3LCPC

Crystal structure of the carbohydrate recognition domain of lman1 in complex with mcfd2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
68
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Protein ERGIC-53
publication title Crystal structure of the LMAN1-CRD/MCFD2 transport receptor complex provides insight into combined deficiency of factor V and factor VIII.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 68
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lcpC00
1SMGA 3CR4X 5PALA 2LLSA 1K9KA 2PVBA 3VROA 1BF5A 1SCMB 1S36A 2ZKMX 5CPVA 2WOSA 3CR5X 3O4YA 2WNDA 1MF8B 1B8LA 3O6BA 3D10A 1F4QA 2GGZA 4CIDA 1DJHA 1QV1A 1UP5A 3I5GB 1UHIA 2E6WA 2LHLA 3C1VA 3EVUA 5I2OA 1PSBA 1WDCC 1DJIA 2I94A 1CM4A 4DCKA 3RM1A 1L2OB 3I5FC 1PK0D 2F8PA 1KFXL 1SL7A 2AUCA 4GGFA 2LC5A 2JNFA 1QX7A 1PVAA 1MWNA 2KFFA 3BUNB 3TUYB 2L50A 2WCEA 1NCZA 3NSKA 1LA0A 1LINA 1R6PA 3TDIA 1S6CA 4BY4A 4CPVA 4BY5A 4ETOA 1SL9A 1KCYA 3EVVA 1F71A 1JSAA 3TZ1A 2CXJA 3A4UB 4CLNA 2F33A 1AP4A 1LKJA 2I2RE 5AXIA 1S6JA 2JT0A 2M7LA 2JULA 1F70A 1KSOA 2JT3A 4F0ZB 4ORAB 1ZACA 1QVIY 1B4CA 3NSOA 1K9UA 3KPXA 1HQVA 1KK7Y 1K96A 2BCXA 4I5NB 4YI8A 5K89A 1B47A 1BLQA 3VGOA 2M7NA 4MRXA 2KAYA 3SIBA 1FI6A 1BR1B 1Y1UA 1N2DA 2HETA 4MZJA 2K2FA 3PM8A 4L9MA 1DF0B 5D69A 3IQQA 1JF0A 2LV7A 2L5XB 1CDMA 1XK4C 2K8MB 3EK8A 2OTGC 1IJ5A 5FYXA 1DTLA 1DT7B 4GPLB 2I7AA 2L0PA 2MJWB 2FOTA 3VRPA 2K7DA 1WLMA 2F3YA 4GAOA 1J1EA 2MRDA 1WDCB 3CZTX 3GK1A 1TTXA 4P2YB 1LA3A 2PRUA 1RFJA 2JXLA 1OMRA 1V1GA 2JXCA 3I5FB 3GK2A 4CFQA 2PMYA 4ORCB 5KU1A 1EG3A 4U8DA 4DS7A 4OVNF 5DKQA 3ZWHA 2HF5A 2M97A 3GOFA 1K94A 4ZCUA 2ZRTA 1RECA 2I18A 4N1GA 4NDCA 2AAOA 4GUKA 2JT8A 5I2QA 4MVFA 3DF0A 1QLSA 1AUIB 2NCPA 3HCMA 5BPJA 3M0WA 1DGVA 4PDZA 2LNKA 1ALVA 1ODBA 1JWDA 3JTDC 1BT6A 2LLUA 2ZNEA 4YGDB 1K2HA 1IQ5A 2PSRA 3BYAA 1A75A 1LVCD 3KF9A 2CT9A 4A4BA 1NCYA 1QV0A 1XFYO 2H2KA 4MBEA 1HT9A 2BECA 1G8IA 1NIWA 2KGBC 4R1EA 1SKTA 3AKAA 1YTZC 2OTGB 4MLWA 1D1OA 2JTZA 2K7CA 2BKIB 1WRZA 1K95A 1F55A 1BG1A 2Y1NA 3BOWA 2FJUB 5J3XA 1Y6WA 2LMUA 3BUWB 1OZOA 1ZOTB 2LVVA 1RWYA 1KWOC 2KNEA 4YGAA 2KAVA 4PE1A 2KYCA 1IG5A 1QJTA 3O2PA 1EH2A 1EG4A 1AJ5A 1XYDA 2IS9A 1OE9B 5CSNA 4PE7A 1JBAA 2JC2A 3PN7C 2WCBA 3EKJA 4JPZB 1BR4B 1KK8C 1MHOA 1YX7A 2KOTA 1UHHA 1YRTB 4PHKA 2KI6C 1PALA 2Y1MA 3WHUB 1J7PA 1YURA 1SRAA 4QJ3B 4QJ5B 2K61A 1DMOA 1S1EA 2Q91A 4I5JA 4PE4A 1J1DA 3VRNA 3OHMB 3JTDB 2FCDA 3AAJA 4XJKB 3SG3A 3LK1A 2HQWA 2LUXA 1G4YR 2OS8C 4YBHB 4CFRA 1QXPA 2BE4A 1C07A 1WRKA 1BODA 2KAXA 2A4JA 1H4BA 2O60A 2Y5IA 4MSPA 2EC6C 3SG4A 2LCPA 4DUQA 4WRIA 2LAPA 1IGVA 2BE6A 5G08A 1N0YA 2L2EA 4C0JA 1C7WA 1TNQA 3SG7A 2M0RA 1B8CA 4DIRA 1CMGA 2G2BA 3VRQA 1CDNA 3ZNIA 1BMOA 1K8UA 1OMVA 1NP8A 1ZUZA 1PVBA 1M46A 3I5HC 1N65A 2H61A 3KO0A 4GGNA 1EL4A 1KWOB 2KDHA 1EJ3A 1M63B 1XFWO 2M29A 2CCMA 2SASA 3FS7A 3EK7A 4MZKA 2JWWA 1S6IA 3PFVA 4MN0A 3PN7B 2M3WA 1KQVA 2BBNA 2CTNA 3H4SE 1KK8B 1M39A 2LMTA 4I5KA 4NDDA 4I5LB 2TN4A 2MLFC 2QACA 4XYNA 1J55A 3IQOA 1RROA 4FTGA 1IRJA 2NXQA 3JVTC 3LL8B 1YUSA 2D8NA 1B1GA 2CBLA 4AQJA 1JUOA 1CFPA 1AJ4A 2Y4QA 3CTNA 1RTP1 3BUMB 3DVKA 1DJWA 4C0KA 1CLBA 2BL0C 2AMIA 2JRFA 3PATA 1QVIZ 1S5GY 3CWGA 1B7TY 2OS8B 2L98A 1NCXA 1QLKA 1CTRA 1U5IB 4PHJA 1KK7Z 4IL1A 2GV5A 2KYFA 2LVJA 2EC6B 1A29A 1FW4A 3VRRA 1TOPA 1DF0A 1TIZA 5TNCA 1R2UA 1YUTA 1SW8A 2COLB 2OPOA 3IF7A 1MUXA 5GQQC 1TN4A 1EXRA 1SR6C 1NSHA 3WHTB 1BU3A 3DVJA 4PE0A 1UUSA 1SY9A 4PHMA 4JQ0D 4C0LA 1L7ZA 4GGFC 2VRGA 1JC2A 1SL8A 1OQPA 3I5HB 3I5IC 1ZMZA 1CFFA 1GJYA 2B1UA 2O5GA 5CSFA 1PULA 1SCMC 1CLMA 2KFHA 2LVKA 1QX5B 1U5IA 3CS1A 2KGRA 5HYDA 3DVEA 1NWDA 5I2LA 1W7IB 1K9PA 3FWCA 3BUXB 5KTYA 4OKHA 1YVLA 1YRUB 4PCWA 1SNLA 5I8NA 2BCBA 1IQ3A 1QIVA 4YI9A 1WRLA 2KI6D 3AAKA 1NX0A 3JVTB 1CDPA 1CDLA 1A4PA 1IWQA 1CM1A 2M9GA 4ZCVA 4D1EA 2P6BB 2JTTA 3O78A 1M45A 1K93D 1UHKA 3QRXA 2L4HA 1CB1A 1MXLC 1E8AA 2JPTA 2Q4UA 1CNPA 3MSEB 4NQGA 3WXAA 2BL0B 4M2PA 2KQ6A 5AEQA 1CFCA 3LLEA 1IJ6A 3FIAA 4FQOA 5HKWA 3DVMA 2JOJA 4GBAA 4ICBA 4OR9B 2V53A 4A4CA 1DVIA 3NSLA 1XK4A 2CNPA 2RGIA 4ORBB 4TNCA 4E68A 2JZIA 2MA2A 1OZSA 3AKBA 1OOJA 1J7QA 3NSIA 5IBWA 3WNXB 5AANA 2MHHA 1DGUA 4HSZA 1QATA 1DJZA 3I5IB 1FBVA 2BKHB 1MR8A 4M2QA 4YGCB 5DKRA 3TDZA 1MQ1A 3SIAA 1NX2A 1UHNA 2ZN9A 4YRUA 4GFTA 3SG6A 4QJ4B 2M1KB 1PRWA 3A8RA 3HX4A 1IH0A 2DOQA 4M2OA 2E30A 1KFUS 2M49B 4DRWA 1UHJA 1FI5A 2NCOA 3DD4A 1MXEA 1YUUA 2HQ8A 1ALWA 3LK0A 1WY9A 2R2IA 1RJVA 1B9AA 1S3PA 2K2AA 1YX8A 1AHRA 1QX2A 5AFPA 2KFGA 1TCOB 5CSIA 5HLVA 3F45A 3OB2B 1OMDA 2L51A 4XJKA 4JWQA 2KBIA 2JNXA 3CR2A 1NX3A 3CGAA 2ISDA 3EK4A 3EVRA 5HLOA 4YGBB 2LHIA 3ICBA 2F3ZA 3OP0A 1H8BA 2PASA 2WC8A 4N5XA 1SYMA 2WCFA 5ER4X 1AK8A 5ER5A 1GGWA 1FPWA 1F8HA 2KSPA 2KI4C 1V1FA 2GGMA 1SK6D 2F2OA 2M1UA 2PALA 4HREE 4PALA 3OX6A 3KHEA 2WORA 2LANA 2LP3A 5F6TA 2EGDA 1GQMA 2MAZA 3LCPC 2K7OA 1KSMA 1NX1A 2ZNDA 3OB1B 2KHNA 2SCPA 3RLZA 1J7OA 1SBJA 3GK4X 4UPGA 3NXAA 4N1FA 1QTXA 2LUCA 1KQMC 5D7FA 1SPYA 2LM5A 3DF0B 4AQIA 1KFXS 1Y1AA 4Q04A 3SJSA 1XFXO 1G33A 1BOCA 1XFVO 4YGEB 3KEVA 1J7RA 1XA5A 1X02A 3TS5C 1CLLA 1M31A 1AVSA 1XVJA 1XO5A 1CMFA 1PSRA 3K21A 1XFUO 1XFZO 4WQ3A 1A75B 3D0YB 1F4OA 4HRGA 3OX5A 1DJXA 1W7JB 4GNKB 2K0JA 2NLNA 1TCFA 1RK9A 2BBMA 1Y0VH 1Y1XA 2F2PA 3BQ3A 3CLNA 1UWOA 5HKZA 5HKYA 1WLZA 3PALA 3EKHA 4HRHA 1S26D 1S5GZ 1QIWA 3PLFB 1B7TZ 3SG2A 1F54A 3I5GC 4MRYA 4MZLA 3BOWB 2H61C 2KI4B 4PHNA 1VRKA 3E3RA 4OV2A 1L2OC 2BCAA 2LP2A 1ZFSA 4MEWA 1TNWA 5CSJA 1OSAA 1TNXA 3FWBA 1YR5A 2LVIA 2L4IA 1KFUL 1CKKA 4OCIA 2EHBA 1TNPA 2ZRSA 3D0YA 3TDUA 3TUYC 4WQ2A 2ZFDA 2NZ0A 1JF2A 1IKUA 1NUBA 2LE9B 1KQMB 1A2XA 2JQ6A 2QPTA 3SG5A 1BJFA 1JFKA 1QS7A 5JOLA 2MBXA 1LXFC 2MLEC 2G9BA 2ZN8A 1B8RA 2LLTA 5AERA 4USLA 1YVHA 4P5OE 1JFJA 5B8IB 3TS5B 2M8UA 1NPQA 2K7BA 1CFDA 1Q80A 1SR6B 1DJYA 1UURA 2KBMA 2LMVA 4AOMA 3BXKA 5DKNA 2JU0A 1A03A 1FF1A 1NYAA 3BUOB 2HPSA 5KSZA 1DJGA 1TRFA 1C7VA 2KQYA 2FCEA 5JJGA 1K90D 1SCVA 1GGZA 3PSRA 4NDBA 1QASA
