1F54A

Solution structure of the apo n-terminal domain of yeast calmodulin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f54A00
5FYXA 1TNPA 3BUMB 2R2IA 1CFDA 1S5GZ 2EC6C 1AJ5A 2L98A 2JOJA 3KPXA 2HPSA 2L5XB 4AQIA 1EJ3A 4OV2A 2JNXA 1QTXA 1Y1AA 1K2HA 4YGDB 3AAKA 4GGFC 1DJZA 1SR6B 2NXQA 5J3XA 1MR8A 4CFRA 2KAVA 1CDPA 1KFUS 1DT7B 2BCBA 3D0YB 3I5IC 4YI9A 3NXAA 1FI5A 3DD4A 1PVAA 3AKBA 1CFCA 1K9KA 1RECA 1H4BA 2BKHB 1M45A 3QRXA 4YGEB 1TN4A 1UHHA 2KYFA 2ZKMX 3IQOA 1DMOA 1RTP1 1RWYA 4OCIA 2LV7A 3BQ3A 2JU0A 2ZNDA 4GGFA 4YGBB 2JT3A 3WNXB 1DJXA 2MA2A 1GJYA 1YUUA 5JOLA 3GOFA 2LLSA 1K93D 3HCMA 4PHKA 1TNQA 1CMGA 1IQ5A 2LAPA 1TNXA 3K21A 3I5FC 3ICBA 1LKJA 1JSAA 3VROA 1OMDA 3KHEA 1L7ZA 1F4OA 4DUQA 1Y1XA 1Y6WA 2WCEA 2KFFA 1EXRA 2OPOA 3DVMA 3E3RA 4IL1A 1CB1A 2MHHA 5DKRA 1PVBA 2CXJA 1OE9B 5I2LA 2MBXA 4C0LA 2JXCA 3PLFB 1OMRA 4PHMA 1GGWA 2ZRSA 1JFKA 1B47A 4YGCB 1M46A 2LVVA 4CIDA 1AK8A 2LNKA 2LVIA 4ICBA 1HQVA 1XFWO 2BCAA 2ISDA 1IGVA 4GGNA 5CSNA 1XO5A 2BCXA 3SG4A 2BL0B 2K8MB 3WXAA 2M3WA 2LHIA 1KK7Z 4PDZA 1D1OA 1BJFA 3EKJA 2F33A 2K2FA 4ZCVA 1H8BA 2LVJA 2LMTA 3TS5B 1MQ1A 1TTXA 2E6WA 2HQWA 1LA0A 1YUTA 1ALWA 4JQ0D 1S6CA 1K9PA 5DKNA 1GQMA 1WDCB 4QJ5B 1YVLA 1EH2A 2BBNA 1NX2A 2M29A 2I18A 1FW4A 1S36A 4YGAA 1DF0A 2JZIA 1BG1A 1BU3A 4OR9B 2CCMA 1FI6A 3BYAA 3IF7A 4OVNF 4AQJA 2K61A 1J7RA 2KSPA 1LVCD 2H2KA 2JULA 2MJWB 1B8CA 1IH0A 2Q91A 2Y4QA 2F8PA 1WRLA 3D0YA 3LCPC 1DGUA 1QJTA 2M8UA 5AANA 3TUYB 3OB1B 3NSIA 3CLNA 3PM8A 5AERA 3CR5X 3VGOA 1DJGA 1SW8A 2WNDA 1KQVA 1K90D 4BY4A 1QV0A 3NSLA 3ZWHA 2MLFC 1EG3A 1QXPA 2JT8A 4ORBB 3WHTB 1F4QA 1YX7A 2WORA 4HREE 1IJ5A 4Q04A 3AKAA 1PSBA 3RM1A 1N2DA 2BL0C 4NDDA 1NP8A 3I5FB 3JVTB 2M7LA 2FCEA 2JWWA 1A2XA 3OX6A 4ETOA 1KSMA 1PALA 2EGDA 1KSOA 1TNWA 4HSZA 5IBWA 1OZSA 1V1FA 2Y1NA 4USLA 3VRQA 2KNEA 3A8RA 2DOQA 1QVIY 3EK7A 5G08A 4MN0A 4MSPA 3CZTX 1SPYA 4DIRA 4A4CA 5CSJA 4PCWA 5AXIA 1TRFA 2CNPA 3M0WA 1KCYA 2KQ6A 4E68A 1NUBA 3NSOA 4NDCA 3CWGA 1DF0B 1IQ3A 1QIVA 1S26D 4WQ3A 4M2OA 4WRIA 1QASA 5JJGA 1QX7A 1FBVA 4ORAB 1AJ4A 1NPQA 1CTRA 5KSZA 1NCYA 1SMGA 2KFGA 4MEWA 1N0YA 4A4BA 1YUSA 2RGIA 2O60A 4BY5A 3SG6A 3TUYC 1KFXS 2M1UA 1FF1A 2TN4A 1NX1A 3BOWB 1L2OB 1IWQA 1QIWA 4HRHA 4MBEA 4PE7A 4C0KA 1RFJA 1YX8A 2KGBC 1SBJA 4OKHA 2WCBA 2I94A 2OS8C 2L0PA 1MUXA 2Q4UA 2PVBA 3PALA 1K95A 1RK9A 1YTZC 4GFTA 4YBHB 1WY9A 3JVTC 2FJUB 2ZN9A 3SG2A 2LMUA 1UHIA 3AAJA 2KI6C 1CNPA 2K7BA 4PHNA 4PHJA 2KQYA 3C1VA 1ALVA 1XFXO 2QACA 3PN7B 1EG4A 1JF2A 1JBAA 3TDUA 2KOTA 2HF5A 1CFPA 1B1GA 2LANA 3OB2B 4M2QA 4QJ3B 1OOJA 3LK1A 1G4YR 2KI4C 4WQ2A 1PK0D 1YVHA 2ZNEA 1B7TZ 2G2BA 5I8NA 1R6PA 2LUCA 4PALA 2K7OA 1SNLA 1F70A 4L9MA 2PRUA 3EVUA 2Y5IA 3EVVA 2KBIA 1K96A 1LA3A 1XVJA 1NCZA 1ODBA 3PSRA 2ZRTA 2L2EA 1LXFC 3BUNB 1J1EA 2F2PA 1S5GY 1CDLA 4NQGA 5D69A 1K8UA 1IJ6A 5F6TA 1LINA 1NSHA 1A03A 1L2OC 4CPVA 2COLB 3EKHA 2KDHA 5HKZA 1IKUA 2MLEC 1CM4A 2AAOA 2WOSA 3EVRA 1Y0VH 1DJHA 1NYAA 1M31A 3PFVA 2K7DA 1OMVA 4N1GA 2LMVA 2L4IA 5ER4X 1CDMA 2KAXA 3DVJA 1UWOA 2I7AA 2CBLA 4GPLB 5AEQA 1J7PA 1BLQA 4P5OE 4CLNA 2HQ8A 3BOWA 2PMYA 3WHUB 5KTYA 3PN7C 1A75B 4DRWA 1B8RA 1DJYA 2IS9A 1C7VA 5CPVA 1CLBA 4M2PA 3VRPA 3CR4X 4NDBA 1BR4B 1K94A 2V53A 1GGZA 1QLKA 1UP5A 2PSRA 1BODA 2A4JA 2OS8B 1SL9A 1QATA 2G9BA 2JNFA 2KBMA 3O4YA 4JWQA 1CM1A 1J7QA 4AOMA 4FTGA 1B4CA 4PE0A 2KFHA 1S3PA 1CMFA 2GGMA 1KFUL 4XJKA 3GK4X 1HT9A 1RROA 1QX5B 2L51A 3KO0A 2F3ZA 2OTGB 2GV5A 4GBAA 5DKQA 1N65A 2ZFDA 4I5JA 5GQQC 1CFFA 5HYDA 1KK7Y 2KI4B 3CGAA 2L50A 3DF0A 1DTLA 2LE9B 1UURA 1PULA 2LP3A 1E8AA 4P2YB 2I2RE 1AP4A 2NZ0A 3BXKA 5I2OA 1MXLC 1C07A 5I2QA 1JUOA 1IRJA 2P6BB 1UUSA 1QX2A 1SK6D 3TDIA 2MRDA 2CTNA 1XFVO 1YURA 3H4SE 1WRZA 1ZOTB 2LLTA 1XFYO 2E30A 3LL8B 1U5IB 3A4UB 3KF9A 1NIWA 1WLZA 2PASA 1JC2A 3CS1A 2JPTA 1TCOB 3EK8A 5BPJA 1SRAA 1DJIA 1OSAA 2QPTA 3OP0A 1V1GA 4QJ4B 5HLVA 1QLSA 1EL4A 2BKIB 1BR1B 5HKYA 3O6BA 1PSRA 3JTDB 2M7NA 4I5NB 4F0ZB 1NX3A 2M9GA 1KWOC 2LUXA 1XYDA 1PRWA 1OQPA 3BUWB 3FS7A 4DCKA 4D1EA 2LLUA 5KU1A 1F54A 2KHNA 2JRFA 1X02A 1ZUZA 1MHOA 2M0RA 2AMIA 1A75A 3SG7A 3SG3A 5CSIA 2FOTA 2JTZA 3FWCA 3GK1A 1B8LA 2B1UA 4XJKB 1Q80A 4CFQA 1J1DA 2D8NA 2OTGC 2L4HA 1SY9A 1SYMA 1Y1UA 1W7IB 1M63B 1VRKA 4FQOA 1ZACA 2F2OA 4MZLA 3SIBA 1SL8A 1DJWA 1W7JB 1XK4C 2K2AA 2LM5A 5TNCA 1SKTA 3TDZA 4GAOA 2LP2A 3DF0B 1CLMA 1G8IA 3BUXB 1NWDA 2O5GA 1F55A 1S1EA 1TIZA 4GUKA 3ZNIA 3BUOB 4MRYA 4R1EA 5HKWA 3I5HB 4N1FA 1BMOA 3HX4A 1SCMB 3VRRA 2KGRA 1UHNA 1UHKA 1ZMZA 1J55A 2JQ6A 3I5GB 1WRKA 4MLWA 2AUCA 1KQMB 2H61C 2K7CA 3TZ1A 4DS7A 1TOPA 4ZCUA 1XK4A 1AUIB 1C7WA 1K9UA 3SJSA 1S6JA 1QVIZ 4HRGA 4PE1A 1AVSA 3OX5A 1TCFA 1YR5A 4MZKA 4MZJA 3DVEA 1OZOA 2LCPA 1S6IA 3FIAA 1KK8B 3JTDC 3VRNA 5AFPA 3D10A 1JWDA 1CKKA 2WC8A 2Y1MA 1QV1A 1IG5A 1F8HA 3PATA 1XA5A 4XYNA 1SR6C 4C0JA 3CR2A 1U5IA 1DGVA 2NLNA 1XFZO 2H61A 1SCVA 2GGZA 2M1KB 1BT6A 1UHJA 1YRUB 2SASA 3EK4A 4MRXA 1AHRA 2FCDA 2JXLA 4I5KA 4PE4A 5HLOA 1BOCA 2MAZA 3O2PA 3F45A 1XFUO 2EC6B 2BE4A 2KI6D 2JC2A 2VRGA 1KWOB 3GK2A 4MVFA 1YRTB 1SL7A 5K89A 1DVIA 4TNCA 2BE6A 5ER5A 5B8IB 2LVKA 2M49B 1R2UA 2JTTA 2NCOA 1CDNA 1B9AA 3O78A 1MXEA 4YRUA 1NX0A 1WLMA 2F3YA 1JFJA 3I5IB 2BBMA 2NCPA 3MSEB 2KYCA 4UPGA 2JT0A 3I5HC 3LK0A 3RLZA 3SIAA 1JF0A 1MWNA 1MF8B 1QS7A 1SCMC 3CTNA 1KFXL 2HETA 1BF5A 2PALA 1RJVA 2M97A 3I5GC 3LLEA 2EHBA 1KQMC 4GNKB 1B7TY 1J7OA 2BECA 2ZN8A 1FPWA 4JPZB 4U8DA 1CLLA 5CSFA 2WCFA 4I5LB 4YI8A 1NCXA 1KK8C 1M39A 5D7FA 1A29A 2CT9A 2KAYA 1ZFSA 1A4PA 3OHMB 3DVKA 4ORCB 3NSKA 4N5XA 3FWBA 5PALA 3TS5C 2LHLA 1F71A 1G33A 2K0JA 2SCPA 3SG5A 3KEVA 2LC5A 3IQQA 1WDCC
