1F54A

Solution structure of the apo n-terminal domain of yeast calmodulin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f54A00
1CFFA 2LNKA 4NDCA 1DT7B 2OTGB 4N5XA 4PDZA 1J7PA 1PVBA 1UHNA 2KBMA 1DJWA 2JT3A 1IWQA 4OVNF 2LHIA 3BYAA 3TDZA 2VRGA 2LM5A 1IG5A 2FCDA 3HX4A 1CLLA 4PALA 4PHMA 3PFVA 1BT6A 1J1EA 1YR5A 4I5JA 2AUCA 1OZOA 1SNLA 2BKIB 1ZOTB 1SPYA 1L2OC 1OMVA 3EK7A 1A75A 3GK1A 2KYCA 2M0RA 2M9GA 3WHUB 1NX2A 1QLKA 4P2YB 4HREE 1FI6A 1XK4C 2L98A 1J55A 2CNPA 1B7TZ 2PSRA 5J3XA 2JZIA 1EG3A 3O78A 3CWGA 1SMGA 1XYDA 5CSNA 1SY9A 3TUYB 1F71A 1YRTB 4GUKA 2ZN8A 2Y5IA 4I5LB 1UUSA 1M39A 1NP8A 1L7ZA 1RJVA 1CDMA 2LP3A 1QVIY 5B8IB 3IQOA 5AERA 2M97A 1CTRA 1SCMC 3I5IB 1B7TY 3KF9A 1PSRA 1A75B 4OCIA 2M8UA 1OOJA 1JF2A 3K21A 5AEQA 1B9AA 3NSIA 1EG4A 4GNKB 3OB2B 3CR4X 4PE7A 1ZMZA 3CTNA 2O5GA 2LHLA 1NIWA 1FBVA 1SL9A 1WDCB 1RROA 2LV7A 1KWOB 1IJ5A 3A8RA 2LLUA 2JWWA 1EL4A 3F45A 5CPVA 1AK8A 2KBIA 5I2QA 2KQ6A 2BBMA 1YX7A 1Y1XA 4YI9A 2BCAA 3O6BA 2K7DA 4QJ4B 1DJGA 2F8PA 2H2KA 4CLNA 1U5IA 4XJKA 4JWQA 2JNFA 5HKZA 2A4JA 1NX3A 1F8HA 2KHNA 1ALVA 4MLWA 2LVIA 1QTXA 1YUSA 1GGZA 3HCMA 3GK2A 1UHJA 2MA2A 1NWDA 1YTZC 2MRDA 1F4QA 1K93D 4YGDB 4CIDA 1CFPA 1D1OA 2LP2A 3BQ3A 2JXLA 3TS5C 1A03A 2HF5A 2JT0A 1KQVA 2EHBA 1PSBA 3DVMA 2CCMA 1TOPA 1QV1A 1BU3A 1YRUB 1J1DA 1U5IB 2OS8B 4XJKB 2KI4B 1B8LA 1IJ6A 1IQ5A 2ZN9A 1KQMC 2L0PA 3VGOA 1KFUS 4PHNA 2BL0B 2B1UA 3EVRA 1OE9B 2ZNDA 2F3ZA 1LA0A 2L50A 2MHHA 1B8RA 2EGDA 1XFXO 1KSMA 1CDLA 1UWOA 1W7JB 4XYNA 2I94A 4UPGA 4HRHA 1TNWA 3KPXA 4N1FA 4DS7A 1EJ3A 4PE0A 3JVTB 2JTTA 5HLOA 1TNQA 4L9MA 3CR5X 3AAJA 2M7LA 3VRQA 1EH2A 1F54A 1QS7A 1TN4A 4FQOA 2L51A 3BUMB 4YGCB 4ORAB 1CMGA 1SL8A 1N65A 1XFZO 2CTNA 2KGRA 1KK7Z 1K2HA 1KK8C 4MVFA 2K7OA 3CZTX 3I5HC 3LCPC 2BCXA 2LLTA 3FIAA 5ER4X 1G33A 3IF7A 3NSKA 1BOCA 4DCKA 1N2DA 2OTGC 3A4UB 1AHRA 1DGUA 3D0YA 2LUXA 4ZCVA 1V1GA 4MRYA 4AOMA 2F2OA 1HT9A 2JULA 3TDUA 1PRWA 1K9UA 1KSOA 2LCPA 2BCBA 3OHMB 1AVSA 4MZLA 2EC6B 2FOTA 1S1EA 1IGVA 1HQVA 1KK7Y 2K2FA 4ORCB 2KOTA 3BUOB 3OX6A 5AFPA 1S6CA 2GGZA 3KO0A 1SKTA 3FWCA 1QV0A 2KNEA 3EK8A 3JTDB 4GPLB 4MEWA 1TNPA 2TN4A 4M2QA 1LVCD 1ALWA 1QVIZ 2LC5A 2LVVA 2SASA 3D10A 4MRXA 1CB1A 2K7CA 5HLVA 3D0YB 4A4BA 1YUTA 1RWYA 1YURA 1DJXA 1F4OA 1YUUA 1XK4A 2WOSA 3TUYC 2KFFA 1MF8B 4R1EA 5AXIA 1KFXS 2NCOA 3KHEA 3DVEA 3TZ1A 2PMYA 1AJ5A 1TIZA 2M3WA 2PASA 4MZJA 4OR9B 1M45A 4I5KA 3SG7A 1WLZA 2K7BA 4WQ2A 3I5IC 1S3PA 1KFUL 1RECA 5KU1A 2JNXA 2NZ0A 2L4HA 3SG4A 1S5GY 4GBAA 1CKKA 2KI6C 2H61A 1QIWA 5GQQC 1R6PA 1A29A 1Y1AA 2WCBA 1FPWA 4E68A 3FWBA 4YBHB 1Y0VH 1XVJA 4MSPA 1CLMA 3I5GB 1KWOC 2OPOA 1MXEA 3SG6A 1S36A 3OP0A 1C7VA 1TCOB 4BY5A 1DVIA 1K90D 1CMFA 4C0KA 1K9KA 3DVJA 1NSHA 2P6BB 4CFQA 1M63B 1QASA 3DVKA 4I5NB 1XA5A 2KI6D 1DGVA 4GFTA 1JC2A 2V53A 1CFCA 2HPSA 4YGEB 1B4CA 3ICBA 1IRJA 3BUNB 1JFKA 3QRXA 4YGBB 4GGFC 3OB1B 1J7OA 3RLZA 1TRFA 2ZRTA 2I18A 2O60A 2MBXA 2AMIA 1CDPA 1GGWA 4C0JA 4JPZB 1YX8A 3EKHA 2K8MB 2OS8C 2CT9A 1SYMA 1UHKA 5ER5A 2JQ6A 5KSZA 1QJTA 1XFYO 2K2AA 3SIAA 2KDHA 1IQ3A 3PM8A 1J7QA 2KGBC 2BL0C 1WY9A 1SR6B 1WLMA 1CFDA 2WCEA 1UP5A 1X02A 1N0YA 3NXAA 2JC2A 4N1GA 3VRNA 2MLEC 1Q80A 3TDIA 1DMOA 1QATA 2QPTA 1KFXL 2M49B 1DJHA 2I7AA 1SW8A 2KYFA 1K96A 3EVUA 1MXLC 2CXJA 3JVTC 1ZFSA 1QIVA 2Y1MA 1Y1UA 1QX7A 3PALA 4WQ3A 2SCPA 3EKJA 1RK9A 1K94A 4QJ5B 4A4CA 1QX5B 1MHOA 3PLFB 2ZKMX 1UHIA 1QX2A 4M2OA 1PVAA 2GV5A 4ZCUA 3LK1A 2KAVA 4OV2A 5FYXA 2L4IA 2JXCA 1F70A 3BUXB 2M1KB 1DF0A 3SIBA 3PN7B 1SCVA 2MAZA 2K0JA 1ODBA 4ICBA 4PE1A 4U8DA 2EC6C 1WRLA 3I5FB 2D8NA 1DTLA 1B1GA 1S26D 1V1FA 1BJFA 1CNPA 1RTP1 4MN0A 2PRUA 2JPTA 2LLSA 5HYDA 4NDBA 2L5XB 5D7FA 4F0ZB 2I2RE 2ZNEA 2FJUB 4NDDA 1PALA 3RM1A 2MLFC 1CDNA 1PULA 1GJYA 1JF0A 3VRRA 2KFGA 1GQMA 5TNCA 1SK6D 1DF0B 5K89A 1S5GZ 3DD4A 3FS7A 4CPVA 1NCXA 3ZWHA 1ZACA 1IKUA 2NXQA 2E30A 1BLQA 3O4YA 1NPQA 5I2OA 1J7RA 5CSJA 2WCFA 5G08A 4PHJA 2LMUA 2WORA 2JT8A 4ETOA 4USLA 1TCFA 1XFVO 1SL7A 3IQQA 2PALA 4FTGA 4YI8A 1FI5A 5DKNA 1A4PA 1LA3A 1FF1A 2Y4QA 1XFUO 1E8AA 2BKHB 1B47A 1L2OB 2AAOA 2MJWB 3NSOA 2CBLA 5HKYA 2JOJA 4MBEA 1BMOA 5I2LA 4C0LA 4PCWA 2ZFDA 5IBWA 1JBAA 2GGMA 2LANA 3VROA 3CLNA 1JSAA 1YVLA 1EXRA 2JTZA 2G2BA 3I5GC 3WXAA 1PK0D 1WDCC 1B8CA 1DJIA 2COLB 2WC8A 1MWNA 4HRGA 1BR1B 1SBJA 1XFWO 3NSLA 1F55A 1SRAA 4TNCA 1LKJA 1QXPA 2E6WA 4P5OE 5JJGA 5AANA 2LMVA 4GGNA 4Q04A 1XO5A 1M46A 4NQGA 2H61C 1SCMB 2F3YA 2KFHA 2L2EA 1NX1A 2KAXA 1JWDA 1S6JA 5D69A 5CSFA 3EK4A 3CGAA 2Q4UA 2LVJA 3GOFA 2M1UA 3SJSA 1MR8A 2BBNA 1NYAA 2FCEA 3C1VA 2NCPA 1H8BA 2M29A 4AQJA 1AUIB 1CLBA 1AJ4A 1TTXA 1LXFC 1ZUZA 2BE4A 4GGFA 1DJYA 3WHTB 4ORBB 5HKWA 5BPJA 3BXKA 4IL1A 1NCZA 2LE9B 2JRFA 5DKRA 2HETA 1K95A 1A2XA 2KI4C 2RGIA 3AKBA 4YRUA 1OQPA 3CS1A 5DKQA 3CR2A 2K61A 3MSEB 1BG1A 2Q91A 1CM4A 2ISDA 1SR6C 1UHHA 4OKHA 2WNDA 1YVHA 2F2PA 3LLEA 2KQYA 5JOLA 1BODA 1VRKA 3WNXB 5F6TA 1BR4B 1G8IA 4AQIA 2KAYA 4PHKA 3ZNIA 2BECA 1C7WA 4D1EA 1S6IA 1BF5A 4PE4A 3LL8B 4QJ3B 3TS5B 2JU0A 1CM1A 1DJZA 1OMRA 2ZRSA 2Y1NA 1M31A 1OSAA 3E3RA 3H4SE 1G4YR 1MUXA 3PSRA 4M2PA 1NX0A 1JFJA 3M0WA 2LMTA 3EVVA 4DIRA 2HQWA 5PALA 2LAPA 4HSZA 1KQMB 2LUCA 5CSIA 4GAOA 1WRZA 3AKAA 4WRIA 4YGAA 3BOWA 1NCYA 2HQ8A 3O2PA 3DF0A 3AAKA 4DUQA 1FW4A 1R2UA 5I8NA 2DOQA 3SG2A 3SG5A 3VRPA 3OX5A 1TNXA 3PN7C 1JUOA 2M7NA 1W7IB 2PVBA 2F33A 3KEVA 4MZKA 3LK0A 1OMDA 4CFRA 1MQ1A 1K8UA 1RFJA 5KTYA 2KSPA 3BUWB 3I5FC 2NLNA 1WRKA 2R2IA 3GK4X 1IH0A 1QLSA 2G9BA 1C07A 1H4BA 1LINA 1KCYA 4JQ0D 3PATA 3BOWB 4DRWA 3SG3A 1NUBA 2QACA 1K9PA 3JTDC 4BY4A 3DF0B 1UURA 1OZSA 2BE6A 1AP4A 2LVKA 1KK8B 1Y6WA 3I5HB 2IS9A
