TUJ A;  2FCE A;  4AOM A;  1LS8 A;  2LUX A;  1FI5 A;  1MXE A;  4GBA A;  1QX2 A;  4JKT A;  3I5I B;  1JF0 A;  3TUY B;  4GUK A;  1WRL A;  3AKA A;  1PSB A;  3K21 A;  4N1G A;  5F6T A;  4GGF C;  2EC6 C;  3ICB A;  3VRP A;  4PAL A;  1JC2 A;  1OMV A;  1OOG A;  2JU0 A;  1EL4 A;  2HET A;  1OOJ A;  2QPT A;  3OGN A;  5DKN A;  2MHH A;  1XO5 A;  2JOJ A;  3TDZ A;  4JPZ B;  3I5G C;  1XK4 A;  3S0F A;  3NSL A;  1NX2 A;  1CNP A;  2NLN A;  1NCZ A;  2ZND A;  2K7D A;  2LVI A;  3F45 A;  4Q04 A;  1OMD A;  4AQJ A;  1H4B A;  1TWO A;  1KWO C;  4NDB A;  2MLE C;  5I2O A;  3QME A;  1EJ3 A;  1PVA A;  1KQM B;  1OE9 B;  2WCL A;  2Y5I A;  3AAJ A;  3NXA A;  3R1P A;  1FPW A;  1CDL A;  1ALW A;  2BE6 A;  2KYF A;  2KI6 C;  3CWG A;  3D0Y A;  3EKH A;  3PFV A;  4OV2 A;  3CAB A;  3FE8 A;  1AJ4 A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  3PM2 A;  3ZWH A;  2P6B B;  3CS1 A;  1A03 A;  1KSO A;  1NX3 A;  1LKJ A;  1NX1 A;  2JTZ A;  3CLN A;  3FE9 A;  1FI6 A;  1KK7 Y;  1DEK A;  2DOQ A;  3IQQ A;  4ZCV A;  4GAO A;  1M39 A;  1MHO A;  1RK9 A;  1OZO A;  1UUR A;  2KDH A;  1CFC A;  1QTX A;  1LA0 A;  1RFJ A;  1PAL A;  3O6B A;  2JC2 A;  2KOT A;  5JOL A;  2EC6 B;  2BNX A;  1WLZ A;  4GGN A;  1LIN A;  1EG3 A;  4YI8 A;  2BAP A;  5B8I B;  3A4U B;  1FW4 A;  1NUB A;  1XFY O;  1QX7 A;  3GK2 A;  3OHM B;  2OPO A;  1TNQ A;  2QEO A;  1MUX A;  3I5G B;  5JJG A;  3NSK A;  1H8B A;  2K61 A;  1WY9 A;  3OP0 A;  1XA5 A;  2WCK A;  1SMG A;  1A75 B;  3BYA A;  3GK1 A;  4I5L B;  1MQ1 A;  1KWO B;  1BU3 A;  1TNP A;  2JRF A;  1IRJ A;  2LVJ A;  1SW8 A;  1BLQ A;  2YGU A;  3SG2 A;  5I2Q A;  3VB1 A;  4P5O E;  2AAO A;  2MAZ A;  3BUO B;  1Y1U A;  4GGF A;  2COL B;  1S26 D;  2M9G A;  2E30 A;  2WCE A;  3PSR A;  2WOR A;  3DVE A;  2BCB A;  2KSP A;  2L4H A;  4PE4 A;  1F8H A;  1JFK A;  2LP2 A;  1DJW A;  2WCB A;  3JTD C;  1YUR A;  3NSI A;  2JXC A;  1L7Z A;  1WLM A;  2L50 A;  5J3X A;  1CDN A;  2LLS A;  4JWQ A;  2K7C A;  2KHN A;  1SPY A;  1Y6W A;  1M45 A;  1SCM B;  4CID A;  3IQO A;  1CFP A;  1U5I B;  3IVT A;  2LVK A;  1C3Y A;  3B88 A;  4ICB A;  1S6J A;  1FBV A;  1XFU O;  2BBM A;  4USL A;  1DTL A;  3BUM B;  5HLO A;  2ZRT A;  3WHT B;  1N0Y A;  2FJU B;  2H2K A;  3E3R A;  1DC1 A;  3KF9 A;  3SG7 A;  1UUS A;  1SL7 A;  2KFH A;  4MSP A;  4M2O A;  4PT1 A;  1S36 A;  2JT8 A;  3CZ2 A;  5I94 A;  1QVI Y;  2CBL A;  1IGV A;  