chains in the Genus database with same CATH superfamily
5FYXA 1TNPA 3BUMB 2R2IA 2JPOA 4INXA 1CFDA 1S5GZ 2EC6C 1AJ5A 2L98A 2JOJA 3KPXA 2HPSA 2L5XB 4AQIA 1T14A 1EJ3A 4OV2A 2JNXA 1QTXA 1Y1AA 1K2HA 4YGDB 3AAKA 4GGFC 3NHIA 1DJZA 1SR6B 2NXQA 5J3XA 1MR8A 4CFRA 2KAVA 1CDPA 1KFUS 1DT7B 2BCBA 3D0YB 3I5IC 4YI9A 3NXAA 2BNXA 3DD4A 1FI5A 1PVAA 3AKBA 1CFCA 1K9KA 1RECA 1H4BA 2BKHB 1M45A 3QRXA 4YGEB 1TN4A 1UHHA 2KYFA 2ZKMX 3IQOA 1DMOA 3Q8IA 1RTP1 1RWYA 4OCIA 3CABA 2LV7A 3BQ3A 2JU0A 2ZNDA 1OW4A 4GGFA 4YGBB 2JT3A 3N7HA 3WNXB 1DJXA 2MA2A 1GJYA 1YUUA 5JOLA 3GOFA 2LLSA 1K93D 2BAPA 3HCMA 3R1OA 4PHKA 1TNQA 3DYEA 1CMGA 1IQ5A 2LAPA 1TNXA 3K21A 3I5FC 3ICBA 1LKJA 1JSAA 3UO9A 3VROA 2QEVA 1OMDA 3KHEA 4C0LA 1L7ZA 3S0AA 1F4OA 2P70A 1Y1XA 4DUQA 1Y6WA 2WCEA 2KFFA 1EXRA 2OPOA 3BFHA 3D75A 3DVMA 3QMEA 3E3RA 4IL1A 1CB1A 2MHHA 5DKRA 1PVBA 1TWOA 1OE9B 2CXJA 5I2LA 2MBXA 2JXCA 3PLFB 1Z2CB 1OMRA 2WC5A 4PHMA 3SS4A 1GGWA 2ZRSA 1JFKA 1B47A 4YGCB 1M46A 2ERBA 2LVVA 3L47A 4CIDA 1AK8A 2LNKA 2LVIA 4ICBA 1HQVA 3B88A 1XFWO 2BCAA 2ISDA 1IGVA 1ORGA 2K60A 4GGNA 1XO5A 2BCXA 5CSNA 2BL0B 3SG4A 2K8MB 3WXAA 2M3WA 2LHIA 5I94A 1KK7Z 4PDZA 1D1OA 2KPHA 1BJFA 3EKJA 2F33A 2K2FA 4ZCVA 3B6XA 1H8BA 2LVJA 2LMTA 3TS5B 1MQ1A 1TTXA 2E6WA 2HQWA 3D74A 1LA0A 1YUTA 1ALWA 4JQ0D 1S6CA 1K9PA 5DKNA 1GQMA 1WDCB 4QJ5B 1YVLA 1EH2A 2BBNA 1NX2A 2M29A 2I18A 1FW4A 1S36A 4YGAA 1DF0A 2JZIA 3CZ1A 1BG1A 3D76A 1BU3A 4OR9B 2CCMA 1FI6A 3BYAA 3IF7A 1OOFA 4OVNF 4AQJA 2K61A 1J7RA 2KSPA 1LVCD 2H2KA 2JULA 2MJWB 1B8CA 1IH0A 2Q91A 2Y4QA 3R1PA 2F8PA 1WRLA 3D0YA 3LCPC 1DGUA 1QJTA 4KYNA 2M8UA 5AANA 3SS5A 3TUYB 3OB1B 3NSIA 3CLNA 3PM8A 5AERA 3CR5X 3VGOA 1DJGA 1SW8A 2WNDA 1KQVA 1K90D 4BY4A 1QV0A 1DEKA 3NSLA 3ZWHA 2MLFC 1EG3A 1QXPA 2JT8A 4ORBB 3WHTB 1F4QA 1OOIX 1YX7A 2WORA 4HREE 1IJ5A 1Z4HA 2KLEA 4Q04A 3AKAA 1PSBA 3RM1A 1N2DA 2BL0C 4NDDA 1DC1A 1NP8A 3I5FB 3JVTB 2M7LA 2FCEA 2JWWA 1A2XA 3OX6A 4ETOA 1KSMA 1PALA 2EGDA 1KSOA 1TNWA 4HSZA 5IBWA 3D78A 1OZSA 1V1FA 2Y1NA 3BFAA 3D73A 2WC6A 4USLA 3VRQA 2KNEA 3A8RA 2DOQA 1QVIY 3EK7A 5G08A 4MN0A 4MSPA 3CZTX 1SPYA 4DIRA 4A4CA 3OGNA 5CSJA 4PCWA 5AXIA 1TRFA 2CNPA 3M0WA 2QEHA 1KCYA 2KQ6A 4E68A 1NUBA 3NSOA 2QDIA 4NDCA 3CWGA 1DF0B 5D3OA 3OBVA 1QIVA 1IQ3A 1S26D 4WQ3A 4M2OA 4WRIA 1DQEA 1QASA 5FI6A 5JJGA 1QX7A 1FBVA 4ORAB 1AJ4A 1NPQA 1CTRA 5KSZA 5FI2A 1NCYA 1SMGA 2KFGA 2KLDA 3S0BA 4MEWA 3R1VA 1N0YA 4JD9A 4A4BA 1YUSA 2RGIA 2O60A 3PM2A 4BY5A 1OOGA 5DICA 3SG6A 3TUYC 3DZTA 1KFXS 2M1UA 1FF1A 2TN4A 1NX1A 3BOWB 1L2OB 1IWQA 1QIWA 2L5YA 4HRHA 4MBEA 4PE7A 4C0KA 1RFJA 1YX8A 2KGBC 1SBJA 4OKHA 2WCBA 2I94A 2OS8C 2L0PA 1MUXA 3K1EA 2Q4UA 2PVBA 3PALA 1QWVA 1K95A 1RK9A 1YTZC 4GFTA 4YBHB 5FI7A 1WY9A 3JVTC 2FJUB 2ZN9A 2QEOA 3SG2A 2LMUA 1UHIA 3AAJA 2KI6C 1CNPA 3CZ2A 2K7BA 4PHNA 4PHJA 2KQYA 3C1VA 1ALVA 1XFXO 2QACA 3PN7B 1EG4A 1JF2A 1JBAA 3TDUA 2KOTA 2HF5A 3DXLA 1B1GA 1CFPA 2LANA 3OB2B 4M2QA 4QJ3B 1OOJA 3LK1A 3NHTA 1G4YR 2KI4C 4WQ2A 1PK0D 1YVHA 2ZNEA 1B7TZ 2G2BA 5I8NA 1R6PA 2LUCA 4PALA 2K7OA 1SNLA 1F70A 4L9MA 2PRUA 3B87A 3EVUA 3V2LA 2Y5IA 3EVVA 2KBIA 1K96A 1LA3A 1XVJA 1NCZA 1ODBA 3PSRA 2ZRTA 2L2EA 1LXFC 3BUNB 1J1EA 2F2PA 1S5GY 1CDLA 3IVTA 4NQGA 5D69A 1K8UA 1IJ6A 5F6TA 3PJIA 1LINA 1C3ZA 1NSHA 1A03A 1L2OC 1LS8A 4CPVA 2COLB 3EKHA 2KDHA 5HKZA 1IKUA 2MLEC 1CM4A 2AAOA 2WOSA 3EVRA 1Y0VH 1DJHA 1NYAA 1M31A 3PFVA 2K7DA 1OMVA 4N1GA 2LMVA 2L4IA 5ER4X 1CDMA 2KAXA 3DVJA 1UWOA 2I7AA 2CBLA 4GPLB 5AEQA 1J7PA 1BLQA 3RZSA 4P5OE 3B7AA 4CLNA 2HQ8A 3BOWA 2PMYA 3WHUB 5KTYA 3PN7C 1A75B 4DRWA 1B8RA 1DJYA 2IS9A 3FE6A 3O4XA 5CPVA 1C7VA 4M2PA 1CLBA 1IIOA 3VRPA 3CR4X 4NDBA 1BR4B 1K94A 2V53A 1GGZA 1QLKA 1UP5A 2PSRA 3D77A 1BODA 2A4JA 2OS8B 1SL9A 3FE8A 3CZ0A 1QATA 2G9BA 2JNFA 2KBMA 3O4YA 4JWQA 1CM1A 1TUJA 4F7FA 1J7QA 4AOMA 4FTGA 1B4CA 4PE0A 2KFHA 1S3PA 1CMFA 2GGMA 1KFUL 4XJKA 3GK4X 1HT9A 1RROA 1QX5B 2L51A 3KO0A 3S0FA 2F3ZA 2OTGB 3BJHA 2GV5A 4GBAA 5DKQA 3SS3A 1N65A 2ZFDA 4I5JA 5GQQC 1CFFA 5HYDA 1KK7Y 2KI4B 3CGAA 2L50A 3DF0A 1DTLA 2LE9B 1UURA 1W9ZA 2PQLA 3FE9A 1PULA 2LP3A 1E8AA 4P2YB 2I2RE 1AP4A 2H8VA 2NZ0A 3BXKA 5I2OA 1MXLC 1C07A 5I2QA 1JUOA 1IRJA 2P6BB 1UUSA 1QX2A 1SK6D 3TDIA 2MRDA 2CTNA 1XFVO 1YURA 3H4SE 1WRZA 1ZOTB 2LLTA 1XFYO 3S0EA 2E30A 3LL8B 1U5IB 3A4UB 3KF9A 1NIWA 3L4AA 1WLZA 1GM0A 2PASA 1JC2A 3CS1A 2JPTA 3CYZA 3R72A 1TCOB 3EK8A 5BPJA 1SRAA 1DJIA 1OSAA 2QPTA 3OP0A 1V1GA 4QJ4B 5HLVA 1QLSA 1EL4A 2BKIB 1BR1B 4INWA 5HKYA 3O6BA 1PSRA 3JTDB 2M7NA 4I5NB 5EL2A 4F0ZB 1NX3A 2M9GA 1KWOC 2LUXA 1XYDA 1PRWA 1OQPA 3BUWB 3FS7A 1C3YA 4DCKA 4D1EA 2LLUA 5HL1A 5KU1A 1F54A 2KHNA 2JRFA 2QEBA 1X02A 1ZUZA 1MHOA 2M0RA 2AMIA 1A75A 2PYQA 3SG7A 3SG3A 5CSIA 3VB1A 2FOTA 2JTZA 3FWCA 3GK1A 1B8LA 2B1UA 4XJKB 1Q80A 4CFQA 1J1DA 2D8NA 2L2CA 2OTGC 2L4HA 1SY9A 3NGVA 1SYMA 1Y1UA 3B86A 1W7IB 1M63B 1VRKA 4FQOA 1ZACA 2F2OA 1XFRA 4MZLA 1SL8A 1DJWA 1W7JB 1XK4C 2K2AA 2LM5A 5TNCA 1SKTA 3SIBA 3TDZA 2FJYA 4GAOA 2LP2A 3DF0B 1CLMA 1G8IA 3BUXB 1NWDA 2O5GA 1F55A 1S1EA 1TIZA 4GUKA 3ZNIA 3BUOB 4MRYA 4R1EA 5HKWA 3I5HB 4FQTA 2WCLA 4N1FA 1BMOA 3HX4A 1SCMB 3VRRA 2KGRA 1UHNA 1UHKA 1ZMZA 1J55A 2JQ6A 3I5GB 1WRKA 4MLWA 2AUCA 1KQMB 2H61C 2K7CA 4OZDA 3TZ1A 1TOPA 4DS7A 4ZCUA 1XK4A 1AUIB 1C7WA 1K9UA 3CDNA 1S6JA 1QVIZ 4HRGA 4PE1A 1AVSA 3OX5A 3SJSA 1TCFA 