chains in the Genus database with same CATH superfamily
3DXLA 1CFFA 2LNKA 4NDCA 1DT7B 2OTGB 4N5XA 4PDZA 1J7PA 1PVBA 1UHNA 2KBMA 2KLDA 1DJWA 2JT3A 1IWQA 4OVNF 2LHIA 3BYAA 3TDZA 2VRGA 2LM5A 1IG5A 1W9ZA 2FCDA 3HX4A 1CLLA 4PALA 4PHMA 3PFVA 1BT6A 1J1EA 1YR5A 4I5JA 2AUCA 1OZOA 1SNLA 2BKIB 1ZOTB 1SPYA 3O4XA 1L2OC 1OMVA 5FI7A 4F7FA 3EK7A 1A75A 2WCLA 5HL1A 3GK1A 2KYCA 2M0RA 2M9GA 3WHUB 1NX2A 1QLKA 4P2YB 4HREE 1FI6A 1XK4C 2L98A 1J55A 2CNPA 1B7TZ 2PSRA 5J3XA 2JZIA 1EG3A 3DZTA 3O78A 3CWGA 3D78A 1SMGA 5EL2A 1XYDA 4IJ7A 5CSNA 1SY9A 3TUYB 1F71A 1YRTB 4GUKA 2ZN8A 3UNWA 2Y5IA 4I5LB 1UUSA 1M39A 1NP8A 1L7ZA 1RJVA 1CDMA 2LP3A 1QVIY 5B8IB 3IQOA 3BFHA 5AERA 2M97A 1CTRA 1SCMC 3I5IB 1B7TY 3KF9A 1PSRA 1A75B 4OCIA 2M8UA 1OOJA 3S0GA 1JF2A 3K21A 5AEQA 1B9AA 3NSIA 1EG4A 4GNKB 3OB2B 3B86A 3CR4X 2H8VA 4PE7A 1ZMZA 3CTNA 2O5GA 2LHLA 1NIWA 1LS8A 1FBVA 1SL9A 1WDCB 1RROA 2LV7A 1KWOB 1IJ5A 3A8RA 2LLUA 2JWWA 1EL4A 3F45A 5CPVA 1AK8A 2KBIA 5FI2A 5I2QA 2KQ6A 2BBMA 1YX7A 1Y1XA 2WCHA 4YI9A 2BCAA 3O6BA 2K7DA 4QJ4B 1DJGA 2F8PA 2H2KA 4CLNA 1U5IA 4XJKA 4INXA 2JNFA 4JWQA 5HKZA 2A4JA 3CZ2A 1NX3A 1F8HA 2KHNA 1ALVA 4MLWA 2LVIA 4INWA 1DC1A 1QTXA 1YUSA 1GGZA 3HCMA 3GK2A 1UHJA 2MA2A 1NWDA 1YTZC 2MRDA 1F4QA 1K93D 4YGDB 4CIDA 1CFPA 1D1OA 2LP2A 1Z2CB 3BQ3A 2JXLA 3TS5C 1A03A 2HF5A 1OOFA 2JT0A 2EHBA 1PSBA 3DVMA 2CCMA 1TOPA 1KQVA 1QV1A 1BU3A 1YRUB 1J1DA 1U5IB 2OS8B 2BAPA 4XJKB 2KI4B 1B8LA 3OBVA 1IJ6A 1IQ5A 2ZN9A 1KQMC 2L0PA 3BFAA 3VGOA 1KFUS 3SS4A 4PHNA 2BL0B 2B1UA 2WC6A 3EVRA 1OE9B 1OOHA 2F3ZA 2ZNDA 1LA0A 2L50A 2MHHA 1B8RA 2EGDA 1XFXO 1KSMA 1CDLA 1UWOA 1W7JB 2PQLA 4XYNA 2I94A 4UPGA 2P70A 4HRHA 1TUJA 1TNWA 3KPXA 4N1FA 4DS7A 1EJ3A 4PE0A 3JVTB 2JTTA 5HLOA 1TNQA 4L9MA 3CR5X 3AAJA 2M7LA 3VRQA 1EH2A 1F54A 1QS7A 1TN4A 4FQOA 2L51A 3BUMB 4YGCB 2L2CA 4ORAB 1CMGA 1SL8A 1N65A 1XFZO 1T14A 2CTNA 2KGRA 1KK7Z 1K2HA 1KK8C 4MVFA 2K7OA 3V2LA 3CZTX 3I5HC 3D75A 3LCPC 2BCXA 2LLTA 3FIAA 2KPHA 1G33A 3IF7A 3NSKA 5ER4X 1BOCA 4DCKA 1N2DA 2OTGC 3A4UB 1AHRA 1DGUA 3D0YA 5I94A 2LUXA 4ZCVA 1V1GA 4MRYA 4AOMA 1DELA 2F2OA 1HT9A 2JULA 3TDUA 3D76A 1PRWA 1K9UA 1KSOA 2LCPA 2BCBA 3OHMB 1AVSA 4MZLA 2EC6B 2FOTA 1S1EA 1IGVA 1HQVA 1KK7Y 2K2FA 4KYNA 4ORCB 4OZDA 2KOTA 3BUOB 2YGUA 1TUZA 1ORGA 3OX6A 1S6CA 2GGZA 3D73A 3KO0A 5AFPA 1SKTA 3FWCA 1QV0A 2KNEA 3EK8A 3JTDB 4GPLB 4MEWA 1TNPA 2TN4A 3S0DA 4M2QA 1LVCD 1ALWA 1QVIZ 2LC5A 2LVVA 2SASA 3D10A 4MRXA 1CB1A 2K7CA 5HLVA 3D0YB 1P28A 2QDIA 4A4BA 1YUTA 1RWYA 1YURA 1DJXA 1F4OA 1YUUA 1XK4A 2P71A 2WOSA 3CYZA 3TUYC 3IVTA 1DQEA 1MF8B 2KFFA 3NGVA 4R1EA 5AXIA 1KFXS 2NCOA 3KHEA 3DVEA 3TZ1A 2PMYA 1AJ5A 1TIZA 2WCKA 2M3WA 2PASA 4MZJA 4OR9B 1M45A 4I5KA 3SG7A 1WLZA 2K7BA 4WQ2A 3I5IC 1S3PA 1KFUL 1RECA 3CDNA 2JNXA 3B87A 2NZ0A 4JD9A 5KU1A 2QEOA 2L4HA 3SG4A 1S5GY 4GBAA 1CKKA 2WCMA 2KI6C 2H61A 1QIWA 5GQQC 1R6PA 1A29A 1Y1AA 2WCBA 1FPWA 4E68A 3FWBA 4YBHB 1Y0VH 1XVJA 4MSPA 1CLMA 1OOGA 3I5GB 1KWOC 2OPOA 1MXEA 3SG6A 1C3YA 1S36A 5DICA 3OP0A 3NHIA 1C7VA 1TCOB 3VB1A 4BY5A 1DVIA 1K90D 1CMFA 4C0KA 1K9KA 3DVJA 1NSHA 2P6BB 1TWOA 4CFQA 1M63B 1QASA 3DVKA 1QWVA 4I5NB 1XA5A 2KI6D 1DGVA 4GFTA 1JC2A 2V53A 1CFCA 2HPSA 1Z4HA 2WCJA 4YGEB 1B4CA 1XFRA 3ICBA 1IRJA 3BUNB 1JFKA 3QRXA 4JKTA 4YGBB 4GGFC 3OB1B 1J7OA 3RLZA 1TRFA 2ZRTA 2I18A 2O60A 2MBXA 2AMIA 3OGNA 1CDPA 1GGWA 1DEKA 3K1EA 4C0JA 4JPZB 1YX8A 3EKHA 2K8MB 2OS8C 2CT9A 1SYMA 1UHKA 5ER5A 2JQ6A 5KSZA 1QJTA 1XFYO 2K2AA 3SIAA 2KDHA 1IQ3A 1SSEB 3PM8A 1J7QA 2KGBC 2BL0C 1WY9A 1SR6B 1WLMA 1CFDA 2WCEA 1UP5A 1X02A 1N0YA 3NXAA 2JC2A 4N1GA 2FJYA 3VRNA 2MLEC 1Q80A 2ERBA 3TDIA 1DMOA 1QATA 2QPTA 1KFXL 2M49B 1DJHA 2I7AA 3SS3A 1SW8A 2KYFA 1K96A 3EVUA 2K60A 1MXLC 2CXJA 3JVTC 1ZFSA 1QIVA 2Y1MA 1Y1UA 1QX7A 3PALA 4WQ3A 2SCPA 3EKJA 1RK9A 2QEVA 1K94A 4QJ5B 1GM0A 4A4CA 1QX5B 1MHOA 3PLFB 2ZKMX 3Q8IA 1UHIA 1QX2A 1C3ZA 4M2OA 1PVAA 2GV5A 4ZCUA 3LK1A 2KAVA 4OV2A 5FYXA 2L4IA 2JXCA 1F70A 3BUXB 2M1KB 1DF0A 3SIBA 3PN7B 1SCVA 2MAZA 2K0JA 1ODBA 4ICBA 2GTEA 4PE1A 2EC6C 4U8DA 1WRLA 3I5FB 2D8NA 1DTLA 1B1GA 1S26D 1V1FA 3PJIA 1BJFA 1CNPA 1RTP1 4MN0A 2PRUA 2JPTA 2LLSA 5HYDA 4NDBA 2L5XB 5D7FA 3UO9A 2QEBA 4F0ZB 2I2RE 2ZNEA 2FJUB 4NDDA 3RZSA 1PALA 3RM1A 2MLFC 1CDNA 1PULA 1JF0A 1GJYA 3VRRA 2KFGA 1GQMA 5TNCA 1SK6D 1DF0B 5K89A 1S5GZ 3DD4A 3FS7A 4CPVA 1NCXA 3ZWHA 1OOIX 1ZACA 1IKUA 2NXQA 2E30A 3L4AA 2WC5A 3O4YA 1BLQA 1NPQA 5I2OA 1J7RA 5CSJA 3S0AA 2WCFA 3QMEA 4PHJA 4PT1A 5G08A 2LMUA 2WORA 3D74A 2JT8A 4ETOA 4USLA 1TCFA 1XFVO 1SL7A 3IQQA 2PALA 3R1PA 4FTGA 4YI8A 1FI5A 5DKNA 1A4PA 1LA3A 1FF1A 2Y4QA 1XFUO 1E8AA 2BKHB 1B47A 1L2OB 2AAOA 2MJWB 3NSOA 2CBLA 5HKYA 2JOJA 4MBEA 1BMOA 5I2LA 4C0LA 4PCWA 2ZFDA 5IBWA 1JBAA 2GGMA 2LANA 3VROA 2BNXA 3CLNA 3CZ1A 1YVLA 1EXRA 2JTZA 2G2BA 3I5GC 3WXAA 1JSAA 1PK0D 1WDCC 1B8CA 3DY9A 1DJIA 2COLB 2WC8A 1MWNA 4HRGA 3BJHA 1BR1B 1SBJA 1XFWO 3EG5B 3NSLA 1F55A 1SRAA 4TNCA 1LKJA 1QXPA 2E6WA 4P5OE 5JJGA 5AANA 2PYQA 2LMVA 4GGNA 4Q04A 1XO5A 1M46A 4NQGA 5FI6A 2H61C 1SCMB 2F3YA 2KFHA 2L2EA 1NX1A 2KAXA 3FE8A 1JWDA 1S6JA 3L47A 5CSFA 5D69A 3EK4A 3CGAA 2Q4UA 2LVJA 3GOFA 2M1UA 3SJSA 1MR8A 2BBNA 1NYAA 2FCEA 3C1VA 