3LCPC

Crystal structure of the carbohydrate recognition domain of lman1 in complex with mcfd2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
68
Chain Sequence
b'EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Crystal structure of the LMAN1-CRD/MCFD2 transport receptor complex provides insight into combined deficiency of factor V and factor VIII.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 68
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lcpC00
2LE9B 2KNEA 3EK7A 1NCYA 5DKQA 1M46A 1IRJA 1KK7Y 3O78A 3GK4X 4DIRA 1UHIA 4MVFA 2LLUA 1G33A 1KWOB 3BOWA 1B7TZ 3K21A 1LKJA 5DKNA 1IKUA 4N1GA 4MSPA 1BR1B 1RFJA 5I2LA 1SNLA 2FCEA 1BMOA 2LAPA 1CDLA 5AXIA 4GPLB 1PALA 2LM5A 4YI8A 1NPQA 1YRTB 2LMUA 2HETA 4A4BA 2D8NA 1SYMA 2SASA 3PALA 1QIWA 1CLBA 3IQOA 2K7CA 5CSNA 1M45A 4CIDA 1W7IB 3M0WA 4I5JA 1ODBA 1Y1AA 5KTYA 1XFWO 2GGZA 3SG2A 1SRAA 4PE4A 1YURA 1V1GA 1B1GA 3NSLA 1FF1A 1OE9B 4MRYA 4FTGA 1WDCC 2E30A 2L98A 1SL9A 1SKTA 3IF7A 3O4YA 1ZFSA 1JFJA 4XJKA 3CR2A 3EK4A 4OCIA 3TS5C 2L5XB 4L9MA 2O60A 2CCMA 3D0YB 3MSEB 1RECA 2JT8A 2LHLA 2P6BB 1HQVA 1BODA 5CSFA 2MHHA 1S6IA 2M9GA 1S3PA 3CR5X 4PHJA 1SL7A 2WOSA 4OVNF 1JUOA 1EH2A 2HQWA 1YTZC 4OKHA 1CNPA 3EKHA 3SIBA 2CTNA 1S6CA 1S6JA 2JT3A 4D1EA 2L0PA 4CFRA 2L4HA 2ZN8A 2F33A 4AQIA 1PVBA 2OTGC 1PSBA 1A2XA 3SJSA 3OX5A 2GGMA 4MZKA 2L2EA 1KFXS 4TNCA 1C7VA 2ZN9A 3JVTB 3I5IB 3CZTX 1NWDA 1FI6A 2DOQA 2H2KA 3OX6A 4QJ3B 1XFVO 1U5IA 1BG1A 2LCPA 2L51A 1JBAA 1QV1A 2FCDA 3GOFA 4M2PA 5CSIA 1JC2A 4C0JA 2BE4A 3BUMB 2Y4QA 1AP4A 1YVHA 1QV0A 3BUXB 1YVLA 1WLMA 2KFFA 1DJGA 1GGWA 1TN4A 2PASA 1B47A 2R2IA 1QX7A 2KGRA 3DD4A 2KOTA 1L7ZA 3FWCA 3LL8B 2M49B 1TIZA 2Q4UA 1QASA 1R6PA 1MR8A 1G8IA 2ZNDA 4CLNA 1MUXA 1IJ5A 1PVAA 2NXQA 4MEWA 4NDCA 4USLA 2FOTA 2EC6C 1IQ5A 3KPXA 1S5GY 3I5HB 4DCKA 1NP8A 2ZRTA 4FQOA 3VROA 3LCPC 4C0LA 4P5OE 2LMTA 1BLQA 1XFUO 2K61A 1S26D 2KAXA 3D10A 1M31A 3KEVA 3PLFB 2CT9A 1SBJA 1JFKA 1F71A 2E6WA 2F3ZA 3DVKA 3I5GB 4DRWA 3BUNB 1QS7A 2F2OA 3SG3A 2KAVA 1CFDA 1IWQA 1HT9A 2JQ6A 3GK1A 1ZMZA 3LK1A 4NDDA 1A03A 2I2RE 1XA5A 2I94A 1BT6A 3CR4X 1EXRA 2OS8C 4P2YB 1B4CA 5CPVA 1Y6WA 2JULA 3H4SE 5AANA 2LANA 1Q80A 2PSRA 4YI9A 1Y1XA 2NCOA 1B9AA 4GFTA 2MBXA 2Y5IA 1ZUZA 1BU3A 1SL8A 3PATA 1NUBA 4IL1A 2ZFDA 3TUYC 1KQMB 3JTDC 5KU1A 1QLSA 3O6BA 4GAOA 2JWWA 4C0KA 2HQ8A 3SG5A 1CDMA 1NCZA 4MN0A 1L2OC 1NYAA 5HKYA 1SR6C 1BOCA 1SCMC 5I8NA 2LP2A 1QVIZ 3PN7B 1WLZA 1SY9A 3I5FC 2JPTA 2JRFA 1X02A 4QJ5B 2KFGA 1KCYA 1QX5B 1UURA 4JWQA 1IQ3A 1OOJA 1C7WA 3CS1A 4JPZB 2V53A 4R1EA 1S36A 3GK2A 1KWOC 3TZ1A 1RWYA 2K0JA 2KYCA 1QLKA 4PE7A 5D69A 1DJXA 2RGIA 2LVKA 1JF2A 5G08A 1DTLA 1J1DA 3KO0A 4DS7A 1K90D 2K7DA 4ETOA 2M7LA 1UUSA 2M7NA 1A75B 2A4JA 4GBAA 3E3RA 1GGZA 1DGUA 4PHMA 1LXFC 2H61A 3RLZA 3VGOA 2CXJA 1TNPA 1YX7A 2KBIA 2AMIA 2MLEC 4MLWA 2FJUB 1QATA 5KSZA 1XFYO 1CTRA 1XK4A 2KI4B 1B7TY 5HKZA 2H61C 1J7RA 1WRLA 2LLTA 2M97A 3D0YA 4GNKB 2KFHA 1K9PA 3OHMB 4HSZA 2I18A 4M2QA 1AVSA 4ORBB 1CFPA 2PVBA 1OZOA 3WHTB 3CTNA 1RTP1 4PCWA 5HKWA 1QX2A 4PE0A 2LC5A 1CLLA 1KQVA 2OTGB 1N0YA 4I5LB 1M39A 2G2BA 2WORA 3NXAA 3OB1B 3C1VA 3BXKA 1K95A 1UHKA 4YGBB 4UPGA 1B8LA 1KFXL 2JTZA 1TNQA 4I5KA 4OV2A 3EK8A 1OMVA 1NX3A 5HYDA 1OZSA 2QACA 1J7PA 1AJ4A 2KGBC 2B1UA 1W7JB 1TTXA 3AKAA 3OB2B 1DF0B 1PSRA 1DGVA 5I2OA 1UHJA 3WXAA 2MAZA 2PRUA 2LV7A 1DJIA 4YRUA 3JVTC 3CGAA 2JZIA 1K94A 3I5IC 1R2UA 5AERA 3O2PA 1PULA 1SMGA 3FS7A 4MBEA 5F6TA 5B8IB 1B8CA 1CM1A 2ZNEA 4YGAA 1NX1A 2BE6A 5ER5A 1H8BA 1KK8B 4YGDB 3HCMA 5TNCA 1VRKA 1QJTA 1SK6D 1MWNA 5D7FA 4YBHB 2LVIA 2ZRSA 4F0ZB 4Q04A 2NCPA 3SG4A 3TDUA 1LINA 1KK7Z 3VRPA 4MRXA 4OR9B 1BF5A 2M3WA 3SIAA 3PM8A 1D1OA 2KBMA 3DF0B 3FIAA 2K7OA 1XFXO 1DJZA 2COLB 4HRHA 1FW4A 1XVJA 2Y1NA 1YUSA 2OS8B 1LA3A 2LUCA 1GQMA 1OMRA 1F4QA 2WCFA 1IJ6A 2M8UA 3DVEA 1E8AA 1CKKA 1LVCD 3NSKA 2KAYA 2JXLA 5PALA 2K2FA 4YGCB 3KHEA 3TUYB 2K8MB 1K93D 2ZKMX 3AKBA 4HRGA 3I5GC 3VRRA 4CFQA 1FI5A 5ER4X 3RM1A 1SCVA 1PRWA 3BYAA 5AEQA 1XO5A 1CDNA 1WRKA 4XYNA 2M29A 3CWGA 1K9UA 2G9BA 3FWBA 2CNPA 2WCEA 3BQ3A 2LLSA 2SCPA 1EJ3A 1N2DA 1S1EA 3HX4A 1IH0A 2EHBA 5HLVA 1B8RA 1LA0A 3BOWB 1F8HA 2BL0C 1NSHA 4PHKA 2BECA 1RK9A 2EGDA 2BCBA 3EVVA 1XYDA 2BKIB 2WCBA 3AAJA 5IBWA 1F4OA 1KQMC 2LNKA 4YGEB 5CSJA 3LLEA 3PFVA 4CPVA 1TNXA 1UHHA 2NLNA 1AJ5A 2HPSA 1FBVA 1K96A 1N65A 1TRFA 3EVRA 2M0RA 3LK0A 3QRXA 3PSRA 2BKHB 4NQGA 1YUUA 1UP5A 3VRQA 1J1EA 1WDCB 4ORAB 3PN7C 2JNFA 1YX8A 3TS5B 3WHUB 2L50A 1NX2A 2OPOA 3TDIA 1CDPA 1F55A 1DJHA 2BCAA 1V1FA 2JC2A 1GJYA 1XFZO 2KQ6A 2KYFA 2QPTA 3KF9A 4U8DA 2PALA 2IS9A 1PK0D 1QIVA 4MZJA 1CM4A 4XJKB 5GQQC 2Q91A 3BUOB 3F45A 1A75A 1YR5A 1OMDA 1G4YR 3ICBA 4PALA 1ZOTB 1AUIB 2Y1MA 1NCXA 1MQ1A 3DVMA 5FYXA 5J3XA 2KSPA 4N1FA 1XK4C 3NSIA 4ZCUA 1QVIY 1CLMA 1KSMA 4PDZA 1DJWA 4AOMA 2MRDA 3ZNIA 2JT0A 2MLFC 3VRNA 1JF0A 1DVIA 3AAKA 1EG3A 1RJVA 4MZLA 1C07A 1SPYA 2GV5A 1MXEA 2K7BA 4JQ0D 4ORCB 1YRUB 1MXLC 2JNXA 2LVJA 1J55A 4WRIA 4AQJA 5JJGA 1CMFA 1F54A 2KI4C 3CLNA 2ISDA 2F3YA 2JOJA 2LHIA 4M2OA 4A4CA 1MHOA 2TN4A 1JWDA 1TCFA 1F70A 1MF8B 4DUQA 1A29A 1K8UA 1S5GZ 1J7OA 1BJFA 1QXPA 2M1KB 4QJ4B 1U5IB 3NSOA 2KHNA 1WRZA 1TOPA 1UWOA 2PMYA 4ZCVA 1DF0A 2LVVA 5K89A 4N5XA 1JSAA 1Y1UA 5JOLA 1QTXA 3WNXB 2F2PA 2HF5A 1K9KA 2EC6B 3EKJA 2KQYA 2MA2A 3IQQA 1AK8A 1OQPA 1DMOA 1FPWA 2NZ0A 1ALWA 2VRGA 2MJWB 2WNDA 4NDBA 3SG6A 2KDHA 1OSAA 3DVJA 1TNWA 1DT7B 1CB1A 1ZACA 1J7QA 2O5GA 4BY4A 3TDZA 1BR4B 1KSOA 1A4PA 1RROA 2LMVA 3A8RA 4GGFA 1IG5A 2M1UA 4GUKA 4ICBA 1UHNA 2AAOA 1KK8C 2JU0A 2KI6C 1AHRA 2L4IA 1H4BA 1M63B 2BCXA 5BPJA 3I5HC 3BUWB 1EL4A 2JXCA 4GGFC 1IGVA 5DKRA 1DJYA 2I7AA 2BBMA 2CBLA 1ALVA 3DF0A 1NX0A 1CFCA 2JTTA 1CMGA 1YUTA 3OP0A 4PHNA 5I2QA 2F8PA 3A4UB 1TCOB 2WC8A 2AUCA 3JTDB 1K2HA 4E68A 4BY5A 1NIWA 4WQ3A 1SW8A 3ZWHA 1EG4A 1L2OB 3EVUA 4I5NB 1SR6B 2K2AA 5HLOA 1SCMB 5AFPA 1CFFA 4GGNA 1KFUS 1WY9A 4HREE 2LP3A 2KI6D 4PE1A 4WQ2A 2BL0B 1Y0VH 1KFUL 2BBNA 3I5FB 2LUXA 3SG7A