2WCKA 1YR5A 4MZKA 4MZJA 3DVEA 1OZOA 2LCPA 1S6IA 3FIAA 1KK8B 3JTDC 3VRNA 1OOHA 5AFPA 3D10A 1JWDA 2GTEA 1CKKA 2WC8A 2Y1MA 1QV1A 1IG5A 1F8HA 3PATA 3BFBA 1XA5A 4XYNA 1SR6C 4C0JA 3CR2A 1U5IA 1DGVA 2NLNA 1XFZO 2H61A 1SCVA 2GGZA 2M1KB 1BT6A 1UHJA 1YRUB 3DY9A 2SASA 3EK4A 4MRXA 1AHRA 2FCDA 2YGUA 2JXLA 2P71A 4I5KA 4PE4A 3S0GA 3EG5B 5HLOA 1BOCA 2MAZA 3O2PA 3F45A 1XFUO 2EC6B 2BE4A 2KI6D 2JC2A 2VRGA 1KWOB 3GK2A 4MVFA 2WCHA 1YRTB 1SL7A 5K89A 1DVIA 4TNCA 2BE6A 1P28A 5ER5A 2WCMA 5B8IB 2LVKA 2M49B 3L4LA 1R2UA 2JTTA 2NCOA 1CDNA 1B9AA 3O78A 1MXEA 4YRUA 1NX0A 1WLMA 2F3YA 3S0DA 3I5IB 1JFJA 2BBMA 2NCPA 3MSEB 2KYCA 4UPGA 4PT1A 2JT0A 3I5HC 3LK0A 3RLZA 3SIAA 1JF0A 1MWNA 1MF8B 1QS7A 1SCMC 3CTNA 1KFXL 2HETA 1BF5A 2PALA 1RJVA 2M97A 3UNWA 3I5GC 3LLEA 2EHBA 1KQMC 4GNKB 1B7TY 2WCJA 1J7OA 2BECA 2ZN8A 1FPWA 4JPZB 4U8DA 1CLLA 5CSFA 2WCFA 4I5LB 4YI8A 1NCXA 1KK8C 1M39A 5D7FA 1A29A 2CT9A 2KAYA 1TUZA 1A4PA 1ZFSA 3OHMB 3DVKA 4ORCB 3NSKA 4JKTA 4N5XA 3FWBA 5PALA 3TS5C 2LHLA 1F71A 1G33A 2K0JA 2SCPA 1DELA 3KEVA 3SG5A 2LC5A 1SSEB 4IJ7A 3IQQA 1WDCC
chains in the Genus database with same CATH topology
5FYXA 1TNPA 3BUMB 2R2IA 1CFDA 1S5GZ 2EC6C 1AJ5A 2L98A 2JOJA 3KPXA 2HPSA 2L5XB 4AQIA 1EJ3A 4OV2A 2JNXA 1QTXA 1Y1AA 1K2HA 4YGDB 3AAKA 4GGFC 1DJZA 1SR6B 2NXQA 5J3XA 1MR8A 4CFRA 2KAVA 1CDPA 1KFUS 1DT7B 2BCBA 3D0YB 3I5IC 4YI9A 3NXAA 1FI5A 3DD4A 1PVAA 3AKBA 1CFCA 1K9KA 1RECA 1H4BA 2BKHB 1M45A 3QRXA 4YGEB 1TN4A 1UHHA 2KYFA 2ZKMX 3IQOA 1DMOA 1RTP1 1RWYA 4OCIA 2LV7A 3BQ3A 2JU0A 2ZNDA 4GGFA 4YGBB 2JT3A 3WNXB 1DJXA 2MA2A 1GJYA 1YUUA 5JOLA 3GOFA 2LLSA 1K93D 3HCMA 4PHKA 1TNQA 1CMGA 1IQ5A 2LAPA 1TNXA 3K21A 3I5FC 3ICBA 1LKJA 1JSAA 3VROA 1OMDA 3KHEA 1L7ZA 1F4OA 4DUQA 1Y1XA 1Y6WA 2WCEA 2KFFA 1EXRA 2OPOA 3DVMA 3E3RA 4IL1A 1CB1A 2MHHA 5DKRA 1PVBA 2CXJA 1OE9B 5I2LA 2MBXA 4C0LA 2JXCA 3PLFB 1OMRA 4PHMA 1GGWA 2ZRSA 1JFKA 1B47A 4YGCB 1M46A 2LVVA 4CIDA 1AK8A 2LNKA 2LVIA 4ICBA 1HQVA 1XFWO 2BCAA 2ISDA 1IGVA 4GGNA 5CSNA 1XO5A 2BCXA 3SG4A 2BL0B 2K8MB 3WXAA 2M3WA 2LHIA 1KK7Z 4PDZA 1D1OA 1BJFA 3EKJA 2F33A 2K2FA 4ZCVA 1H8BA 2LVJA 2LMTA 3TS5B 1MQ1A 1TTXA 2E6WA 2HQWA 1LA0A 1YUTA 1ALWA 4JQ0D 1S6CA 1K9PA 5DKNA 1GQMA 1WDCB 4QJ5B 1YVLA 1EH2A 2BBNA 1NX2A 2M29A 2I18A 1FW4A 1S36A 4YGAA 1DF0A 2JZIA 1BG1A 1BU3A 4OR9B 2CCMA 1FI6A 3BYAA 3IF7A 4OVNF 4AQJA 2K61A 1J7RA 2KSPA 1LVCD 2H2KA 2JULA 2MJWB 1B8CA 1IH0A 2Q91A 2Y4QA 2F8PA 1WRLA 3D0YA 3LCPC 1DGUA 1QJTA 2M8UA 5AANA 3TUYB 3OB1B 3NSIA 3CLNA 3PM8A 5AERA 3CR5X 3VGOA 1DJGA 1SW8A 2WNDA 1KQVA 1K90D 4BY4A 1QV0A 3NSLA 3ZWHA 2MLFC 1EG3A 1QXPA 2JT8A 4ORBB 3WHTB 1F4QA 1YX7A 2WORA 4HREE 1IJ5A 4Q04A 3AKAA 1PSBA 3RM1A 1N2DA 2BL0C 4NDDA 1NP8A 3I5FB 3JVTB 2M7LA 2FCEA 2JWWA 1A2XA 3OX6A 4ETOA 1KSMA 1PALA 2EGDA 1KSOA 1TNWA 4HSZA 5IBWA 1OZSA 1V1FA 2Y1NA 4USLA 3VRQA 2KNEA 3A8RA 2DOQA 1QVIY 3EK7A 5G08A 4MN0A 4MSPA 3CZTX 1SPYA 4DIRA 4A4CA 5CSJA 4PCWA 5AXIA 1TRFA 2CNPA 3M0WA 1KCYA 2KQ6A 4E68A 1NUBA 3NSOA 4NDCA 3CWGA 1DF0B 1IQ3A 1QIVA 1S26D 4WQ3A 4M2OA 4WRIA 1QASA 5JJGA 1QX7A 1FBVA 4ORAB 1AJ4A 1NPQA 1CTRA 5KSZA 1NCYA 1SMGA 2KFGA 4MEWA 1N0YA 4A4BA 1YUSA 2RGIA 2O60A 4BY5A 3SG6A 3TUYC 1KFXS 2M1UA 1FF1A 2TN4A 1NX1A 3BOWB 1L2OB 1IWQA 1QIWA 4HRHA 4MBEA 4PE7A 4C0KA 1RFJA 1YX8A 2KGBC 1SBJA 4OKHA 2WCBA 2I94A 2OS8C 2L0PA 1MUXA 2Q4UA 2PVBA 3PALA 1K95A 1RK9A 1YTZC 4GFTA 4YBHB 1WY9A 3JVTC 2FJUB 2ZN9A 3SG2A 2LMUA 1UHIA 3AAJA 2KI6C 1CNPA 2K7BA 4PHNA 4PHJA 2KQYA 3C1VA 1ALVA 1XFXO 2QACA 3PN7B 1EG4A 1JF2A 1JBAA 3TDUA 2KOTA 2HF5A 1CFPA 1B1GA 2LANA 3OB2B 4M2QA 4QJ3B 1OOJA 3LK1A 1G4YR 2KI4C 4WQ2A 1PK0D 1YVHA 2ZNEA 1B7TZ 2G2BA 5I8NA 1R6PA 2LUCA 4PALA 2K7OA 1SNLA 1F70A 4L9MA 2PRUA 3EVUA 2Y5IA 3EVVA 2KBIA 1K96A 1LA3A 1XVJA 1NCZA 1ODBA 3PSRA 2ZRTA 2L2EA 1LXFC 3BUNB 1J1EA 2F2PA 1S5GY 1CDLA 4NQGA 5D69A 1K8UA 1IJ6A 5F6TA 1LINA 1NSHA 1A03A 1L2OC 4CPVA 2COLB 3EKHA 2KDHA 5HKZA 1IKUA 2MLEC 1CM4A 2AAOA 2WOSA 3EVRA 1Y0VH 1DJHA 1NYAA 1M31A 3PFVA 2K7DA 1OMVA 4N1GA 2LMVA 2L4IA 5ER4X 1CDMA 2KAXA 3DVJA 1UWOA 2I7AA 2CBLA 4GPLB 5AEQA 1J7PA 1BLQA 4P5OE 4CLNA 2HQ8A 3BOWA 2PMYA 3WHUB 5KTYA 3PN7C 1A75B 4DRWA 1B8RA 1DJYA 2IS9A 1C7VA 5CPVA 1CLBA 4M2PA 3VRPA 3CR4X 4NDBA 1BR4B 1K94A 2V53A 1GGZA 1QLKA 1UP5A 2PSRA 1BODA 2A4JA 2OS8B 1SL9A 1QATA 2G9BA 2JNFA 2KBMA 3O4YA 4JWQA 1CM1A 1J7QA 4AOMA 4FTGA 1B4CA 4PE0A 2KFHA 1S3PA 1CMFA 2GGMA 1KFUL 4XJKA 3GK4X 1HT9A 1RROA 1QX5B 2L51A 3KO0A 2F3ZA 2OTGB 2GV5A 4GBAA 5DKQA 1N65A 2ZFDA 4I5JA 5GQQC 1CFFA 5HYDA 1KK7Y 2KI4B 3CGAA 2L50A 3DF0A 1DTLA 2LE9B 1UURA 1PULA 2LP3A 1E8AA 4P2YB 2I2RE 1AP4A 2NZ0A 3BXKA 5I2OA 1MXLC 1C07A 5I2QA 1JUOA 1IRJA 2P6BB 1UUSA 1QX2A 1SK6D 3TDIA 2MRDA 2CTNA 1XFVO 1YURA 3H4SE 1WRZA 1ZOTB 2LLTA 1XFYO 2E30A 3LL8B 1U5IB 3A4UB 3KF9A 1NIWA 1WLZA 2PASA 1JC2A 3CS1A 2JPTA 1TCOB 3EK8A 5BPJA 1SRAA 1DJIA 1OSAA 2QPTA 3OP0A 1V1GA 4QJ4B 5HLVA 1QLSA 1EL4A 2BKIB 1BR1B 5HKYA 3O6BA 1PSRA 3JTDB 2M7NA 4I5NB 4F0ZB 1NX3A 2M9GA 1KWOC 2LUXA 1XYDA 1PRWA 1OQPA 3BUWB 3FS7A 4DCKA 4D1EA 2LLUA 5KU1A 1F54A 2KHNA 2JRFA 1X02A 1ZUZA 1MHOA 2M0RA 2AMIA 1A75A 3SG7A 3SG3A 5CSIA 2FOTA 2JTZA 3FWCA 3GK1A 1B8LA 2B1UA 4XJKB 1Q80A 4CFQA 1J1DA 2D8NA 2OTGC 2L4HA 1SY9A 1SYMA 1Y1UA 1W7IB 1M63B 1VRKA 4FQOA 1ZACA 2F2OA 4MZLA 3SIBA 1SL8A 1DJWA 1W7JB 1XK4C 2K2AA 2LM5A 5TNCA 1SKTA 3TDZA 4GAOA 2LP2A 3DF0B 1CLMA 1G8IA 3BUXB 1NWDA 2O5GA 1F55A 1S1EA 1TIZA 4GUKA 3ZNIA 3BUOB 4MRYA 4R1EA 5HKWA 3I5HB 4N1FA 1BMOA 