2NCPA 3PM2A 2M29A 3L4LA 2L5YA 4AQJA 1H8BA 3SS5A 1AUIB 1CLBA 1AJ4A 1TTXA 3B6XA 1LXFC 1ZUZA 2BE4A 4GGFA 1DJYA 3WHTB 3B7AA 4ORBB 5HKWA 3S0BA 5BPJA 3BXKA 4IL1A 1NCZA 2LE9B 2JRFA 3DYEA 5DKRA 2HETA 1K95A 1A2XA 2KI4C 2QEHA 2RGIA 3AKBA 1OQPA 3BFBA 3CS1A 4YRUA 5DKQA 3CR2A 3S0FA 2K61A 3MSEB 1BG1A 2Q91A 1CM4A 2ISDA 3S0EA 1SR6C 1UHHA 4OKHA 4FQTA 2WNDA 1YVHA 2F2PA 3LLEA 2KLEA 2KQYA 5D3OA 5JOLA 1BODA 3D77A 1VRKA 3WNXB 5F6TA 1BR4B 1G8IA 4AQIA 2KAYA 3R1OA 4PHKA 3ZNIA 1IIOA 2BECA 1C7WA 4D1EA 1S6IA 2JPOA 3R1VA 4PE4A 3LL8B 4QJ3B 1BF5A 3TS5B 2JU0A 1CM1A 1DJZA 1OMRA 2ZRSA 2Y1NA 3FE6A 1M31A 1OSAA 3E3RA 3H4SE 1G4YR 1MUXA 3PSRA 3CZ0A 1NX0A 4M2PA 1JFJA 3M0WA 2LMTA 3EVVA 4DIRA 2HQWA 5PALA 2LAPA 4HSZA 1KQMB 2LUCA 5CSIA 4GAOA 1WRZA 3AKAA 4WRIA 4YGAA 3BOWA 1NCYA 2HQ8A 3B88A 3CABA 3O2PA 3DF0A 3AAKA 4DUQA 1FW4A 1R2UA 5I8NA 2DOQA 3SG2A 3SG5A 3VRPA 3OX5A 1TNXA 3N7HA 3PN7C 1JUOA 2M7NA 1W7IB 2PVBA 2F33A 3KEVA 4MZKA 3LK0A 1OMDA 4CFRA 1MQ1A 1K8UA 1RFJA 5KTYA 3R72A 2KSPA 3BUWB 3FE9A 2NLNA 3I5FC 3NHTA 1WRKA 2R2IA 3GK4X 1IH0A 1QLSA 2G9BA 1C07A 1H4BA 1LINA 1KCYA 4JQ0D 3PATA 3BOWB 4DRWA 3SG3A 1NUBA 2QACA 1K9PA 3JTDC 4BY4A 3DF0B 1UURA 1OZSA 2BE6A 1OW4A 1AP4A 2LVKA 1KK8B 1Y6WA 3I5HB 2IS9A
chains in the Genus database with same CATH topology
1CFFA 2LNKA 4NDCA 1DT7B 2OTGB 4N5XA 4PDZA 1J7PA 1PVBA 1UHNA 2KBMA 1DJWA 2JT3A 1IWQA 4OVNF 2LHIA 3BYAA 3TDZA 2VRGA 2LM5A 1IG5A 2FCDA 3HX4A 1CLLA 4PALA 4PHMA 3PFVA 1BT6A 1J1EA 1YR5A 4I5JA 2AUCA 1OZOA 1SNLA 2BKIB 1ZOTB 1SPYA 1L2OC 1OMVA 3EK7A 1A75A 3GK1A 2KYCA 2M0RA 2M9GA 3WHUB 1NX2A 1QLKA 4P2YB 4HREE 1FI6A 1XK4C 2L98A 1J55A 2CNPA 1B7TZ 2PSRA 5J3XA 2JZIA 1EG3A 3O78A 3CWGA 1SMGA 1XYDA 5CSNA 1SY9A 3TUYB 1F71A 1YRTB 4GUKA 2ZN8A 2Y5IA 4I5LB 1UUSA 1M39A 1NP8A 1L7ZA 1RJVA 1CDMA 2LP3A 1QVIY 5B8IB 3IQOA 5AERA 2M97A 1CTRA 1SCMC 3I5IB 1B7TY 3KF9A 1PSRA 1A75B 4OCIA 2M8UA 1OOJA 1JF2A 3K21A 5AEQA 1B9AA 3NSIA 1EG4A 4GNKB 3OB2B 3CR4X 4PE7A 1ZMZA 3CTNA 2O5GA 2LHLA 1NIWA 1FBVA 1SL9A 1WDCB 1RROA 2LV7A 1KWOB 1IJ5A 3A8RA 2LLUA 2JWWA 1EL4A 3F45A 5CPVA 1AK8A 2KBIA 5I2QA 2KQ6A 2BBMA 1YX7A 1Y1XA 4YI9A 2BCAA 3O6BA 2K7DA 4QJ4B 1DJGA 2F8PA 2H2KA 4CLNA 1U5IA 4XJKA 4JWQA 2JNFA 5HKZA 2A4JA 1NX3A 1F8HA 2KHNA 1ALVA 4MLWA 2LVIA 1QTXA 1YUSA 1GGZA 3HCMA 3GK2A 1UHJA 2MA2A 1NWDA 1YTZC 2MRDA 1F4QA 1K93D 4YGDB 4CIDA 1CFPA 1D1OA 2LP2A 3BQ3A 2JXLA 3TS5C 1A03A 2HF5A 2JT0A 1KQVA 2EHBA 1PSBA 3DVMA 2CCMA 1TOPA 1QV1A 1BU3A 1YRUB 1J1DA 1U5IB 2OS8B 4XJKB 2KI4B 1B8LA 1IJ6A 1IQ5A 2ZN9A 1KQMC 2L0PA 3VGOA 1KFUS 4PHNA 2BL0B 2B1UA 3EVRA 1OE9B 2ZNDA 2F3ZA 1LA0A 2L50A 2MHHA 1B8RA 2EGDA 1XFXO 1KSMA 1CDLA 1UWOA 1W7JB 4XYNA 2I94A 4UPGA 4HRHA 1TNWA 3KPXA 4N1FA 4DS7A 1EJ3A 4PE0A 3JVTB 2JTTA 5HLOA 1TNQA 4L9MA 3CR5X 3AAJA 2M7LA 3VRQA 1EH2A 1F54A 1QS7A 1TN4A 4FQOA 2L51A 3BUMB 4YGCB 4ORAB 1CMGA 1SL8A 1N65A 1XFZO 2CTNA 2KGRA 1KK7Z 1K2HA 1KK8C 4MVFA 2K7OA 3CZTX 3I5HC 3LCPC 2BCXA 2LLTA 3FIAA 5ER4X 1G33A 3IF7A 3NSKA 1BOCA 4DCKA 1N2DA 2OTGC 3A4UB 1AHRA 1DGUA 3D0YA 2LUXA 4ZCVA 1V1GA 4MRYA 4AOMA 2F2OA 1HT9A 2JULA 3TDUA 1PRWA 1K9UA 1KSOA 2LCPA 2BCBA 3OHMB 1AVSA 4MZLA 2EC6B 2FOTA 1S1EA 1IGVA 1HQVA 1KK7Y 2K2FA 4ORCB 2KOTA 3BUOB 3OX6A 5AFPA 1S6CA 2GGZA 3KO0A 1SKTA 3FWCA 1QV0A 2KNEA 3EK8A 3JTDB 4GPLB 4MEWA 1TNPA 2TN4A 4M2QA 1LVCD 1ALWA 1QVIZ 2LC5A 2LVVA 2SASA 3D10A 4MRXA 1CB1A 2K7CA 5HLVA 3D0YB 4A4BA 1YUTA 1RWYA 1YURA 1DJXA 1F4OA 1YUUA 1XK4A 2WOSA 3TUYC 2KFFA 1MF8B 4R1EA 5AXIA 1KFXS 2NCOA 3KHEA 3DVEA 3TZ1A 2PMYA 1AJ5A 1TIZA 2M3WA 2PASA 4MZJA 4OR9B 1M45A 4I5KA 3SG7A 1WLZA 2K7BA 4WQ2A 3I5IC 1S3PA 1KFUL 1RECA 5KU1A 2JNXA 2NZ0A 2L4HA 3SG4A 1S5GY 4GBAA 1CKKA 2KI6C 2H61A 1QIWA 5GQQC 1R6PA 1A29A 1Y1AA 2WCBA 1FPWA 4E68A 3FWBA 4YBHB 1Y0VH 1XVJA 4MSPA 1CLMA 3I5GB 1KWOC 2OPOA 1MXEA 3SG6A 1S36A 3OP0A 1C7VA 1TCOB 4BY5A 1DVIA 1K90D 1CMFA 4C0KA 1K9KA 3DVJA 1NSHA 2P6BB 4CFQA 1M63B 1QASA 3DVKA 4I5NB 1XA5A 2KI6D 1DGVA 4GFTA 1JC2A 2V53A 1CFCA 2HPSA 4YGEB 1B4CA 3ICBA 1IRJA 3BUNB 1JFKA 3QRXA 4YGBB 4GGFC 3OB1B 1J7OA 3RLZA 1TRFA 2ZRTA 2I18A 2O60A 2MBXA 2AMIA 1CDPA 1GGWA 4C0JA 4JPZB 1YX8A 3EKHA 2K8MB 2OS8C 2CT9A 1SYMA 1UHKA 5ER5A 2JQ6A 5KSZA 1QJTA 1XFYO 2K2AA 3SIAA 2KDHA 1IQ3A 3PM8A 1J7QA 2KGBC 2BL0C 1WY9A 1SR6B 1WLMA 1CFDA 2WCEA 1UP5A 1X02A 1N0YA 3NXAA 2JC2A 4N1GA 3VRNA 2MLEC 1Q80A 3TDIA 1DMOA 1QATA 2QPTA 1KFXL 2M49B 1DJHA 2I7AA 1SW8A 2KYFA 1K96A 3EVUA 1MXLC 2CXJA 3JVTC 1ZFSA 1QIVA 2Y1MA 1Y1UA 1QX7A 3PALA 4WQ3A 2SCPA 3EKJA 1RK9A 1K94A 4QJ5B 4A4CA 1QX5B 1MHOA 3PLFB 2ZKMX 1UHIA 1QX2A 4M2OA 1PVAA 2GV5A 4ZCUA 3LK1A 2KAVA 4OV2A 5FYXA 2L4IA 2JXCA 1F70A 3BUXB 2M1KB 1DF0A 3SIBA 3PN7B 1SCVA 2MAZA 2K0JA 1ODBA 4ICBA 4PE1A 4U8DA 2EC6C 1WRLA 3I5FB 2D8NA 1DTLA 1B1GA 1S26D 1V1FA 1BJFA 1CNPA 1RTP1 4MN0A 2PRUA 2JPTA 2LLSA 5HYDA 4NDBA 2L5XB 5D7FA 4F0ZB 2I2RE 2ZNEA 2FJUB 4NDDA 1PALA 3RM1A 2MLFC 1CDNA 1PULA 1GJYA 1JF0A 3VRRA 2KFGA 1GQMA 5TNCA 1SK6D 1DF0B 5K89A 1S5GZ 3DD4A 3FS7A 4CPVA 1NCXA 3ZWHA 1ZACA 1IKUA 2NXQA 2E30A 1BLQA 3O4YA 1NPQA 5I2OA 1J7RA 5CSJA 2WCFA 5G08A 4PHJA 2LMUA 2WORA 2JT8A 4ETOA 4USLA 1TCFA 1XFVO 1SL7A 3IQQA 2PALA 4FTGA 4YI8A 1FI5A 5DKNA 1A4PA 1LA3A 1FF1A 2Y4QA 1XFUO 1E8AA 2BKHB 1B47A 1L2OB 2AAOA 2MJWB 3NSOA 2CBLA 5HKYA 2JOJA 4MBEA 1BMOA 5I2LA 4C0LA 4PCWA 2ZFDA 5IBWA 1JBAA 2GGMA 2LANA 3VROA 3CLNA 1JSAA 1YVLA 1EXRA 2JTZA 2G2BA 3I5GC 