chains in the Genus database with same CATH superfamily
2ERBA 2LE9B 2KNEA 3EK7A 1NCYA 5DKQA 1M46A 1IRJA 1KK7Y 3O78A 3GK4X 4DIRA 1UHIA 2QEVA 3R1OA 4MVFA 2LLUA 3IVTA 1G33A 1KWOB 3BOWA 1B7TZ 3K21A 1LKJA 5DKNA 1IKUA 4N1GA 4MSPA 1BR1B 1RFJA 5I94A 5I2LA 2WCKA 1SNLA 4OZDA 2FCEA 1BMOA 2LAPA 1CDLA 5AXIA 4GPLB 1PALA 2LM5A 4YI8A 1NPQA 1YRTB 3PJIA 2LMUA 2HETA 4A4BA 1T14A 1SYMA 2D8NA 2SASA 3PALA 1QIWA 1CLBA 3B88A 3CZ0A 3IQOA 2K7CA 5CSNA 1M45A 4CIDA 1W7IB 3M0WA 4I5JA 1ODBA 1Y1AA 5KTYA 1XFWO 2GGZA 1Z4HA 1SRAA 3SG2A 4PE4A 1YURA 1V1GA 5FI7A 3NSLA 1B1GA 1FF1A 1OE9B 4MRYA 3FE8A 4FTGA 1WDCC 2E30A 2L98A 1SL9A 1SKTA 3IF7A 3O4YA 1ZFSA 1JFJA 3L4LA 4XJKA 1GM0A 3SS3A 3CR2A 3EK4A 4OCIA 3TS5C 2L5XB 4L9MA 2O60A 2CCMA 3D0YB 3MSEB 1RECA 2JT8A 2LHLA 2P6BB 1HQVA 1BODA 5CSFA 2WC6A 2MHHA 1S6IA 2M9GA 1S3PA 3CDNA 3CR5X 4PHJA 3SS4A 1SL7A 3BFHA 2WOSA 4OVNF 1JUOA 1EH2A 2HQWA 1YTZC 4OKHA 1CNPA 3EKHA 3SIBA 2CTNA 3CZ2A 1S6CA 1S6JA 2JT3A 3R1VA 1OOFA 3DZTA 2L0PA 4D1EA 3D74A 4CFRA 2L4HA 2ZN8A 2F33A 1SSEB 1Z2CB 2P71A 3N7HA 4AQIA 1PVBA 2OTGC 1PSBA 1A2XA 3SJSA 3OX5A 2GGMA 4MZKA 1XFRA 2L2EA 1KFXS 4TNCA 1C7VA 2ZN9A 3JVTB 3I5IB 1OOIX 3CZTX 1NWDA 3UO9A 1FI6A 2DOQA 2H2KA 3OX6A 4QJ3B 1XFVO 3CYZA 1ORGA 1U5IA 1BG1A 2LCPA 2L51A 3L47A 2BAPA 1QV1A 2FCDA 3GOFA 4M2PA 5CSIA 1JC2A 1JBAA 5D3OA 4C0JA 2BE4A 3BUMB 2Y4QA 1AP4A 1YVHA 1QV0A 3BUXB 1YVLA 4IJ7A 1WLMA 2KFFA 1DJGA 1LS8A 1GGWA 1TN4A 2PASA 1B47A 2R2IA 1QX7A 2KGRA 3DD4A 2KOTA 2WCLA 1L7ZA 3FWCA 3LL8B 2M49B 1TIZA 2Q4UA 1QASA 1R6PA 1MR8A 1TWOA 1G8IA 2ZNDA 4CLNA 1MUXA 1IJ5A 1PVAA 2NXQA 4MEWA 4NDCA 4USLA 2FOTA 2EC6C 2L5YA 1IQ5A 3KPXA 1S5GY 3RZSA 3I5HB 4DCKA 1NP8A 2ZRTA 4FQOA 3VROA 3LCPC 4C0LA 4P5OE 2LMTA 1BLQA 1XFUO 2K61A 1S26D 2KAXA 3D10A 1M31A 3KEVA 3PLFB 2CT9A 1SBJA 1JFKA 1F71A 2E6WA 2F3ZA 3DVKA 3I5GB 4DRWA 3BUNB 1DELA 1QS7A 2F2OA 3SG3A 2KAVA 1DQEA 1CFDA 1IWQA 1HT9A 2JQ6A 3GK1A 1ZMZA 3LK1A 4NDDA 4PT1A 1A03A 2I2RE 1XA5A 2I94A 1BT6A 3CR4X 1EXRA 2OS8C 2WC5A 3D73A 4P2YB 5CPVA 1Y6WA 2JULA 3H4SE 5AANA 2LANA 1Q80A 2PSRA 4YI9A 1Y1XA 2NCOA 1B9AA 3S0AA 4GFTA 2MBXA 2Y5IA 1ZUZA 3S0GA 1BU3A 1SL8A 3PATA 1NUBA 4IL1A 2ZFDA 3TUYC 1KQMB 2KLDA 3JTDC 5KU1A 1QLSA 3O6BA 4GAOA 2JWWA 4C0KA 2HQ8A 3SG5A 1CDMA 1NCZA 4MN0A 1L2OC 1NYAA 5HKYA 1SR6C 1BOCA 1SCMC 5I8NA 2LP2A 2KLEA 2QEHA 1QVIZ 3PN7B 1WLZA 1SY9A 3I5FC 2JPTA 2JRFA 1X02A 4QJ5B 2KFGA 1KCYA 1QX5B 1UURA 4JWQA 1IQ3A 1OOJA 1C7WA 3CS1A 4JPZB 2V53A 4R1EA 1C3ZA 1S36A 3GK2A 1KWOC 3TZ1A 1RWYA 2K0JA 2KYCA 1QLKA 4PE7A 5D69A 1DJXA 2RGIA 2LVKA 1JF2A 5G08A 3D75A 1DTLA 1J1DA 3KO0A 4DS7A 1K90D 2K7DA 4ETOA 2M7LA 1UUSA 3DY9A 2M7NA 3SS5A 1A75B 2A4JA 4GBAA 3E3RA 1GGZA 1DGUA 4PHMA 1LXFC 2H61A 3RLZA 3CZ1A 2CXJA 1TNPA 3VGOA 3S0EA 1YX7A 1W9ZA 2KBIA 2AMIA 2MLEC 3PM2A 4MLWA 2FJUB 3S0FA 1QATA 5KSZA 1XFYO 1CTRA 1XK4A 2KI4B 1B7TY 5HKZA 2H61C 1J7RA 1WRLA 2LLTA 2M97A 3D0YA 4GNKB 2KFHA 1K9PA 3OHMB 4HSZA 2I18A 4M2QA 1AVSA 4ORBB 1CFPA 2PVBA 1OZOA 3WHTB 3CTNA 1RTP1 4PCWA 5HKWA 1QX2A 5FI2A 3D78A 4PE0A 2LC5A 3NHTA 1CLLA 1KQVA 2OTGB 1N0YA 4I5LB 1M39A 2G2BA 2WORA 3NXAA 3OB1B 3C1VA 1OW4A 3BXKA 1K95A 1UHKA 4YGBB 5FI6A 4UPGA 1B8LA 1KFXL 2JTZA 1TNQA 4I5KA 4OV2A 3EK8A 1OMVA 1NX3A 5HYDA 1OZSA 2QACA 1J7PA 1AJ4A 2KGBC 2PYQA 2B1UA 1W7JB 1TTXA 3AKAA 3OB2B 1DF0B 1PSRA 1DGVA 5I2OA 1UHJA 3WXAA 2MAZA 2PRUA 2QEBA 2LV7A 1DJIA 3DXLA 3O4XA 4YRUA 1TUZA 3JVTC 3CGAA 2JZIA 1K94A 3I5IC 1R2UA 5AERA 3O2PA 1PULA 1SMGA 3QMEA 3FS7A 2K60A 4MBEA 5F6TA 1B8CA 5B8IB 1CM1A 2ZNEA 4YGAA 1NX1A 2BE6A 3NHIA 5ER5A 1H8BA 2WCJA 1OOHA 1KK8B 4YGDB 3HCMA 5TNCA 1VRKA 1QJTA 2WCMA 1SK6D 1MWNA 3D77A 4YBHB 2LVIA 2ZRSA 5D7FA 1P28A 4Q04A 4F0ZB 2NCPA 3SG4A 3TDUA 1LINA 5HL1A 1B4CA 1KK7Z 3VRPA 3B87A 4MRXA 4OR9B 2M3WA 3SIAA 3PM8A 1BF5A 1D1OA 2KBMA 3DF0B 3FIAA 2K7OA 1XFXO 1DJZA 2COLB 4HRHA 1FW4A 3FE9A 1XVJA 2H8VA 2Y1NA 1YUSA 2OS8B 1LA3A 3OGNA 2LUCA 1GQMA 1OMRA 1F4QA 3V2LA 2WCFA 1IJ6A 2M8UA 3DVEA 1E8AA 1CKKA 1LVCD 3NSKA 2KAYA 2JXLA 5PALA 2K2FA 4YGCB 3S0DA 3KHEA 2GTEA 3TUYB 2K8MB 1K93D 2ZKMX 3AKBA 4HRGA 3I5GC 4INXA 3VRRA 4CFQA 1FI5A 5ER4X 3RM1A 1SCVA 1PRWA 3BYAA 5AEQA 1XO5A 1CDNA 1WRKA 4XYNA 2M29A 3CWGA 1K9UA 2G9BA 3FWBA 2CNPA 2WCEA 3BQ3A 2LLSA 2SCPA 1EJ3A 1N2DA 1S1EA 3HX4A 1IH0A 2EHBA 5HLVA 1B8RA 1LA0A 3BOWB 1F8HA 2BL0C 5EL2A 1NSHA 3OBVA 2BECA 4PHKA 1RK9A 2EGDA 2BCBA 3EVVA 1XYDA 2BKIB 3R72A 2WCBA 3AAJA 5IBWA 3DYEA 1F4OA 1KQMC 2LNKA 3EG5B 4YGEB 5CSJA 3LLEA 3PFVA 4CPVA 1TNXA 1UHHA 2NLNA 1AJ5A 2HPSA 1FBVA 1K96A 1N65A 1TRFA 3EVRA 2M0RA 3LK0A 3QRXA 3PSRA 2BKHB 4NQGA 1YUUA 1UP5A 3VRQA 1J1EA 1WDCB 4ORAB 3PN7C 4F7FA 2JNFA 1YX8A 1IIOA 3TS5B 3WHUB 2L50A 1NX2A 2OPOA 3TDIA 1CDPA 1F55A 3S0BA 1DJHA 2BCAA 1V1FA 2JC2A 1GJYA 1XFZO 2KQ6A 2KYFA 2QPTA 3KF9A 4U8DA 2PALA 2IS9A 1PK0D 1QIVA 4MZJA 1CM4A 4XJKB 5GQQC 2Q91A 3BUOB 3F45A 1A75A 1YR5A 1OMDA 4KYNA 1G4YR 3ICBA 4PALA 1ZOTB 1AUIB 2Y1MA 1NCXA 1MQ1A 3DVMA 4JKTA 5FYXA 5J3XA 2KSPA 4N1FA 1XK4C 3NSIA 4ZCUA 1QVIY 1CLMA 3BJHA 1KSMA 2JPOA 4PDZA 1DJWA 4AOMA 2MRDA 