3HX4A 1SCMB 3VRRA 2KGRA 1UHNA 1UHKA 1ZMZA 1J55A 2JQ6A 3I5GB 1WRKA 4MLWA 2AUCA 1KQMB 2H61C 2K7CA 3TZ1A 4DS7A 1TOPA 4ZCUA 1XK4A 1AUIB 1C7WA 1K9UA 3SJSA 1S6JA 1QVIZ 4HRGA 4PE1A 1AVSA 3OX5A 1TCFA 1YR5A 4MZKA 4MZJA 3DVEA 1OZOA 2LCPA 1S6IA 3FIAA 1KK8B 3JTDC 3VRNA 5AFPA 3D10A 1JWDA 1CKKA 2WC8A 2Y1MA 1QV1A 1IG5A 1F8HA 3PATA 1XA5A 4XYNA 1SR6C 4C0JA 3CR2A 1U5IA 1DGVA 2NLNA 1XFZO 2H61A 1SCVA 2GGZA 2M1KB 1BT6A 1UHJA 1YRUB 2SASA 3EK4A 4MRXA 1AHRA 2FCDA 2JXLA 4I5KA 4PE4A 5HLOA 1BOCA 2MAZA 3O2PA 3F45A 1XFUO 2EC6B 2BE4A 2KI6D 2JC2A 2VRGA 1KWOB 3GK2A 4MVFA 1YRTB 1SL7A 5K89A 1DVIA 4TNCA 2BE6A 5ER5A 5B8IB 2LVKA 2M49B 1R2UA 2JTTA 2NCOA 1CDNA 1B9AA 3O78A 1MXEA 4YRUA 1NX0A 1WLMA 2F3YA 1JFJA 3I5IB 2BBMA 2NCPA 3MSEB 2KYCA 4UPGA 2JT0A 3I5HC 3LK0A 3RLZA 3SIAA 1JF0A 1MWNA 1MF8B 1QS7A 1SCMC 3CTNA 1KFXL 2HETA 1BF5A 2PALA 1RJVA 2M97A 3I5GC 3LLEA 2EHBA 1KQMC 4GNKB 1B7TY 1J7OA 2BECA 2ZN8A 1FPWA 4JPZB 4U8DA 1CLLA 5CSFA 2WCFA 4I5LB 4YI8A 1NCXA 1KK8C 1M39A 5D7FA 1A29A 2CT9A 2KAYA 1ZFSA 1A4PA 3OHMB 3DVKA 4ORCB 3NSKA 4N5XA 3FWBA 5PALA 3TS5C 2LHLA 1F71A 1G33A 2K0JA 2SCPA 3SG5A 3KEVA 2LC5A 3IQQA 1WDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYX A;  1TNP A;  3BUM B;  2R2I A;  1CFD A;  1S5G Z;  2EC6 C;  1AJ5 A;  2L98 A;  2JOJ A;  3KPX A;  2HPS A;  2L5X B;  4AQI A;  1EJ3 A;  4OV2 A;  2JNX A;  1QTX A;  1Y1A A;  1K2H A;  4YGD B;  3AAK A;  4GGF C;  1DJZ A;  1SR6 B;  2NXQ A;  5J3X A;  1MR8 A;  4CFR A;  2KAV A;  1CDP A;  1KFU S;  1DT7 B;  2BCB A;  3D0Y B;  3I5I C;  4YI9 A;  3NXA A;  1FI5 A;  3DD4 A;  1PVA A;  3AKB A;  1CFC A;  1K9K A;  1REC A;  1H4B A;  2BKH B;  1M45 A;  3QRX A;  4YGE B;  1TN4 A;  1UHH A;  2KYF A;  2ZKM X;  3IQO A;  1DMO A;  1RTP 1;  1RWY A;  4OCI A;  2LV7 A;  3BQ3 A;  2JU0 A;  2ZND A;  4GGF A;  4YGB B;  2JT3 A;  3WNX B;  1DJX A;  2MA2 A;  1GJY A;  1YUU A;  5JOL A;  3GOF A;  2LLS A;  1K93 D;  3HCM A;  4PHK A;  1TNQ A;  1CMG A;  1IQ5 A;  2LAP A;  1TNX A;  3K21 A;  3I5F C;  3ICB A;  1LKJ A;  1JSA A;  3VRO A;  1OMD A;  3KHE A;  1L7Z A;  1F4O A;  4DUQ A;  1Y1X A;  1Y6W A;  2WCE A;  2KFF A;  1EXR A;  2OPO A;  3DVM A;  3E3R A;  4IL1 A;  1CB1 A;  2MHH A;  5DKR A;  1PVB A;  2CXJ A;  1OE9 B;  5I2L A;  2MBX A;  4C0L A;  2JXC A;  3PLF B;  1OMR A;  4PHM A;  1GGW A;  2ZRS A;  1JFK A;  1B47 A;  4YGC B;  1M46 A;  2LVV A;  4CID A;  1AK8 A;  2LNK A;  2LVI A;  4ICB A;  1HQV A;  1XFW O;  2BCA A;  2ISD A;  1IGV A;  4GGN A;  5CSN A;  1XO5 A;  2BCX A;  3SG4 A;  2BL0 B;  2K8M B;  3WXA A;  2M3W A;  2LHI A;  1KK7 Z;  4PDZ A;  1D1O A;  1BJF A;  3EKJ A;  2F33 A;  2K2F A;  4ZCV A;  1H8B A;  2LVJ A;  2LMT A;  3TS5 B;  1MQ1 A;  1TTX A;  2E6W A;  2HQW A;  1LA0 A;  1YUT A;  1ALW A;  4JQ0 D;  1S6C A;  1K9P A;  5DKN A;  1GQM A;  1WDC B;  4QJ5 B;  1YVL A;  1EH2 A;  2BBN A;  1NX2 A;  2M29 A;  2I18 A;  1FW4 A;  1S36 A;  4YGA A;  1DF0 A;  2JZI A;  1BG1 A;  1BU3 A;  4OR9 B;  2CCM A;  1FI6 A;  3BYA A;  3IF7 A;  4OVN F;  4AQJ A;  2K61 A;  1J7R A;  2KSP A;  1LVC D;  2H2K A;  2JUL A;  2MJW B;  1B8C A;  1IH0 A;  2Q91 A;  2Y4Q A;  2F8P A;  1WRL A;  3D0Y A;  3LCP C;  1DGU A;  1QJT A;  2M8U A;  5AAN A;  3TUY B;  3OB1 B;  3NSI A;  3CLN A;  3PM8 A;  5AER A;  3CR5 X;  3VGO A;  1DJG A;  1SW8 A;  2WND A;  1KQV A;  1K90 D;  4BY4 A;  1QV0 A;  3NSL A;  3ZWH A;  2MLF C;  1EG3 A;  1QXP A;  2JT8 A;  4ORB B;  3WHT B;  1F4Q A;  1YX7 A;  2WOR A;  4HRE E;  1IJ5 A;  4Q04 A;  3AKA A;  1PSB A;  3RM1 A;  1N2D A;  2BL0 C;  4NDD A;  1NP8 A;  3I5F B;  3JVT B;  2M7L A;  2FCE A;  2JWW A;  1A2X A;  3OX6 A;  4ETO A;  1KSM A;  1PAL A;  2EGD A;  1KSO A;  1TNW A;  4HSZ A;  5IBW A;  1OZS A;  1V1F A;  2Y1N A;  4USL A;  3VRQ A;  2KNE A;  3A8R A;  2DOQ A;  1QVI Y;  3EK7 A;  5G08 A;  4MN0 A;  4MSP A;  3CZT X;  1SPY A;  4DIR A;  4A4C A;  5CSJ A;  4PCW A;  5AXI A;  1TRF A;  2CNP A;  3M0W A;  1KCY A;  2KQ6 A;  4E68 A;  1NUB A;  3NSO A;  4NDC A;  3CWG A;  1DF0 B;  1IQ3 A;  1QIV A;  1S26 D;  4WQ3 A;  4M2O A;  4WRI A;  1QAS A;  5JJG A;  1QX7 A;  1FBV A;  4ORA B;  1AJ4 A;  1NPQ A;  1CTR A;  5KSZ A;  1NCY A;  1SMG A;  2KFG A;  4MEW A;  1N0Y A;  4A4B A;  1YUS A;  2RGI A;  2O60 A;  4BY5 A;  3SG6 A;  3TUY C;  1KFX S;  2M1U A;  1FF1 A;  2TN4 A;  1NX1 A;  3BOW B;  1L2O B;  1IWQ A;  1QIW A;  4HRH A;  4MBE A;  4PE7 A;  4C0K A;  1RFJ A;  1YX8 A;  2KGB C;  1SBJ A;  4OKH A;  2WCB A;  2I94 A;  2OS8 C;  2L0P A;  1MUX A;  2Q4U A;  2PVB A;  3PAL A;  1K95 A;  1RK9 A;  1YTZ C;  4GFT A;  4YBH B;  1WY9 A;  3JVT C;  2FJU B;  2ZN9 A;  3SG2 A;  2LMU A;  1UHI A;  3AAJ A;  2KI6 C;  1CNP A;  2K7B A;  4PHN A;  4PHJ A;  2KQY A;  3C1V A;  1ALV A;  1XFX O;  2QAC A;  3PN7 B;  1EG4 A;  1JF2 A;  1JBA A;  3TDU A;  2KOT A;  2HF5 A;  1CFP A;  1B1G A;  2LAN A;  3OB2 B;  4M2Q A;  4QJ3 B;  1OOJ A;  3LK1 A;  1G4Y R;  2KI4 C;  4WQ2 A;  1PK0 D;  1YVH A;  2ZNE A;  1B7T Z;  2G2B A;  5I8N A;  1R6P A;  2LUC A;  4PAL A;  2K7O A;  1SNL A;  1F70 A;  4L9M A;  2PRU A;  3EVU A;  2Y5I A;  3EVV A;  2KBI A;  1K96 A;  1LA3 A;  1XVJ A;  1NCZ A;  1ODB A;  3PSR A;  2ZRT A;  2L2E A;  1LXF C;  3BUN B;  1J1E A;  2F2P A;  1S5G Y;  1CDL A;  4NQG A;  5D69 A;  1K8U A;  1IJ6 A;  5F6T A;  1LIN A;  1NSH A;  1A03 A;  1L2O C;  4CPV A;  2COL B;  3EKH A;  2KDH A;  5HKZ A;  1IKU A;  2MLE C;  1CM4 A;  2AAO A;  2WOS A;  3EVR A;  1Y0V H;  1DJH A;  1NYA A;  1M31 A;  3PFV A;  