3WXAA 1PK0D 1WDCC 1B8CA 1DJIA 2COLB 2WC8A 1MWNA 4HRGA 1BR1B 1SBJA 1XFWO 3NSLA 1F55A 1SRAA 4TNCA 1LKJA 1QXPA 2E6WA 4P5OE 5JJGA 5AANA 2LMVA 4GGNA 4Q04A 1XO5A 1M46A 4NQGA 2H61C 1SCMB 2F3YA 2KFHA 2L2EA 1NX1A 2KAXA 1JWDA 1S6JA 5D69A 5CSFA 3EK4A 3CGAA 2Q4UA 2LVJA 3GOFA 2M1UA 3SJSA 1MR8A 2BBNA 1NYAA 2FCEA 3C1VA 2NCPA 1H8BA 2M29A 4AQJA 1AUIB 1CLBA 1AJ4A 1TTXA 1LXFC 1ZUZA 2BE4A 4GGFA 1DJYA 3WHTB 4ORBB 5HKWA 5BPJA 3BXKA 4IL1A 1NCZA 2LE9B 2JRFA 5DKRA 2HETA 1K95A 1A2XA 2KI4C 2RGIA 3AKBA 4YRUA 1OQPA 3CS1A 5DKQA 3CR2A 2K61A 3MSEB 1BG1A 2Q91A 1CM4A 2ISDA 1SR6C 1UHHA 4OKHA 2WNDA 1YVHA 2F2PA 3LLEA 2KQYA 5JOLA 1BODA 1VRKA 3WNXB 5F6TA 1BR4B 1G8IA 4AQIA 2KAYA 4PHKA 3ZNIA 2BECA 1C7WA 4D1EA 1S6IA 1BF5A 4PE4A 3LL8B 4QJ3B 3TS5B 2JU0A 1CM1A 1DJZA 1OMRA 2ZRSA 2Y1NA 1M31A 1OSAA 3E3RA 3H4SE 1G4YR 1MUXA 3PSRA 4M2PA 1NX0A 1JFJA 3M0WA 2LMTA 3EVVA 4DIRA 2HQWA 5PALA 2LAPA 4HSZA 1KQMB 2LUCA 5CSIA 4GAOA 1WRZA 3AKAA 4WRIA 4YGAA 3BOWA 1NCYA 2HQ8A 3O2PA 3DF0A 3AAKA 4DUQA 1FW4A 1R2UA 5I8NA 2DOQA 3SG2A 3SG5A 3VRPA 3OX5A 1TNXA 3PN7C 1JUOA 2M7NA 1W7IB 2PVBA 2F33A 3KEVA 4MZKA 3LK0A 1OMDA 4CFRA 1MQ1A 1K8UA 1RFJA 5KTYA 2KSPA 3BUWB 3I5FC 2NLNA 1WRKA 2R2IA 3GK4X 1IH0A 1QLSA 2G9BA 1C07A 1H4BA 1LINA 1KCYA 4JQ0D 3PATA 3BOWB 4DRWA 3SG3A 1NUBA 2QACA 1K9PA 3JTDC 4BY4A 3DF0B 1UURA 1OZSA 2BE6A 1AP4A 2LVKA 1KK8B 1Y6WA 3I5HB 2IS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFF A;  2LNK A;  4NDC A;  1DT7 B;  2OTG B;  4N5X A;  4PDZ A;  1J7P A;  1PVB A;  1UHN A;  2KBM A;  1DJW A;  2JT3 A;  1IWQ A;  4OVN F;  2LHI A;  3BYA A;  3TDZ A;  2VRG A;  2LM5 A;  1IG5 A;  2FCD A;  3HX4 A;  1CLL A;  4PAL A;  4PHM A;  3PFV A;  1BT6 A;  1J1E A;  1YR5 A;  4I5J A;  2AUC A;  1OZO A;  1SNL A;  2BKI B;  1ZOT B;  1SPY A;  1L2O C;  1OMV A;  3EK7 A;  1A75 A;  3GK1 A;  2KYC A;  2M0R A;  2M9G A;  3WHU B;  1NX2 A;  1QLK A;  4P2Y B;  4HRE E;  1FI6 A;  1XK4 C;  2L98 A;  1J55 A;  2CNP A;  1B7T Z;  2PSR A;  5J3X A;  2JZI A;  1EG3 A;  3O78 A;  3CWG A;  1SMG A;  1XYD A;  5CSN A;  1SY9 A;  3TUY B;  1F71 A;  1YRT B;  4GUK A;  2ZN8 A;  2Y5I A;  4I5L B;  1UUS A;  1M39 A;  1NP8 A;  1L7Z A;  1RJV A;  1CDM A;  2LP3 A;  1QVI Y;  5B8I B;  3IQO A;  5AER A;  2M97 A;  1CTR A;  1SCM C;  3I5I B;  1B7T Y;  3KF9 A;  1PSR A;  1A75 B;  4OCI A;  2M8U A;  1OOJ A;  1JF2 A;  3K21 A;  5AEQ A;  1B9A A;  3NSI A;  1EG4 A;  4GNK B;  3OB2 B;  3CR4 X;  4PE7 A;  1ZMZ A;  3CTN A;  2O5G A;  2LHL A;  1NIW A;  1FBV A;  1SL9 A;  1WDC B;  1RRO A;  2LV7 A;  1KWO B;  1IJ5 A;  3A8R A;  2LLU A;  2JWW A;  1EL4 A;  3F45 A;  5CPV A;  1AK8 A;  2KBI A;  5I2Q A;  2KQ6 A;  2BBM A;  1YX7 A;  1Y1X A;  4YI9 A;  2BCA A;  3O6B A;  2K7D A;  4QJ4 B;  1DJG A;  2F8P A;  2H2K A;  4CLN A;  1U5I A;  4XJK A;  4JWQ A;  2JNF A;  5HKZ A;  2A4J A;  1NX3 A;  1F8H A;  2KHN A;  1ALV A;  4MLW A;  2LVI A;  1QTX A;  1YUS A;  1GGZ A;  3HCM A;  3GK2 A;  1UHJ A;  2MA2 A;  1NWD A;  1YTZ C;  2MRD A;  1F4Q A;  1K93 D;  4YGD B;  4CID A;  1CFP A;  1D1O A;  2LP2 A;  3BQ3 A;  2JXL A;  3TS5 C;  1A03 A;  2HF5 A;  2JT0 A;  1KQV A;  2EHB A;  1PSB A;  3DVM A;  2CCM A;  1TOP A;  1QV1 A;  1BU3 A;  1YRU B;  1J1D A;  1U5I B;  2OS8 B;  4XJK B;  2KI4 B;  1B8L A;  1IJ6 A;  1IQ5 A;  2ZN9 A;  1KQM C;  2L0P A;  3VGO A;  1KFU S;  4PHN A;  2BL0 B;  2B1U A;  3EVR A;  1OE9 B;  2ZND A;  2F3Z A;  1LA0 A;  2L50 A;  2MHH A;  1B8R A;  2EGD A;  1XFX O;  1KSM A;  1CDL A;  1UWO A;  1W7J B;  4XYN A;  2I94 A;  4UPG A;  4HRH A;  1TNW A;  3KPX A;  4N1F A;  4DS7 A;  1EJ3 A;  4PE0 A;  3JVT B;  2JTT A;  5HLO A;  1TNQ A;  4L9M A;  3CR5 X;  3AAJ A;  2M7L A;  3VRQ A;  1EH2 A;  1F54 A;  1QS7 A;  1TN4 A;  4FQO A;  2L51 A;  3BUM B;  4YGC B;  4ORA B;  1CMG A;  1SL8 A;  1N65 A;  1XFZ O;  2CTN A;  2KGR A;  1KK7 Z;  1K2H A;  1KK8 C;  4MVF A;  2K7O A;  3CZT X;  3I5H C;  3LCP C;  2BCX A;  2LLT A;  3FIA A;  5ER4 X;  1G33 A;  3IF7 A;  3NSK A;  1BOC A;  4DCK A;  1N2D A;  2OTG C;  3A4U B;  1AHR A;  1DGU A;  3D0Y A;  2LUX A;  4ZCV A;  1V1G A;  4MRY A;  4AOM A;  2F2O A;  1HT9 A;  2JUL A;  3TDU A;  1PRW A;  1K9U A;  1KSO A;  2LCP A;  2BCB A;  3OHM B;  1AVS A;  4MZL A;  2EC6 B;  2FOT A;  1S1E A;  1IGV A;  1HQV A;  1KK7 Y;  2K2F A;  4ORC B;  2KOT A;  3BUO B;  3OX6 A;  5AFP A;  1S6C A;  2GGZ A;  3KO0 A;  1SKT A;  3FWC A;  1QV0 A;  2KNE A;  3EK8 A;  3JTD B;  4GPL B;  4MEW A;  1TNP A;  2TN4 A;  4M2Q A;  1LVC D;  1ALW A;  1QVI Z;  2LC5 A;  2LVV A;  2SAS A;  3D10 A;  4MRX A;  1CB1 A;  2K7C A;  5HLV A;  3D0Y B;  4A4B A;  1YUT A;  1RWY A;  1YUR A;  1DJX A;  1F4O A;  1YUU A;  1XK4 A;  2WOS A;  3TUY C;  2KFF A;  1MF8 B;  4R1E A;  5AXI A;  1KFX S;  2NCO A;  3KHE A;  3DVE A;  3TZ1 A;  2PMY A;  1AJ5 A;  1TIZ A;  2M3W A;  2PAS A;  4MZJ A;  4OR9 B;  1M45 A;  4I5K A;  3SG7 A;  1WLZ A;  2K7B A;  4WQ2 A;  3I5I C;  1S3P A;  1KFU L;  1REC A;  5KU1 A;  2JNX A;  2NZ0 A;  2L4H A;  3SG4 A;  1S5G Y;  4GBA A;  1CKK A;  2KI6 C;  2H61 A;  1QIW A;  5GQQ C;  1R6P A;  1A29 A;  1Y1A A;  2WCB A;  1FPW A;  4E68 A;  3FWB A;  4YBH B;  1Y0V H;  1XVJ A;  4MSP A;  1CLM A;  3I5G B;  1KWO C;  2OPO A;  1MXE A;  3SG6 A;  1S36 A;  3OP0 A;  1C7V A;  1TCO B;  4BY5 A;  1DVI A;  1K90 D;  1CMF A;  4C0K A;  1K9K A;  3DVJ A;  1NSH A;  2P6B B;  4CFQ A;  1M63 B;  1QAS A;  3DVK A;  4I5N B;  1XA5 