chains in the Genus database with same CATH superfamily
1SMGA 3CR4X 3S0DA 5PALA 2LLSA 5FI6A 1K9KA 2PVBA 3VROA 1DC1A 1BF5A 1SCMB 1S36A 2ZKMX 5CPVA 2WOSA 3CR5X 3O4YA 2WNDA 1MF8B 1B8LA 3O6BA 3BJHA 3D10A 1F4QA 2GGZA 4CIDA 1DJHA 1QV1A 1UP5A 3I5GB 1UHIA 2E6WA 2LHLA 3C1VA 3EVUA 5I2OA 4F7FA 1PSBA 1WDCC 1DJIA 2I94A 1CM4A 4DCKA 3RM1A 1L2OB 3I5FC 1PK0D 2F8PA 1KFXL 1SL7A 2AUCA 4GGFA 2LC5A 2JNFA 1QX7A 2QEBA 1PVAA 1MWNA 3SS5A 2KFFA 3BUNB 3TUYB 2L50A 2WCEA 1NCZA 3NSKA 1ORGA 1LA0A 1LINA 1R6PA 3TDIA 1S6CA 2KLEA 4BY4A 4BY5A 4CPVA 4ETOA 1SL9A 1KCYA 3EVVA 1F71A 4PT1A 1JSAA 3O4XA 4KYNA 3TZ1A 2CXJA 3A4UB 4CLNA 2BAPA 2F33A 1AP4A 1LKJA 2I2RE 5AXIA 1S6JA 3V2LA 2JT0A 2M7LA 3R1VA 2JULA 1F70A 1KSOA 2JT3A 4F0ZB 4ORAB 1ZACA 1QVIY 1B4CA 3NSOA 1K9UA 2BNXA 3KPXA 1HQVA 1KK7Y 1K96A 2BCXA 4I5NB 4YI8A 5K89A 1B47A 1BLQA 3VGOA 2M7NA 3BFBA 4MRXA 2KAYA 3SIBA 1FI6A 1BR1B 1Y1UA 3BFHA 1N2DA 2HETA 4MZJA 2K2FA 3PM8A 4L9MA 1DF0B 5D69A 3IQQA 1JF0A 2LV7A 2L5XB 3D76A 1CDMA 1XK4C 1TUJA 2K8MB 2OTGC 3EK8A 1IJ5A 5FYXA 1DTLA 3EG5B 1DT7B 4GPLB 2I7AA 3UO9A 5FI7A 2L0PA 2MJWB 2FOTA 3QMEA 3VRPA 2K7DA 1WLMA 2F3YA 4GAOA 3FE9A 1J1EA 2MRDA 1WDCB 2QEHA 3CZTX 1TTXA 3GK1A 4P2YB 1LA3A 3SS3A 2PRUA 1RFJA 2JXLA 1OMRA 1V1GA 2JXCA 3I5FB 3GK2A 4CFQA 1C3YA 2PMYA 4ORCB 2ERBA 5KU1A 1EG3A 4U8DA 4DS7A 4OVNF 5DKQA 3ZWHA 2HF5A 2M97A 2WCLA 1K94A 3B7AA 3GOFA 4ZCUA 2ZRTA 1RECA 2I18A 2KLDA 4N1GA 4NDCA 2AAOA 1Z4HA 2JT8A 4GUKA 4MVFA 5I2QA 3DF0A 1QLSA 1AUIB 2NCPA 3HCMA 5BPJA 3M0WA 1DGVA 4PDZA 1GM0A 2LNKA 1ALVA 1ODBA 1W9ZA 3JTDC 1JWDA 2PQLA 1BT6A 2LLUA 2P70A 2ZNEA 4YGDB 1DELA 1K2HA 1IQ5A 2PSRA 3NHIA 3BYAA 1A75A 1LVCD 3KF9A 2CT9A 4A4BA 2L5YA 3S0AA 1NCYA 1QV0A 1XFYO 2H2KA 4MBEA 1HT9A 2BECA 1G8IA 1NIWA 2KGBC 4R1EA 1SKTA 3AKAA 1YTZC 2OTGB 4MLWA 1D1OA 2JTZA 2K7CA 2H8VA 2BKIB 1WRZA 1K95A 1F55A 1BG1A 2Y1NA 3BOWA 2FJUB 5J3XA 4FQTA 1Y6WA 2LMUA 3BUWB 1OZOA 1ZOTB 2LVVA 1RWYA 1KWOC 2KNEA 4YGAA 2KAVA 4PE1A 2KYCA 1IG5A 1QJTA 3O2PA 1EH2A 1EG4A 1AJ5A 1XYDA 2IS9A 1OE9B 5CSNA 4PE7A 1C3ZA 3D77A 1JBAA 2JC2A 3PN7C 2WCBA 1LS8A 3EKJA 3D74A 4JPZB 2GTEA 1BR4B 1KK8C 1MHOA 1YX7A 2KOTA 1UHHA 1YRTB 2PYQA 4PHKA 2KI6C 1PALA 2Y1MA 3WHUB 1J7PA 1YURA 1SRAA 4QJ3B 4QJ5B 2K61A 1DMOA 1S1EA 2Q91A 4I5JA 1TWOA 4PE4A 2QDIA 3OBVA 1J1DA 3VRNA 3OHMB 3PM2A 3JTDB 2FCDA 3AAJA 3SS4A 4XJKB 3SG3A 3LK1A 2HQWA 2LUXA 1G4YR 2OS8C 4YBHB 4CFRA 1QXPA 2BE4A 1C07A 1WRKA 2KPHA 1BODA 2KAXA 2A4JA 1H4BA 2O60A 2Y5IA 4MSPA 2EC6C 3SG4A 2LCPA 4DUQA 4WRIA 2LAPA 1IGVA 2BE6A 5G08A 1N0YA 2L2EA 4C0JA 1C7WA 1TNQA 3SG7A 2M0RA 1B8CA 4DIRA 1CMGA 2G2BA 3PJIA 2K60A 3VRQA 1CDNA 3ZNIA 1BMOA 1K8UA 1OMVA 1NP8A 1ZUZA 1PVBA 1M46A 3I5HC 1N65A 2H61A 3KO0A 4GGNA 3CZ0A 1EL4A 1KWOB 2KDHA 1EJ3A 1M63B 1XFWO 2JPOA 2M29A 2CCMA 2SASA 3CZ2A 3FS7A 3EK7A 4MZKA 2JWWA 1S6IA 1OOFA 3PFVA 4MN0A 1OW4A 3PN7B 2M3WA 3NHTA 1KQVA 2BBNA 2CTNA 3VB1A 3CABA 5I94A 3H4SE 1KK8B 1M39A 2LMTA 4I5KA 4NDDA 3D78A 4I5LB 2TN4A 2MLFC 2QACA 4XYNA 1J55A 2FJYA 1RROA 3IQOA 4INXA 4FTGA 1IRJA 2NXQA 2WCMA 3JVTC 1YUSA 2D8NA 3LL8B 3N7HA 3FE8A 1B1GA 2CBLA 4AQJA 3R1OA 1JUOA 1CFPA 3S0EA 1AJ4A 2Y4QA 3BFAA 3CTNA 1RTP1 3BUMB 3DVKA 1DJWA 1QWVA 4C0KA 2BL0C 1CLBA 2AMIA 2JRFA 2L2CA 1QVIZ 1S5GY 3CWGA 1B7TY 3PATA 2OS8B 3DZTA 2L98A 1NCXA 1QLKA 1CTRA 1U5IB 3B86A 4PHJA 1KK7Z 4IL1A 2GV5A 2KYFA 2LVJA 2EC6B 1A29A 1FW4A 3VRRA 1TOPA 1DF0A 1TIZA 3S0GA 5TNCA 1R2UA 1YUTA 1SW8A 2COLB 2OPOA 3IF7A 1MUXA 5GQQC 1TN4A 4IJ7A 1IIOA 1EXRA 1SR6C 2WC5A 1NSHA 3WHTB 1BU3A 3DVJA 4PE0A 1UUSA 1SY9A 4PHMA 5EL2A 4JQ0D 4C0LA 1L7ZA 4GGFC 2VRGA 1JC2A 1SL8A 1OQPA 3I5HB 3I5IC 1ZMZA 1CFFA 1GJYA 2B1UA 2O5GA 3R1PA 5CSFA 1PULA 1SCMC 1CLMA 1OOGA 2KFHA 2LVKA 1QX5B 1U5IA 3CS1A 4JD9A 2KGRA 5HYDA 3CDNA 3DVEA 1NWDA 5I2LA 3B87A 4OZDA 1W7IB 1K9PA 3FWCA 3BUXB 5KTYA 3IVTA 3RZSA 3S0BA 3R72A 4OKHA 1YVLA 1YRUB 4PCWA 1SNLA 5I8NA 2BCBA 1IQ3A 1QIVA 4YI9A 1WRLA 3L4AA 2KI6D 3AAKA 1NX0A 3JVTB 4INWA 3Q8IA 1CDPA 1CDLA 1A4PA 1IWQA 1CM1A 2M9GA 4ZCVA 4D1EA 2P6BB 2JTTA 3O78A 1M45A 1K93D 1UHKA 1OOHA 3QRXA 2L4HA 1CB1A 1MXLC 1Z2CB 1E8AA 2JPTA 2Q4UA 1CNPA 3B6XA 3MSEB 4NQGA 2BL0B 4M2PA 3WXAA 2KQ6A 5AEQA 1CFCA 3LLEA 1IJ6A 3FIAA 4FQOA 5HKWA 3DVMA 3OGNA 2JOJA 4GBAA 4ICBA 4OR9B 2V53A 3D73A 4A4CA 1DVIA 3NSLA 1XK4A 2CNPA 2RGIA 4ORBB 4TNCA 4E68A 2JZIA 2MA2A 2YGUA 1OZSA 3AKBA 1OOJA 5FI2A 1J7QA 3NSIA 5IBWA 3WNXB 3DYEA 5AANA 2MHHA 3L4LA 1DGUA 4HSZA 3S0FA 1QATA 1DJZA 1DQEA 3K1EA 3I5IB 5DICA 1FBVA 2BKHB 1MR8A 4M2QA 4YGCB 5DKRA 3TDZA 1MQ1A 3SIAA 5D3OA 1NX2A 1UHNA 2ZN9A 4YRUA 4GFTA 3UNWA 3SG6A 4QJ4B 2M1KB 1PRWA 3A8RA 3HX4A 1IH0A 2DOQA 4M2OA 2E30A 1KFUS 1OOIX 2M49B 2QEVA 4DRWA 1UHJA 1FI5A 2NCOA 3DD4A 1MXEA 1YUUA 2HQ8A 1ALWA 3LK0A 1WY9A 2P71A 2R2IA 4JKTA 1RJVA 1B9AA 1S3PA 2K2AA 1YX8A 1AHRA 1QX2A 5AFPA 2KFGA 1TCOB 5CSIA 5HLVA 3F45A 3OB2B 1OMDA 2L51A 4XJKA 4JWQA 2KBIA 2JNXA 3CR2A 1NX3A 3CGAA 2ISDA 3EK4A 3FE6A 3EVRA 5HLOA 4YGBB 1T14A 2LHIA 3ICBA 2F3ZA 3L47A 5HL1A 1P28A 3OP0A 1H8BA 2PASA 2WC8A 4N5XA 1SYMA 2WCFA 