3ZNIA 2JT0A 2MLFC 2PQLA 3CABA 1JF0A 1DVIA 3VRNA 3AAKA 1EG3A 1RJVA 3K1EA 4MZLA 1C07A 1SPYA 2GV5A 1MXEA 2K7BA 4JQ0D 4ORCB 2FJYA 1OOGA 1YRUB 1MXLC 2JNXA 2LVJA 1J55A 4WRIA 4AQJA 3FE6A 5JJGA 1CMFA 1F54A 3L4AA 2KI4C 3D76A 3CLNA 2ISDA 2F3YA 1TUJA 2JOJA 2LHIA 2QEOA 4M2OA 4A4CA 1MHOA 2TN4A 1JWDA 1TCFA 1F70A 1MF8B 4DUQA 3Q8IA 1A29A 1K8UA 1S5GZ 5DICA 1C3YA 1J7OA 1BJFA 2YGUA 1QXPA 2M1KB 4QJ4B 1U5IB 3BFAA 3NSOA 2KHNA 1WRZA 1TOPA 1UWOA 2PMYA 4ZCVA 1DF0A 2LVVA 3VB1A 3BFBA 4N5XA 5K89A 3B86A 1DC1A 1JSAA 1Y1UA 5JOLA 1QTXA 3WNXB 2F2PA 2HF5A 1K9KA 2EC6B 3EKJA 2KQYA 2L2CA 2MA2A 2QDIA 3IQQA 3R1PA 1AK8A 1OQPA 1DMOA 1FPWA 2NZ0A 1QWVA 1ALWA 2VRGA 2MJWB 2WNDA 4NDBA 3SG6A 4JD9A 2KDHA 1OSAA 3DVJA 1TNWA 1DT7B 1CB1A 2KPHA 1ZACA 1J7QA 2O5GA 4BY4A 3TDZA 1BR4B 1KSOA 1A4PA 1RROA 2LMVA 3A8RA 4GGFA 1IG5A 2M1UA 4GUKA 4ICBA 1UHNA 2AAOA 1KK8C 2JU0A 2P70A 2KI6C 1AHRA 2L4IA 1H4BA 1M63B 2BCXA 5BPJA 3I5HC 3BUWB 4INWA 1EL4A 2JXCA 4GGFC 1IGVA 5DKRA 2BNXA 3B6XA 1DJYA 2I7AA 2BBMA 1DEKA 2CBLA 1ALVA 3DF0A 1NX0A 1CFCA 2JTTA 1CMGA 3B7AA 1YUTA 3OP0A 4PHNA 5I2QA 2F8PA 3A4UB 1TCOB 2WC8A 2AUCA 3JTDB 1K2HA 4E68A 4BY5A 1NIWA 2WCHA 4WQ3A 1SW8A 3ZWHA 3UNWA 1EG4A 1L2OB 3EVUA 4I5NB 1SR6B 2K2AA 5HLOA 1SCMB 5AFPA 1CFFA 4GGNA 1KFUS 1WY9A 4HREE 4FQTA 2LP3A 2KI6D 3NGVA 4PE1A 4WQ2A 2BL0B 1Y0VH 1KFUL 2BBNA 3I5FB 2LUXA 3SG7A
chains in the Genus database with same CATH topology
2LE9B 2KNEA 3EK7A 1NCYA 5DKQA 1M46A 1IRJA 1KK7Y 3O78A 3GK4X 4DIRA 1UHIA 4MVFA 2LLUA 1G33A 1KWOB 3BOWA 1B7TZ 3K21A 1LKJA 5DKNA 1IKUA 4N1GA 4MSPA 1BR1B 1RFJA 5I2LA 1SNLA 2FCEA 1BMOA 2LAPA 1CDLA 5AXIA 4GPLB 1PALA 2LM5A 4YI8A 1NPQA 1YRTB 2LMUA 2HETA 4A4BA 2D8NA 1SYMA 2SASA 3PALA 1QIWA 1CLBA 3IQOA 2K7CA 5CSNA 1M45A 4CIDA 1W7IB 3M0WA 4I5JA 1ODBA 1Y1AA 5KTYA 1XFWO 2GGZA 3SG2A 1SRAA 4PE4A 1YURA 1V1GA 1B1GA 3NSLA 1FF1A 1OE9B 4MRYA 4FTGA 1WDCC 2E30A 2L98A 1SL9A 1SKTA 3IF7A 3O4YA 1ZFSA 1JFJA 4XJKA 3CR2A 3EK4A 4OCIA 3TS5C 2L5XB 4L9MA 2O60A 2CCMA 3D0YB 3MSEB 1RECA 2JT8A 2LHLA 2P6BB 1HQVA 1BODA 5CSFA 2MHHA 1S6IA 2M9GA 1S3PA 3CR5X 4PHJA 1SL7A 2WOSA 4OVNF 1JUOA 1EH2A 2HQWA 1YTZC 4OKHA 1CNPA 3EKHA 3SIBA 2CTNA 1S6CA 1S6JA 2JT3A 4D1EA 2L0PA 4CFRA 2L4HA 2ZN8A 2F33A 4AQIA 1PVBA 2OTGC 1PSBA 1A2XA 3SJSA 3OX5A 2GGMA 4MZKA 2L2EA 1KFXS 4TNCA 1C7VA 2ZN9A 3JVTB 3I5IB 3CZTX 1NWDA 1FI6A 2DOQA 2H2KA 3OX6A 4QJ3B 1XFVO 1U5IA 1BG1A 2LCPA 2L51A 1JBAA 1QV1A 2FCDA 3GOFA 4M2PA 5CSIA 1JC2A 4C0JA 2BE4A 3BUMB 2Y4QA 1AP4A 1YVHA 1QV0A 3BUXB 1YVLA 1WLMA 2KFFA 1DJGA 1GGWA 1TN4A 2PASA 1B47A 2R2IA 1QX7A 2KGRA 3DD4A 2KOTA 1L7ZA 3FWCA 3LL8B 2M49B 1TIZA 2Q4UA 1QASA 1R6PA 1MR8A 1G8IA 2ZNDA 4CLNA 1MUXA 1IJ5A 1PVAA 2NXQA 4MEWA 4NDCA 4USLA 2FOTA 2EC6C 1IQ5A 3KPXA 1S5GY 3I5HB 4DCKA 1NP8A 2ZRTA 4FQOA 3VROA 3LCPC 4C0LA 4P5OE 2LMTA 1BLQA 1XFUO 2K61A 1S26D 2KAXA 3D10A 1M31A 3KEVA 3PLFB 2CT9A 1SBJA 1JFKA 1F71A 2E6WA 2F3ZA 3DVKA 3I5GB 4DRWA 3BUNB 1QS7A 2F2OA 3SG3A 2KAVA 1CFDA 1IWQA 1HT9A 2JQ6A 3GK1A 1ZMZA 3LK1A 4NDDA 1A03A 2I2RE 1XA5A 2I94A 1BT6A 3CR4X 1EXRA 2OS8C 4P2YB 1B4CA 5CPVA 1Y6WA 2JULA 3H4SE 5AANA 2LANA 1Q80A 2PSRA 4YI9A 1Y1XA 2NCOA 1B9AA 4GFTA 2MBXA 2Y5IA 1ZUZA 1BU3A 1SL8A 3PATA 1NUBA 4IL1A 2ZFDA 3TUYC 1KQMB 3JTDC 5KU1A 1QLSA 3O6BA 4GAOA 2JWWA 4C0KA 2HQ8A 3SG5A 1CDMA 1NCZA 4MN0A 1L2OC 1NYAA 5HKYA 1SR6C 1BOCA 1SCMC 5I8NA 2LP2A 1QVIZ 3PN7B 1WLZA 1SY9A 3I5FC 2JPTA 2JRFA 1X02A 4QJ5B 2KFGA 1KCYA 1QX5B 1UURA 4JWQA 1IQ3A 1OOJA 1C7WA 3CS1A 4JPZB 2V53A 4R1EA 1S36A 3GK2A 1KWOC 3TZ1A 1RWYA 2K0JA 2KYCA 1QLKA 4PE7A 5D69A 1DJXA 2RGIA 2LVKA 1JF2A 5G08A 1DTLA 1J1DA 3KO0A 4DS7A 1K90D 2K7DA 4ETOA 2M7LA 1UUSA 2M7NA 1A75B 2A4JA 4GBAA 3E3RA 1GGZA 1DGUA 4PHMA 1LXFC 2H61A 3RLZA 3VGOA 2CXJA 1TNPA 1YX7A 2KBIA 2AMIA 2MLEC 4MLWA 2FJUB 1QATA 5KSZA 1XFYO 1CTRA 1XK4A 2KI4B 1B7TY 5HKZA 2H61C 1J7RA 1WRLA 2LLTA 2M97A 3D0YA 4GNKB 2KFHA 1K9PA 3OHMB 4HSZA 2I18A 4M2QA 1AVSA 4ORBB 1CFPA 2PVBA 1OZOA 3WHTB 3CTNA 1RTP1 4PCWA 5HKWA 1QX2A 4PE0A 2LC5A 1CLLA 1KQVA 2OTGB 1N0YA 4I5LB 1M39A 2G2BA 2WORA 3NXAA 3OB1B 3C1VA 3BXKA 1K95A 1UHKA 4YGBB 4UPGA 1B8LA 1KFXL 2JTZA 1TNQA 4I5KA 4OV2A 3EK8A 1OMVA 1NX3A 5HYDA 1OZSA 2QACA 1J7PA 1AJ4A 2KGBC 2B1UA 1W7JB 1TTXA 3AKAA 3OB2B 1DF0B 1PSRA 1DGVA 5I2OA 1UHJA 3WXAA 2MAZA 2PRUA 2LV7A 1DJIA 4YRUA 3JVTC 3CGAA 2JZIA 1K94A 3I5IC 1R2UA 5AERA 3O2PA 1PULA 1SMGA 3FS7A 4MBEA 5F6TA 5B8IB 1B8CA 1CM1A 2ZNEA 4YGAA 1NX1A 2BE6A 5ER5A 1H8BA 1KK8B 4YGDB 3HCMA 5TNCA 1VRKA 1QJTA 1SK6D 1MWNA 5D7FA 4YBHB 2LVIA 2ZRSA 4F0ZB 4Q04A 2NCPA 3SG4A 3TDUA 1LINA 1KK7Z 3VRPA 4MRXA 4OR9B 1BF5A 2M3WA 3SIAA 3PM8A 1D1OA 2KBMA 3DF0B 3FIAA 2K7OA 1XFXO 1DJZA 2COLB 4HRHA 1FW4A 1XVJA 2Y1NA 1YUSA 2OS8B 1LA3A 2LUCA 1GQMA 1OMRA 1F4QA 2WCFA 1IJ6A 2M8UA 3DVEA 1E8AA 1CKKA 1LVCD 3NSKA 2KAYA 2JXLA 5PALA 2K2FA 4YGCB 3KHEA 3TUYB 2K8MB 1K93D 2ZKMX 3AKBA 4HRGA 3I5GC 3VRRA 4CFQA 1FI5A 5ER4X 3RM1A 1SCVA 1PRWA 3BYAA 5AEQA 1XO5A 1CDNA 1WRKA 4XYNA 2M29A 3CWGA 1K9UA 2G9BA 3FWBA 2CNPA 2WCEA 3BQ3A 2LLSA 2SCPA 1EJ3A 1N2DA 1S1EA 3HX4A 1IH0A 2EHBA 5HLVA 1B8RA 1LA0A 3BOWB 1F8HA 2BL0C 1NSHA 4PHKA 2BECA 1RK9A 2EGDA 2BCBA 3EVVA 1XYDA 2BKIB 2WCBA 3AAJA 5IBWA 1F4OA 1KQMC 2LNKA 4YGEB 5CSJA 3LLEA 3PFVA 4CPVA 1TNXA 1UHHA 2NLNA 1AJ5A 2HPSA 1FBVA 1K96A 1N65A 1TRFA 3EVRA 2M0RA 3LK0A 3QRXA 3PSRA 2BKHB 4NQGA 1YUUA 1UP5A 3VRQA 1J1EA 1WDCB 4ORAB 3PN7C 2JNFA 1YX8A 3TS5B 3WHUB 2L50A 1NX2A 2OPOA 3TDIA 1CDPA 1F55A 1DJHA 2BCAA 1V1FA 2JC2A 1GJYA 1XFZO 2KQ6A 2KYFA 2QPTA 3KF9A 