A;  2KI6 D;  1DGV A;  4GFT A;  1JC2 A;  2V53 A;  1CFC A;  2HPS A;  4YGE B;  1B4C A;  3ICB A;  1IRJ A;  3BUN B;  1JFK A;  3QRX A;  4YGB B;  4GGF C;  3OB1 B;  1J7O A;  3RLZ A;  1TRF A;  2ZRT A;  2I18 A;  2O60 A;  2MBX A;  2AMI A;  1CDP A;  1GGW A;  4C0J A;  4JPZ B;  1YX8 A;  3EKH A;  2K8M B;  2OS8 C;  2CT9 A;  1SYM A;  1UHK A;  5ER5 A;  2JQ6 A;  5KSZ A;  1QJT A;  1XFY O;  2K2A A;  3SIA A;  2KDH A;  1IQ3 A;  3PM8 A;  1J7Q A;  2KGB C;  2BL0 C;  1WY9 A;  1SR6 B;  1WLM A;  1CFD A;  2WCE A;  1UP5 A;  1X02 A;  1N0Y A;  3NXA A;  2JC2 A;  4N1G A;  3VRN A;  2MLE C;  1Q80 A;  3TDI A;  1DMO A;  1QAT A;  2QPT A;  1KFX L;  2M49 B;  1DJH A;  2I7A A;  1SW8 A;  2KYF A;  1K96 A;  3EVU A;  1MXL C;  2CXJ A;  3JVT C;  1ZFS A;  1QIV A;  2Y1M A;  1Y1U A;  1QX7 A;  3PAL A;  4WQ3 A;  2SCP A;  3EKJ A;  1RK9 A;  1K94 A;  4QJ5 B;  4A4C A;  1QX5 B;  1MHO A;  3PLF B;  2ZKM X;  1UHI A;  1QX2 A;  4M2O A;  1PVA A;  2GV5 A;  4ZCU A;  3LK1 A;  2KAV A;  4OV2 A;  5FYX A;  2L4I A;  2JXC A;  1F70 A;  3BUX B;  2M1K B;  1DF0 A;  3SIB A;  3PN7 B;  1SCV A;  2MAZ A;  2K0J A;  1ODB A;  4ICB A;  4PE1 A;  4U8D A;  2EC6 C;  1WRL A;  3I5F B;  2D8N A;  1DTL A;  1B1G A;  1S26 D;  1V1F A;  1BJF A;  1CNP A;  1RTP 1;  4MN0 A;  2PRU A;  2JPT A;  2LLS A;  5HYD A;  4NDB A;  2L5X B;  5D7F A;  4F0Z B;  2I2R E;  2ZNE A;  2FJU B;  4NDD A;  1PAL A;  3RM1 A;  2MLF C;  1CDN A;  1PUL A;  1GJY A;  1JF0 A;  3VRR A;  2KFG A;  1GQM A;  5TNC A;  1SK6 D;  1DF0 B;  5K89 A;  1S5G Z;  3DD4 A;  3FS7 A;  4CPV A;  1NCX A;  3ZWH A;  1ZAC A;  1IKU A;  2NXQ A;  2E30 A;  1BLQ A;  3O4Y A;  1NPQ A;  5I2O A;  1J7R A;  5CSJ A;  2WCF A;  5G08 A;  4PHJ A;  2LMU A;  2WOR A;  2JT8 A;  4ETO A;  4USL A;  1TCF A;  1XFV O;  1SL7 A;  3IQQ A;  2PAL A;  4FTG A;  4YI8 A;  1FI5 A;  5DKN A;  1A4P A;  1LA3 A;  1FF1 A;  2Y4Q A;  1XFU O;  1E8A A;  2BKH B;  1B47 A;  1L2O B;  2AAO A;  2MJW B;  3NSO A;  2CBL A;  5HKY A;  2JOJ A;  4MBE A;  1BMO A;  5I2L A;  4C0L A;  4PCW A;  2ZFD A;  5IBW A;  1JBA A;  2GGM A;  2LAN A;  3VRO A;  3CLN A;  1JSA A;  1YVL A;  1EXR A;  2JTZ A;  2G2B A;  3I5G C;  3WXA A;  1PK0 D;  1WDC C;  1B8C A;  1DJI A;  2COL B;  2WC8 A;  1MWN A;  4HRG A;  1BR1 B;  1SBJ A;  1XFW O;  3NSL A;  1F55 A;  1SRA A;  4TNC A;  1LKJ A;  1QXP A;  2E6W A;  4P5O E;  5JJG A;  5AAN A;  2LMV A;  4GGN A;  4Q04 A;  1XO5 A;  1M46 A;  4NQG A;  2H61 C;  1SCM B;  2F3Y A;  2KFH A;  2L2E A;  1NX1 A;  2KAX A;  1JWD A;  1S6J A;  5D69 A;  5CSF A;  3EK4 A;  3CGA A;  2Q4U A;  2LVJ A;  3GOF A;  2M1U A;  3SJS A;  1MR8 A;  2BBN A;  1NYA A;  2FCE A;  3C1V A;  2NCP A;  1H8B A;  2M29 A;  4AQJ A;  1AUI B;  1CLB A;  1AJ4 A;  1TTX A;  1LXF C;  1ZUZ A;  2BE4 A;  4GGF A;  1DJY A;  3WHT B;  4ORB B;  5HKW A;  5BPJ A;  3BXK A;  4IL1 A;  1NCZ A;  2LE9 B;  2JRF A;  5DKR A;  2HET A;  1K95 A;  1A2X A;  2KI4 C;  2RGI A;  3AKB A;  4YRU A;  1OQP A;  3CS1 A;  5DKQ A;  3CR2 A;  2K61 A;  3MSE B;  1BG1 A;  2Q91 A;  1CM4 A;  2ISD A;  1SR6 C;  1UHH A;  4OKH A;  2WND A;  1YVH A;  2F2P A;  3LLE A;  2KQY A;  5JOL A;  1BOD A;  1VRK A;  3WNX B;  5F6T A;  1BR4 B;  1G8I A;  4AQI A;  2KAY A;  4PHK A;  3ZNI A;  2BEC A;  1C7W A;  4D1E A;  1S6I A;  1BF5 A;  4PE4 A;  3LL8 B;  4QJ3 B;  3TS5 B;  2JU0 A;  1CM1 A;  1DJZ A;  1OMR A;  2ZRS A;  2Y1N A;  1M31 A;  1OSA A;  3E3R A;  3H4S E;  1G4Y R;  1MUX A;  3PSR A;  4M2P A;  1NX0 A;  1JFJ A;  3M0W A;  2LMT A;  3EVV A;  4DIR A;  2HQW A;  5PAL A;  2LAP A;  4HSZ A;  1KQM B;  2LUC A;  5CSI A;  4GAO A;  1WRZ A;  3AKA A;  4WRI A;  4YGA A;  3BOW A;  1NCY A;  2HQ8 A;  3O2P A;  3DF0 A;  3AAK A;  4DUQ A;  1FW4 A;  1R2U A;  5I8N A;  2DOQ A;  3SG2 A;  3SG5 A;  3VRP A;  3OX5 A;  1TNX A;  3PN7 C;  1JUO A;  2M7N A;  1W7I B;  2PVB A;  2F33 A;  3KEV A;  4MZK A;  3LK0 A;  1OMD A;  4CFR A;  1MQ1 A;  1K8U A;  1RFJ A;  5KTY A;  2KSP A;  3BUW B;  3I5F C;  2NLN A;  1WRK A;  2R2I A;  3GK4 X;  1IH0 A;  1QLS A;  2G9B A;  1C07 A;  1H4B A;  1LIN A;  1KCY A;  4JQ0 D;  3PAT A;  3BOW B;  4DRW A;  3SG3 A;  1NUB A;  2QAC A;  1K9P A;  3JTD C;  4BY4 A;  3DF0 B;  1UUR A;  1OZS A;  2BE6 A;  1AP4 A;  2LVK A;  1KK8 B;  1Y6W A;  3I5H B;  2IS9 A; 
#chains in the Genus database with same CATH topology
 3DXL A;  1CFF A;  2LNK A;  4NDC A;  1DT7 B;  2OTG B;  4N5X A;  4PDZ A;  1J7P A;  1PVB A;  1UHN A;  2KBM A;  2KLD A;  1DJW A;  2JT3 A;  1IWQ A;  4OVN F;  2LHI A;  3BYA A;  3TDZ A;  2VRG A;  2LM5 A;  1IG5 A;  1W9Z A;  2FCD A;  3HX4 A;  1CLL A;  4PAL A;  4PHM A;  3PFV A;  1BT6 A;  1J1E A;  1YR5 A;  4I5J A;  2AUC A;  1OZO A;  1SNL A;  2BKI B;  1ZOT B;  1SPY A;  3O4X A;  1L2O C;  1OMV A;  5FI7 A;  4F7F A;  3EK7 A;  1A75 A;  2WCL A;  5HL1 A;  3GK1 A;  2KYC A;  2M0R A;  2M9G A;  3WHU B;  1NX2 A;  1QLK A;  4P2Y B;  4HRE E;  1FI6 A;  1XK4 C;  2L98 A;  1J55 A;  2CNP A;  1B7T Z;  2PSR A;  5J3X A;  2JZI A;  1EG3 A;  3DZT A;  3O78 A;  3CWG A;  3D78 A;  1SMG A;  5EL2 A;  1XYD A;  4IJ7 A;  5CSN A;  1SY9 A;  3TUY B;  1F71 A;  1YRT B;  4GUK A;  2ZN8 A;  3UNW A;  2Y5I A;  4I5L B;  1UUS A;  1M39 A;  1NP8 A;  1L7Z A;  1RJV A;  1CDM A;  2LP3 A;  1QVI Y;  5B8I B;  3IQO A;  3BFH A;  5AER A;  2M97 A;  1CTR A;  1SCM C;  3I5I B;  1B7T Y;  3KF9 A;  1PSR A;  1A75 B;  4OCI A;  2M8U A;  1OOJ A;  3S0G A;  1JF2 A;  