2K7D A;  1OMV A;  4N1G A;  2LMV A;  2L4I A;  5ER4 X;  1CDM A;  2KAX A;  3DVJ A;  1UWO A;  2I7A A;  2CBL A;  4GPL B;  5AEQ A;  1J7P A;  1BLQ A;  4P5O E;  4CLN A;  2HQ8 A;  3BOW A;  2PMY A;  3WHU B;  5KTY A;  3PN7 C;  1A75 B;  4DRW A;  1B8R A;  1DJY A;  2IS9 A;  1C7V A;  5CPV A;  1CLB A;  4M2P A;  3VRP A;  3CR4 X;  4NDB A;  1BR4 B;  1K94 A;  2V53 A;  1GGZ A;  1QLK A;  1UP5 A;  2PSR A;  1BOD A;  2A4J A;  2OS8 B;  1SL9 A;  1QAT A;  2G9B A;  2JNF A;  2KBM A;  3O4Y A;  4JWQ A;  1CM1 A;  1J7Q A;  4AOM A;  4FTG A;  1B4C A;  4PE0 A;  2KFH A;  1S3P A;  1CMF A;  2GGM A;  1KFU L;  4XJK A;  3GK4 X;  1HT9 A;  1RRO A;  1QX5 B;  2L51 A;  3KO0 A;  2F3Z A;  2OTG B;  2GV5 A;  4GBA A;  5DKQ A;  1N65 A;  2ZFD A;  4I5J A;  5GQQ C;  1CFF A;  5HYD A;  1KK7 Y;  2KI4 B;  3CGA A;  2L50 A;  3DF0 A;  1DTL A;  2LE9 B;  1UUR A;  1PUL A;  2LP3 A;  1E8A A;  4P2Y B;  2I2R E;  1AP4 A;  2NZ0 A;  3BXK A;  5I2O A;  1MXL C;  1C07 A;  5I2Q A;  1JUO A;  1IRJ A;  2P6B B;  1UUS A;  1QX2 A;  1SK6 D;  3TDI A;  2MRD A;  2CTN A;  1XFV O;  1YUR A;  3H4S E;  1WRZ A;  1ZOT B;  2LLT A;  1XFY O;  2E30 A;  3LL8 B;  1U5I B;  3A4U B;  3KF9 A;  1NIW A;  1WLZ A;  2PAS A;  1JC2 A;  3CS1 A;  2JPT A;  1TCO B;  3EK8 A;  5BPJ A;  1SRA A;  1DJI A;  1OSA A;  2QPT A;  3OP0 A;  1V1G A;  4QJ4 B;  5HLV A;  1QLS A;  1EL4 A;  2BKI B;  1BR1 B;  5HKY A;  3O6B A;  1PSR A;  3JTD B;  2M7N A;  4I5N B;  4F0Z B;  1NX3 A;  2M9G A;  1KWO C;  2LUX A;  1XYD A;  1PRW A;  1OQP A;  3BUW B;  3FS7 A;  4DCK A;  4D1E A;  2LLU A;  5KU1 A;  1F54 A;  2KHN A;  2JRF A;  1X02 A;  1ZUZ A;  1MHO A;  2M0R A;  2AMI A;  1A75 A;  3SG7 A;  3SG3 A;  5CSI A;  2FOT A;  2JTZ A;  3FWC A;  3GK1 A;  1B8L A;  2B1U A;  4XJK B;  1Q80 A;  4CFQ A;  1J1D A;  2D8N A;  2OTG C;  2L4H A;  1SY9 A;  1SYM A;  1Y1U A;  1W7I B;  1M63 B;  1VRK A;  4FQO A;  1ZAC A;  2F2O A;  4MZL A;  3SIB A;  1SL8 A;  1DJW A;  1W7J B;  1XK4 C;  2K2A A;  2LM5 A;  5TNC A;  1SKT A;  3TDZ A;  4GAO A;  2LP2 A;  3DF0 B;  1CLM A;  1G8I A;  3BUX B;  1NWD A;  2O5G A;  1F55 A;  1S1E A;  1TIZ A;  4GUK A;  3ZNI A;  3BUO B;  4MRY A;  4R1E A;  5HKW A;  3I5H B;  4N1F A;  1BMO A;  3HX4 A;  1SCM B;  3VRR A;  2KGR A;  1UHN A;  1UHK A;  1ZMZ A;  1J55 A;  2JQ6 A;  3I5G B;  1WRK A;  4MLW A;  2AUC A;  1KQM B;  2H61 C;  2K7C A;  3TZ1 A;  4DS7 A;  1TOP A;  4ZCU A;  1XK4 A;  1AUI B;  1C7W A;  1K9U A;  3SJS A;  1S6J A;  1QVI Z;  4HRG A;  4PE1 A;  1AVS A;  3OX5 A;  1TCF A;  1YR5 A;  4MZK A;  4MZJ A;  3DVE A;  1OZO A;  2LCP A;  1S6I A;  3FIA A;  1KK8 B;  3JTD C;  3VRN A;  5AFP A;  3D10 A;  1JWD A;  1CKK A;  2WC8 A;  2Y1M A;  1QV1 A;  1IG5 A;  1F8H A;  3PAT A;  1XA5 A;  4XYN A;  1SR6 C;  4C0J A;  3CR2 A;  1U5I A;  1DGV A;  2NLN A;  1XFZ O;  2H61 A;  1SCV A;  2GGZ A;  2M1K B;  1BT6 A;  1UHJ A;  1YRU B;  2SAS A;  3EK4 A;  4MRX A;  1AHR A;  2FCD A;  2JXL A;  4I5K A;  4PE4 A;  5HLO A;  1BOC A;  2MAZ A;  3O2P A;  3F45 A;  1XFU O;  2EC6 B;  2BE4 A;  2KI6 D;  2JC2 A;  2VRG A;  1KWO B;  3GK2 A;  4MVF A;  1YRT B;  1SL7 A;  5K89 A;  1DVI A;  4TNC A;  2BE6 A;  5ER5 A;  5B8I B;  2LVK A;  2M49 B;  1R2U A;  2JTT A;  2NCO A;  1CDN A;  1B9A A;  3O78 A;  1MXE A;  4YRU A;  1NX0 A;  1WLM A;  2F3Y A;  1JFJ A;  3I5I B;  2BBM A;  2NCP A;  3MSE B;  2KYC A;  4UPG A;  2JT0 A;  3I5H C;  3LK0 A;  3RLZ A;  3SIA A;  1JF0 A;  1MWN A;  1MF8 B;  1QS7 A;  1SCM C;  3CTN A;  1KFX L;  2HET A;  1BF5 A;  2PAL A;  1RJV A;  2M97 A;  3I5G C;  3LLE A;  2EHB A;  1KQM C;  4GNK B;  1B7T Y;  1J7O A;  2BEC A;  2ZN8 A;  1FPW A;  4JPZ B;  4U8D A;  1CLL A;  5CSF A;  2WCF A;  4I5L B;  4YI8 A;  1NCX A;  1KK8 C;  1M39 A;  5D7F A;  1A29 A;  2CT9 A;  2KAY A;  1ZFS A;  1A4P A;  3OHM B;  3DVK A;  4ORC B;  3NSK A;  4N5X A;  3FWB A;  5PAL A;  3TS5 C;  2LHL A;  1F71 A;  1G33 A;  2K0J A;  2SCP A;  3SG5 A;  3KEV A;  2LC5 A;  3IQQ A;  1WDC C; 
#chains in the Genus database with same CATH topology
 5FYX A;  1TNP A;  3BUM B;  2R2I A;  2JPO A;  4INX A;  1CFD A;  1S5G Z;  2EC6 C;  1AJ5 A;  2L98 A;  2JOJ A;  3KPX A;  2HPS A;  2L5X B;  4AQI A;  1T14 A;  1EJ3 A;  4OV2 A;  2JNX A;  1QTX A;  1Y1A A;  1K2H A;  4YGD B;  3AAK A;  4GGF C;  3NHI A;  1DJZ A;  1SR6 B;  2NXQ A;  5J3X A;  1MR8 A;  4CFR A;  2KAV A;  1CDP A;  1KFU S;  1DT7 B;  2BCB A;  3D0Y B;  3I5I C;  4YI9 A;  3NXA A;  2BNX A;  3DD4 A;  1FI5 A;  1PVA A;  3AKB A;  1CFC A;  1K9K A;  1REC A;  1H4B A;  2BKH B;  1M45 A;  3QRX A;  4YGE B;  1TN4 A;  1UHH A;  2KYF A;  2ZKM X;  3IQO A;  1DMO A;  3Q8I A;  1RTP 1;  1RWY A;  4OCI A;  3CAB A;  2LV7 A;  3BQ3 A;  2JU0 A;  2ZND A;  1OW4 A;  4GGF A;  4YGB B;  2JT3 A;  3N7H A;  3WNX B;  1DJX A;  2MA2 A;  1GJY A;  1YUU A;  5JOL A;  3GOF A;  2LLS A;  1K93 D;  2BAP A;  3HCM A;  3R1O A;  4PHK A;  1TNQ A;  3DYE A;  1CMG A;  1IQ5 A;  2LAP A;  1TNX A;  3K21 A;  3I5F C;  3ICB A;  1LKJ A;  1JSA A;  3UO9 A;  3VRO A;  2QEV A;  1OMD A;  3KHE A;  4C0L A;  1L7Z A;  3S0A A;  1F4O A;  2P70 A;  1Y1X A;  4DUQ A;  1Y6W A;  2WCE A;  2KFF A;  1EXR A;  2OPO A;  3BFH A;  3D75 A;  3DVM A;  3QME A;  3E3R A;  4IL1 A;  1CB1 A;  2MHH A;  5DKR A;  1PVB A;  1TWO A;  1OE9 B;  2CXJ A;  5I2L A;  2MBX A;  2JXC A;  3PLF B;  1Z2C B;  1OMR A;  2WC5 A;  4PHM A;  3SS4 A;  1GGW A;  2ZRS A;  1JFK A;  1B47 A;  4YGC B;  1M46 A;  2ERB A;  2LVV A;  3L47 A;  4CID A;  1AK8 A;  2LNK A;  2LVI