4U8DA 2PALA 2IS9A 1PK0D 1QIVA 4MZJA 1CM4A 4XJKB 5GQQC 2Q91A 3BUOB 3F45A 1A75A 1YR5A 1OMDA 1G4YR 3ICBA 4PALA 1ZOTB 1AUIB 2Y1MA 1NCXA 1MQ1A 3DVMA 5FYXA 5J3XA 2KSPA 4N1FA 1XK4C 3NSIA 4ZCUA 1QVIY 1CLMA 1KSMA 4PDZA 1DJWA 4AOMA 2MRDA 3ZNIA 2JT0A 2MLFC 3VRNA 1JF0A 1DVIA 3AAKA 1EG3A 1RJVA 4MZLA 1C07A 1SPYA 2GV5A 1MXEA 2K7BA 4JQ0D 4ORCB 1YRUB 1MXLC 2JNXA 2LVJA 1J55A 4WRIA 4AQJA 5JJGA 1CMFA 1F54A 2KI4C 3CLNA 2ISDA 2F3YA 2JOJA 2LHIA 4M2OA 4A4CA 1MHOA 2TN4A 1JWDA 1TCFA 1F70A 1MF8B 4DUQA 1A29A 1K8UA 1S5GZ 1J7OA 1BJFA 1QXPA 2M1KB 4QJ4B 1U5IB 3NSOA 2KHNA 1WRZA 1TOPA 1UWOA 2PMYA 4ZCVA 1DF0A 2LVVA 5K89A 4N5XA 1JSAA 1Y1UA 5JOLA 1QTXA 3WNXB 2F2PA 2HF5A 1K9KA 2EC6B 3EKJA 2KQYA 2MA2A 3IQQA 1AK8A 1OQPA 1DMOA 1FPWA 2NZ0A 1ALWA 2VRGA 2MJWB 2WNDA 4NDBA 3SG6A 2KDHA 1OSAA 3DVJA 1TNWA 1DT7B 1CB1A 1ZACA 1J7QA 2O5GA 4BY4A 3TDZA 1BR4B 1KSOA 1A4PA 1RROA 2LMVA 3A8RA 4GGFA 1IG5A 2M1UA 4GUKA 4ICBA 1UHNA 2AAOA 1KK8C 2JU0A 2KI6C 1AHRA 2L4IA 1H4BA 1M63B 2BCXA 5BPJA 3I5HC 3BUWB 1EL4A 2JXCA 4GGFC 1IGVA 5DKRA 1DJYA 2I7AA 2BBMA 2CBLA 1ALVA 3DF0A 1NX0A 1CFCA 2JTTA 1CMGA 1YUTA 3OP0A 4PHNA 5I2QA 2F8PA 3A4UB 1TCOB 2WC8A 2AUCA 3JTDB 1K2HA 4E68A 4BY5A 1NIWA 4WQ3A 1SW8A 3ZWHA 1EG4A 1L2OB 3EVUA 4I5NB 1SR6B 2K2AA 5HLOA 1SCMB 5AFPA 1CFFA 4GGNA 1KFUS 1WY9A 4HREE 2LP3A 2KI6D 4PE1A 4WQ2A 2BL0B 1Y0VH 1KFUL 2BBNA 3I5FB 2LUXA 3SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE9 B;  2KNE A;  3EK7 A;  1NCY A;  5DKQ A;  1M46 A;  1IRJ A;  1KK7 Y;  3O78 A;  3GK4 X;  4DIR A;  1UHI A;  4MVF A;  2LLU A;  1G33 A;  1KWO B;  3BOW A;  1B7T Z;  3K21 A;  1LKJ A;  5DKN A;  1IKU A;  4N1G A;  4MSP A;  1BR1 B;  1RFJ A;  5I2L A;  1SNL A;  2FCE A;  1BMO A;  2LAP A;  1CDL A;  5AXI A;  4GPL B;  1PAL A;  2LM5 A;  4YI8 A;  1NPQ A;  1YRT B;  2LMU A;  2HET A;  4A4B A;  2D8N A;  1SYM A;  2SAS A;  3PAL A;  1QIW A;  1CLB A;  3IQO A;  2K7C A;  5CSN A;  1M45 A;  4CID A;  1W7I B;  3M0W A;  4I5J A;  1ODB A;  1Y1A A;  5KTY A;  1XFW O;  2GGZ A;  3SG2 A;  1SRA A;  4PE4 A;  1YUR A;  1V1G A;  1B1G A;  3NSL A;  1FF1 A;  1OE9 B;  4MRY A;  4FTG A;  1WDC C;  2E30 A;  2L98 A;  1SL9 A;  1SKT A;  3IF7 A;  3O4Y A;  1ZFS A;  1JFJ A;  4XJK A;  3CR2 A;  3EK4 A;  4OCI A;  3TS5 C;  2L5X B;  4L9M A;  2O60 A;  2CCM A;  3D0Y B;  3MSE B;  1REC A;  2JT8 A;  2LHL A;  2P6B B;  1HQV A;  1BOD A;  5CSF A;  2MHH A;  1S6I A;  2M9G A;  1S3P A;  3CR5 X;  4PHJ A;  1SL7 A;  2WOS A;  4OVN F;  1JUO A;  1EH2 A;  2HQW A;  1YTZ C;  4OKH A;  1CNP A;  3EKH A;  3SIB A;  2CTN A;  1S6C A;  1S6J A;  2JT3 A;  4D1E A;  2L0P A;  4CFR A;  2L4H A;  2ZN8 A;  2F33 A;  4AQI A;  1PVB A;  2OTG C;  1PSB A;  1A2X A;  3SJS A;  3OX5 A;  2GGM A;  4MZK A;  2L2E A;  1KFX S;  4TNC A;  1C7V A;  2ZN9 A;  3JVT B;  3I5I B;  3CZT X;  1NWD A;  1FI6 A;  2DOQ A;  2H2K A;  3OX6 A;  4QJ3 B;  1XFV O;  1U5I A;  1BG1 A;  2LCP A;  2L51 A;  1JBA A;  1QV1 A;  2FCD A;  3GOF A;  4M2P A;  5CSI A;  1JC2 A;  4C0J A;  2BE4 A;  3BUM B;  2Y4Q A;  1AP4 A;  1YVH A;  1QV0 A;  3BUX B;  1YVL A;  1WLM A;  2KFF A;  1DJG A;  1GGW A;  1TN4 A;  2PAS A;  1B47 A;  2R2I A;  1QX7 A;  2KGR A;  3DD4 A;  2KOT A;  1L7Z A;  3FWC A;  3LL8 B;  2M49 B;  1TIZ A;  2Q4U A;  1QAS A;  1R6P A;  1MR8 A;  1G8I A;  2ZND A;  4CLN A;  1MUX A;  1IJ5 A;  1PVA A;  2NXQ A;  4MEW A;  4NDC A;  4USL A;  2FOT A;  2EC6 C;  1IQ5 A;  3KPX A;  1S5G Y;  3I5H B;  4DCK A;  1NP8 A;  2ZRT A;  4FQO A;  3VRO A;  3LCP C;  4C0L A;  4P5O E;  2LMT A;  1BLQ A;  1XFU O;  2K61 A;  1S26 D;  2KAX A;  3D10 A;  1M31 A;  3KEV A;  3PLF B;  2CT9 A;  1SBJ A;  1JFK A;  1F71 A;  2E6W A;  2F3Z A;  3DVK A;  3I5G B;  4DRW A;  3BUN B;  1QS7 A;  2F2O A;  3SG3 A;  2KAV A;  1CFD A;  1IWQ A;  1HT9 A;  2JQ6 A;  3GK1 A;  1ZMZ A;  3LK1 A;  4NDD A;  1A03 A;  2I2R E;  1XA5 A;  2I94 A;  1BT6 A;  3CR4 X;  1EXR A;  2OS8 C;  4P2Y B;  1B4C A;  5CPV A;  1Y6W A;  2JUL A;  3H4S E;  5AAN A;  2LAN A;  1Q80 A;  2PSR A;  4YI9 A;  1Y1X A;  2NCO A;  1B9A A;  4GFT A;  2MBX A;  2Y5I A;  1ZUZ A;  1BU3 A;  1SL8 A;  3PAT A;  1NUB A;  4IL1 A;  2ZFD A;  3TUY C;  1KQM B;  3JTD C;  5KU1 A;  1QLS A;  3O6B A;  4GAO A;  2JWW A;  4C0K A;  2HQ8 A;  3SG5 A;  1CDM A;  1NCZ A;  4MN0 A;  1L2O C;  1NYA A;  5HKY A;  1SR6 C;  1BOC A;  1SCM C;  5I8N A;  2LP2 A;  1QVI Z;  3PN7 B;  1WLZ A;  1SY9 A;  3I5F C;  2JPT A;  2JRF A;  1X02 A;  4QJ5 B;  2KFG A;  1KCY A;  1QX5 B;  1UUR A;  4JWQ A;  1IQ3 A;  1OOJ A;  1C7W A;  3CS1 A;  4JPZ B;  2V53 A;  4R1E A;  1S36 A;  3GK2 A;  1KWO C;  3TZ1 A;  1RWY A;  2K0J A;  2KYC A;  1QLK A;  4PE7 A;  5D69 A;  1DJX A;  2RGI A;  2LVK A;  1JF2 A;  5G08 A;  1DTL A;  1J1D A;  3KO0 A;  4DS7 A;  1K90 D;  2K7D A;  4ETO A;  2M7L A;  1UUS A;  2M7N A;  1A75 B;  2A4J A;  4GBA A;  3E3R A;  1GGZ A;  1DGU A;  4PHM A;  1LXF C;  2H61 A;  3RLZ A;  3VGO A;  2CXJ A;  1TNP A;  1YX7 A;  2KBI A;  2AMI A;  2MLE C;  4MLW A;  2FJU B;  1QAT A;  5KSZ A;  1XFY O;  1CTR A;  1XK4 A;  2KI4 B;  1B7T Y;  5HKZ A;  2H61 C;  1J7R A;  1WRL A;  2LLT A;  2M97 A;  3D0Y A;  4GNK B;  2KFH A;  1K9P A;  3OHM B;  4HSZ A;  2I18 A;  4M2Q A;  1AVS A;  4ORB B;  1CFP A;  2PVB A;  1OZO A;  3WHT B;  3CTN A;  1RTP 1;  4PCW A;  5HKW A;  1QX2 A;  4PE0 A;  2LC5 A;  1CLL A;  1KQV A;  2OTG B;  1N0Y A;  4I5L B;  1M39 A;  2G2B A;  2WOR A;  3NXA A;  3OB1 B;  3C1V A;  3BXK A;  1K95 A;  1UHK A;  4YGB B;  4UPG A;  1B8L A;  1KFX L;  2JTZ A;  1TNQ A;  4I5K A;  4OV2 A;  3EK8 A;  1OMV A;  1NX3 A;  5HYD A;  1OZS A;  2QAC A;  1J7P A;  1AJ4 A;  2KGB C;  2B1U A;  1W7J B;  1TTX A;  3AKA A;  3OB2 B;  1DF0 B;  1PSR A;  1DGV A;  5I2O A;  1UHJ A;  3WXA A;  2MAZ A;  2PRU A;  2LV7 A;  1DJI A;  4YRU A;  3JVT C;  3CGA A;  2JZI A;  1K94 A;  3I5I C;  1R2U A;  5AER A;  3O2P A;  1PUL A;  1SMG A;  3FS7 A;  4MBE A;  5F6T A;  5B8I B;  1B8C A;  1CM1 A;  2ZNE A;  4YGA A;  1NX1 A;  2BE6 A;  5ER5 A;  1H8B A;  1KK8 B;  4YGD B;  3HCM A;  5TNC A;  1VRK A;  1QJT A;  1SK6 D;  1MWN A;  5D7F A;  4YBH B;  2LVI A;  2ZRS A;  4F0Z B;  4Q04 A;  2NCP A;  3SG4 A;  3TDU A;  1LIN A;  1KK7 Z;  3VRP A;  4MRX A;  4OR9 B;  1BF5 A;  2M3W A;  3SIA A;  3PM8 A;  1D1O A;  2KBM A;  3DF0 B;  3FIA A;  2K7O A;  1XFX O;  1DJZ A;  2COL B;  4HRH A;  1FW4 A;  1XVJ A;  2Y1N A;  1YUS A;  2OS8 B;  1LA3 A;  2LUC A;  1GQM A;  1OMR A;  1F4Q A;  2WCF A;  1IJ6 A;  2M8U A;  3DVE A;  1E8A A;  1CKK A;  1LVC D;  3NSK A;  2KAY A;  2JXL A;  5PAL A;  2K2F A;  4YGC B;  3KHE A;  3TUY B;  2K8M B;  1K93 D;  2ZKM X;  3AKB A;  4HRG A;  3I5G C;  3VRR A;  4CFQ A;  1FI5 A;  5ER4 X;  3RM1 A;  1SCV A;  1PRW A;  3BYA A;  5AEQ A;  1XO5 A;  1CDN A;  1WRK A;  4XYN A;  2M29 A;  3CWG A;  1K9U A;  2G9B A;  3FWB A;  2CNP A;  2WCE A;  3BQ3 A;  2LLS A;  2SCP A;  1EJ3 A;  1N2D A;  1S1E A;  3HX4 A;  1IH0 A;  2EHB A;  5HLV A;  1B8R A;  1LA0 A;  3BOW B;  1F8H A;  2BL0 C;  1NSH A;  4PHK A;  2BEC A;  1RK9 A;  2EGD A;  2BCB A;  3EVV A;  1XYD A;  2BKI B;  2WCB A;  3AAJ A;  5IBW A;  1F4O A;  1KQM C;  2LNK A;  4YGE B;  5CSJ A;  3LLE A;  3PFV A;  4CPV A;  1TNX A;  1UHH A;  2NLN A;  1AJ5 A;  2HPS A;  1FBV A;  1K96 A;  1N65 A;  1TRF A;  3EVR A;  2M0R A;  3LK0 A;  3QRX A;  3PSR A;  2BKH B;  4NQG A;  1YUU A;  1UP5 A;  3VRQ A;  1J1E A;  1WDC B;  4ORA B;  3PN7 C;  2JNF A;  1YX8 A;  3TS5 B;  3WHU B;  2L50 A;  1NX2 A;  2OPO A;  3TDI A;  1CDP A;  1F55 A;  1DJH A;  2BCA A;  1V1F A;  2JC2 A;  1GJY A;  1XFZ O;  2KQ6 A;  2KYF A;  2QPT A;  3KF9 A;  4U8D A;  2PAL A;  2IS9 A;  1PK0 D;  1QIV A;  4MZJ A;  1CM4 A;  4XJK B;  5GQQ C;  2Q91 A;  3BUO B;  3F45 A;  1A75 A;  1YR5 A;  1OMD A;  1G4Y R;  3ICB A;  4PAL A;  1ZOT B;  1AUI B;  2Y1M A;  1NCX A;  1MQ1 A;  3DVM A;  5FYX A;  5J3X A;  2KSP A;  4N1F A;  1XK4 C;  3NSI A;  4ZCU A;  1QVI Y;  1CLM A;  1KSM A;  4PDZ A;  1DJW A;  4AOM A;  2MRD A;  3ZNI A;  2JT0 A;  2MLF C;  3VRN A;  1JF0 A;  1DVI A;  3AAK A;  1EG3 A;  1RJV A;  4MZL A;  1C07 A;  1SPY A;  2GV5 A;  1MXE A;  2K7B A;  4JQ0 D;  4ORC B;  1YRU B;  1MXL C;  2JNX A;  2LVJ A;  1J55 A;  4WRI A;  4AQJ A;  5JJG A;  1CMF A;  1F54 A;  2KI4 C;  3CLN A;  2ISD A;  2F3Y A;  2JOJ A;  2LHI A;  4M2O A;  4A4C A;  1MHO A;  2TN4 A;  1JWD A;  1TCF A;  1F70 A;  1MF8 B;  4DUQ A;  1A29 A;  1K8U A;  1S5G Z;  1J7O A;  1BJF A;  1QXP A;  2M1K B;  4QJ4 B;  1U5I B;  3NSO A;  2KHN A;  1WRZ A;  1TOP A;  1UWO A;  2PMY A;  4ZCV A;  1DF0 A;  2LVV A;  5K89 A;  4N5X A;  1JSA A;  1Y1U A;  5JOL A;  1QTX A;  3WNX B;  2F2P A;  2HF5 A;  1K9K A;  2EC6 B;  3EKJ A;  2KQY A;  2MA2 A;  3IQQ A;  1AK8 A;  1OQP A;  1DMO A;  1FPW A;  2NZ0 A;  1ALW A;  2VRG A;  2MJW B;  2WND A;  4NDB A;  3SG6 A;  2KDH A;  1OSA A;  3DVJ A;  1TNW A;  1DT7 B;  1CB1 A;  1ZAC A;  1J7Q A;  2O5G A;  4BY4 A;  3TDZ A;  1BR4 B;  1KSO A;  1A4P A;  1RRO A;  2LMV A;  3A8R A;  4GGF A;  1IG5 A;  2M1U A;  4GUK A;  4ICB A;  1UHN A;  2AAO A;  1KK8 C;  2JU0 A;  2KI6 C;  1AHR A;  2L4I A;  1H4B A;  1M63 B;  2BCX A;  5BPJ A;  3I5H C;  3BUW B;  1EL4 A;  2JXC A;  4GGF C;  1IGV A;  5DKR A;  1DJY A;  2I7A A;  2BBM A;  2CBL A;  1ALV A;  3DF0 A;  1NX0 A;  1CFC A;  2JTT A;  1CMG A;  1YUT A;  3OP0 A;  4PHN A;  5I2Q A;  2F8P A;  3A4U B;  1TCO B;  2WC8 A;  2AUC A;  3JTD B;  1K2H A;  4E68 A;  4BY5 A;  1NIW A;  4WQ3 A;  1SW8 A;  3ZWH A;  1EG4 A;  1L2O B;  3EVU A;  4I5N B;  1SR6 B;  2K2A A;  5HLO A;  1SCM B;  5AFP A;  1CFF A;  4GGN A;  1KFU S;  1WY9 A;  4HRE E;  2LP3 A;  2KI6 D;  4PE1 A;  4WQ2 A;  2BL0 B;  1Y0V H;  1KFU L;  2BBN A;  3I5F B;  2LUX A;  3SG7 A; 
#chains in the Genus database with same CATH topology
 2ERB A;  2LE9 B;  2KNE A;  3EK7 A;  1NCY A;  5DKQ A;  1M46 A;  1IRJ A;  1KK7 Y;  3O78 A;  3GK4 X;  4DIR A;  1UHI A;  2QEV A;  3R1O A;  4MVF A;  2LLU A;  3IVT A;  1G33 A;  1KWO B;  3BOW A;  1B7T Z;  3K21 A;  1LKJ A;  5DKN A;  1IKU A;  4N1G A;  4MSP A;  1BR1 B;  1RFJ A;  5I94 A;  5I2L A;  2WCK A;  1SNL A;  4OZD A;  2FCE A;  1BMO A;  2LAP A;  1CDL A;  5AXI A;  4GPL B;  1PAL A;  2LM5 A;  4YI8 A;  1NPQ A;  1YRT B;  3PJI A;  2LMU A;  2HET A;  4A4B A;  1T14 A;  1SYM A;  2D8N A;  2SAS A;  3PAL A;  1QIW A;  1CLB A;  3B88 A;  3CZ0 A;  3IQO A;  2K7C A;  5CSN A;  1M45 A;  4CID A;  1W7I B;  3M0W A;  4I5J A;  1ODB A;  1Y1A A;  5KTY A;  1XFW O;  2GGZ A;  1Z4H A;  1SRA A;  3SG2 A;  4PE4 A;  1YUR A;  1V1G A;  5FI7 A;  3NSL A;  1B1G A;  1FF1 A;  1OE9 B;  4MRY A;  3FE8 A;  4FTG A;  1WDC C;  2E30 A;  2L98 A;  1SL9 A;  1SKT A;  3IF7 A;  3O4Y A;  1ZFS A;  1JFJ A;  3L4L A;  4XJK A;  1GM0 A;  3SS3 A;  3CR2 A;  3EK4 A;  4OCI A;  3TS5 C;  2L5X B;  4L9M A;  2O60 A;  2CCM A;  3D0Y B;  3MSE B;  1REC A;  2JT8 A;  2LHL A;  2P6B B;  1HQV A;  1BOD A;  5CSF A;  2WC6 A;  2MHH A;  1S6I A;  2M9G A;  1S3P A;  3CDN A;  3CR5 X;  4PHJ A;  3SS4 A;  1SL7 A;  3BFH A;  2WOS A;  4OVN F;  1JUO A;  1EH2 A;  2HQW A;  1YTZ C;  4OKH A;  1CNP A;  3EKH A;  