3K21 A;  5AEQ A;  1B9A A;  3NSI A;  1EG4 A;  4GNK B;  3OB2 B;  3B86 A;  3CR4 X;  2H8V A;  4PE7 A;  1ZMZ A;  3CTN A;  2O5G A;  2LHL A;  1NIW A;  1LS8 A;  1FBV A;  1SL9 A;  1WDC B;  1RRO A;  2LV7 A;  1KWO B;  1IJ5 A;  3A8R A;  2LLU A;  2JWW A;  1EL4 A;  3F45 A;  5CPV A;  1AK8 A;  2KBI A;  5FI2 A;  5I2Q A;  2KQ6 A;  2BBM A;  1YX7 A;  1Y1X A;  2WCH A;  4YI9 A;  2BCA A;  3O6B A;  2K7D A;  4QJ4 B;  1DJG A;  2F8P A;  2H2K A;  4CLN A;  1U5I A;  4XJK A;  4INX A;  2JNF A;  4JWQ A;  5HKZ A;  2A4J A;  3CZ2 A;  1NX3 A;  1F8H A;  2KHN A;  1ALV A;  4MLW A;  2LVI A;  4INW A;  1DC1 A;  1QTX A;  1YUS A;  1GGZ A;  3HCM A;  3GK2 A;  1UHJ A;  2MA2 A;  1NWD A;  1YTZ C;  2MRD A;  1F4Q A;  1K93 D;  4YGD B;  4CID A;  1CFP A;  1D1O A;  2LP2 A;  1Z2C B;  3BQ3 A;  2JXL A;  3TS5 C;  1A03 A;  2HF5 A;  1OOF A;  2JT0 A;  2EHB A;  1PSB A;  3DVM A;  2CCM A;  1TOP A;  1KQV A;  1QV1 A;  1BU3 A;  1YRU B;  1J1D A;  1U5I B;  2OS8 B;  2BAP A;  4XJK B;  2KI4 B;  1B8L A;  3OBV A;  1IJ6 A;  1IQ5 A;  2ZN9 A;  1KQM C;  2L0P A;  3BFA A;  3VGO A;  1KFU S;  3SS4 A;  4PHN A;  2BL0 B;  2B1U A;  2WC6 A;  3EVR A;  1OE9 B;  1OOH A;  2F3Z A;  2ZND A;  1LA0 A;  2L50 A;  2MHH A;  1B8R A;  2EGD A;  1XFX O;  1KSM A;  1CDL A;  1UWO A;  1W7J B;  2PQL A;  4XYN A;  2I94 A;  4UPG A;  2P70 A;  4HRH A;  1TUJ A;  1TNW A;  3KPX A;  4N1F A;  4DS7 A;  1EJ3 A;  4PE0 A;  3JVT B;  2JTT A;  5HLO A;  1TNQ A;  4L9M A;  3CR5 X;  3AAJ A;  2M7L A;  3VRQ A;  1EH2 A;  1F54 A;  1QS7 A;  1TN4 A;  4FQO A;  2L51 A;  3BUM B;  4YGC B;  2L2C A;  4ORA B;  1CMG A;  1SL8 A;  1N65 A;  1XFZ O;  1T14 A;  2CTN A;  2KGR A;  1KK7 Z;  1K2H A;  1KK8 C;  4MVF A;  2K7O A;  3V2L A;  3CZT X;  3I5H C;  3D75 A;  3LCP C;  2BCX A;  2LLT A;  3FIA A;  2KPH A;  1G33 A;  3IF7 A;  3NSK A;  5ER4 X;  1BOC A;  4DCK A;  1N2D A;  2OTG C;  3A4U B;  1AHR A;  1DGU A;  3D0Y A;  5I94 A;  2LUX A;  4ZCV A;  1V1G A;  4MRY A;  4AOM A;  1DEL A;  2F2O A;  1HT9 A;  2JUL A;  3TDU A;  3D76 A;  1PRW A;  1K9U A;  1KSO A;  2LCP A;  2BCB A;  3OHM B;  1AVS A;  4MZL A;  2EC6 B;  2FOT A;  1S1E A;  1IGV A;  1HQV A;  1KK7 Y;  2K2F A;  4KYN A;  4ORC B;  4OZD A;  2KOT A;  3BUO B;  2YGU A;  1TUZ A;  1ORG A;  3OX6 A;  1S6C A;  2GGZ A;  3D73 A;  3KO0 A;  5AFP A;  1SKT A;  3FWC A;  1QV0 A;  2KNE A;  3EK8 A;  3JTD B;  4GPL B;  4MEW A;  1TNP A;  2TN4 A;  3S0D A;  4M2Q A;  1LVC D;  1ALW A;  1QVI Z;  2LC5 A;  2LVV A;  2SAS A;  3D10 A;  4MRX A;  1CB1 A;  2K7C A;  5HLV A;  3D0Y B;  1P28 A;  2QDI A;  4A4B A;  1YUT A;  1RWY A;  1YUR A;  1DJX A;  1F4O A;  1YUU A;  1XK4 A;  2P71 A;  2WOS A;  3CYZ A;  3TUY C;  3IVT A;  1DQE A;  1MF8 B;  2KFF A;  3NGV A;  4R1E A;  5AXI A;  1KFX S;  2NCO A;  3KHE A;  3DVE A;  3TZ1 A;  2PMY A;  1AJ5 A;  1TIZ A;  2WCK A;  2M3W A;  2PAS A;  4MZJ A;  4OR9 B;  1M45 A;  4I5K A;  3SG7 A;  1WLZ A;  2K7B A;  4WQ2 A;  3I5I C;  1S3P A;  1KFU L;  1REC A;  3CDN A;  2JNX A;  3B87 A;  2NZ0 A;  4JD9 A;  5KU1 A;  2QEO A;  2L4H A;  3SG4 A;  1S5G Y;  4GBA A;  1CKK A;  2WCM A;  2KI6 C;  2H61 A;  1QIW A;  5GQQ C;  1R6P A;  1A29 A;  1Y1A A;  2WCB A;  1FPW A;  4E68 A;  3FWB A;  4YBH B;  1Y0V H;  1XVJ A;  4MSP A;  1CLM A;  1OOG A;  3I5G B;  1KWO C;  2OPO A;  1MXE A;  3SG6 A;  1C3Y A;  1S36 A;  5DIC A;  3OP0 A;  3NHI A;  1C7V A;  1TCO B;  3VB1 A;  4BY5 A;  1DVI A;  1K90 D;  1CMF A;  4C0K A;  1K9K A;  3DVJ A;  1NSH A;  2P6B B;  1TWO A;  4CFQ A;  1M63 B;  1QAS A;  3DVK A;  1QWV A;  4I5N B;  1XA5 A;  2KI6 D;  1DGV A;  4GFT A;  1JC2 A;  2V53 A;  1CFC A;  2HPS A;  1Z4H A;  2WCJ A;  4YGE B;  1B4C A;  1XFR A;  3ICB A;  1IRJ A;  3BUN B;  1JFK A;  3QRX A;  4JKT A;  4YGB B;  4GGF C;  3OB1 B;  1J7O A;  3RLZ A;  1TRF A;  2ZRT A;  2I18 A;  2O60 A;  2MBX A;  2AMI A;  3OGN A;  1CDP A;  1GGW A;  1DEK A;  3K1E A;  4C0J A;  4JPZ B;  1YX8 A;  3EKH A;  2K8M B;  2OS8 C;  2CT9 A;  1SYM A;  1UHK A;  5ER5 A;  2JQ6 A;  5KSZ A;  1QJT A;  1XFY O;  2K2A A;  3SIA A;  2KDH A;  1IQ3 A;  1SSE B;  3PM8 A;  1J7Q A;  2KGB C;  2BL0 C;  1WY9 A;  1SR6 B;  1WLM A;  1CFD A;  2WCE A;  1UP5 A;  1X02 A;  1N0Y A;  3NXA A;  2JC2 A;  4N1G A;  2FJY A;  3VRN A;  2MLE C;  1Q80 A;  2ERB A;  3TDI A;  1DMO A;  1QAT A;  2QPT A;  1KFX L;  2M49 B;  1DJH A;  2I7A A;  3SS3 A;  1SW8 A;  2KYF A;  1K96 A;  3EVU A;  2K60 A;  1MXL C;  2CXJ A;  3JVT C;  1ZFS A;  1QIV A;  2Y1M A;  1Y1U A;  1QX7 A;  3PAL A;  4WQ3 A;  2SCP A;  3EKJ A;  1RK9 A;  2QEV A;  1K94 A;  4QJ5 B;  1GM0 A;  4A4C A;  1QX5 B;  1MHO A;  3PLF B;  2ZKM X;  3Q8I A;  1UHI A;  1QX2 A;  1C3Z A;  4M2O A;  1PVA A;  2GV5 A;  4ZCU A;  3LK1 A;  2KAV A;  4OV2 A;  5FYX A;  2L4I A;  2JXC A;  1F70 A;  3BUX B;  2M1K B;  1DF0 A;  3SIB A;  3PN7 B;  1SCV A;  2MAZ A;  2K0J A;  1ODB A;  4ICB A;  2GTE A;  4PE1 A;  2EC6 C;  4U8D A;  1WRL A;  3I5F B;  2D8N A;  1DTL A;  1B1G A;  1S26 D;  1V1F A;  3PJI A;  1BJF A;  1CNP A;  1RTP 1;  4MN0 A;  2PRU A;  2JPT A;  2LLS A;  5HYD A;  4NDB A;  2L5X B;  5D7F A;  3UO9 A;  2QEB A;  4F0Z B;  2I2R E;  2ZNE A;  2FJU B;  4NDD A;  3RZS A;  1PAL A;  3RM1 A;  2MLF C;  1CDN A;  1PUL A;  1JF0 A;  1GJY A;  3VRR A;  2KFG A;  1GQM A;  5TNC A;  1SK6 D;  1DF0 B;  5K89 A;  1S5G Z;  3DD4 A;  3FS7 A;  4CPV A;  1NCX A;  3ZWH A;  1OOI X;  1ZAC A;  1IKU A;  2NXQ A;  2E30 