A;  4ICB A;  1HQV A;  3B88 A;  1XFW O;  2BCA A;  2ISD A;  1IGV A;  1ORG A;  2K60 A;  4GGN A;  1XO5 A;  2BCX A;  5CSN A;  2BL0 B;  3SG4 A;  2K8M B;  3WXA A;  2M3W A;  2LHI A;  5I94 A;  1KK7 Z;  4PDZ A;  1D1O A;  2KPH A;  1BJF A;  3EKJ A;  2F33 A;  2K2F A;  4ZCV A;  3B6X A;  1H8B A;  2LVJ A;  2LMT A;  3TS5 B;  1MQ1 A;  1TTX A;  2E6W A;  2HQW A;  3D74 A;  1LA0 A;  1YUT A;  1ALW A;  4JQ0 D;  1S6C A;  1K9P A;  5DKN A;  1GQM A;  1WDC B;  4QJ5 B;  1YVL A;  1EH2 A;  2BBN A;  1NX2 A;  2M29 A;  2I18 A;  1FW4 A;  1S36 A;  4YGA A;  1DF0 A;  2JZI A;  3CZ1 A;  1BG1 A;  3D76 A;  1BU3 A;  4OR9 B;  2CCM A;  1FI6 A;  3BYA A;  3IF7 A;  1OOF A;  4OVN F;  4AQJ A;  2K61 A;  1J7R A;  2KSP A;  1LVC D;  2H2K A;  2JUL A;  2MJW B;  1B8C A;  1IH0 A;  2Q91 A;  2Y4Q A;  3R1P A;  2F8P A;  1WRL A;  3D0Y A;  3LCP C;  1DGU A;  1QJT A;  4KYN A;  2M8U A;  5AAN A;  3SS5 A;  3TUY B;  3OB1 B;  3NSI A;  3CLN A;  3PM8 A;  5AER A;  3CR5 X;  3VGO A;  1DJG A;  1SW8 A;  2WND A;  1KQV A;  1K90 D;  4BY4 A;  1QV0 A;  1DEK A;  3NSL A;  3ZWH A;  2MLF C;  1EG3 A;  1QXP A;  2JT8 A;  4ORB B;  3WHT B;  1F4Q A;  1OOI X;  1YX7 A;  2WOR A;  4HRE E;  1IJ5 A;  1Z4H A;  2KLE A;  4Q04 A;  3AKA A;  1PSB A;  3RM1 A;  1N2D A;  2BL0 C;  4NDD A;  1DC1 A;  1NP8 A;  3I5F B;  3JVT B;  2M7L A;  2FCE A;  2JWW A;  1A2X A;  3OX6 A;  4ETO A;  1KSM A;  1PAL A;  2EGD A;  1KSO A;  1TNW A;  4HSZ A;  5IBW A;  3D78 A;  1OZS A;  1V1F A;  2Y1N A;  3BFA A;  3D73 A;  2WC6 A;  4USL A;  3VRQ A;  2KNE A;  3A8R A;  2DOQ A;  1QVI Y;  3EK7 A;  5G08 A;  4MN0 A;  4MSP A;  3CZT X;  1SPY A;  4DIR A;  4A4C A;  3OGN A;  5CSJ A;  4PCW A;  5AXI A;  1TRF A;  2CNP A;  3M0W A;  2QEH A;  1KCY A;  2KQ6 A;  4E68 A;  1NUB A;  3NSO A;  2QDI A;  4NDC A;  3CWG A;  1DF0 B;  5D3O A;  3OBV A;  1QIV A;  1IQ3 A;  1S26 D;  4WQ3 A;  4M2O A;  4WRI A;  1DQE A;  1QAS A;  5FI6 A;  5JJG A;  1QX7 A;  1FBV A;  4ORA B;  1AJ4 A;  1NPQ A;  1CTR A;  5KSZ A;  5FI2 A;  1NCY A;  1SMG A;  2KFG A;  2KLD A;  3S0B A;  4MEW A;  3R1V A;  1N0Y A;  4JD9 A;  4A4B A;  1YUS A;  2RGI A;  2O60 A;  3PM2 A;  4BY5 A;  1OOG A;  5DIC A;  3SG6 A;  3TUY C;  3DZT A;  1KFX S;  2M1U A;  1FF1 A;  2TN4 A;  1NX1 A;  3BOW B;  1L2O B;  1IWQ A;  1QIW A;  2L5Y A;  4HRH A;  4MBE A;  4PE7 A;  4C0K A;  1RFJ A;  1YX8 A;  2KGB C;  1SBJ A;  4OKH A;  2WCB A;  2I94 A;  2OS8 C;  2L0P A;  1MUX A;  3K1E A;  2Q4U A;  2PVB A;  3PAL A;  1QWV A;  1K95 A;  1RK9 A;  1YTZ C;  4GFT A;  4YBH B;  5FI7 A;  1WY9 A;  3JVT C;  2FJU B;  2ZN9 A;  2QEO A;  3SG2 A;  2LMU A;  1UHI A;  3AAJ A;  2KI6 C;  1CNP A;  3CZ2 A;  2K7B A;  4PHN A;  4PHJ A;  2KQY A;  3C1V A;  1ALV A;  1XFX O;  2QAC A;  3PN7 B;  1EG4 A;  1JF2 A;  1JBA A;  3TDU A;  2KOT A;  2HF5 A;  3DXL A;  1B1G A;  1CFP A;  2LAN A;  3OB2 B;  4M2Q A;  4QJ3 B;  1OOJ A;  3LK1 A;  3NHT A;  1G4Y R;  2KI4 C;  4WQ2 A;  1PK0 D;  1YVH A;  2ZNE A;  1B7T Z;  2G2B A;  5I8N A;  1R6P A;  2LUC A;  4PAL A;  2K7O A;  1SNL A;  1F70 A;  4L9M A;  2PRU A;  3B87 A;  3EVU A;  3V2L A;  2Y5I A;  3EVV A;  2KBI A;  1K96 A;  1LA3 A;  1XVJ A;  1NCZ A;  1ODB A;  3PSR A;  2ZRT A;  2L2E A;  1LXF C;  3BUN B;  1J1E A;  2F2P A;  1S5G Y;  1CDL A;  3IVT A;  4NQG A;  5D69 A;  1K8U A;  1IJ6 A;  5F6T A;  3PJI A;  1LIN A;  1C3Z A;  1NSH A;  1A03 A;  1L2O C;  1LS8 A;  4CPV A;  2COL B;  3EKH A;  2KDH A;  5HKZ A;  1IKU A;  2MLE C;  1CM4 A;  2AAO A;  2WOS A;  3EVR A;  1Y0V H;  1DJH A;  1NYA A;  1M31 A;  3PFV A;  2K7D A;  1OMV A;  4N1G A;  2LMV A;  2L4I A;  5ER4 X;  1CDM A;  2KAX A;  3DVJ A;  1UWO A;  2I7A A;  2CBL A;  4GPL B;  5AEQ A;  1J7P A;  1BLQ A;  3RZS A;  4P5O E;  3B7A A;  4CLN A;  2HQ8 A;  3BOW A;  2PMY A;  3WHU B;  5KTY A;  3PN7 C;  1A75 B;  4DRW A;  1B8R A;  1DJY A;  2IS9 A;  3FE6 A;  3O4X A;  5CPV A;  1C7V A;  4M2P A;  1CLB A;  1IIO A;  3VRP A;  3CR4 X;  4NDB A;  1BR4 B;  1K94 A;  2V53 A;  1GGZ A;  1QLK A;  1UP5 A;  2PSR A;  3D77 A;  1BOD A;  2A4J A;  2OS8 B;  1SL9 A;  3FE8 A;  3CZ0 A;  1QAT A;  2G9B A;  2JNF A;  2KBM A;  3O4Y A;  4JWQ A;  1CM1 A;  1TUJ A;  4F7F A;  1J7Q A;  4AOM A;  4FTG A;  1B4C A;  4PE0 A;  2KFH A;  1S3P A;  1CMF A;  2GGM A;  1KFU L;  4XJK A;  3GK4 X;  1HT9 A;  1RRO A;  1QX5 B;  2L51 A;  3KO0 A;  3S0F A;  2F3Z A;  2OTG B;  3BJH A;  2GV5 A;  4GBA A;  5DKQ A;  3SS3 A;  1N65 A;  2ZFD A;  4I5J A;  5GQQ C;  1CFF A;  5HYD A;  1KK7 Y;  2KI4 B;  3CGA A;  2L50 A;  3DF0 A;  1DTL A;  2LE9 B;  1UUR A;  1W9Z A;  2PQL A;  3FE9 A;  1PUL A;  2LP3 A;  1E8A A;  4P2Y B;  2I2R E;  1AP4 A;  2H8V A;  2NZ0 A;  3BXK A;  5I2O A;  1MXL C;  1C07 A;  5I2Q A;  1JUO A;  1IRJ A;  2P6B B;  1UUS A;  1QX2 A;  1SK6 D;  3TDI A;  2MRD A;  2CTN A;  1XFV O;  1YUR A;  3H4S E;  1WRZ A;  1ZOT B;  2LLT A;  1XFY O;  3S0E A;  2E30 A;  3LL8 B;  1U5I B;  3A4U B;  3KF9 A;  1NIW A;  3L4A A;  1WLZ A;  1GM0 A;  2PAS A;  1JC2 A;  3CS1 A;  2JPT A;  3CYZ A;  3R72 A;  1TCO B;  3EK8 A;  5BPJ A;  1SRA A;  1DJI A;  1OSA A;  2QPT A;  3OP0 A;  1V1G A;  4QJ4 B;  5HLV A;  1QLS A;  1EL4 A;  2BKI B;  1BR1 B;  4INW A;  5HKY A;  3O6B A;  1PSR A;  3JTD B;  2M7N A;  4I5N B;  5EL2 A;  4F0Z B;  1NX3 A;  2M9G A;  1KWO C;  2LUX A;  1XYD A;  1PRW A;  1OQP A;  3BUW B;  3FS7 A;  1C3Y A;  4DCK A;  4D1E A;  2LLU A;  5HL1 A;  5KU1 A;  1F54 A;  2KHN A;  2JRF A;  2QEB A;  1X02 A;  1ZUZ A;  1MHO A;  2M0R A;  2AMI A;  