5ER4X 1AK8A 5ER5A 1GGWA 1FPWA 1F8HA 2KSPA 2KI4C 1V1FA 2GGMA 1SK6D 2F2OA 2M1UA 2PALA 4HREE 4PALA 3OX6A 3KHEA 2WORA 2LANA 2LP3A 5F6TA 2EGDA 1GQMA 2MAZA 3LCPC 2K7OA 1KSMA 1NX1A 2ZNDA 3OB1B 2KHNA 2SCPA 3RLZA 1J7OA 1SBJA 3GK4X 4UPGA 3NXAA 4N1FA 1QTXA 2LUCA 2WC6A 1KQMC 5D7FA 1SPYA 2QEOA 2LM5A 3DF0B 4AQIA 1KFXS 1Y1AA 4Q04A 3SJSA 1XFXO 3CZ1A 1G33A 1BOCA 1XFVO 4YGEB 3KEVA 1J7RA 1XA5A 3DY9A 1X02A 3TS5C 1CLLA 1M31A 1AVSA 1XVJA 1XO5A 1CMFA 1PSRA 3K21A 1XFUO 1XFZO 4WQ3A 1A75B 3D0YB 1F4OA 4HRGA 3OX5A 1DJXA 1W7JB 2WCHA 2K0JA 2NLNA 1TCFA 1RK9A 4GNKB 2BBMA 1Y0VH 1Y1XA 2F2PA 1XFRA 3BQ3A 3CLNA 1UWOA 5HKZA 5HKYA 1WLZA 3PALA 3EKHA 4HRHA 1S26D 1S5GZ 1QIWA 3PLFB 1B7TZ 3SG2A 1F54A 3I5GC 4MRYA 4MZLA 3BOWB 2WCJA 1SSEB 2H61C 2KI4B 3DXLA 4PHNA 1VRKA 3E3RA 4OV2A 1L2OC 2BCAA 2LP2A 1ZFSA 4MEWA 1TNWA 5CSJA 1OSAA 1TNXA 3FWBA 1YR5A 2LVIA 2L4IA 3NGVA 1KFUL 1CKKA 4OCIA 2EHBA 1TNPA 2ZRSA 3D0YA 3TDUA 3TUYC 4WQ2A 1DEKA 2ZFDA 2NZ0A 1JF2A 1TUZA 1IKUA 1NUBA 2LE9B 1KQMB 1A2XA 2JQ6A 2QPTA 3SG5A 1BJFA 1JFKA 1QS7A 5JOLA 2MBXA 1LXFC 2MLEC 2G9BA 2ZN8A 1B8RA 2LLTA 5AERA 4USLA 1YVHA 4P5OE 3CYZA 1JFJA 3B88A 5B8IB 3TS5B 2M8UA 1NPQA 2K7BA 1CFDA 1Q80A 1SR6B 1DJYA 1UURA 2KBMA 2LMVA 4AOMA 3BXKA 3D75A 5DKNA 2JU0A 2WCKA 1A03A 1NYAA 1FF1A 3BUOB 2HPSA 5KSZA 1DJGA 1TRFA 1C7VA 2KQYA 2FCEA 5JJGA 1K90D 1SCVA 1GGZA 3PSRA 4NDBA 1QASA
chains in the Genus database with same CATH topology
1SMGA 3CR4X 5PALA 2LLSA 1K9KA 2PVBA 3VROA 1BF5A 1SCMB 1S36A 2ZKMX 5CPVA 2WOSA 3CR5X 3O4YA 2WNDA 1MF8B 1B8LA 3O6BA 3D10A 1F4QA 2GGZA 4CIDA 1DJHA 1QV1A 1UP5A 3I5GB 1UHIA 2E6WA 2LHLA 3C1VA 3EVUA 5I2OA 1PSBA 1WDCC 1DJIA 2I94A 1CM4A 4DCKA 3RM1A 1L2OB 3I5FC 1PK0D 2F8PA 1KFXL 1SL7A 2AUCA 4GGFA 2LC5A 2JNFA 1QX7A 1PVAA 1MWNA 2KFFA 3BUNB 3TUYB 2L50A 2WCEA 1NCZA 3NSKA 1LA0A 1LINA 1R6PA 3TDIA 1S6CA 4BY4A 4CPVA 4BY5A 4ETOA 1SL9A 1KCYA 3EVVA 1F71A 1JSAA 3TZ1A 2CXJA 3A4UB 4CLNA 2F33A 1AP4A 1LKJA 2I2RE 5AXIA 1S6JA 2JT0A 2M7LA 2JULA 1F70A 1KSOA 2JT3A 4F0ZB 4ORAB 1ZACA 1QVIY 1B4CA 3NSOA 1K9UA 3KPXA 1HQVA 1KK7Y 1K96A 2BCXA 4I5NB 4YI8A 5K89A 1B47A 1BLQA 3VGOA 2M7NA 4MRXA 2KAYA 3SIBA 1FI6A 1BR1B 1Y1UA 1N2DA 2HETA 4MZJA 2K2FA 3PM8A 4L9MA 1DF0B 5D69A 3IQQA 1JF0A 2LV7A 2L5XB 1CDMA 1XK4C 2K8MB 3EK8A 2OTGC 1IJ5A 5FYXA 1DTLA 1DT7B 4GPLB 2I7AA 2L0PA 2MJWB 2FOTA 3VRPA 2K7DA 1WLMA 2F3YA 4GAOA 1J1EA 2MRDA 1WDCB 3CZTX 3GK1A 1TTXA 4P2YB 1LA3A 2PRUA 1RFJA 2JXLA 1OMRA 1V1GA 2JXCA 3I5FB 3GK2A 4CFQA 2PMYA 4ORCB 5KU1A 1EG3A 4U8DA 4DS7A 4OVNF 5DKQA 3ZWHA 2HF5A 2M97A 3GOFA 1K94A 4ZCUA 2ZRTA 1RECA 2I18A 4N1GA 4NDCA 2AAOA 4GUKA 2JT8A 5I2QA 4MVFA 3DF0A 1QLSA 1AUIB 2NCPA 3HCMA 5BPJA 3M0WA 1DGVA 4PDZA 2LNKA 1ALVA 1ODBA 1JWDA 3JTDC 1BT6A 2LLUA 2ZNEA 4YGDB 1K2HA 1IQ5A 2PSRA 3BYAA 1A75A 1LVCD 3KF9A 2CT9A 4A4BA 1NCYA 1QV0A 1XFYO 2H2KA 4MBEA 1HT9A 2BECA 1G8IA 1NIWA 2KGBC 4R1EA 1SKTA 3AKAA 1YTZC 2OTGB 4MLWA 1D1OA 2JTZA 2K7CA 2BKIB 1WRZA 1K95A 1F55A 1BG1A 2Y1NA 3BOWA 2FJUB 5J3XA 1Y6WA 2LMUA 3BUWB 1OZOA 1ZOTB 2LVVA 1RWYA 1KWOC 2KNEA 4YGAA 2KAVA 4PE1A 2KYCA 1IG5A 1QJTA 3O2PA 1EH2A 1EG4A 1AJ5A 1XYDA 2IS9A 1OE9B 5CSNA 4PE7A 1JBAA 2JC2A 3PN7C 2WCBA 3EKJA 4JPZB 1BR4B 1KK8C 1MHOA 1YX7A 2KOTA 1UHHA 1YRTB 4PHKA 2KI6C 1PALA 2Y1MA 3WHUB 1J7PA 1YURA 1SRAA 4QJ3B 4QJ5B 2K61A 1DMOA 1S1EA 2Q91A 4I5JA 4PE4A 1J1DA 3VRNA 3OHMB 3JTDB 2FCDA 3AAJA 4XJKB 3SG3A 3LK1A 2HQWA 2LUXA 1G4YR 2OS8C 4YBHB 4CFRA 1QXPA 2BE4A 1C07A 1WRKA 1BODA 2KAXA 2A4JA 1H4BA 2O60A 2Y5IA 4MSPA 2EC6C 3SG4A 2LCPA 4DUQA 4WRIA 2LAPA 1IGVA 2BE6A 5G08A 1N0YA 2L2EA 4C0JA 1C7WA 1TNQA 3SG7A 2M0RA 1B8CA 4DIRA 1CMGA 2G2BA 3VRQA 1CDNA 3ZNIA 1BMOA 1K8UA 1OMVA 1NP8A 1ZUZA 1PVBA 1M46A 3I5HC 1N65A 2H61A 3KO0A 4GGNA 1EL4A 1KWOB 2KDHA 1EJ3A 1M63B 1XFWO 2M29A 2CCMA 2SASA 3FS7A 3EK7A 4MZKA 2JWWA 1S6IA 3PFVA 4MN0A 3PN7B 2M3WA 1KQVA 2BBNA 2CTNA 3H4SE 1KK8B 1M39A 2LMTA 4I5KA 4NDDA 4I5LB 2TN4A 2MLFC 2QACA 4XYNA 1J55A 3IQOA 1RROA 4FTGA 1IRJA 2NXQA 3JVTC 3LL8B 1YUSA 2D8NA 1B1GA 2CBLA 4AQJA 1JUOA 1CFPA 1AJ4A 2Y4QA 3CTNA 1RTP1 3BUMB 3DVKA 1DJWA 4C0KA 1CLBA 2BL0C 2AMIA 2JRFA 3PATA 1QVIZ 1S5GY 3CWGA 1B7TY 2OS8B 2L98A 1NCXA 1QLKA 1CTRA 1U5IB 4PHJA 1KK7Z 4IL1A 2GV5A 2KYFA 2LVJA 2EC6B 1A29A 1FW4A 3VRRA 1TOPA 1DF0A 1TIZA 5TNCA 1R2UA 1YUTA 1SW8A 2COLB 2OPOA 3IF7A 1MUXA 5GQQC 1TN4A 1EXRA 1SR6C 1NSHA 3WHTB 1BU3A 3DVJA 4PE0A 1UUSA 1SY9A 4PHMA 4JQ0D 4C0LA 1L7ZA 4GGFC 2VRGA 1JC2A 1SL8A 1OQPA 3I5HB 3I5IC 1ZMZA 1CFFA 1GJYA 2B1UA 2O5GA 5CSFA 1PULA 1SCMC 1CLMA 2KFHA 2LVKA 1QX5B 1U5IA 3CS1A 2KGRA 5HYDA 3DVEA 1NWDA 5I2LA 1W7IB 1K9PA 3FWCA 3BUXB 5KTYA 4OKHA 1YVLA 1YRUB 4PCWA 1SNLA 5I8NA 2BCBA 1IQ3A 1QIVA 4YI9A 1WRLA 2KI6D 3AAKA 1NX0A 3JVTB 1CDPA 1CDLA 1A4PA 1IWQA 1CM1A 2M9GA 4ZCVA 4D1EA 2P6BB 2JTTA 3O78A 1M45A 1K93D 1UHKA 3QRXA 2L4HA 1CB1A 1MXLC 1E8AA 2JPTA 2Q4UA 1CNPA 3MSEB 4NQGA 3WXAA 2BL0B 4M2PA 2KQ6A 5AEQA 1CFCA 3LLEA 1IJ6A 3FIAA 4FQOA 5HKWA 3DVMA 2JOJA 4GBAA 4ICBA 4OR9B 2V53A 4A4CA 1DVIA 3NSLA 1XK4A 2CNPA 2RGIA 4ORBB 4TNCA 4E68A 2JZIA 2MA2A 1OZSA 3AKBA 1OOJA 1J7QA 3NSIA 5IBWA 3WNXB 5AANA 2MHHA 1DGUA 4HSZA 1QATA 1DJZA 3I5IB 1FBVA 2BKHB 1MR8A 4M2QA 4YGCB 5DKRA 3TDZA 1MQ1A 3SIAA 1NX2A 1UHNA 2ZN9A 4YRUA 4GFTA 3SG6A 4QJ4B 2M1KB 1PRWA 3A8RA 3HX4A 1IH0A 2DOQA 4M2OA 2E30A 1KFUS 2M49B 4DRWA 1UHJA 1FI5A 2NCOA 3DD4A 1MXEA 1YUUA 2HQ8A 1ALWA 3LK0A 1WY9A 2R2IA 1RJVA 1B9AA 1S3PA 2K2AA 1YX8A 1AHRA 1QX2A 5AFPA 2KFGA 1TCOB 5CSIA 5HLVA 3F45A 3OB2B 1OMDA 2L51A 4XJKA 4JWQA 2KBIA 