2KQY A;  4XJK B;  3DY9 A;  2ZFD A;  2V53 A;  4JQ0 D;  1IQ3 A;  4GNK B;  1K2H A;  4WQ2 A;  2LHI A;  1F54 A;  3CZ1 A;  3TS5 C;  3RZS A;  1OZS A;  1J55 A;  3BUX B;  1DF0 A;  2B1U A;  2JT3 A;  3LK1 A;  1E8A A;  1S6C A;  1U5I A;  4QJ4 B;  2M7L A;  2F2O A;  3L47 A;  1CFD A;  4FQO A;  4PHJ A;  5HKZ A;  1QS7 A;  1IJ5 A;  3HCM A;  5TNC A;  3SG3 A;  2K7B A;  3SS3 A;  3CR5 X;  1L2O B;  3JTD B;  2NCO A;  1T14 A;  1G8I A;  1B7T Z;  3O2P A;  4U8D A;  1KK8 C;  4D1E A;  4OKH A;  3PN7 C;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  1QV0 A;  3KPX A;  2L5Y A;  4I5N B;  2BEC A;  2GGZ A;  1B47 A;  2G2B A;  1BR4 B;  5KTY A;  5KU1 A;  4JD9 A;  2PVB A;  4M2P A;  2I94 A;  3BQ3 A;  4A4C A;  1MXL C;  1CMF A;  1G33 A;  2LMT A;  3BFA A;  3DF0 B;  3M0W A;  3CZT X;  4PE1 A;  3SS5 A;  4MZK A;  2H61 C;  1A2X A;  3CGA A;  1XVJ A;  1HQV A;  1SL9 A;  5AXI A;  1D1O A;  2CNP A;  4WRI A;  1NP8 A;  3PM8 A;  1S5G Z;  3DVM A;  4OCI A;  2BCX A;  1NIW A;  3FWC A;  3RM1 A;  2KAV A;  1W9Z A;  2WND A;  2LHL A;  4DCK A;  4INX A;  3ZNI A;  3TS5 B;  2BCA A;  1KFU S;  3LLE A;  2LMU A;  1S6I A;  1SK6 D;  5IBW A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2MJW B;  2VRG A;  4MLW A;  1DVI A;  3O4X A;  1ALV A;  2M3W A;  2K7O A;  2KI4 C;  4N1F A;  1PSR A;  2LP3 A;  2TN4 A;  1UHN A;  1RWY A;  2PSR A;  2RGI A;  1A4P A;  3B7A A;  5ER4 X;  5G08 A;  1LA3 A;  5I2L A;  2PAS A;  2WC5 A;  3PLF B;  1KK8 B;  1NPQ A;  1BR1 B;  1KFU L;  3BUW B;  3PN7 B;  2OTG B;  2F3Z A;  2OS8 B;  2WCH A;  1DEL A;  3AKB A;  1NWD A;  2PQL A;  4MVF A;  5FI6 A;  3CYZ A;  2M1K B;  1EH2 A;  1F4Q A;  3L4L A;  3SIB A;  1JF2 A;  2HF5 A;  5CPV A;  3OB1 B;  1SCM C;  3NSO A;  1B1G A;  3OX6 A;  1J7Q A;  1CDP A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  3SG6 A;  3D76 A;  1F71 A;  4ZCU A;  1XYD A;  3A8R A;  4BY5 A;  5DKQ A;  1K96 A;  1Q80 A;  1IG5 A;  1K95 A;  1XFW O;  2CXJ A;  2F3Y A;  2O60 A;  2PMY A;  4FQT A;  1OQP A;  3D77 A;  4PE0 A;  4F0Z B;  1J7R A;  2A4J A;  1UHK A;  2EHB A;  2LNK A;  2MLF C;  2BL0 C;  1KQV A;  2L2C A;  4ORB B;  3S0B A;  5K89 A;  3K1E A;  1IH0 A;  3GOF A;  4N5X A;  3EK4 A;  3D75 A;  2KBM A;  1ORG A;  2LC5 A;  1ZAC A;  3EVU A;  1QLK A;  1V1F A;  4IJ7 A;  5FYX A;  3VRR A;  2KI4 B;  1CFF A;  1JWD A;  1ZFS A;  3SIA A;  2WCM A;  1EXR A;  2LCP A;  4I5K A;  3SG4 A;  2GTE