1A75 A;  2PYQ A;  3SG7 A;  3SG3 A;  5CSI A;  3VB1 A;  2FOT A;  2JTZ A;  3FWC A;  3GK1 A;  1B8L A;  2B1U A;  4XJK B;  1Q80 A;  4CFQ A;  1J1D A;  2D8N A;  2L2C A;  2OTG C;  2L4H A;  1SY9 A;  3NGV A;  1SYM A;  1Y1U A;  3B86 A;  1W7I B;  1M63 B;  1VRK A;  4FQO A;  1ZAC A;  2F2O A;  1XFR A;  4MZL A;  1SL8 A;  1DJW A;  1W7J B;  1XK4 C;  2K2A A;  2LM5 A;  5TNC A;  1SKT A;  3SIB A;  3TDZ A;  2FJY A;  4GAO A;  2LP2 A;  3DF0 B;  1CLM A;  1G8I A;  3BUX B;  1NWD A;  2O5G A;  1F55 A;  1S1E A;  1TIZ A;  4GUK A;  3ZNI A;  3BUO B;  4MRY A;  4R1E A;  5HKW A;  3I5H B;  4FQT A;  2WCL A;  4N1F A;  1BMO A;  3HX4 A;  1SCM B;  3VRR A;  2KGR A;  1UHN A;  1UHK A;  1ZMZ A;  1J55 A;  2JQ6 A;  3I5G B;  1WRK A;  4MLW A;  2AUC A;  1KQM B;  2H61 C;  2K7C A;  4OZD A;  3TZ1 A;  1TOP A;  4DS7 A;  4ZCU A;  1XK4 A;  1AUI B;  1C7W A;  1K9U A;  3CDN A;  1S6J A;  1QVI Z;  4HRG A;  4PE1 A;  1AVS A;  3OX5 A;  3SJS A;  1TCF A;  2WCK A;  1YR5 A;  4MZK A;  4MZJ A;  3DVE A;  1OZO A;  2LCP A;  1S6I A;  3FIA A;  1KK8 B;  3JTD C;  3VRN A;  1OOH A;  5AFP A;  3D10 A;  1JWD A;  2GTE A;  1CKK A;  2WC8 A;  2Y1M A;  1QV1 A;  1IG5 A;  1F8H A;  3PAT A;  3BFB A;  1XA5 A;  4XYN A;  1SR6 C;  4C0J A;  3CR2 A;  1U5I A;  1DGV A;  2NLN A;  1XFZ O;  2H61 A;  1SCV A;  2GGZ A;  2M1K B;  1BT6 A;  1UHJ A;  1YRU B;  3DY9 A;  2SAS A;  3EK4 A;  4MRX A;  1AHR A;  2FCD A;  2YGU A;  2JXL A;  2P71 A;  4I5K A;  4PE4 A;  3S0G A;  3EG5 B;  5HLO A;  1BOC A;  2MAZ A;  3O2P A;  3F45 A;  1XFU O;  2EC6 B;  2BE4 A;  2KI6 D;  2JC2 A;  2VRG A;  1KWO B;  3GK2 A;  4MVF A;  2WCH A;  1YRT B;  1SL7 A;  5K89 A;  1DVI A;  4TNC A;  2BE6 A;  1P28 A;  5ER5 A;  2WCM A;  5B8I B;  2LVK A;  2M49 B;  3L4L A;  1R2U A;  2JTT A;  2NCO A;  1CDN A;  1B9A A;  3O78 A;  1MXE A;  4YRU A;  1NX0 A;  1WLM A;  2F3Y A;  3S0D A;  3I5I B;  1JFJ A;  2BBM A;  2NCP A;  3MSE B;  2KYC A;  4UPG A;  4PT1 A;  2JT0 A;  3I5H C;  3LK0 A;  3RLZ A;  3SIA A;  1JF0 A;  1MWN A;  1MF8 B;  1QS7 A;  1SCM C;  3CTN A;  1KFX L;  2HET A;  1BF5 A;  2PAL A;  1RJV A;  2M97 A;  3UNW A;  3I5G C;  3LLE A;  2EHB A;  1KQM C;  4GNK B;  1B7T Y;  2WCJ A;  1J7O A;  2BEC A;  2ZN8 A;  1FPW A;  4JPZ B;  4U8D A;  1CLL A;  5CSF A;  2WCF A;  4I5L B;  4YI8 A;  1NCX A;  1KK8 C;  1M39 A;  5D7F A;  1A29 A;  2CT9 A;  2KAY A;  1TUZ A;  1A4P A;  1ZFS A;  3OHM B;  3DVK A;  4ORC B;  3NSK A;  4JKT A;  4N5X A;  3FWB A;  5PAL A;  3TS5 C;  2LHL A;  1F71 A;  1G33 A;  2K0J A;  2SCP A;  1DEL A;  3KEV A;  3SG5 A;  2LC5 A;  1SSE B;  4IJ7 A;  3IQQ A;  1WDC C; 
#chains in the Genus database with same CATH homology
 5FYX A;  1TNP A;  3BUM B;  2R2I A;  1CFD A;  1S5G Z;  2EC6 C;  1AJ5 A;  2L98 A;  2JOJ A;  3KPX A;  2HPS A;  2L5X B;  4AQI A;  1EJ3 A;  4OV2 A;  2JNX A;  1QTX A;  1Y1A A;  1K2H A;  4YGD B;  3AAK A;  4GGF C;  1DJZ A;  1SR6 B;  2NXQ A;  5J3X A;  1MR8 A;  4CFR A;  2KAV A;  1CDP A;  1KFU S;  1DT7 B;  2BCB A;  3D0Y B;  3I5I C;  4YI9 A;  3NXA A;  1FI5 A;  3DD4 A;  1PVA A;  3AKB A;  1CFC A;  1K9K A;  1REC A;  1H4B A;  2BKH B;  1M45 A;  3QRX A;  4YGE B;  1TN4 A;  1UHH A;  2KYF A;  2ZKM X;  3IQO A;  1DMO A;  1RTP 1;  1RWY A;  4OCI A;  2LV7 A;  3BQ3 A;  2JU0 A;  2ZND A;  4GGF A;  4YGB B;  2JT3 A;  3WNX B;  1DJX A;  2MA2 A;  1GJY A;  1YUU A;  5JOL A;  3GOF A;  2LLS A;  1K93 D;  3HCM A;  4PHK A;  1TNQ A;  1CMG A;  1IQ5 A;  2LAP A;  1TNX A;  3K21 A;  3I5F C;  3ICB A;  1LKJ A;  1JSA A;  3VRO A;  1OMD A;  3KHE A;  1L7Z A;  1F4O A;  4DUQ A;  1Y1X A;  1Y6W A;  2WCE A;  2KFF A;  1EXR A;  2OPO A;  3DVM A;  3E3R A;  4IL1 A;  1CB1 A;  2MHH A;  5DKR A;  1PVB A;  2CXJ A;  1OE9 B;  5I2L A;  2MBX A;  4C0L A;  2JXC A;  3PLF B;  1OMR A;  4PHM A;  1GGW A;  2ZRS A;  1JFK A;  1B47 A;  4YGC B;  1M46 A;  2LVV A;  4CID A;  1AK8 A;  2LNK A;  2LVI A;  4ICB A;  1HQV A;  1XFW O;  2BCA A;  2ISD A;  1IGV A;  4GGN A;  5CSN A;  1XO5 A;  2BCX A;  3SG4 A;  2BL0 B;  2K8M B;  3WXA A;  2M3W A;  2LHI A;  1KK7 Z;  4PDZ A;  1D1O A;  1BJF A;  3EKJ A;  2F33 A;  2K2F A;  4ZCV A;  1H8B A;  2LVJ A;  2LMT A;  3TS5 B;  1MQ1 A;  1TTX A;  2E6W A;  2HQW A;  1LA0 A;  1YUT A;  1ALW A;  4JQ0 D;  1S6C A;  1K9P A;  5DKN A;  1GQM A;  1WDC B;  4QJ5 B;  1YVL A;  1EH2 A;  2BBN A;  1NX2 A;  2M29 A;  2I18 A;  1FW4 A;  1S36 A;  4YGA A;  1DF0 A;  2JZI A;  1BG1 A;  1BU3 A;  4OR9 B;  2CCM A;  1FI6 A;  3BYA A;  3IF7 A;  4OVN F;  4AQJ A;  2K61 A;  1J7R A;  2KSP A;  1LVC D;  2H2K A;  2JUL A;  2MJW B;  1B8C A;  1IH0 A;  2Q91 A;  2Y4Q A;  2F8P A;  1WRL A;  3D0Y A;  3LCP C;  1DGU A;  1QJT A;  2M8U A;  5AAN A;  3TUY B;  3OB1 B;  3NSI A;  3CLN A;  3PM8 A;  5AER A;  3CR5 X;  3VGO A;  1DJG A;  1SW8 A;  2WND A;  1KQV A;  1K90 D;  4BY4 A;  1QV0 A;  3NSL A;  3ZWH A;  2MLF C;  1EG3 A;  1QXP A;  2JT8 A;  4ORB B;  3WHT B;  1F4Q A;  1YX7 A;  2WOR A;  4HRE E;  1IJ5 A;  4Q04 A;  3AKA A;  1PSB A;  3RM1 A;  1N2D A;  2BL0 C;  4NDD A;  1NP8 A;  3I5F B;  3JVT B;  2M7L A;  2FCE A;  2JWW A;  1A2X A;  3OX6 A;  4ETO A;  1KSM A;  1PAL A;  2EGD A;  1KSO A;  1TNW A;  4HSZ A;  5IBW A;  1OZS A;  1V1F A;  2Y1N A;  4USL A;  3VRQ A;  2KNE A;  3A8R A;  2DOQ A;  1QVI Y;  3EK7 A;  5G08 A;  4MN0 A;  4MSP A;  3CZT X;  1SPY A;  4DIR A;  4A4C A;  5CSJ A;  4PCW A;  5AXI A;  1TRF A;  2CNP A;  3M0W A;  1KCY A;  2KQ6 A;  4E68 A;  1NUB A;  3NSO A;  4NDC A;  3CWG A;  1DF0 B;  