A;  3L4A A;  2WC5 A;  3O4Y A;  1BLQ A;  1NPQ A;  5I2O A;  1J7R A;  5CSJ A;  3S0A A;  2WCF A;  3QME A;  4PHJ A;  4PT1 A;  5G08 A;  2LMU A;  2WOR A;  3D74 A;  2JT8 A;  4ETO A;  4USL A;  1TCF A;  1XFV O;  1SL7 A;  3IQQ A;  2PAL A;  3R1P A;  4FTG A;  4YI8 A;  1FI5 A;  5DKN A;  1A4P A;  1LA3 A;  1FF1 A;  2Y4Q A;  1XFU O;  1E8A A;  2BKH B;  1B47 A;  1L2O B;  2AAO A;  2MJW B;  3NSO A;  2CBL A;  5HKY A;  2JOJ A;  4MBE A;  1BMO A;  5I2L A;  4C0L A;  4PCW A;  2ZFD A;  5IBW A;  1JBA A;  2GGM A;  2LAN A;  3VRO A;  2BNX A;  3CLN A;  3CZ1 A;  1YVL A;  1EXR A;  2JTZ A;  2G2B A;  3I5G C;  3WXA A;  1JSA A;  1PK0 D;  1WDC C;  1B8C A;  3DY9 A;  1DJI A;  2COL B;  2WC8 A;  1MWN A;  4HRG A;  3BJH A;  1BR1 B;  1SBJ A;  1XFW O;  3EG5 B;  3NSL A;  1F55 A;  1SRA A;  4TNC A;  1LKJ A;  1QXP A;  2E6W A;  4P5O E;  5JJG A;  5AAN A;  2PYQ A;  2LMV A;  4GGN A;  4Q04 A;  1XO5 A;  1M46 A;  4NQG A;  5FI6 A;  2H61 C;  1SCM B;  2F3Y A;  2KFH A;  2L2E A;  1NX1 A;  2KAX A;  3FE8 A;  1JWD A;  1S6J A;  3L47 A;  5CSF A;  5D69 A;  3EK4 A;  3CGA A;  2Q4U A;  2LVJ A;  3GOF A;  2M1U A;  3SJS A;  1MR8 A;  2BBN A;  1NYA A;  2FCE A;  3C1V A;  2NCP A;  3PM2 A;  2M29 A;  3L4L A;  2L5Y A;  4AQJ A;  1H8B A;  3SS5 A;  1AUI B;  1CLB A;  1AJ4 A;  1TTX A;  3B6X A;  1LXF C;  1ZUZ A;  2BE4 A;  4GGF A;  1DJY A;  3WHT B;  3B7A A;  4ORB B;  5HKW A;  3S0B A;  5BPJ A;  3BXK A;  4IL1 A;  1NCZ A;  2LE9 B;  2JRF A;  3DYE A;  5DKR A;  2HET A;  1K95 A;  1A2X A;  2KI4 C;  2QEH A;  2RGI A;  3AKB A;  1OQP A;  3BFB A;  3CS1 A;  4YRU A;  5DKQ A;  3CR2 A;  3S0F A;  2K61 A;  3MSE B;  1BG1 A;  2Q91 A;  1CM4 A;  2ISD A;  3S0E A;  1SR6 C;  1UHH A;  4OKH A;  4FQT A;  2WND A;  1YVH A;  2F2P A;  3LLE A;  2KLE A;  2KQY A;  5D3O A;  5JOL A;  1BOD A;  3D77 A;  1VRK A;  3WNX B;  5F6T A;  1BR4 B;  1G8I A;  4AQI A;  2KAY A;  3R1O A;  4PHK A;  3ZNI A;  1IIO A;  2BEC A;  1C7W A;  4D1E A;  1S6I A;  2JPO A;  3R1V A;  4PE4 A;  3LL8 B;  4QJ3 B;  1BF5 A;  3TS5 B;  2JU0 A;  1CM1 A;  1DJZ A;  1OMR A;  2ZRS A;  2Y1N A;  3FE6 A;  1M31 A;  1OSA A;  3E3R A;  3H4S E;  1G4Y R;  1MUX A;  3PSR A;  3CZ0 A;  1NX0 A;  4M2P A;  1JFJ A;  3M0W A;  2LMT A;  3EVV A;  4DIR A;  2HQW A;  5PAL A;  2LAP A;  4HSZ A;  1KQM B;  2LUC A;  5CSI A;  4GAO A;  1WRZ A;  3AKA A;  4WRI A;  4YGA A;  3BOW A;  1NCY A;  2HQ8 A;  3B88 A;  3CAB A;  3O2P A;  3DF0 A;  3AAK A;  4DUQ A;  1FW4 A;  1R2U A;  5I8N A;  2DOQ A;  3SG2 A;  3SG5 A;  3VRP A;  3OX5 A;  1TNX A;  3N7H A;  3PN7 C;  1JUO A;  2M7N A;  1W7I B;  2PVB A;  2F33 A;  3KEV A;  4MZK A;  3LK0 A;  1OMD A;  4CFR A;  1MQ1 A;  1K8U A;  1RFJ A;  5KTY A;  3R72 A;  2KSP A;  3BUW B;  3FE9 A;  2NLN A;  3I5F C;  3NHT A;  1WRK A;  2R2I A;  3GK4 X;  1IH0 A;  1QLS A;  2G9B A;  1C07 A;  1H4B A;  1LIN A;  1KCY A;  4JQ0 D;  3PAT A;  3BOW B;  4DRW A;  3SG3 A;  1NUB A;  2QAC A;  1K9P A;  3JTD C;  4BY4 A;  3DF0 B;  1UUR A;  1OZS A;  2BE6 A;  1OW4 A;  1AP4 A;  2LVK A;  1KK8 B;  1Y6W A;  3I5H B;  2IS9 A; 
#chains in the Genus database with same CATH homology
 1CFF A;  2LNK A;  4NDC A;  1DT7 B;  2OTG B;  4N5X A;  4PDZ A;  1J7P A;  1PVB A;  1UHN A;  2KBM A;  1DJW A;  2JT3 A;  1IWQ A;  4OVN F;  2LHI A;  3BYA A;  3TDZ A;  2VRG A;  2LM5 A;  1IG5 A;  2FCD A;  3HX4 A;  1CLL A;  4PAL A;  4PHM A;  3PFV A;  1BT6 A;  1J1E A;  1YR5 A;  4I5J A;  2AUC A;  1OZO A;  1SNL A;  2BKI B;  1ZOT B;  1SPY A;  1L2O C;  1OMV A;  3EK7 A;  1A75 A;  3GK1 A;  2KYC A;  2M0R A;  2M9G A;  3WHU B;  1NX2 A;  1QLK A;  4P2Y B;  4HRE E;  1FI6 A;  1XK4 C;  2L98 A;  1J55 A;  2CNP A;  1B7T Z;  2PSR A;  5J3X A;  2JZI A;  1EG3 A;  3O78 A;  3CWG A;  1SMG A;  1XYD A;  5CSN A;  1SY9 A;  3TUY B;  1F71 A;  1YRT B;  4GUK A;  2ZN8 A;  2Y5I A;  4I5L B;  1UUS A;  1M39 A;  1NP8 A;  1L7Z A;  1RJV A;  1CDM A;  2LP3 A;  1QVI Y;  5B8I B;  3IQO A;  5AER A;  2M97 A;  1CTR A;  1SCM C;  3I5I B;  1B7T Y;  3KF9 A;  1PSR A;  1A75 B;  4OCI A;  2M8U A;  1OOJ A;  1JF2 A;  3K21 A;  5AEQ A;  1B9A A;  3NSI A;  1EG4 A;  4GNK B;  3OB2 B;  3CR4 X;  4PE7 A;  1ZMZ A;  3CTN A;  2O5G A;  2LHL A;  1NIW A;  1FBV A;  1SL9 A;  1WDC B;  1RRO A;  2LV7 A;  1KWO B;  1IJ5 A;  3A8R A;  2LLU A;  2JWW A;  1EL4 A;  3F45 A;  5CPV A;  1AK8 A;  2KBI A;  5I2Q A;  2KQ6 A;  2BBM A;  1YX7 A;  1Y1X A;  4YI9 A;  2BCA A;  3O6B A;  2K7D A;  4QJ4 B;  1DJG A;  2F8P A;  2H2K A;  4CLN A;  1U5I A;  4XJK A;  4JWQ A;  2JNF A;  5HKZ A;  2A4J A;  1NX3 A;  1F8H A;  2KHN A;  1ALV A;  4MLW A;  2LVI A;  1QTX A;  1YUS A;  1GGZ A;  3HCM A;  3GK2 A;  1UHJ A;  2MA2 A;  1NWD A;  1YTZ C;  2MRD A;  1F4Q A;  1K93 D;  4YGD B;  4CID A;  1CFP A;  1D1O A;  2LP2 A;  3BQ3 A;  2JXL A;  3TS5 C;  1A03 A;  2HF5 A;  2JT0 A;  1KQV A;  2EHB A;  1PSB A;  3DVM A;  2CCM A;  1TOP A;  1QV1 A;  1BU3 A;  1YRU B;  1J1D A;  1U5I B;  2OS8 B;  4XJK B;  2KI4 B;  1B8L A;  1IJ6 A;  1IQ5 A;  2ZN9 A;  1KQM C;  2L0P A;  3VGO A;  1KFU S;  4PHN A;  2BL0 B;  2B1U A;  3EVR A;  1OE9 B;  2ZND A;  2F3Z A;  1LA0 A;  2L50 A;  2MHH A;  1B8R A;  2EGD A;  1XFX O;  1KSM A;  1CDL A;  1UWO A;  1W7J B;  4XYN A;  2I94 A;  4UPG A;  4HRH A;  1TNW A;  3KPX A;  4N1F A;  4DS7 A;  1EJ3 A;  4PE0 A;  3JVT B;  2JTT A;  5HLO A;  1TNQ A;  4L9M A;  3CR5 X;  3AAJ A;  2M7L A;  3VRQ A;  1EH2 A;  1F54 A;  