A;  3CTN A;  4L9M A;  2JZI A;  2SAS A;  1BMO A;  1ZMZ A;  2KI6 D;  2NZ0 A;  1OMR A;  1SR6 B;  4M2Q A;  3V2L A;  1KSM A;  1L2O C;  1ZUZ A;  2P71 A;  2FCD A;  4NDD A;  1PK0 D;  4TNC A;  1BF5 A;  3KEV A;  2F2P A;  4ORC B;  4A4B A;  3EG5 B;  1A75 A;  2KFG A;  2L98 A;  2LLT A;  1G4Y R;  5FI2 A;  1C3Z A;  3JVT B;  3D73 A;  4WQ3 A;  1QV1 A;  1YUU A;  1TCF A;  3SG5 A;  3KHE A;  3I5H C;  2G9B A;  1AUI B;  1AP4 A;  4MEW A;  2L2E A;  1AK8 A;  1N65 A;  2M8U A;  2JT0 A;  5DIC A;  5PAL A;  1XFZ O;  3FS7 A;  1Z2C B;  1Y1A A;  2BL0 B;  3CR2 A;  4HSZ A;  1Z4H A;  2K2A A;  1JSA A;  2LUC A;  4BY4 A;  2HQW A;  1B4C A;  1QAS A;  1YRT B;  1XK4 C;  1BJF A;  1AVS A;  1BOC A;  1W7I B;  1XFV O;  1EG4 A;  2QDI A;  3DZT A;  4CLN A;  4GFT A;  4MRY A;  1YUS A;  1NCY A;  2K0J A;  2HQ8 A;  1DGV A;  1S1E A;  2Q91 A;  3FE6 A;  2K2F A;  3R1O A;  4YGD B;  4AQI A;  1KK7 Z;  1K9K A;  1YVH A;  2PRU A;  1AHR A;  1M31 A;  2CT9 A;  1QIV A;  4PHK A;  3D74 A;  2KGR A;  1OSA A;  1TN4 A;  1YR5 A;  2WC6 A;  1GGW A;  1SCV A;  1DJZ A;  2ERB A;  2FJY A;  1LXF C;  1QX5 B;  1TTX A;  3HX4 A;  3EVV A;  3DYE A;  2OTG C;  2E6W A;  1CLM A;  2OS8 C;  2KQ6 A;  1GJY A;  4XJK A;  2FOT A;  2Y4Q A;  3WXA A;  3S0A A;  1SBJ A;  2M7N A;  3CDN A;  5CSI A;  3I5H B;  1NX0 A;  1BT6 A; 
#chains in the Genus database with same CATH homology
 4YGC B;  4FTG A;  3DVJ A;  4PDZ A;  5BPJ A;  1JBA A;  5GQQ C;  2MBX A;  1MF8 B;  3C1V A;  1SY9 A;  1CKK A;  2ZN9 A;  4MRX A;  4PE7 A;  1DMO A;  3EK7 A;  1R2U A;  1YVL A;  2M97 A;  2MRD A;  2WOS A;  1B9A A;  4OR9 B;  4QJ3 B;  1R6P A;  1PUL A;  4C0J A;  1B8C A;  1TIZ A;  2GV5 A;  1QJT A;  3QRX A;  4PHM A;  2R2I A;  2M29 A;  2JTT A;  1BOD A;  4NDC A;  2Y1M A;  3LK0 A;  1RJV A;  4C0L A;  1IWQ A;  4MN0 A;  3I5F C;  1WRZ A;  3DF0 A;  3EVR A;  1YTZ C;  3BXK A;  1J7O A;  4HRE E;  3D0Y B;  4UPG A;  1GQM A;  1LVC D;  2LVV A;  2EGD A;  2ZN8 A;  2ZKM X;  4PHN A;  3SJS A;  1KCY A;  1K93 D;  1MWN A;  2JUL A;  5HKY A;  1CM4 A;  1SR6 C;  2ZNE A;  1GGZ A;  2JNX A;  1DJI A;  1PVB A;  2KYC A;  4P2Y B;  4ETO A;  1K8U A;  2ISD A;  1QVI Z;  1W7J B;  1NSH A;  3JVT C;  1X02 A;  2KNE A;  5DKR A;  4DS7 A;  1KFX S;  1DT7 B;  1ODB A;  2I2R E;  2NCP A;  2PAL A;  4CFQ A;  2L51 A;  3FIA A;  3TDI A;  1IJ6 A;  2K8M B;  2JQ6 A;  3TDU A;  1RRO A;  4YRU A;  4NQG A;  1KFX L;  1J1D A;  