3SIB A;  2CTN A;  3CZ2 A;  1S6C A;  1S6J A;  2JT3 A;  3R1V A;  1OOF A;  3DZT A;  2L0P A;  4D1E A;  3D74 A;  4CFR A;  2L4H A;  2ZN8 A;  2F33 A;  1SSE B;  1Z2C B;  2P71 A;  3N7H A;  4AQI A;  1PVB A;  2OTG C;  1PSB A;  1A2X A;  3SJS A;  3OX5 A;  2GGM A;  4MZK A;  1XFR A;  2L2E A;  1KFX S;  4TNC A;  1C7V A;  2ZN9 A;  3JVT B;  3I5I B;  1OOI X;  3CZT X;  1NWD A;  3UO9 A;  1FI6 A;  2DOQ A;  2H2K A;  3OX6 A;  4QJ3 B;  1XFV O;  3CYZ A;  1ORG A;  1U5I A;  1BG1 A;  2LCP A;  2L51 A;  3L47 A;  2BAP A;  1QV1 A;  2FCD A;  3GOF A;  4M2P A;  5CSI A;  1JC2 A;  1JBA A;  5D3O A;  4C0J A;  2BE4 A;  3BUM B;  2Y4Q A;  1AP4 A;  1YVH A;  1QV0 A;  3BUX B;  1YVL A;  4IJ7 A;  1WLM A;  2KFF A;  1DJG A;  1LS8 A;  1GGW A;  1TN4 A;  2PAS A;  1B47 A;  2R2I A;  1QX7 A;  2KGR A;  3DD4 A;  2KOT A;  2WCL A;  1L7Z A;  3FWC A;  3LL8 B;  2M49 B;  1TIZ A;  2Q4U A;  1QAS A;  1R6P A;  1MR8 A;  1TWO A;  1G8I A;  2ZND A;  4CLN A;  1MUX A;  1IJ5 A;  1PVA A;  2NXQ A;  4MEW A;  4NDC A;  4USL A;  2FOT A;  2EC6 C;  2L5Y A;  1IQ5 A;  3KPX A;  1S5G Y;  3RZS A;  3I5H B;  4DCK A;  1NP8 A;  2ZRT A;  4FQO A;  3VRO A;  3LCP C;  4C0L A;  4P5O E;  2LMT A;  1BLQ A;  1XFU O;  2K61 A;  1S26 D;  2KAX A;  3D10 A;  1M31 A;  3KEV A;  3PLF B;  2CT9 A;  1SBJ A;  1JFK A;  1F71 A;  2E6W A;  2F3Z A;  3DVK A;  3I5G B;  4DRW A;  3BUN B;  1DEL A;  1QS7 A;  2F2O A;  3SG3 A;  2KAV A;  1DQE A;  1CFD A;  1IWQ A;  1HT9 A;  2JQ6 A;  3GK1 A;  1ZMZ A;  3LK1 A;  4NDD A;  4PT1 A;  1A03 A;  2I2R E;  1XA5 A;  2I94 A;  1BT6 A;  3CR4 X;  1EXR A;  2OS8 C;  2WC5 A;  3D73 A;  4P2Y B;  5CPV A;  1Y6W A;  2JUL A;  3H4S E;  5AAN A;  2LAN A;  1Q80 A;  2PSR A;  4YI9 A;  1Y1X A;  2NCO A;  1B9A A;  3S0A A;  4GFT A;  2MBX A;  2Y5I A;  1ZUZ A;  3S0G A;  1BU3 A;  1SL8 A;  3PAT A;  1NUB A;  4IL1 A;  2ZFD A;  3TUY C;  1KQM B;  2KLD A;  3JTD C;  5KU1 A;  1QLS A;  3O6B A;  4GAO A;  2JWW A;  4C0K A;  2HQ8 A;  3SG5 A;  1CDM A;  1NCZ A;  4MN0 A;  1L2O C;  1NYA A;  5HKY A;  1SR6 C;  1BOC A;  1SCM C;  5I8N A;  2LP2 A;  2KLE A;  2QEH A;  1QVI Z;  3PN7 B;  1WLZ A;  1SY9 A;  3I5F C;  2JPT A;  2JRF A;  1X02 A;  4QJ5 B;  2KFG A;  1KCY A;  1QX5 B;  1UUR A;  4JWQ A;  1IQ3 A;  1OOJ A;  1C7W A;  3CS1 A;  4JPZ B;  2V53 A;  4R1E A;  1C3Z A;  1S36 A;  3GK2 A;  1KWO C;  3TZ1 A;  1RWY A;  2K0J A;  2KYC A;  1QLK A;  4PE7 A;  5D69 A;  1DJX A;  2RGI A;  2LVK A;  1JF2 A;  5G08 A;  3D75 A;  1DTL A;  1J1D A;  3KO0 A;  4DS7 A;  1K90 D;  2K7D A;  4ETO A;  2M7L A;  1UUS A;  3DY9 A;  2M7N A;  3SS5 A;  1A75 B;  2A4J A;  4GBA A;  3E3R A;  1GGZ A;  1DGU A;  4PHM A;  1LXF C;  2H61 A;  3RLZ A;  3CZ1 A;  2CXJ A;  1TNP A;  3VGO A;  3S0E A;  1YX7 A;  1W9Z A;  2KBI A;  2AMI A;  2MLE C;  3PM2 A;  4MLW A;  2FJU B;  3S0F A;  1QAT A;  5KSZ A;  1XFY O;  1CTR A;  1XK4 A;  2KI4 B;  1B7T Y;  5HKZ A;  2H61 C;  1J7R A;  1WRL A;  2LLT A;  2M97 A;  3D0Y A;  4GNK B;  2KFH A;  1K9P A;  3OHM B;  4HSZ A;  2I18 A;  4M2Q A;  1AVS A;  4ORB B;  1CFP A;  2PVB A;  1OZO A;  3WHT B;  3CTN A;  1RTP 1;  4PCW A;  5HKW A;  1QX2 A;  5FI2 A;  3D78 A;  4PE0 A;  2LC5 A;  3NHT A;  1CLL A;  1KQV A;  2OTG B;  1N0Y A;  4I5L B;  1M39 A;  2G2B A;  2WOR A;  3NXA A;  3OB1 B;  3C1V A;  1OW4 A;  3BXK A;  1K95 A;  1UHK A;  4YGB B;  5FI6 A;  4UPG A;  1B8L A;  1KFX L;  2JTZ A;  1TNQ A;  4I5K A;  4OV2 A;  3EK8 A;  1OMV A;  1NX3 A;  5HYD A;  1OZS A;  2QAC A;  1J7P A;  1AJ4 A;  2KGB C;  2PYQ A;  2B1U A;  1W7J B;  1TTX A;  3AKA A;  3OB2 B;  1DF0 B;  1PSR A;  1DGV A;  5I2O A;  1UHJ A;  3WXA A;  2MAZ A;  2PRU A;  2QEB A;  2LV7 A;  1DJI A;  3DXL A;  3O4X A;  4YRU A;  1TUZ A;  3JVT C;  3CGA A;  2JZI A;  1K94 A;  3I5I C;  1R2U A;  5AER A;  3O2P A;  1PUL A;  1SMG A;  3QME A;  3FS7 A;  2K60 A;  4MBE A;  5F6T A;  1B8C A;  5B8I B;  1CM1 A;  2ZNE A;  4YGA A;  1NX1 A;  2BE6 A;  3NHI A;  5ER5 A;  1H8B A;  2WCJ A;  1OOH A;  1KK8 B;  4YGD B;  3HCM A;  5TNC A;  1VRK A;  1QJT A;  2WCM A;  1SK6 D;  1MWN A;  3D77 A;  4YBH B;  2LVI A;  2ZRS A;  5D7F A;  1P28 A;  4Q04 A;  4F0Z B;  2NCP A;  3SG4 A;  3TDU A;  1LIN A;  5HL1 A;  1B4C A;  1KK7 Z;  3VRP A;  3B87 A;  4MRX A;  4OR9 B;  2M3W A;  3SIA A;  3PM8 A;  1BF5 A;  1D1O A;  2KBM A;  3DF0 B;  3FIA A;  2K7O A;  1XFX O;  1DJZ A;  2COL B;  4HRH A;  1FW4 A;  3FE9 A;  1XVJ A;  2H8V A;  2Y1N A;  1YUS A;  2OS8 B;  1LA3 A;  3OGN A;  2LUC A;  1GQM A;  1OMR A;  1F4Q A;  3V2L A;  2WCF A;  1IJ6 A;  2M8U A;  3DVE A;  1E8A A;  1CKK A;  1LVC D;  3NSK A;  2KAY A;  2JXL A;  5PAL A;  2K2F A;  4YGC B;  3S0D A;  3KHE A;  2GTE A;  3TUY B;  2K8M B;  1K93 D;  2ZKM X;  3AKB A;  4HRG A;  3I5G C;  4INX A;  3VRR A;  4CFQ A;  1FI5 A;  5ER4 X;  3RM1 A;  1SCV A;  1PRW A;  3BYA A;  5AEQ A;  1XO5 A;  1CDN A;  1WRK A;  4XYN A;  2M29 A;  3CWG A;  1K9U A;  2G9B A;  3FWB A;  2CNP A;  2WCE A;  3BQ3 A;  2LLS A;  2SCP A;  1EJ3 A;  1N2D A;  1S1E A;  3HX4 A;  1IH0 A;  2EHB A;  5HLV A;  1B8R A;  1LA0 A;  3BOW B;  1F8H A;  2BL0 C;  5EL2 A;  1NSH A;  3OBV A;  2BEC A;  4PHK A;  1RK9 A;  2EGD A;  2BCB A;  3EVV A;  1XYD A;  2BKI B;  3R72 A;  2WCB A;  3AAJ A;  5IBW A;  3DYE A;  1F4O A;  1KQM C;  2LNK A;  3EG5 B;  4YGE B;  5CSJ A;  3LLE A;  3PFV A;  4CPV A;  1TNX A;  1UHH A;  2NLN A;  1AJ5 A;  2HPS A;  1FBV A;  1K96 A;  1N65 A;  1TRF A;  3EVR A;  2M0R A;  3LK0 A;  3QRX A;  3PSR A;  2BKH B;  4NQG A;  1YUU A;  1UP5 A;  3VRQ A;  1J1E A;  1WDC B;  