2JNXA 3CR2A 1NX3A 3CGAA 2ISDA 3EK4A 3EVRA 5HLOA 4YGBB 2LHIA 3ICBA 2F3ZA 3OP0A 1H8BA 2PASA 2WC8A 4N5XA 1SYMA 2WCFA 5ER4X 1AK8A 5ER5A 1GGWA 1FPWA 1F8HA 2KSPA 2KI4C 1V1FA 2GGMA 1SK6D 2F2OA 2M1UA 2PALA 4HREE 4PALA 3OX6A 3KHEA 2WORA 2LANA 2LP3A 5F6TA 2EGDA 1GQMA 2MAZA 3LCPC 2K7OA 1KSMA 1NX1A 2ZNDA 3OB1B 2KHNA 2SCPA 3RLZA 1J7OA 1SBJA 3GK4X 4UPGA 3NXAA 4N1FA 1QTXA 2LUCA 1KQMC 5D7FA 1SPYA 2LM5A 3DF0B 4AQIA 1KFXS 1Y1AA 4Q04A 3SJSA 1XFXO 1G33A 1BOCA 1XFVO 4YGEB 3KEVA 1J7RA 1XA5A 1X02A 3TS5C 1CLLA 1M31A 1AVSA 1XVJA 1XO5A 1CMFA 1PSRA 3K21A 1XFUO 1XFZO 4WQ3A 1A75B 3D0YB 1F4OA 4HRGA 3OX5A 1DJXA 1W7JB 4GNKB 2K0JA 2NLNA 1TCFA 1RK9A 2BBMA 1Y0VH 1Y1XA 2F2PA 3BQ3A 3CLNA 1UWOA 5HKZA 5HKYA 1WLZA 3PALA 3EKHA 4HRHA 1S26D 1S5GZ 1QIWA 3PLFB 1B7TZ 3SG2A 1F54A 3I5GC 4MRYA 4MZLA 3BOWB 2H61C 2KI4B 4PHNA 1VRKA 3E3RA 4OV2A 1L2OC 2BCAA 2LP2A 1ZFSA 4MEWA 1TNWA 5CSJA 1OSAA 1TNXA 3FWBA 1YR5A 2LVIA 2L4IA 1KFUL 1CKKA 4OCIA 2EHBA 1TNPA 2ZRSA 3D0YA 3TDUA 3TUYC 4WQ2A 2ZFDA 2NZ0A 1JF2A 1IKUA 1NUBA 2LE9B 1KQMB 1A2XA 2JQ6A 2QPTA 3SG5A 1BJFA 1JFKA 1QS7A 5JOLA 2MBXA 1LXFC 2MLEC 2G9BA 2ZN8A 1B8RA 2LLTA 5AERA 4USLA 1YVHA 4P5OE 1JFJA 5B8IB 3TS5B 2M8UA 1NPQA 2K7BA 1CFDA 1Q80A 1SR6B 1DJYA 1UURA 2KBMA 2LMVA 4AOMA 3BXKA 5DKNA 2JU0A 1A03A 1FF1A 1NYAA 3BUOB 2HPSA 5KSZA 1DJGA 1TRFA 1C7VA 2KQYA 2FCEA 5JJGA 1K90D 1SCVA 1GGZA 3PSRA 4NDBA 1QASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMG A;  3CR4 X;  5PAL A;  2LLS A;  1K9K A;  2PVB A;  3VRO A;  1BF5 A;  1SCM B;  1S36 A;  2ZKM X;  5CPV A;  2WOS A;  3CR5 X;  3O4Y A;  2WND A;  1MF8 B;  1B8L A;  3O6B A;  3D10 A;  1F4Q A;  2GGZ A;  4CID A;  1DJH A;  1QV1 A;  1UP5 A;  3I5G B;  1UHI A;  2E6W A;  2LHL A;  3C1V A;  3EVU A;  5I2O A;  1PSB A;  1WDC C;  1DJI A;  2I94 A;  1CM4 A;  4DCK A;  3RM1 A;  1L2O B;  3I5F C;  1PK0 D;  2F8P A;  1KFX L;  1SL7 A;  2AUC A;  4GGF A;  2LC5 A;  2JNF A;  1QX7 A;  1PVA A;  1MWN A;  2KFF A;  3BUN B;  3TUY B;  2L50 A;  2WCE A;  1NCZ A;  3NSK A;  1LA0 A;  1LIN A;  1R6P A;  3TDI A;  1S6C A;  4BY4 A;  4CPV A;  4BY5 A;  4ETO A;  1SL9 A;  1KCY A;  3EVV A;  1F71 A;  1JSA A;  3TZ1 A;  2CXJ A;  3A4U B;  4CLN A;  2F33 A;  1AP4 A;  1LKJ A;  2I2R E;  5AXI A;  1S6J A;  2JT0 A;  2M7L A;  2JUL A;  1F70 A;  1KSO A;  2JT3 A;  4F0Z B;  4ORA B;  1ZAC A;  1QVI Y;  1B4C A;  3NSO A;  1K9U A;  3KPX A;  1HQV A;  1KK7 Y;  1K96 A;  2BCX A;  4I5N B;  4YI8 A;  5K89 A;  1B47 A;  1BLQ A;  3VGO A;  2M7N A;  4MRX A;  2KAY A;  3SIB A;  1FI6 A;  1BR1 B;  1Y1U A;  1N2D A;  2HET A;  4MZJ A;  2K2F A;  3PM8 A;  4L9M A;  1DF0 B;  5D69 A;  3IQQ A;  1JF0 A;  2LV7 A;  2L5X B;  1CDM A;  1XK4 C;  2K8M B;  3EK8 A;  2OTG C;  1IJ5 A;  5FYX A;  1DTL A;  1DT7 B;  4GPL B;  2I7A A;  2L0P A;  2MJW B;  2FOT A;  3VRP A;  2K7D A;  1WLM A;  2F3Y A;  4GAO A;  1J1E A;  2MRD A;  1WDC B;  3CZT X;  3GK1 A;  1TTX A;  4P2Y B;  1LA3 A;  2PRU A;  1RFJ A;  2JXL A;  1OMR A;  1V1G A;  2JXC A;  3I5F B;  3GK2 A;  4CFQ A;  2PMY A;  4ORC B;  5KU1 A;  1EG3 A;  4U8D A;  4DS7 A;  4OVN F;  5DKQ A;  3ZWH A;  2HF5 A;  2M97 A;  3GOF A;  1K94 A;  4ZCU A;  2ZRT A;  1REC A;  2I18 A;  4N1G A;  4NDC A;  2AAO A;  4GUK A;  2JT8 A;  5I2Q A;  4MVF A;  3DF0 A;  1QLS A;  1AUI B;  2NCP A;  3HCM A;  5BPJ A;  3M0W A;  1DGV A;  4PDZ A;  2LNK A;  1ALV A;  1ODB A;  1JWD A;  3JTD C;  1BT6 A;  2LLU A;  2ZNE A;  4YGD B;  1K2H A;  1IQ5 A;  2PSR A;  3BYA A;  1A75 A;  1LVC D;  3KF9 A;  2CT9 A;  4A4B A;  1NCY A;  1QV0 A;  1XFY O;  2H2K A;  4MBE A;  1HT9 A;  2BEC A;  1G8I A;  1NIW A;  2KGB C;  4R1E A;  1SKT A;  3AKA A;  1YTZ C;  2OTG B;  4MLW A;  1D1O A;  2JTZ A;  2K7C A;  2BKI B;  1WRZ A;  1K95 A;  1F55 A;  1BG1 A;  2Y1N A;  3BOW A;  2FJU B;  5J3X A;  1Y6W A;  2LMU A;  3BUW B;  1OZO A;  1ZOT B;  2LVV A;  1RWY A;  1KWO C;  2KNE A;  4YGA A;  2KAV A;  4PE1 A;  2KYC A;  1IG5 A;  1QJT A;  3O2P A;  1EH2 A;  1EG4 A;  1AJ5 A;  1XYD A;  2IS9 A;  1OE9 B;  5CSN A;  4PE7 A;  1JBA A;  2JC2 A;  3PN7 C;  2WCB A;  3EKJ A;  4JPZ B;  1BR4 B;  1KK8 C;  1MHO A;  1YX7 A;  2KOT A;  1UHH A;  1YRT B;  4PHK A;  2KI6 C;  1PAL A;  2Y1M A;  3WHU B;  1J7P A;  1YUR A;  1SRA A;  4QJ3 B;  4QJ5 B;  2K61 A;  1DMO A;  1S1E A;  2Q91 A;  4I5J A;  4PE4 A;  1J1D A;  3VRN A;  3OHM B;  3JTD B;  2FCD A;  3AAJ A;  4XJK B;  3SG3 A;  3LK1 A;  2HQW A;  2LUX A;  1G4Y R;  2OS8 C;  4YBH B;  4CFR A;  1QXP A;  2BE4 A;  1C07 A;  1WRK A;  1BOD A;  2KAX A;  2A4J A;  1H4B A;  2O60 A;  2Y5I A;  4MSP A;  2EC6 C;  3SG4 A;  2LCP A;  4DUQ A;  4WRI A;  2LAP A;  1IGV A;  2BE6 A;  5G08 A;  1N0Y A;  2L2E A;  4C0J A;  1C7W A;  1TNQ A;  3SG7 A;  2M0R A;  1B8C A;  4DIR A;  1CMG A;  2G2B A;  3VRQ A;  1CDN A;  3ZNI A;  1BMO A;  1K8U A;  1OMV A;  1NP8 A;  1ZUZ A;  1PVB A;  1M46 A;  3I5H C;  1N65 A;  2H61 A;  3KO0 A;  4GGN A;  1EL4 A;  1KWO B;  2KDH A;  1EJ3 A;  1M63 B;  1XFW O;  2M29 A;  2CCM A;  2SAS A;  3FS7 A;  3EK7 A;  4MZK A;  2JWW A;  1S6I A;  3PFV A;  4MN0 A;  3PN7 B;  2M3W A;  1KQV A;  2BBN A;  2CTN A;  3H4S E;  1KK8 B;  1M39 A;  2LMT A;  4I5K A;  4NDD A;  4I5L B;  2TN4 A;  2MLF C;  2QAC A;  4XYN A;  1J55 A;  3IQO A;  1RRO A;  4FTG A;  1IRJ A;  2NXQ A;  3JVT C;  3LL8 B;  1YUS A;  2D8N A;  1B1G A;  2CBL A;  4AQJ A;  1JUO A;  1CFP A;  1AJ4 A;  2Y4Q A;  3CTN A;  1RTP 1;  3BUM B;  3DVK A;  1DJW A;  4C0K A;  1CLB A;  2BL0 C;  2AMI A;  2JRF A;  3PAT A;  1QVI Z;  1S5G Y;  3CWG A;  1B7T Y;  