1J7P A;  1IKU A;  1IQ5 A;  3AAK A;  5I8N A;  2BKH B;  2LAN A;  1HT9 A;  3EKJ A;  2LE9 B;  1CDM A;  4R1E A;  1AJ5 A;  5ER5 A;  3VRO A;  1WDC C;  2JXL A;  1CB1 A;  3I5F B;  1N2D A;  1XFX O;  2L0P A;  2LV7 A;  3BOW B;  1TNX A;  1YRU B;  1B7T Y;  1A29 A;  1YUT A;  2H61 A;  4CPV A;  3VRN A;  2KAY A;  1UHJ A;  1RTP 1;  1CM1 A;  1K94 A;  1TRF A;  2JNF A;  3TZ1 A;  4DUQ A;  2M49 B;  3BUN B;  4DIR A;  1DJH A;  2ZRS A;  3IF7 A;  5KSZ A;  2KGB C;  2I7A A;  5CSJ A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  2BE4 A;  4OVN F;  1C7W A;  1PRW A;  4PE4 A;  1K9P A;  2BKI B;  2WCF A;  4GPL B;  1V1G A;  3EK8 A;  2JPT A;  3O78 A;  2F33 A;  5HYD A;  1S5G Y;  5AEQ A;  1MR8 A;  3BOW A;  5CSN A;  4IL1 A;  4CFR A;  3VGO A;  2NXQ A;  1TCO B;  2CCM A;  3FWB A;  3MSE B;  2GGM A;  3PAL A;  3LL8 B;  4C0K A;  3DVK A;  3PAT A;  4XYN A;  2F8P A;  1CMG A;  1Y0V H;  5D7F A;  5D69 A;  4MBE A;  3D10 A;  1B8L A;  4YGE B;  1CLB A;  1WDC B;  2L4I A;  1DF0 B;  1C07 A;  1UP5 A;  2M0R A;  1WRK A;  3O4Y A;  2M1U A;  4YI9 A;  1SNL A;  1UHI A;  2O5G A;  3RLZ A;  3OB2 B;  2HPS A;  2Q4U A;  2KAX A;  3I5I C;  1UWO A;  2BBN A;  1J1E A;  4MZJ A;  4HRH A;  4QJ5 B;  3TUY C;  1BG1 A;  2LM5 A;  1F4O A;  2D8N A;  4I5J A;  4PCW A;  4YBH B;  3CR4 X;  4DRW A;  2KFF A;  1VRK A;  1M63 B;  2QAC A;  1REC A;  1CLL A;  1ZOT B;  2SCP A;  1DJX A;  5CSF A;  3DD4 A;  1F70 A;  1K90 D;  3KO0 A;  2IS9 A;  2JWW A;  1C7V A;  3WHU B;  1DJG A;  1SYM A;  4YGB B;  2I18 A;  4MZL A;  1YX7 A;  5HKW A;  5AFP A;  2LMV A;  1UHH A;  3H4S E;  1K9U A;  1CTR A;  1SL8 A;  2Y1N A;  1KQM C;  1NCX A;  5AER A;  1JFJ A;  1M46 A;  1QAT A;  2LLU A;  1B8R A;  5AAN A;  5HLV A;  3WNX B;  4E68 A;  1DJY A;  4YGA A;  1SRA A;  3GK4 X;  1DGU A;  2WC8 A;  2FCE A;  4AOM A;  1FI5 A;  2LUX A;  1MXE A;  4GBA A;  1QX2 A;  3I5I B;  1JF0 A;  3TUY B;  4GUK A;  1WRL A;  3AKA A;  1PSB A;  3K21 A;  4N1G A;  5F6T A;  4GGF C;  2EC6 C;  3ICB A;  3VRP A;  4PAL A;  1JC2 A;  1OMV A;  2JU0 A;  1EL4 A;  2HET A;  1OOJ A;  2QPT A;  5DKN A;  2MHH A;  1XO5 A;  2JOJ A;  3TDZ A;  4JPZ B;  3I5G C;  1XK4 A;  3NSL A;  1NX2 A;  1CNP A;  2NLN A;  1NCZ A;  2ZND A;  2K7D A;  2LVI A;  3F45 A;  4Q04 A;  1OMD A;  4AQJ A;  1H4B A;  1KWO C;  4NDB A;  2MLE C;  5I2O A;  1EJ3 A;  1PVA A;  1KQM B;  1OE9 B;  2Y5I A;  3AAJ A;  3NXA A;  1FPW A;  1CDL A;  