4ORA B;  3PN7 C;  4F7F A;  2JNF A;  1YX8 A;  1IIO A;  3TS5 B;  3WHU B;  2L50 A;  1NX2 A;  2OPO A;  3TDI A;  1CDP A;  1F55 A;  3S0B A;  1DJH A;  2BCA A;  1V1F A;  2JC2 A;  1GJY A;  1XFZ O;  2KQ6 A;  2KYF A;  2QPT A;  3KF9 A;  4U8D A;  2PAL A;  2IS9 A;  1PK0 D;  1QIV A;  4MZJ A;  1CM4 A;  4XJK B;  5GQQ C;  2Q91 A;  3BUO B;  3F45 A;  1A75 A;  1YR5 A;  1OMD A;  4KYN A;  1G4Y R;  3ICB A;  4PAL A;  1ZOT B;  1AUI B;  2Y1M A;  1NCX A;  1MQ1 A;  3DVM A;  4JKT A;  5FYX A;  5J3X A;  2KSP A;  4N1F A;  1XK4 C;  3NSI A;  4ZCU A;  1QVI Y;  1CLM A;  3BJH A;  1KSM A;  2JPO A;  4PDZ A;  1DJW A;  4AOM A;  2MRD A;  3ZNI A;  2JT0 A;  2MLF C;  2PQL A;  3CAB A;  1JF0 A;  1DVI A;  3VRN A;  3AAK A;  1EG3 A;  1RJV A;  3K1E A;  4MZL A;  1C07 A;  1SPY A;  2GV5 A;  1MXE A;  2K7B A;  4JQ0 D;  4ORC B;  2FJY A;  1OOG A;  1YRU B;  1MXL C;  2JNX A;  2LVJ A;  1J55 A;  4WRI A;  4AQJ A;  3FE6 A;  5JJG A;  1CMF A;  1F54 A;  3L4A A;  2KI4 C;  3D76 A;  3CLN A;  2ISD A;  2F3Y A;  1TUJ A;  2JOJ A;  2LHI A;  2QEO A;  4M2O A;  4A4C A;  1MHO A;  2TN4 A;  1JWD A;  1TCF A;  1F70 A;  1MF8 B;  4DUQ A;  3Q8I A;  1A29 A;  1K8U A;  1S5G Z;  5DIC A;  1C3Y A;  1J7O A;  1BJF A;  2YGU A;  1QXP A;  2M1K B;  4QJ4 B;  1U5I B;  3BFA A;  3NSO A;  2KHN A;  1WRZ A;  1TOP A;  1UWO A;  2PMY A;  4ZCV A;  1DF0 A;  2LVV A;  3VB1 A;  3BFB A;  4N5X A;  5K89 A;  3B86 A;  1DC1 A;  1JSA A;  1Y1U A;  5JOL A;  1QTX A;  3WNX B;  2F2P A;  2HF5 A;  1K9K A;  2EC6 B;  3EKJ A;  2KQY A;  2L2C A;  2MA2 A;  2QDI A;  3IQQ A;  3R1P A;  1AK8 A;  1OQP A;  1DMO A;  1FPW A;  2NZ0 A;  1QWV A;  1ALW A;  2VRG A;  2MJW B;  2WND A;  4NDB A;  3SG6 A;  4JD9 A;  2KDH A;  1OSA A;  3DVJ A;  1TNW A;  1DT7 B;  1CB1 A;  2KPH A;  1ZAC A;  1J7Q A;  2O5G A;  4BY4 A;  3TDZ A;  1BR4 B;  1KSO A;  1A4P A;  1RRO A;  2LMV A;  3A8R A;  4GGF A;  1IG5 A;  2M1U A;  4GUK A;  4ICB A;  1UHN A;  2AAO A;  1KK8 C;  2JU0 A;  2P70 A;  2KI6 C;  1AHR A;  2L4I A;  1H4B A;  1M63 B;  2BCX A;  5BPJ A;  3I5H C;  3BUW B;  4INW A;  1EL4 A;  2JXC A;  4GGF C;  1IGV A;  5DKR A;  2BNX A;  3B6X A;  1DJY A;  2I7A A;  2BBM A;  1DEK A;  2CBL A;  1ALV A;  3DF0 A;  1NX0 A;  1CFC A;  2JTT A;  1CMG A;  3B7A A;  1YUT A;  3OP0 A;  4PHN A;  5I2Q A;  2F8P A;  3A4U B;  1TCO B;  2WC8 A;  2AUC A;  3JTD B;  1K2H A;  4E68 A;  4BY5 A;  1NIW A;  2WCH A;  4WQ3 A;  1SW8 A;  3ZWH A;  3UNW A;  1EG4 A;  1L2O B;  3EVU A;  4I5N B;  1SR6 B;  2K2A A;  5HLO A;  1SCM B;  5AFP A;  1CFF A;  4GGN A;  1KFU S;  1WY9 A;  4HRE E;  4FQT A;  2LP3 A;  2KI6 D;  3NGV A;  4PE1 A;  4WQ2 A;  2BL0 B;  1Y0V H;  1KFU L;  2BBN A;  3I5F B;  2LUX A;  3SG7 A; 
#chains in the Genus database with same CATH homology
 2LE9 B;  2KNE A;  3EK7 A;  1NCY A;  5DKQ A;  1M46 A;  1IRJ A;  1KK7 Y;  3O78 A;  3GK4 X;  4DIR A;  1UHI A;  4MVF A;  2LLU A;  1G33 A;  1KWO B;  3BOW A;  1B7T Z;  3K21 A;  1LKJ A;  5DKN A;  1IKU A;  4N1G A;  4MSP A;  1BR1 B;  1RFJ A;  5I2L A;  1SNL A;  2FCE A;  1BMO A;  2LAP A;  1CDL A;  5AXI A;  4GPL B;  1PAL A;  2LM5 A;  4YI8 A;  1NPQ A;  1YRT B;  2LMU A;  2HET A;  4A4B A;  2D8N A;  1SYM A;  2SAS A;  3PAL A;  1QIW A;  1CLB A;  3IQO A;  2K7C A;  5CSN A;  1M45 A;  4CID A;  1W7I B;  3M0W A;  4I5J A;  1ODB A;  1Y1A A;  5KTY A;  1XFW O;  2GGZ A;  3SG2 A;  1SRA A;  4PE4 A;  1YUR A;  1V1G A;  1B1G A;  3NSL A;  1FF1 A;  1OE9 B;  4MRY A;  4FTG A;  1WDC C;  2E30 A;  2L98 A;  1SL9 A;  1SKT A;  3IF7 A;  3O4Y A;  1ZFS A;  1JFJ A;  4XJK A;  3CR2 A;  3EK4 A;  4OCI A;  3TS5 C;  2L5X B;  4L9M A;  2O60 A;  2CCM A;  3D0Y B;  3MSE B;  1REC A;  2JT8 A;  2LHL A;  2P6B B;  1HQV A;  1BOD A;  5CSF A;  2MHH A;  1S6I A;  2M9G A;  1S3P A;  3CR5 X;  4PHJ A;  1SL7 A;  2WOS A;  4OVN F;  1JUO A;  1EH2 A;  2HQW A;  1YTZ C;  4OKH A;  1CNP A;  3EKH A;  3SIB A;  2CTN A;  1S6C A;  1S6J A;  2JT3 A;  4D1E A;  2L0P A;  4CFR A;  2L4H A;  2ZN8 A;  2F33 A;  4AQI A;  1PVB A;  2OTG C;  1PSB A;  1A2X A;  3SJS A;  3OX5 A;  2GGM A;  4MZK A;  2L2E A;  1KFX S;  4TNC A;  1C7V A;  2ZN9 A;  3JVT B;  3I5I B;  3CZT X;  1NWD A;  1FI6 A;  2DOQ A;  2H2K A;  3OX6 A;  4QJ3 B;  1XFV O;  1U5I A;  1BG1 A;  2LCP A;  2L51 A;  1JBA A;  1QV1 A;  2FCD A;  3GOF A;  4M2P A;  5CSI A;  1JC2 A;  4C0J A;  2BE4 A;  3BUM B;  2Y4Q A;  1AP4 A;  1YVH A;  1QV0 A;  3BUX B;  1YVL A;  1WLM A;  2KFF A;  1DJG A;  1GGW A;  1TN4 A;  2PAS A;  1B47 A;  2R2I A;  1QX7 A;  2KGR A;  3DD4 A;  2KOT A;  1L7Z A;  3FWC A;  3LL8 B;  2M49 B;  1TIZ A;  2Q4U A;  1QAS A;  1R6P A;  1MR8 A;  1G8I A;  2ZND A;  4CLN A;  1MUX A;  1IJ5 A;  1PVA A;  2NXQ A;  4MEW A;  4NDC A;  4USL A;  2FOT A;  2EC6 C;  1IQ5 A;  3KPX A;  1S5G Y;  3I5H B;  4DCK A;  1NP8 A;  2ZRT A;  4FQO A;  3VRO A;  3LCP C;  4C0L A;  4P5O E;  2LMT A;  1BLQ A;  1XFU O;  2K61 A;  1S26 D;  2KAX A;  3D10 A;  1M31 A;  3KEV A;  3PLF B;  2CT9 A;  1SBJ A;  1JFK A;  1F71 A;  2E6W A;  2F3Z A;  3DVK A;  3I5G B;  4DRW A;  3BUN B;  1QS7 A;  2F2O A;  3SG3 A;  2KAV A;  1CFD A;  1IWQ A;  1HT9 A;  2JQ6 A;  3GK1 A;  1ZMZ A;  3LK1 A;  4NDD A;  1A03 A;  2I2R E;  1XA5 A;  2I94 A;  1BT6 A;  3CR4 X;  1EXR A;  2OS8 C;  4P2Y B;  1B4C A;  5CPV A;  1Y6W A;  2JUL A;  3H4S E;  5AAN A;  2LAN A;  1Q80 A;  2PSR A;  4YI9 A;  1Y1X A;  2NCO A;  1B9A A;  4GFT A;  2MBX A;  2Y5I A;  1ZUZ A;  1BU3 A;  1SL8 A;  3PAT A;  1NUB A;  4IL1 A;  2ZFD A;  3TUY C;  1KQM B;  3JTD C;  5KU1 A;  1QLS A;  