2OS8 B;  2L98 A;  1NCX A;  1QLK A;  1CTR A;  1U5I B;  4PHJ A;  1KK7 Z;  4IL1 A;  2GV5 A;  2KYF A;  2LVJ A;  2EC6 B;  1A29 A;  1FW4 A;  3VRR A;  1TOP A;  1DF0 A;  1TIZ A;  5TNC A;  1R2U A;  1YUT A;  1SW8 A;  2COL B;  2OPO A;  3IF7 A;  1MUX A;  5GQQ C;  1TN4 A;  1EXR A;  1SR6 C;  1NSH A;  3WHT B;  1BU3 A;  3DVJ A;  4PE0 A;  1UUS A;  1SY9 A;  4PHM A;  4JQ0 D;  4C0L A;  1L7Z A;  4GGF C;  2VRG A;  1JC2 A;  1SL8 A;  1OQP A;  3I5H B;  3I5I C;  1ZMZ A;  1CFF A;  1GJY A;  2B1U A;  2O5G A;  5CSF A;  1PUL A;  1SCM C;  1CLM A;  2KFH A;  2LVK A;  1QX5 B;  1U5I A;  3CS1 A;  2KGR A;  5HYD A;  3DVE A;  1NWD A;  5I2L A;  1W7I B;  1K9P A;  3FWC A;  3BUX B;  5KTY A;  4OKH A;  1YVL A;  1YRU B;  4PCW A;  1SNL A;  5I8N A;  2BCB A;  1IQ3 A;  1QIV A;  4YI9 A;  1WRL A;  2KI6 D;  3AAK A;  1NX0 A;  3JVT B;  1CDP A;  1CDL A;  1A4P A;  1IWQ A;  1CM1 A;  2M9G A;  4ZCV A;  4D1E A;  2P6B B;  2JTT A;  3O78 A;  1M45 A;  1K93 D;  1UHK A;  3QRX A;  2L4H A;  1CB1 A;  1MXL C;  1E8A A;  2JPT A;  2Q4U A;  1CNP A;  3MSE B;  4NQG A;  3WXA A;  2BL0 B;  4M2P A;  2KQ6 A;  5AEQ A;  1CFC A;  3LLE A;  1IJ6 A;  3FIA A;  4FQO A;  5HKW A;  3DVM A;  2JOJ A;  4GBA A;  4ICB A;  4OR9 B;  2V53 A;  4A4C A;  1DVI A;  3NSL A;  1XK4 A;  2CNP A;  2RGI A;  4ORB B;  4TNC A;  4E68 A;  2JZI A;  2MA2 A;  1OZS A;  3AKB A;  1OOJ A;  1J7Q A;  3NSI A;  5IBW A;  3WNX B;  5AAN A;  2MHH A;  1DGU A;  4HSZ A;  1QAT A;  1DJZ A;  3I5I B;  1FBV A;  2BKH B;  1MR8 A;  4M2Q A;  4YGC B;  5DKR A;  3TDZ A;  1MQ1 A;  3SIA A;  1NX2 A;  1UHN A;  2ZN9 A;  4YRU A;  4GFT A;  3SG6 A;  4QJ4 B;  2M1K B;  1PRW A;  3A8R A;  3HX4 A;  1IH0 A;  2DOQ A;  4M2O A;  2E30 A;  1KFU S;  2M49 B;  4DRW A;  1UHJ A;  1FI5 A;  2NCO A;  3DD4 A;  1MXE A;  1YUU A;  2HQ8 A;  1ALW A;  3LK0 A;  1WY9 A;  2R2I A;  1RJV A;  1B9A A;  1S3P A;  2K2A A;  1YX8 A;  1AHR A;  1QX2 A;  5AFP A;  2KFG A;  1TCO B;  5CSI A;  5HLV A;  3F45 A;  3OB2 B;  1OMD A;  2L51 A;  4XJK A;  4JWQ A;  2KBI A;  2JNX A;  3CR2 A;  1NX3 A;  3CGA A;  2ISD A;  3EK4 A;  3EVR A;  5HLO A;  4YGB B;  2LHI A;  3ICB A;  2F3Z A;  3OP0 A;  1H8B A;  2PAS A;  2WC8 A;  4N5X A;  1SYM A;  2WCF A;  5ER4 X;  1AK8 A;  5ER5 A;  1GGW A;  1FPW A;  1F8H A;  2KSP A;  2KI4 C;  1V1F A;  2GGM A;  1SK6 D;  2F2O A;  2M1U A;  2PAL A;  4HRE E;  4PAL A;  3OX6 A;  3KHE A;  2WOR A;  2LAN A;  2LP3 A;  5F6T A;  2EGD A;  1GQM A;  2MAZ A;  3LCP C;  2K7O A;  1KSM A;  1NX1 A;  2ZND A;  3OB1 B;  2KHN A;  2SCP A;  3RLZ A;  1J7O A;  1SBJ A;  3GK4 X;  4UPG A;  3NXA A;  4N1F A;  1QTX A;  2LUC A;  1KQM C;  5D7F A;  1SPY A;  2LM5 A;  3DF0 B;  4AQI A;  1KFX S;  1Y1A A;  4Q04 A;  3SJS A;  1XFX O;  1G33 A;  1BOC A;  1XFV O;  4YGE B;  3KEV A;  1J7R A;  1XA5 A;  1X02 A;  3TS5 C;  1CLL A;  1M31 A;  1AVS A;  1XVJ A;  1XO5 A;  1CMF A;  1PSR A;  3K21 A;  1XFU O;  1XFZ O;  4WQ3 A;  1A75 B;  3D0Y B;  1F4O A;  4HRG A;  3OX5 A;  1DJX A;  1W7J B;  4GNK B;  2K0J A;  2NLN A;  1TCF A;  1RK9 A;  2BBM A;  1Y0V H;  1Y1X A;  2F2P A;  3BQ3 A;  3CLN A;  1UWO A;  5HKZ A;  5HKY A;  1WLZ A;  3PAL A;  3EKH A;  4HRH A;  1S26 D;  1S5G Z;  1QIW A;  3PLF B;  1B7T Z;  3SG2 A;  1F54 A;  3I5G C;  4MRY A;  4MZL A;  3BOW B;  2H61 C;  2KI4 B;  4PHN A;  1VRK A;  3E3R A;  4OV2 A;  1L2O C;  2BCA A;  2LP2 A;  1ZFS A;  4MEW A;  1TNW A;  5CSJ A;  1OSA A;  1TNX A;  3FWB A;  1YR5 A;  2LVI A;  2L4I A;  1KFU L;  1CKK A;  4OCI A;  2EHB A;  1TNP A;  2ZRS A;  3D0Y A;  3TDU A;  3TUY C;  4WQ2 A;  2ZFD A;  2NZ0 A;  1JF2 A;  1IKU A;  1NUB A;  2LE9 B;  1KQM B;  1A2X A;  2JQ6 A;  2QPT A;  3SG5 A;  1BJF A;  1JFK A;  1QS7 A;  5JOL A;  2MBX A;  1LXF C;  2MLE C;  2G9B A;  2ZN8 A;  1B8R A;  2LLT A;  5AER A;  4USL A;  1YVH A;  4P5O E;  1JFJ A;  5B8I B;  3TS5 B;  2M8U A;  1NPQ A;  2K7B A;  1CFD A;  1Q80 A;  1SR6 B;  1DJY A;  1UUR A;  2KBM A;  2LMV A;  4AOM A;  3BXK A;  5DKN A;  2JU0 A;  1A03 A;  1FF1 A;  1NYA A;  3BUO B;  2HPS A;  5KSZ A;  1DJG A;  1TRF A;  1C7V A;  2KQY A;  2FCE A;  5JJG A;  1K90 D;  1SCV A;  1GGZ A;  3PSR A;  4NDB A;  1QAS A; 
#chains in the Genus database with same CATH topology
 1SMG A;  3CR4 X;  3S0D A;  5PAL A;  2LLS A;  5FI6 A;  1K9K A;  2PVB A;  3VRO A;  1DC1 A;  1BF5 A;  1SCM B;  1S36 A;  2ZKM X;  5CPV A;  2WOS A;  3CR5 X;  3O4Y A;  2WND A;  1MF8 B;  1B8L A;  3O6B A;  3BJH A;  3D10 A;  1F4Q A;  2GGZ A;  4CID A;  1DJH A;  1QV1 A;  1UP5 A;  3I5G B;  1UHI A;  2E6W A;  2LHL A;  3C1V A;  3EVU A;  5I2O A;  4F7F A;  1PSB A;  1WDC C;  1DJI A;  2I94 A;  1CM4 A;  4DCK A;  3RM1 A;  1L2O B;  3I5F C;  1PK0 D;  2F8P A;  1KFX L;  1SL7 A;  2AUC A;  4GGF A;  2LC5 A;  2JNF A;  1QX7 A;  2QEB A;  1PVA A;  1MWN A;  3SS5 A;  2KFF A;  3BUN B;  3TUY B;  2L50 A;  2WCE A;  1NCZ A;  3NSK A;  1ORG A;  1LA0 A;  1LIN A;  1R6P A;  3TDI A;  1S6C A;  2KLE A;  4BY4 A;  4BY5 A;  4CPV A;  4ETO A;  1SL9 A;  1KCY A;  3EVV A;  1F71 A;  4PT1 A;  1JSA A;  3O4X A;  4KYN A;  3TZ1 A;  2CXJ A;  3A4U B;  4CLN A;  2BAP A;  2F33 A;  1AP4 A;  1LKJ A;  2I2R E;  5AXI A;  1S6J A;  3V2L A;  2JT0 A;  2M7L A;  3R1V A;  2JUL A;  1F70 A;  1KSO A;  2JT3 A;  4F0Z B;  4ORA B;  1ZAC A;  1QVI Y;  1B4C A;  3NSO A;  1K9U A;  2BNX A;  3KPX A;  1HQV A;  1KK7 Y;  1K96 A;  2BCX A;  4I5N B;  4YI8 A;  5K89 A;  1B47 A;  1BLQ A;  3VGO A;  2M7N A;  3BFB A;  4MRX A;  2KAY A;  3SIB A;  1FI6 A;  1BR1 B;  1Y1U A;  3BFH A;  1N2D A;  2HET A;  4MZJ A;  2K2F A;  3PM8 A;  4L9M A;  1DF0 B;  5D69 A;  3IQQ A;  1JF0 A;  2LV7 A;  2L5X B;  3D76 A;  1CDM A;  1XK4 C;  1TUJ A;  2K8M B;  2OTG C;  3EK8 A;  1IJ5 A;  5FYX A;  1DTL A;  3EG5 B;  1DT7 B;  4GPL B;  2I7A A;  3UO9 A;  5FI7 A;  2L0P A;  2MJW B;  2FOT A;  3QME A;  3VRP A;  2K7D A;  1WLM A;  2F3Y A;  4GAO A;  3FE9 A;  1J1E A;  2MRD A;  1WDC B;  2QEH A;  3CZT X;  1TTX A;  3GK1 A;  4P2Y B;  1LA3 A;  3SS3 A;  2PRU A;  1RFJ A;  2JXL A;  1OMR A;  1V1G A;  2JXC A;  3I5F B;  3GK2 A;  4CFQ A;  1C3Y A;  2PMY A;  4ORC B;  2ERB A;  5KU1 A;  1EG3 A;  4U8D A;  4DS7 A;  4OVN F;  5DKQ A;  3ZWH A;  2HF5 A;  2M97 A;  2WCL A;  1K94 A;  3B7A A;  3GOF A;  4ZCU A;  2ZRT A;  1REC A;  2I18 A;  2KLD A;  4N1G A;  4NDC A;  2AAO A;  1Z4H A;  2JT8 A;  4GUK A;  4MVF A;  5I2Q A;  3DF0 A;  1QLS A;  1AUI B;  2NCP A;  3HCM A;  5BPJ A;  3M0W A;  1DGV A;  4PDZ A;  1GM0 A;  2LNK A;  1ALV A;  1ODB A;  1W9Z A;  3JTD C;  1JWD A;  2PQL A;  1BT6 A;  2LLU A;  2P70 A;  2ZNE A;  4YGD B;  1DEL A;  1K2H A;  1IQ5 A;  2PSR A;  3NHI A;  3BYA A;  1A75 A;  1LVC D;  3KF9 A;  2CT9 A;  4A4B A;  2L5Y A;  3S0A A;  1NCY A;  1QV0 A;  1XFY O;  2H2K A;  4MBE A;  1HT9 A;  2BEC A;  1G8I A;  1NIW A;  2KGB C;  4R1E A;  1SKT A;  3AKA A;  1YTZ C;  2OTG B;  4MLW A;  1D1O A;  2JTZ A;  2K7C A;  2H8V A;  2BKI B;  1WRZ A;  1K95 A;  1F55 A;  1BG1 A;  2Y1N A;  3BOW A;  2FJU B;  5J3X A;  4FQT A;  1Y6W A;  2LMU A;  3BUW B;  1OZO A;  1ZOT B;  2LVV A;  1RWY A;  1KWO C;  2KNE A;  4YGA A;  2KAV A;  4PE1 A;  2KYC A;  1IG5 A;  1QJT A;  3O2P A;  1EH2 A;  1EG4 A;  1AJ5 A;  1XYD A;  2IS9 A;  1OE9 B;  5CSN A;  4PE7 A;  1C3Z A;  3D77 A;  1JBA A;  2JC2 A;  3PN7 C;  2WCB A;  1LS8 A;  3EKJ A;  3D74 A;  4JPZ B;  2GTE A;  1BR4 B;  1KK8 C;  1MHO A;  1YX7 A;  2KOT A;  1UHH A;  1YRT B;  2PYQ A;  4PHK A;  2KI6 C;  1PAL A;  2Y1M A;  3WHU B;  1J7P A;  1YUR A;  1SRA A;  4QJ3 B;  4QJ5 B;  2K61 A;  1DMO A;  1S1E A;  2Q91 A;  4I5J A;  1TWO A;  4PE4 A;  2QDI A;  3OBV A;  1J1D A;  3VRN A;  3OHM B;  3PM2 A;  3JTD B;  2FCD A;  3AAJ A;  3SS4 A;  4XJK B;  3SG3 A;  3LK1 A;  2HQW A;  2LUX A;  1G4Y R;  2OS8 C;  4YBH B;  4CFR A;  1QXP A;  2BE4 A;  1C07 A;  1WRK A;  2KPH A;  1BOD A;  2KAX A;  2A4J A;  1H4B A;  2O60 A;  2Y5I A;  4MSP A;  2EC6 C;  3SG4 A;  2LCP A;  4DUQ A;  4WRI A;  2LAP A;  1IGV A;  2BE6 A;  5G08 A;  1N0Y A;  2L2E A;  4C0J A;  1C7W A;  1TNQ A;  3SG7 A;  2M0R A;  1B8C A;  4DIR A;  1CMG A;  2G2B A;  3PJI A;  2K60 A;  3VRQ A;  1CDN A;  3ZNI A;  1BMO A;  1K8U A;  1OMV A;  1NP8 A;  1ZUZ A;  1PVB A;  1M46 A;  3I5H C;  1N65 A;  2H61 A;  3KO0 A;  4GGN A;  3CZ0 A;  1EL4 A;  1KWO B;  2KDH A;  1EJ3 A;  1M63 B;  1XFW O;  2JPO A;  2M29 A;  2CCM A;  2SAS A;  3CZ2 A;  3FS7 A;  3EK7 A;  4MZK A;  2JWW A;  1S6I A;  1OOF A;  3PFV A;  4MN0 A;  1OW4 A;  3PN7 B;  2M3W A;  3NHT A;  1KQV A;  2BBN A;  2CTN A;  3VB1 A;  3CAB A;  5I94 A;  3H4S E;  1KK8 B;  1M39 A;  2LMT A;  4I5K A;  4NDD A;  3D78 A;  4I5L B;  2TN4 A;  2MLF C;  2QAC A;  4XYN A;  1J55 A;  2FJY A;  1RRO A;  3IQO A;  4INX A;  4FTG A;  1IRJ A;  2NXQ A;  2WCM A;  3JVT C;  1YUS A;  2D8N A;  3LL8 B;  3N7H A;  3FE8 A;  1B1G A;  2CBL A;  4AQJ A;  3R1O A;  1JUO A;  1CFP A;  3S0E A;  1AJ4 A;  2Y4Q A;  3BFA A;  3CTN A;  1RTP 1;  3BUM B;  3DVK A;  1DJW A;  1QWV A;  4C0K A;  2BL0 C;  1CLB A;  2AMI A;  2JRF A;  2L2C A;  1QVI Z;  1S5G Y;  3CWG A;  1B7T Y;  3PAT A;  2OS8 B;  3DZT A;  2L98 A;  1NCX A;  1QLK A;  1CTR A;  1U5I B;  3B86 A;  4PHJ A;  1KK7 Z;  4IL1 A;  2GV5 A;  2KYF A;  2LVJ A;  2EC6 B;  1A29 A;  1FW4 A;  3VRR A;  1TOP A;  1DF0 A;  1TIZ A;  3S0G A;  5TNC A;  1R2U A;  1YUT A;  1SW8 A;  2COL B;  2OPO A;  3IF7 A;  1MUX A;  5GQQ C;  1TN4 A;  4IJ7 A;  1IIO A;  1EXR A;  1SR6 C;  2WC5 A;  1NSH A;  3WHT B;  1BU3 A;  3DVJ A;  4PE0 A;  1UUS A;  1SY9 A;  4PHM A;  5EL2 A;  4JQ0 D;  4C0L A;  1L7Z A;  4GGF C;  2VRG A;  1JC2 A;  1SL8 A;  1OQP A;  3I5H B;  3I5I C;  1ZMZ A;  1CFF A;  1GJY A;  2B1U A;  2O5G A;  3R1P A;  5CSF A;  1PUL A;  1SCM C;  1CLM A;  1OOG A;  2KFH A;  2LVK A;  1QX5 B;  1U5I A;  3CS1 A;  4JD9 A;  2KGR A;  5HYD A;  3CDN A;  3DVE A;  1NWD A;  5I2L A;  3B87 A;  4OZD A;  1W7I B;  1K9P A;  3FWC A;  3BUX B;  5KTY A;  3IVT A;  3RZS A;  3S0B A;  3R72 A;  4OKH A;  1YVL A;  1YRU B;  4PCW A;  1SNL A;  5I8N A;  2BCB A;  1IQ3 A;  1QIV A;  4YI9 A;  1WRL A;  3L4A A;  2KI6 D;  3AAK A;  1NX0 A;  3JVT B;  4INW A;  3Q8I A;  1CDP A;  1CDL A;  1A4P A;  1IWQ A;  1CM1 A;  2M9G A;  4ZCV A;  4D1E A;  2P6B B;  2JTT A;  3O78 A;  1M45 A;  1K93 D;  1UHK A;  1OOH A;  3QRX A;  2L4H A;  1CB1 A;  1MXL C;  1Z2C B;  1E8A A;  2JPT A;  2Q4U A;  1CNP A;  3B6X A;  3MSE B;  4NQG A;  2BL0 B;  4M2P A;  3WXA A;  2KQ6 A;  5AEQ A;  1CFC A;  3LLE A;  1IJ6 A;  3FIA A;  4FQO A;  5HKW A;  3DVM A;  3OGN A;  2JOJ A;  4GBA A;  4ICB A;  4OR9 B;  2V53 A;  3D73 A;  4A4C A;  1DVI A;  3NSL A;  1XK4 A;  2CNP A;  2RGI A;  4ORB B;  4TNC A;  4E68 A;  2JZI A;  2MA2 A;  2YGU A;  1OZS A;  3AKB A;  1OOJ A;  5FI2 A;  1J7Q A;  3NSI A;  5IBW A;  3WNX B;  3DYE A;  5AAN A;  2MHH A;  3L4L A;  1DGU A;  4HSZ A;  3S0F A;  1QAT A;  1DJZ A;  1DQE A;  3K1E A;  3I5I B;  5DIC A;  1FBV A;  2BKH B;  1MR8 A;  4M2Q A;  4YGC B;  5DKR A;  3TDZ A;  1MQ1 A;  3SIA A;  5D3O A;  1NX2 A;  1UHN A;  2ZN9 A;  4YRU A;  4GFT A;  3UNW A;  3SG6 A;  4QJ4 B;  2M1K B;  1PRW A;  3A8R A;  3HX4 