1ALW A;  2BE6 A;  2KYF A;  2KI6 C;  3CWG A;  3D0Y A;  3EKH A;  3PFV A;  4OV2 A;  1AJ4 A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  3ZWH A;  2P6B B;  3CS1 A;  1A03 A;  1KSO A;  1NX3 A;  1LKJ A;  1NX1 A;  2JTZ A;  3CLN A;  1FI6 A;  1KK7 Y;  2DOQ A;  3IQQ A;  4ZCV A;  4GAO A;  1M39 A;  1MHO A;  1RK9 A;  1OZO A;  1UUR A;  2KDH A;  1CFC A;  1QTX A;  1LA0 A;  1RFJ A;  1PAL A;  3O6B A;  2JC2 A;  2KOT A;  5JOL A;  2EC6 B;  1WLZ A;  4GGN A;  1LIN A;  1EG3 A;  4YI8 A;  5B8I B;  3A4U B;  1FW4 A;  1NUB A;  1XFY O;  1QX7 A;  3GK2 A;  3OHM B;  2OPO A;  1TNQ A;  1MUX A;  3I5G B;  5JJG A;  3NSK A;  1H8B A;  2K61 A;  1WY9 A;  3OP0 A;  1XA5 A;  1SMG A;  1A75 B;  3BYA A;  3GK1 A;  4I5L B;  1MQ1 A;  1KWO B;  1BU3 A;  1TNP A;  2JRF A;  1IRJ A;  2LVJ A;  1SW8 A;  1BLQ A;  3SG2 A;  5I2Q A;  4P5O E;  2AAO A;  2MAZ A;  3BUO B;  1Y1U A;  4GGF A;  2COL B;  1S26 D;  2M9G A;  2E30 A;  2WCE A;  3PSR A;  2WOR A;  3DVE A;  2BCB A;  2KSP A;  2L4H A;  1F8H A;  1JFK A;  2LP2 A;  1DJW A;  2WCB A;  3JTD C;  1YUR A;  3NSI A;  2JXC A;  1L7Z A;  1WLM A;  2L50 A;  5J3X A;  1CDN A;  2LLS A;  4JWQ A;  2K7C A;  2KHN A;  1SPY A;  1Y6W A;  1M45 A;  1SCM B;  4CID A;  3IQO A;  1CFP A;  1U5I B;  2LVK A;  4ICB A;  4USL A;  1S6J A;  1FBV A;  1XFU O;  2BBM A;  1DTL A;  3BUM B;  5HLO A;  2ZRT A;  3WHT B;  1N0Y A;  2FJU B;  2H2K A;  3E3R A;  3KF9 A;  3SG7 A;  1UUS A;  1SL7 A;  2KFH A;  4MSP A;  4M2O A;  1S36 A;  2JT8 A;  1QVI Y;  2CBL A;  1IGV A;  2KQY A;  4XJK B;  1IQ3 A;  2ZFD A;  2V53 A;  4JQ0 D;  1K2H A;  4GNK B;  4WQ2 A;  2LHI A;  1F54 A;  3TS5 C;  1OZS A;  1J55 A;  3BUX B;  1DF0 A;  2B1U A;  2JT3 A;  3LK1 A;  1E8A A;  1S6C A;  1U5I A;  4QJ4 B;  2M7L A;  2F2O A;  1CFD A;  4FQO A;  4PHJ A;  5HKZ A;  1QS7 A;  1IJ5 A;  3HCM A;  5TNC A;  3SG3 A;  2K7B A;  3CR5 X;  1L2O B;  3JTD B;  2NCO A;  1G8I A;  1B7T Z;  3O2P A;  4U8D A;  1KK8 C;  4D1E A;  4OKH A;  3PN7 C;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  1QV0 A;  3KPX A;  4I5N B;  2BEC A;  2GGZ A;  1B47 A;  2G2B A;  1BR4 B;  5KTY A;  5KU1 A;  2PVB A;  4M2P A;  2I94 A;  3BQ3 A;  4A4C A;  1MXL C;  1CMF A;  1G33 A;  2LMT A;  3M0W A;  3DF0 B;  4PE1 A;  3CZT X;  4MZK A;  2H61 C;  1A2X A;  3CGA A;  1XVJ A;  1HQV A;  1SL9 A;  5AXI A;  1D1O A;  2CNP A;  4WRI A;  1NP8 A;  3PM8 A;  1S5G Z;  3DVM A;  4OCI A;  