1IQ3 A;  1QIV A;  1S26 D;  4WQ3 A;  4M2O A;  4WRI A;  1QAS A;  5JJG A;  1QX7 A;  1FBV A;  4ORA B;  1AJ4 A;  1NPQ A;  1CTR A;  5KSZ A;  1NCY A;  1SMG A;  2KFG A;  4MEW A;  1N0Y A;  4A4B A;  1YUS A;  2RGI A;  2O60 A;  4BY5 A;  3SG6 A;  3TUY C;  1KFX S;  2M1U A;  1FF1 A;  2TN4 A;  1NX1 A;  3BOW B;  1L2O B;  1IWQ A;  1QIW A;  4HRH A;  4MBE A;  4PE7 A;  4C0K A;  1RFJ A;  1YX8 A;  2KGB C;  1SBJ A;  4OKH A;  2WCB A;  2I94 A;  2OS8 C;  2L0P A;  1MUX A;  2Q4U A;  2PVB A;  3PAL A;  1K95 A;  1RK9 A;  1YTZ C;  4GFT A;  4YBH B;  1WY9 A;  3JVT C;  2FJU B;  2ZN9 A;  3SG2 A;  2LMU A;  1UHI A;  3AAJ A;  2KI6 C;  1CNP A;  2K7B A;  4PHN A;  4PHJ A;  2KQY A;  3C1V A;  1ALV A;  1XFX O;  2QAC A;  3PN7 B;  1EG4 A;  1JF2 A;  1JBA A;  3TDU A;  2KOT A;  2HF5 A;  1CFP A;  1B1G A;  2LAN A;  3OB2 B;  4M2Q A;  4QJ3 B;  1OOJ A;  3LK1 A;  1G4Y R;  2KI4 C;  4WQ2 A;  1PK0 D;  1YVH A;  2ZNE A;  1B7T Z;  2G2B A;  5I8N A;  1R6P A;  2LUC A;  4PAL A;  2K7O A;  1SNL A;  1F70 A;  4L9M A;  2PRU A;  3EVU A;  2Y5I A;  3EVV A;  2KBI A;  1K96 A;  1LA3 A;  1XVJ A;  1NCZ A;  1ODB A;  3PSR A;  2ZRT A;  2L2E A;  1LXF C;  3BUN B;  1J1E A;  2F2P A;  1S5G Y;  1CDL A;  4NQG A;  5D69 A;  1K8U A;  1IJ6 A;  5F6T A;  1LIN A;  1NSH A;  1A03 A;  1L2O C;  4CPV A;  2COL B;  3EKH A;  2KDH A;  5HKZ A;  1IKU A;  2MLE C;  1CM4 A;  2AAO A;  2WOS A;  3EVR A;  1Y0V H;  1DJH A;  1NYA A;  1M31 A;  3PFV A;  2K7D A;  1OMV A;  4N1G A;  2LMV A;  2L4I A;  5ER4 X;  1CDM A;  2KAX A;  3DVJ A;  1UWO A;  2I7A A;  2CBL A;  4GPL B;  5AEQ A;  1J7P A;  1BLQ A;  4P5O E;  4CLN A;  2HQ8 A;  3BOW A;  2PMY A;  3WHU B;  5KTY A;  3PN7 C;  1A75 B;  4DRW A;  1B8R A;  1DJY A;  2IS9 A;  1C7V A;  5CPV A;  1CLB A;  4M2P A;  3VRP A;  3CR4 X;  4NDB A;  1BR4 B;  1K94 A;  2V53 A;  1GGZ A;  1QLK A;  1UP5 A;  2PSR A;  1BOD A;  2A4J A;  2OS8 B;  1SL9 A;  1QAT A;  2G9B A;  2JNF A;  2KBM A;  3O4Y A;  4JWQ A;  1CM1 A;  1J7Q A;  4AOM A;  4FTG A;  1B4C A;  4PE0 A;  2KFH A;  1S3P A;  1CMF A;  2GGM A;  1KFU L;  4XJK A;  3GK4 X;  1HT9 A;  1RRO A;  1QX5 B;  2L51 A;  3KO0 A;  2F3Z A;  2OTG B;  2GV5 A;  4GBA A;  5DKQ A;  1N65 A;  2ZFD A;  4I5J A;  5GQQ C;  1CFF A;  5HYD A;  1KK7 Y;  2KI4 B;  3CGA A;  2L50 A;  3DF0 A;  1DTL A;  2LE9 B;  1UUR A;  1PUL A;  2LP3 A;  1E8A A;  4P2Y B;  2I2R E;  1AP4 A;  2NZ0 A;  3BXK A;  5I2O A;  1MXL C;  1C07 A;  5I2Q A;  1JUO A;  1IRJ A;  2P6B B;  1UUS A;  1QX2 A;  1SK6 D;  3TDI A;  2MRD A;  2CTN A;  1XFV O;  1YUR A;  3H4S E;  1WRZ A;  1ZOT B;  2LLT A;  1XFY O;  2E30 A;  3LL8 B;  1U5I B;  3A4U B;  3KF9 A;  1NIW A;  1WLZ A;  2PAS A;  1JC2 A;  3CS1 A;  2JPT A;  1TCO B;  3EK8 A;  5BPJ A;  1SRA A;  1DJI A;  1OSA A;  2QPT A;  3OP0 A;  1V1G A;  4QJ4 B;  5HLV A;  1QLS A;  1EL4 A;  2BKI B;  1BR1 B;  5HKY A;  3O6B A;  1PSR A;  3JTD B;  2M7N A;  4I5N B;  4F0Z B;  1NX3 A;  2M9G A;  1KWO C;  2LUX A;  1XYD A;  1PRW A;  1OQP A;  3BUW B;  3FS7 A;  4DCK A;  4D1E A;  2LLU A;  5KU1 A;  1F54 A;  2KHN A;  2JRF A;  1X02 A;  1ZUZ A;  1MHO A;  2M0R A;  2AMI A;  1A75 A;  3SG7 A;  3SG3 A;  5CSI A;  2FOT A;  2JTZ A;  3FWC A;  3GK1 A;  1B8L A;  2B1U A;  4XJK B;  1Q80 A;  4CFQ A;  1J1D A;  2D8N A;  2OTG C;  2L4H A;  1SY9 A;  1SYM A;  1Y1U A;  1W7I B;  1M63 B;  1VRK A;  4FQO A;  1ZAC A;  2F2O A;  4MZL A;  3SIB A;  1SL8 A;  1DJW A;  1W7J B;  1XK4 C;  2K2A A;  2LM5 A;  5TNC A;  1SKT A;  3TDZ A;  4GAO A;  2LP2 A;  3DF0 B;  1CLM A;  1G8I A;  3BUX B;  1NWD A;  2O5G A;  1F55 A;  1S1E A;  1TIZ A;  4GUK A;  3ZNI A;  3BUO B;  4MRY A;  4R1E A;  5HKW A;  3I5H B;  4N1F A;  1BMO A;  3HX4 A;  1SCM B;  3VRR A;  2KGR A;  1UHN A;  1UHK A;  1ZMZ A;  1J55 A;  2JQ6 A;  3I5G B;  1WRK A;  4MLW A;  2AUC A;  1KQM B;  2H61 C;  2K7C A;  3TZ1 A;  4DS7 A;  1TOP A;  4ZCU A;  1XK4 A;  1AUI B;  1C7W A;  1K9U A;  3SJS A;  1S6J A;  1QVI Z;  4HRG A;  4PE1 A;  1AVS A;  3OX5 A;  1TCF A;  1YR5 A;  4MZK A;  4MZJ A;  3DVE A;  1OZO A;  2LCP A;  1S6I A;  3FIA A;  1KK8 B;  3JTD C;  3VRN A;  5AFP A;  3D10 A;  1JWD A;  1CKK A;  2WC8 A;  2Y1M A;  1QV1 A;  1IG5 A;  1F8H A;  3PAT A;  1XA5 A;  4XYN A;  1SR6 C;  4C0J A;  3CR2 A;  1U5I A;  1DGV A;  2NLN A;  1XFZ O;  2H61 A;  1SCV A;  2GGZ A;  2M1K B;  1BT6 A;  1UHJ A;  1YRU B;  2SAS A;  3EK4 A;  4MRX A;  1AHR A;  2FCD A;  2JXL A;  4I5K A;  4PE4 A;  5HLO A;  1BOC A;  2MAZ A;  3O2P A;  3F45 A;  1XFU O;  2EC6 B;  2BE4 A;  2KI6 D;  2JC2 A;  2VRG A;  1KWO B;  3GK2 A;  4MVF A;  1YRT B;  1SL7 A;  5K89 A;  1DVI A;  4TNC A;  2BE6 A;  5ER5 A;  5B8I B;  2LVK A;  2M49 B;  1R2U A;  2JTT A;  2NCO A;  1CDN A;  1B9A A;  3O78 A;  1MXE A;  4YRU A;  1NX0 A;  1WLM A;  2F3Y A;  1JFJ A;  3I5I B;  2BBM A;  2NCP A;  3MSE B;  2KYC A;  4UPG A;  2JT0 A;  3I5H C;  3LK0 A;  3RLZ A;  3SIA A;  1JF0 A;  1MWN A;  1MF8 B;  1QS7 A;  1SCM C;  3CTN A;  1KFX L;  2HET A;  1BF5 A;  2PAL A;  1RJV A;  2M97 A;  3I5G C;  3LLE A;  2EHB A;  1KQM C;  4GNK B;  1B7T Y;  1J7O A;  2BEC A;  2ZN8 A;  1FPW A;  4JPZ B;  4U8D A;  1CLL A;  5CSF A;  2WCF A;  4I5L B;  4YI8 A;  1NCX A;  1KK8 C;  1M39 A;  5D7F A;  1A29 A;  2CT9 A;  2KAY A;  1ZFS A;  1A4P A;  3OHM B;  3DVK A;  4ORC B;  3NSK A;  4N5X A;  3FWB A;  5PAL A;  3TS5 C;  2LHL A;  1F71 A;  1G33 A;  2K0J A;  2SCP A;  3SG5 A;  3KEV A;  2LC5 A;  3IQQ A;  1WDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...