A;  1IH0 A;  2DOQ A;  4M2O A;  2E30 A;  1KFU S;  1OOI X;  2M49 B;  2QEV A;  4DRW A;  1UHJ A;  1FI5 A;  2NCO A;  3DD4 A;  1MXE A;  1YUU A;  2HQ8 A;  1ALW A;  3LK0 A;  1WY9 A;  2P71 A;  2R2I A;  4JKT A;  1RJV A;  1B9A A;  1S3P A;  2K2A A;  1YX8 A;  1AHR A;  1QX2 A;  5AFP A;  2KFG A;  1TCO B;  5CSI A;  5HLV A;  3F45 A;  3OB2 B;  1OMD A;  2L51 A;  4XJK A;  4JWQ A;  2KBI A;  2JNX A;  3CR2 A;  1NX3 A;  3CGA A;  2ISD A;  3EK4 A;  3FE6 A;  3EVR A;  5HLO A;  4YGB B;  1T14 A;  2LHI A;  3ICB A;  2F3Z A;  3L47 A;  5HL1 A;  1P28 A;  3OP0 A;  1H8B A;  2PAS A;  2WC8 A;  4N5X A;  1SYM A;  2WCF A;  5ER4 X;  1AK8 A;  5ER5 A;  1GGW A;  1FPW A;  1F8H A;  2KSP A;  2KI4 C;  1V1F A;  2GGM A;  1SK6 D;  2F2O A;  2M1U A;  2PAL A;  4HRE E;  4PAL A;  3OX6 A;  3KHE A;  2WOR A;  2LAN A;  2LP3 A;  5F6T A;  2EGD A;  1GQM A;  2MAZ A;  3LCP C;  2K7O A;  1KSM A;  1NX1 A;  2ZND A;  3OB1 B;  2KHN A;  2SCP A;  3RLZ A;  1J7O A;  1SBJ A;  3GK4 X;  4UPG A;  3NXA A;  4N1F A;  1QTX A;  2LUC A;  2WC6 A;  1KQM C;  5D7F A;  1SPY A;  2QEO A;  2LM5 A;  3DF0 B;  4AQI A;  1KFX S;  1Y1A A;  4Q04 A;  3SJS A;  1XFX O;  3CZ1 A;  1G33 A;  1BOC A;  1XFV O;  4YGE B;  3KEV A;  1J7R A;  1XA5 A;  3DY9 A;  1X02 A;  3TS5 C;  1CLL A;  1M31 A;  1AVS A;  1XVJ A;  1XO5 A;  1CMF A;  1PSR A;  3K21 A;  1XFU O;  1XFZ O;  4WQ3 A;  1A75 B;  3D0Y B;  1F4O A;  4HRG A;  3OX5 A;  1DJX A;  1W7J B;  2WCH A;  2K0J A;  2NLN A;  1TCF A;  1RK9 A;  4GNK B;  2BBM A;  1Y0V H;  1Y1X A;  2F2P A;  1XFR A;  3BQ3 A;  3CLN A;  1UWO A;  5HKZ A;  5HKY A;  1WLZ A;  3PAL A;  3EKH A;  4HRH A;  1S26 D;  1S5G Z;  1QIW A;  3PLF B;  1B7T Z;  3SG2 A;  1F54 A;  3I5G C;  4MRY A;  4MZL A;  3BOW B;  2WCJ A;  1SSE B;  2H61 C;  2KI4 B;  3DXL A;  4PHN A;  1VRK A;  3E3R A;  4OV2 A;  1L2O C;  2BCA A;  2LP2 A;  1ZFS A;  4MEW A;  1TNW A;  5CSJ A;  1OSA A;  1TNX A;  3FWB A;  1YR5 A;  2LVI A;  2L4I A;  3NGV A;  1KFU L;  1CKK A;  4OCI A;  2EHB A;  1TNP A;  2ZRS A;  3D0Y A;  3TDU A;  3TUY C;  4WQ2 A;  1DEK A;  2ZFD A;  2NZ0 A;  1JF2 A;  1TUZ A;  1IKU A;  1NUB A;  2LE9 B;  1KQM B;  1A2X A;  2JQ6 A;  2QPT A;  3SG5 A;  1BJF A;  1JFK A;  1QS7 A;  5JOL A;  2MBX A;  1LXF C;  2MLE C;  2G9B A;  2ZN8 A;  1B8R A;  2LLT A;  5AER A;  4USL A;  1YVH A;  4P5O E;  3CYZ A;  1JFJ A;  3B88 A;  5B8I B;  3TS5 B;  2M8U A;  1NPQ A;  2K7B A;  1CFD A;  1Q80 A;  1SR6 B;  1DJY A;  1UUR A;  2KBM A;  2LMV A;  4AOM A;  3BXK A;  3D75 A;  5DKN A;  2JU0 A;  2WCK A;  1A03 A;  1NYA A;  1FF1 A;  3BUO B;  2HPS A;  5KSZ A;  1DJG A;  1TRF A;  1C7V A;  2KQY A;  2FCE A;  5JJG A;  1K90 D;  1SCV A;  1GGZ A;  3PSR A;  4NDB A;  1QAS A; 
#chains in the Genus database with same CATH homology
 1SMG A;  3CR4 X;  5PAL A;  2LLS A;  1K9K A;  2PVB A;  3VRO A;  1BF5 A;  1SCM B;  1S36 A;  2ZKM X;  5CPV A;  2WOS A;  3CR5 X;  3O4Y A;  2WND A;  1MF8 B;  1B8L A;  3O6B A;  3D10 A;  1F4Q A;  2GGZ A;  4CID A;  1DJH A;  1QV1 A;  1UP5 A;  3I5G B;  1UHI A;  2E6W A;  2LHL A;  3C1V A;  3EVU A;  5I2O A;  1PSB A;  1WDC C;  1DJI A;  2I94 A;  1CM4 A;  4DCK A;  3RM1 A;  1L2O B;  3I5F C;  1PK0 D;  2F8P A;  1KFX L;  1SL7 A;  2AUC A;  4GGF A;  2LC5 A;  2JNF A;  1QX7 A;  1PVA A;  1MWN A;  2KFF A;  3BUN B;  3TUY B;  2L50 A;  2WCE A;  1NCZ A;  3NSK A;  1LA0 A;  1LIN A;  1R6P A;  3TDI A;  1S6C A;  4BY4 A;  4CPV A;  4BY5 A;  4ETO A;  1SL9 A;  1KCY A;  3EVV A;  1F71 A;  1JSA A;  3TZ1 A;  2CXJ A;  3A4U B;  4CLN A;  2F33 A;  1AP4 A;  1LKJ A;  2I2R E;  5AXI A;  1S6J A;  2JT0 A;  2M7L A;  2JUL A;  1F70 A;  1KSO A;  2JT3 A;  4F0Z B;  4ORA B;  1ZAC A;  1QVI Y;  1B4C A;  3NSO A;  1K9U A;  3KPX A;  1HQV A;  1KK7 Y;  1K96 A;  2BCX A;  4I5N B;  4YI8 A;  5K89 A;  1B47 A;  1BLQ A;  3VGO A;  2M7N A;  4MRX A;  2KAY A;  3SIB A;  1FI6 A;  1BR1 B;  1Y1U A;  1N2D A;  2HET A;  4MZJ A;  2K2F A;  3PM8 A;  4L9M A;  1DF0 B;  5D69 A;  3IQQ A;  1JF0 A;  2LV7 A;  2L5X B;  1CDM A;  1XK4 C;  2K8M B;  3EK8 A;  2OTG C;  1IJ5 A;  5FYX A;  1DTL A;  1DT7 B;  4GPL B;  2I7A A;  2L0P A;  2MJW B;  2FOT A;  3VRP A;  2K7D A;  1WLM A;  2F3Y A;  4GAO A;  1J1E A;  2MRD A;  1WDC B;  3CZT X;  3GK1 A;  1TTX A;  4P2Y B;  1LA3 A;  2PRU A;  1RFJ A;  2JXL A;  1OMR A;  1V1G A;  2JXC A;  3I5F B;  3GK2 A;  4CFQ A;  2PMY A;  4ORC B;  5KU1 A;  1EG3 A;  4U8D A;  4DS7 A;  4OVN F;  5DKQ A;  3ZWH A;  2HF5 A;  2M97 A;  3GOF A;  1K94 A;  4ZCU A;  2ZRT A;  1REC A;  2I18 A;  4N1G A;  4NDC A;  2AAO A;  4GUK A;  2JT8 A;  5I2Q A;  4MVF A;  3DF0 A;  1QLS A;  1AUI B;  2NCP A;  3HCM A;  5BPJ A;  3M0W A;  1DGV A;  4PDZ A;  2LNK A;  1ALV A;  1ODB A;  1JWD A;  3JTD C;  1BT6 A;  2LLU A;  2ZNE A;  4YGD B;  1K2H A;  1IQ5 A;  2PSR A;  3BYA A;  1A75 A;  1LVC D;  3KF9 A;  2CT9 A;  4A4B A;  1NCY A;  1QV0 A;  1XFY O;  2H2K A;  4MBE A;  1HT9 A;  2BEC A;  1G8I A;  1NIW A;  2KGB C;  4R1E A;  1SKT A;  3AKA A;  1YTZ C;  2OTG B;  4MLW A;  1D1O A;  2JTZ A;  2K7C A;  2BKI B;  1WRZ A;  1K95 A;  1F55 A;  1BG1 A;  2Y1N A;  3BOW A;  2FJU B;  5J3X A;  1Y6W A;  2LMU A;  3BUW B;  1OZO A;  1ZOT B;  2LVV A;  1RWY A;  1KWO C;  2KNE A;  4YGA A;  2KAV A;  4PE1 A;  2KYC A;  1IG5 A;  1QJT A;  3O2P A;  1EH2 A;  1EG4 A;  1AJ5 A;  1XYD A;  2IS9 A;  1OE9 B;  5CSN A;  4PE7 A;  1JBA A;  2JC2 A;  3PN7 C;  2WCB A;  3EKJ A;  4JPZ B;  1BR4 B;  1KK8 C;  1MHO A;  1YX7 A;  2KOT A;  1UHH A;  1YRT B;  4PHK A;  2KI6 C;  1PAL A;  2Y1M A;  3WHU B;  