2BCX A;  1NIW A;  3FWC A;  3RM1 A;  2KAV A;  2WND A;  2LHL A;  4DCK A;  3ZNI A;  3TS5 B;  2BCA A;  1KFU S;  3LLE A;  2LMU A;  1S6I A;  1SK6 D;  5IBW A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2MJW B;  2VRG A;  4MLW A;  1DVI A;  1ALV A;  2M3W A;  2K7O A;  2KI4 C;  4N1F A;  1PSR A;  2LP3 A;  2TN4 A;  1UHN A;  1RWY A;  2PSR A;  2RGI A;  1A4P A;  5ER4 X;  5G08 A;  1LA3 A;  5I2L A;  2PAS A;  3PLF B;  1KK8 B;  1NPQ A;  1BR1 B;  1KFU L;  3BUW B;  3PN7 B;  2OTG B;  2F3Z A;  2OS8 B;  3AKB A;  1NWD A;  4MVF A;  2M1K B;  1EH2 A;  1F4Q A;  3SIB A;  1JF2 A;  2HF5 A;  5CPV A;  3OB1 B;  1SCM C;  3NSO A;  1B1G A;  3OX6 A;  1J7Q A;  1CDP A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  3SG6 A;  1F71 A;  4ZCU A;  1XYD A;  3A8R A;  4BY5 A;  5DKQ A;  1K96 A;  1Q80 A;  1IG5 A;  1K95 A;  1XFW O;  2CXJ A;  2F3Y A;  2O60 A;  2PMY A;  4PE0 A;  1OQP A;  3VRQ A;  4F0Z B;  1J7R A;  2A4J A;  1UHK A;  2EHB A;  2LNK A;  2MLF C;  2BL0 C;  1KQV A;  4ORB B;  5K89 A;  1IH0 A;  3GOF A;  4N5X A;  3EK4 A;  2KBM A;  3EVU A;  2LC5 A;  1ZAC A;  1JWD A;  1QLK A;  1V1F A;  5FYX A;  3VRR A;  1CFF A;  2KI4 B;  1ZFS A;  3SIA A;  1EXR A;  2LCP A;  4I5K A;  3SG4 A;  3CTN A;  4L9M A;  2JZI A;  2SAS A;  1BMO A;  1ZMZ A;  2KI6 D;  2NZ0 A;  1OMR A;  1SR6 B;  4M2Q A;  1KSM A;  1L2O C;  1ZUZ A;  2FCD A;  4NDD A;  1PK0 D;  4TNC A;  1BF5 A;  3KEV A;  2F2P A;  4ORC B;  4A4B A;  1A75 A;  2KFG A;  2L98 A;  2LLT A;  1G4Y R;  3JVT B;  4WQ3 A;  1QV1 A;  1YUU A;  1TCF A;  3SG5 A;  3KHE A;  3I5H C;  2G9B A;  1AUI B;  1AP4 A;  4MEW A;  2L2E A;  1AK8 A;  1N65 A;  2M8U A;  2JT0 A;  5PAL A;  1XFZ O;  3FS7 A;  1Y1A A;  2BL0 B;  3CR2 A;  4HSZ A;  2K2A A;  1JSA A;  2LUC A;  4BY4 A;  2HQW A;  1B4C A;  1QAS A;  1YRT B;  1XK4 C;  1BJF A;  1AVS A;  1BOC A;  1W7I B;  1XFV O;  1EG4 A;  4CLN A;  4GFT A;  4MRY A;  1YUS A;  1NCY A;  2K0J A;  2HQ8 A;  1DGV A;  1S1E A;  2Q91 A;  4AQI A;  2K2F A;  4YGD B;  1KK7 Z;  1K9K A;  1YVH A;  2PRU A;  1AHR A;  1M31 A;  2CT9 A;  1QIV A;  4PHK A;  2KGR A;  1OSA A;  1TN4 A;  1YR5 A;  1GGW A;  1SCV A;  1DJZ A;  1LXF C;  1QX5 B;  1TTX A;  3HX4 A;  3EVV A;  2OTG C;  2E6W A;  1CLM A;  2OS8 C;  2KQ6 A;  1GJY A;  4XJK A;  2FOT A;  2Y4Q A;  3WXA A;  1SBJ A;  2M7N A;  5CSI A;  3I5H B;  1NX0 A;  1BT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...