3O6B A;  4GAO A;  2JWW A;  4C0K A;  2HQ8 A;  3SG5 A;  1CDM A;  1NCZ A;  4MN0 A;  1L2O C;  1NYA A;  5HKY A;  1SR6 C;  1BOC A;  1SCM C;  5I8N A;  2LP2 A;  1QVI Z;  3PN7 B;  1WLZ A;  1SY9 A;  3I5F C;  2JPT A;  2JRF A;  1X02 A;  4QJ5 B;  2KFG A;  1KCY A;  1QX5 B;  1UUR A;  4JWQ A;  1IQ3 A;  1OOJ A;  1C7W A;  3CS1 A;  4JPZ B;  2V53 A;  4R1E A;  1S36 A;  3GK2 A;  1KWO C;  3TZ1 A;  1RWY A;  2K0J A;  2KYC A;  1QLK A;  4PE7 A;  5D69 A;  1DJX A;  2RGI A;  2LVK A;  1JF2 A;  5G08 A;  1DTL A;  1J1D A;  3KO0 A;  4DS7 A;  1K90 D;  2K7D A;  4ETO A;  2M7L A;  1UUS A;  2M7N A;  1A75 B;  2A4J A;  4GBA A;  3E3R A;  1GGZ A;  1DGU A;  4PHM A;  1LXF C;  2H61 A;  3RLZ A;  3VGO A;  2CXJ A;  1TNP A;  1YX7 A;  2KBI A;  2AMI A;  2MLE C;  4MLW A;  2FJU B;  1QAT A;  5KSZ A;  1XFY O;  1CTR A;  1XK4 A;  2KI4 B;  1B7T Y;  5HKZ A;  2H61 C;  1J7R A;  1WRL A;  2LLT A;  2M97 A;  3D0Y A;  4GNK B;  2KFH A;  1K9P A;  3OHM B;  4HSZ A;  2I18 A;  4M2Q A;  1AVS A;  4ORB B;  1CFP A;  2PVB A;  1OZO A;  3WHT B;  3CTN A;  1RTP 1;  4PCW A;  5HKW A;  1QX2 A;  4PE0 A;  2LC5 A;  1CLL A;  1KQV A;  2OTG B;  1N0Y A;  4I5L B;  1M39 A;  2G2B A;  2WOR A;  3NXA A;  3OB1 B;  3C1V A;  3BXK A;  1K95 A;  1UHK A;  4YGB B;  4UPG A;  1B8L A;  1KFX L;  2JTZ A;  1TNQ A;  4I5K A;  4OV2 A;  3EK8 A;  1OMV A;  1NX3 A;  5HYD A;  1OZS A;  2QAC A;  1J7P A;  1AJ4 A;  2KGB C;  2B1U A;  1W7J B;  1TTX A;  3AKA A;  3OB2 B;  1DF0 B;  1PSR A;  1DGV A;  5I2O A;  1UHJ A;  3WXA A;  2MAZ A;  2PRU A;  2LV7 A;  1DJI A;  4YRU A;  3JVT C;  3CGA A;  2JZI A;  1K94 A;  3I5I C;  1R2U A;  5AER A;  3O2P A;  1PUL A;  1SMG A;  3FS7 A;  4MBE A;  5F6T A;  5B8I B;  1B8C A;  1CM1 A;  2ZNE A;  4YGA A;  1NX1 A;  2BE6 A;  5ER5 A;  1H8B A;  1KK8 B;  4YGD B;  3HCM A;  5TNC A;  1VRK A;  1QJT A;  1SK6 D;  1MWN A;  5D7F A;  4YBH B;  2LVI A;  2ZRS A;  4F0Z B;  4Q04 A;  2NCP A;  3SG4 A;  3TDU A;  1LIN A;  1KK7 Z;  3VRP A;  4MRX A;  4OR9 B;  1BF5 A;  2M3W A;  3SIA A;  3PM8 A;  1D1O A;  2KBM A;  3DF0 B;  3FIA A;  2K7O A;  1XFX O;  1DJZ A;  2COL B;  4HRH A;  1FW4 A;  1XVJ A;  2Y1N A;  1YUS A;  2OS8 B;  1LA3 A;  2LUC A;  1GQM A;  1OMR A;  1F4Q A;  2WCF A;  1IJ6 A;  2M8U A;  3DVE A;  1E8A A;  1CKK A;  1LVC D;  3NSK A;  2KAY A;  2JXL A;  5PAL A;  2K2F A;  4YGC B;  3KHE A;  3TUY B;  2K8M B;  1K93 D;  2ZKM X;  3AKB A;  4HRG A;  3I5G C;  3VRR A;  4CFQ A;  1FI5 A;  5ER4 X;  3RM1 A;  1SCV A;  1PRW A;  3BYA A;  5AEQ A;  1XO5 A;  1CDN A;  1WRK A;  4XYN A;  2M29 A;  3CWG A;  1K9U A;  2G9B A;  3FWB A;  2CNP A;  2WCE A;  3BQ3 A;  2LLS A;  2SCP A;  1EJ3 A;  1N2D A;  1S1E A;  3HX4 A;  1IH0 A;  2EHB A;  5HLV A;  1B8R A;  1LA0 A;  3BOW B;  1F8H A;  2BL0 C;  1NSH A;  4PHK A;  2BEC A;  1RK9 A;  2EGD A;  2BCB A;  3EVV A;  1XYD A;  2BKI B;  2WCB A;  3AAJ A;  5IBW A;  1F4O A;  1KQM C;  2LNK A;  4YGE B;  5CSJ A;  3LLE A;  3PFV A;  4CPV A;  1TNX A;  1UHH A;  2NLN A;  1AJ5 A;  2HPS A;  1FBV A;  1K96 A;  1N65 A;  1TRF A;  3EVR A;  2M0R A;  3LK0 A;  3QRX A;  3PSR A;  2BKH B;  4NQG A;  1YUU A;  1UP5 A;  3VRQ A;  1J1E A;  1WDC B;  4ORA B;  3PN7 C;  2JNF A;  1YX8 A;  3TS5 B;  3WHU B;  2L50 A;  1NX2 A;  2OPO A;  3TDI A;  1CDP A;  1F55 A;  1DJH A;  2BCA A;  1V1F A;  2JC2 A;  1GJY A;  1XFZ O;  2KQ6 A;  2KYF A;  2QPT A;  3KF9 A;  4U8D A;  2PAL A;  2IS9 A;  1PK0 D;  1QIV A;  4MZJ A;  1CM4 A;  4XJK B;  5GQQ C;  2Q91 A;  3BUO B;  3F45 A;  1A75 A;  1YR5 A;  1OMD A;  1G4Y R;  3ICB A;  4PAL A;  1ZOT B;  1AUI B;  2Y1M A;  1NCX A;  1MQ1 A;  3DVM A;  5FYX A;  5J3X A;  2KSP A;  4N1F A;  1XK4 C;  3NSI A;  4ZCU A;  1QVI Y;  1CLM A;  1KSM A;  4PDZ A;  1DJW A;  4AOM A;  2MRD A;  3ZNI A;  2JT0 A;  2MLF C;  3VRN A;  1JF0 A;  1DVI A;  3AAK A;  1EG3 A;  1RJV A;  4MZL A;  1C07 A;  1SPY A;  2GV5 A;  1MXE A;  2K7B A;  4JQ0 D;  4ORC B;  1YRU B;  1MXL C;  2JNX A;  2LVJ A;  1J55 A;  4WRI A;  4AQJ A;  5JJG A;  1CMF A;  1F54 A;  2KI4 C;  3CLN A;  2ISD A;  2F3Y A;  2JOJ A;  2LHI A;  4M2O A;  4A4C A;  1MHO A;  2TN4 A;  1JWD A;  1TCF A;  1F70 A;  1MF8 B;  4DUQ A;  1A29 A;  1K8U A;  1S5G Z;  1J7O A;  1BJF A;  1QXP A;  2M1K B;  4QJ4 B;  1U5I B;  3NSO A;  2KHN A;  1WRZ A;  1TOP A;  1UWO A;  2PMY A;  4ZCV A;  1DF0 A;  2LVV A;  5K89 A;  4N5X A;  1JSA A;  1Y1U A;  5JOL A;  1QTX A;  3WNX B;  2F2P A;  2HF5 A;  1K9K A;  2EC6 B;  3EKJ A;  2KQY A;  2MA2 A;  3IQQ A;  1AK8 A;  1OQP A;  1DMO A;  1FPW A;  2NZ0 A;  1ALW A;  2VRG A;  2MJW B;  2WND A;  4NDB A;  3SG6 A;  2KDH A;  1OSA A;  3DVJ A;  1TNW A;  1DT7 B;  1CB1 A;  1ZAC A;  1J7Q A;  2O5G A;  4BY4 A;  3TDZ A;  1BR4 B;  1KSO A;  1A4P A;  1RRO A;  2LMV A;  3A8R A;  4GGF A;  1IG5 A;  2M1U A;  4GUK A;  4ICB A;  1UHN A;  2AAO A;  1KK8 C;  2JU0 A;  2KI6 C;  1AHR A;  2L4I A;  1H4B A;  1M63 B;  2BCX A;  5BPJ A;  3I5H C;  3BUW B;  1EL4 A;  2JXC A;  4GGF C;  1IGV A;  5DKR A;  1DJY A;  2I7A A;  2BBM A;  2CBL A;  1ALV A;  3DF0 A;  1NX0 A;  1CFC A;  2JTT A;  1CMG A;  1YUT A;  3OP0 A;  4PHN A;  5I2Q A;  2F8P A;  3A4U B;  1TCO B;  2WC8 A;  2AUC A;  3JTD B;  1K2H A;  4E68 A;  4BY5 A;  1NIW A;  4WQ3 A;  1SW8 A;  3ZWH A;  1EG4 A;  1L2O B;  3EVU A;  4I5N B;  1SR6 B;  2K2A A;  5HLO A;  1SCM B;  5AFP A;  1CFF A;  4GGN A;  1KFU S;  1WY9 A;  4HRE E;  2LP3 A;  2KI6 D;  4PE1 A;  4WQ2 A;  2BL0 B;  1Y0V H;  1KFU L;  2BBN A;  3I5F B;  2LUX A;  3SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...