1J7P A;  1YUR A;  1SRA A;  4QJ3 B;  4QJ5 B;  2K61 A;  1DMO A;  1S1E A;  2Q91 A;  4I5J A;  4PE4 A;  1J1D A;  3VRN A;  3OHM B;  3JTD B;  2FCD A;  3AAJ A;  4XJK B;  3SG3 A;  3LK1 A;  2HQW A;  2LUX A;  1G4Y R;  2OS8 C;  4YBH B;  4CFR A;  1QXP A;  2BE4 A;  1C07 A;  1WRK A;  1BOD A;  2KAX A;  2A4J A;  1H4B A;  2O60 A;  2Y5I A;  4MSP A;  2EC6 C;  3SG4 A;  2LCP A;  4DUQ A;  4WRI A;  2LAP A;  1IGV A;  2BE6 A;  5G08 A;  1N0Y A;  2L2E A;  4C0J A;  1C7W A;  1TNQ A;  3SG7 A;  2M0R A;  1B8C A;  4DIR A;  1CMG A;  2G2B A;  3VRQ A;  1CDN A;  3ZNI A;  1BMO A;  1K8U A;  1OMV A;  1NP8 A;  1ZUZ A;  1PVB A;  1M46 A;  3I5H C;  1N65 A;  2H61 A;  3KO0 A;  4GGN A;  1EL4 A;  1KWO B;  2KDH A;  1EJ3 A;  1M63 B;  1XFW O;  2M29 A;  2CCM A;  2SAS A;  3FS7 A;  3EK7 A;  4MZK A;  2JWW A;  1S6I A;  3PFV A;  4MN0 A;  3PN7 B;  2M3W A;  1KQV A;  2BBN A;  2CTN A;  3H4S E;  1KK8 B;  1M39 A;  2LMT A;  4I5K A;  4NDD A;  4I5L B;  2TN4 A;  2MLF C;  2QAC A;  4XYN A;  1J55 A;  3IQO A;  1RRO A;  4FTG A;  1IRJ A;  2NXQ A;  3JVT C;  3LL8 B;  1YUS A;  2D8N A;  1B1G A;  2CBL A;  4AQJ A;  1JUO A;  1CFP A;  1AJ4 A;  2Y4Q A;  3CTN A;  1RTP 1;  3BUM B;  3DVK A;  1DJW A;  4C0K A;  1CLB A;  2BL0 C;  2AMI A;  2JRF A;  3PAT A;  1QVI Z;  1S5G Y;  3CWG A;  1B7T Y;  2OS8 B;  2L98 A;  1NCX A;  1QLK A;  1CTR A;  1U5I B;  4PHJ A;  1KK7 Z;  4IL1 A;  2GV5 A;  2KYF A;  2LVJ A;  2EC6 B;  1A29 A;  1FW4 A;  3VRR A;  1TOP A;  1DF0 A;  1TIZ A;  5TNC A;  1R2U A;  1YUT A;  1SW8 A;  2COL B;  2OPO A;  3IF7 A;  1MUX A;  5GQQ C;  1TN4 A;  1EXR A;  1SR6 C;  1NSH A;  3WHT B;  1BU3 A;  3DVJ A;  4PE0 A;  1UUS A;  1SY9 A;  4PHM A;  4JQ0 D;  4C0L A;  1L7Z A;  4GGF C;  2VRG A;  1JC2 A;  1SL8 A;  1OQP A;  3I5H B;  3I5I C;  1ZMZ A;  1CFF A;  1GJY A;  2B1U A;  2O5G A;  5CSF A;  1PUL A;  1SCM C;  1CLM A;  2KFH A;  2LVK A;  1QX5 B;  1U5I A;  3CS1 A;  2KGR A;  5HYD A;  3DVE A;  1NWD A;  5I2L A;  1W7I B;  1K9P A;  3FWC A;  3BUX B;  5KTY A;  4OKH A;  1YVL A;  1YRU B;  4PCW A;  1SNL A;  5I8N A;  2BCB A;  1IQ3 A;  1QIV A;  4YI9 A;  1WRL A;  2KI6 D;  3AAK A;  1NX0 A;  3JVT B;  1CDP A;  1CDL A;  1A4P A;  1IWQ A;  1CM1 A;  2M9G A;  4ZCV A;  4D1E A;  2P6B B;  2JTT A;  3O78 A;  1M45 A;  1K93 D;  1UHK A;  3QRX A;  2L4H A;  1CB1 A;  1MXL C;  1E8A A;  2JPT A;  2Q4U A;  1CNP A;  3MSE B;  4NQG A;  3WXA A;  2BL0 B;  4M2P A;  2KQ6 A;  5AEQ A;  1CFC A;  3LLE A;  1IJ6 A;  3FIA A;  4FQO A;  5HKW A;  3DVM A;  2JOJ A;  4GBA A;  4ICB A;  4OR9 B;  2V53 A;  4A4C A;  1DVI A;  3NSL A;  1XK4 A;  2CNP A;  2RGI A;  4ORB B;  4TNC A;  4E68 A;  2JZI A;  2MA2 A;  1OZS A;  3AKB A;  1OOJ A;  1J7Q A;  3NSI A;  5IBW A;  3WNX B;  5AAN A;  2MHH A;  1DGU A;  4HSZ A;  1QAT A;  1DJZ A;  3I5I B;  1FBV A;  2BKH B;  1MR8 A;  4M2Q A;  4YGC B;  5DKR A;  3TDZ A;  1MQ1 A;  3SIA A;  1NX2 A;  1UHN A;  2ZN9 A;  4YRU A;  4GFT A;  3SG6 A;  4QJ4 B;  2M1K B;  1PRW A;  3A8R A;  3HX4 A;  1IH0 A;  2DOQ A;  4M2O A;  2E30 A;  1KFU S;  2M49 B;  4DRW A;  1UHJ A;  1FI5 A;  2NCO A;  3DD4 A;  1MXE A;  1YUU A;  2HQ8 A;  1ALW A;  3LK0 A;  1WY9 A;  2R2I A;  1RJV A;  1B9A A;  1S3P A;  2K2A A;  1YX8 A;  1AHR A;  1QX2 A;  5AFP A;  2KFG A;  1TCO B;  5CSI A;  5HLV A;  3F45 A;  3OB2 B;  1OMD A;  2L51 A;  4XJK A;  4JWQ A;  2KBI A;  2JNX A;  3CR2 A;  1NX3 A;  3CGA A;  2ISD A;  3EK4 A;  3EVR A;  5HLO A;  4YGB B;  2LHI A;  3ICB A;  2F3Z A;  3OP0 A;  1H8B A;  2PAS A;  2WC8 A;  4N5X A;  1SYM A;  2WCF A;  5ER4 X;  1AK8 A;  5ER5 A;  1GGW A;  1FPW A;  1F8H A;  2KSP A;  2KI4 C;  1V1F A;  2GGM A;  1SK6 D;  2F2O A;  2M1U A;  2PAL A;  4HRE E;  4PAL A;  3OX6 A;  3KHE A;  2WOR A;  2LAN A;  2LP3 A;  5F6T A;  2EGD A;  1GQM A;  2MAZ A;  3LCP C;  2K7O A;  1KSM A;  1NX1 A;  2ZND A;  3OB1 B;  2KHN A;  2SCP A;  3RLZ A;  1J7O A;  1SBJ A;  3GK4 X;  4UPG A;  3NXA A;  4N1F A;  1QTX A;  2LUC A;  1KQM C;  5D7F A;  1SPY A;  2LM5 A;  3DF0 B;  4AQI A;  1KFX S;  1Y1A A;  4Q04 A;  3SJS A;  1XFX O;  1G33 A;  1BOC A;  1XFV O;  4YGE B;  3KEV A;  1J7R A;  1XA5 A;  1X02 A;  3TS5 C;  1CLL A;  1M31 A;  1AVS A;  1XVJ A;  1XO5 A;  1CMF A;  1PSR A;  3K21 A;  1XFU O;  1XFZ O;  4WQ3 A;  1A75 B;  3D0Y B;  1F4O A;  4HRG A;  3OX5 A;  1DJX A;  1W7J B;  4GNK B;  2K0J A;  2NLN A;  1TCF A;  1RK9 A;  2BBM A;  1Y0V H;  1Y1X A;  2F2P A;  3BQ3 A;  3CLN A;  1UWO A;  5HKZ A;  5HKY A;  1WLZ A;  3PAL A;  3EKH A;  4HRH A;  1S26 D;  1S5G Z;  1QIW A;  3PLF B;  1B7T Z;  3SG2 A;  1F54 A;  3I5G C;  4MRY A;  4MZL A;  3BOW B;  2H61 C;  2KI4 B;  4PHN A;  1VRK A;  3E3R A;  4OV2 A;  1L2O C;  2BCA A;  2LP2 A;  1ZFS A;  4MEW A;  1TNW A;  5CSJ A;  1OSA A;  1TNX A;  3FWB A;  1YR5 A;  2LVI A;  2L4I A;  1KFU L;  1CKK A;  4OCI A;  2EHB A;  1TNP A;  2ZRS A;  3D0Y A;  3TDU A;  3TUY C;  4WQ2 A;  2ZFD A;  2NZ0 A;  1JF2 A;  1IKU A;  1NUB A;  2LE9 B;  1KQM B;  1A2X A;  2JQ6 A;  2QPT A;  3SG5 A;  1BJF A;  1JFK A;  1QS7 A;  5JOL A;  2MBX A;  1LXF C;  2MLE C;  2G9B A;  2ZN8 A;  1B8R A;  2LLT A;  5AER A;  4USL A;  1YVH A;  4P5O E;  1JFJ A;  5B8I B;  3TS5 B;  2M8U A;  1NPQ A;  2K7B A;  1CFD A;  1Q80 A;  1SR6 B;  1DJY A;  1UUR A;  2KBM A;  2LMV A;  4AOM A;  3BXK A;  5DKN A;  2JU0 A;  1A03 A;  1FF1 A;  1NYA A;  3BUO B;  2HPS A;  5KSZ A;  1DJG A;  1TRF A;  1C7V A;  2KQY A;  2FCE A;  5JJG A;  1K90 D;  1SCV A;  1GGZ A;  3PSR A;  4NDB A;  1QAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...