1QS7 A;  1TN4 A;  4FQO A;  2L51 A;  3BUM B;  4YGC B;  4ORA B;  1CMG A;  1SL8 A;  1N65 A;  1XFZ O;  2CTN A;  2KGR A;  1KK7 Z;  1K2H A;  1KK8 C;  4MVF A;  2K7O A;  3CZT X;  3I5H C;  3LCP C;  2BCX A;  2LLT A;  3FIA A;  5ER4 X;  1G33 A;  3IF7 A;  3NSK A;  1BOC A;  4DCK A;  1N2D A;  2OTG C;  3A4U B;  1AHR A;  1DGU A;  3D0Y A;  2LUX A;  4ZCV A;  1V1G A;  4MRY A;  4AOM A;  2F2O A;  1HT9 A;  2JUL A;  3TDU A;  1PRW A;  1K9U A;  1KSO A;  2LCP A;  2BCB A;  3OHM B;  1AVS A;  4MZL A;  2EC6 B;  2FOT A;  1S1E A;  1IGV A;  1HQV A;  1KK7 Y;  2K2F A;  4ORC B;  2KOT A;  3BUO B;  3OX6 A;  5AFP A;  1S6C A;  2GGZ A;  3KO0 A;  1SKT A;  3FWC A;  1QV0 A;  2KNE A;  3EK8 A;  3JTD B;  4GPL B;  4MEW A;  1TNP A;  2TN4 A;  4M2Q A;  1LVC D;  1ALW A;  1QVI Z;  2LC5 A;  2LVV A;  2SAS A;  3D10 A;  4MRX A;  1CB1 A;  2K7C A;  5HLV A;  3D0Y B;  4A4B A;  1YUT A;  1RWY A;  1YUR A;  1DJX A;  1F4O A;  1YUU A;  1XK4 A;  2WOS A;  3TUY C;  2KFF A;  1MF8 B;  4R1E A;  5AXI A;  1KFX S;  2NCO A;  3KHE A;  3DVE A;  3TZ1 A;  2PMY A;  1AJ5 A;  1TIZ A;  2M3W A;  2PAS A;  4MZJ A;  4OR9 B;  1M45 A;  4I5K A;  3SG7 A;  1WLZ A;  2K7B A;  4WQ2 A;  3I5I C;  1S3P A;  1KFU L;  1REC A;  5KU1 A;  2JNX A;  2NZ0 A;  2L4H A;  3SG4 A;  1S5G Y;  4GBA A;  1CKK A;  2KI6 C;  2H61 A;  1QIW A;  5GQQ C;  1R6P A;  1A29 A;  1Y1A A;  2WCB A;  1FPW A;  4E68 A;  3FWB A;  4YBH B;  1Y0V H;  1XVJ A;  4MSP A;  1CLM A;  3I5G B;  1KWO C;  2OPO A;  1MXE A;  3SG6 A;  1S36 A;  3OP0 A;  1C7V A;  1TCO B;  4BY5 A;  1DVI A;  1K90 D;  1CMF A;  4C0K A;  1K9K A;  3DVJ A;  1NSH A;  2P6B B;  4CFQ A;  1M63 B;  1QAS A;  3DVK A;  4I5N B;  1XA5 A;  2KI6 D;  1DGV A;  4GFT A;  1JC2 A;  2V53 A;  1CFC A;  2HPS A;  4YGE B;  1B4C A;  3ICB A;  1IRJ A;  3BUN B;  1JFK A;  3QRX A;  4YGB B;  4GGF C;  3OB1 B;  1J7O A;  3RLZ A;  1TRF A;  2ZRT A;  2I18 A;  2O60 A;  2MBX A;  2AMI A;  1CDP A;  1GGW A;  4C0J A;  4JPZ B;  1YX8 A;  3EKH A;  2K8M B;  2OS8 C;  2CT9 A;  1SYM A;  1UHK A;  5ER5 A;  2JQ6 A;  5KSZ A;  1QJT A;  1XFY O;  2K2A A;  3SIA A;  2KDH A;  1IQ3 A;  3PM8 A;  1J7Q A;  2KGB C;  2BL0 C;  1WY9 A;  1SR6 B;  1WLM A;  1CFD A;  2WCE A;  1UP5 A;  1X02 A;  1N0Y A;  3NXA A;  2JC2 A;  4N1G A;  3VRN A;  2MLE C;  1Q80 A;  3TDI A;  1DMO A;  1QAT A;  2QPT A;  1KFX L;  2M49 B;  1DJH A;  2I7A A;  1SW8 A;  2KYF A;  1K96 A;  3EVU A;  1MXL C;  2CXJ A;  3JVT C;  1ZFS A;  1QIV A;  2Y1M A;  1Y1U A;  1QX7 A;  3PAL A;  4WQ3 A;  2SCP A;  3EKJ A;  1RK9 A;  1K94 A;  4QJ5 B;  4A4C A;  1QX5 B;  1MHO A;  3PLF B;  2ZKM X;  1UHI A;  1QX2 A;  4M2O A;  1PVA A;  2GV5 A;  4ZCU A;  3LK1 A;  2KAV A;  4OV2 A;  5FYX A;  2L4I A;  2JXC A;  1F70 A;  3BUX B;  2M1K B;  1DF0 A;  3SIB A;  3PN7 B;  1SCV A;  2MAZ A;  2K0J A;  1ODB A;  4ICB A;  4PE1 A;  4U8D A;  2EC6 C;  1WRL A;  3I5F B;  2D8N A;  1DTL A;  1B1G A;  1S26 D;  1V1F A;  1BJF A;  1CNP A;  1RTP 1;  4MN0 A;  2PRU A;  2JPT A;  2LLS A;  5HYD A;  4NDB A;  2L5X B;  5D7F A;  4F0Z B;  2I2R E;  2ZNE A;  2FJU B;  4NDD A;  1PAL A;  3RM1 A;  2MLF C;  1CDN A;  1PUL A;  1GJY A;  1JF0 A;  3VRR A;  2KFG A;  1GQM A;  5TNC A;  1SK6 D;  1DF0 B;  5K89 A;  1S5G Z;  3DD4 A;  3FS7 A;  4CPV A;  1NCX A;  3ZWH A;  1ZAC A;  1IKU A;  2NXQ A;  2E30 A;  1BLQ A;  3O4Y A;  1NPQ A;  5I2O A;  1J7R A;  5CSJ A;  2WCF A;  5G08 A;  4PHJ A;  2LMU A;  2WOR A;  2JT8 A;  4ETO A;  4USL A;  1TCF A;  1XFV O;  1SL7 A;  3IQQ A;  2PAL A;  4FTG A;  4YI8 A;  1FI5 A;  5DKN A;  1A4P A;  1LA3 A;  1FF1 A;  2Y4Q A;  1XFU O;  1E8A A;  2BKH B;  1B47 A;  1L2O B;  2AAO A;  2MJW B;  3NSO A;  2CBL A;  5HKY A;  2JOJ A;  4MBE A;  1BMO A;  5I2L A;  4C0L A;  4PCW A;  2ZFD A;  5IBW A;  1JBA A;  2GGM A;  2LAN A;  3VRO A;  3CLN A;  1JSA A;  1YVL A;  1EXR A;  2JTZ A;  2G2B A;  3I5G C;  3WXA A;  1PK0 D;  1WDC C;  1B8C A;  1DJI A;  2COL B;  2WC8 A;  1MWN A;  4HRG A;  1BR1 B;  1SBJ A;  1XFW O;  3NSL A;  1F55 A;  1SRA A;  4TNC A;  1LKJ A;  1QXP A;  2E6W A;  4P5O E;  5JJG A;  5AAN A;  2LMV A;  4GGN A;  4Q04 A;  1XO5 A;  1M46 A;  4NQG A;  2H61 C;  1SCM B;  2F3Y A;  2KFH A;  2L2E A;  1NX1 A;  2KAX A;  1JWD A;  1S6J A;  5D69 A;  5CSF A;  3EK4 A;  3CGA A;  2Q4U A;  2LVJ A;  3GOF A;  2M1U A;  3SJS A;  1MR8 A;  2BBN A;  1NYA A;  2FCE A;  3C1V A;  2NCP A;  1H8B A;  2M29 A;  4AQJ A;  1AUI B;  1CLB A;  1AJ4 A;  1TTX A;  1LXF C;  1ZUZ A;  2BE4 A;  4GGF A;  1DJY A;  3WHT B;  4ORB B;  5HKW A;  5BPJ A;  3BXK A;  4IL1 A;  1NCZ A;  2LE9 B;  2JRF A;  5DKR A;  2HET A;  1K95 A;  1A2X A;  2KI4 C;  2RGI A;  3AKB A;  4YRU A;  1OQP A;  3CS1 A;  5DKQ A;  3CR2 A;  2K61 A;  3MSE B;  1BG1 A;  2Q91 A;  1CM4 A;  2ISD A;  1SR6 C;  1UHH A;  4OKH A;  2WND A;  1YVH A;  2F2P A;  3LLE A;  2KQY A;  5JOL A;  1BOD A;  1VRK A;  3WNX B;  5F6T A;  1BR4 B;  1G8I A;  4AQI A;  2KAY A;  4PHK A;  3ZNI A;  2BEC A;  1C7W A;  4D1E A;  1S6I A;  1BF5 A;  4PE4 A;  3LL8 B;  4QJ3 B;  3TS5 B;  2JU0 A;  1CM1 A;  1DJZ A;  1OMR A;  2ZRS A;  2Y1N A;  1M31 A;  1OSA A;  3E3R A;  3H4S E;  1G4Y R;  1MUX A;  3PSR A;  4M2P A;  1NX0 A;  1JFJ A;  3M0W A;  2LMT A;  3EVV A;  4DIR A;  2HQW A;  5PAL A;  2LAP A;  4HSZ A;  1KQM B;  2LUC A;  5CSI A;  4GAO A;  1WRZ A;  3AKA A;  4WRI A;  4YGA A;  3BOW A;  1NCY A;  2HQ8 A;  3O2P A;  3DF0 A;  3AAK A;  4DUQ A;  1FW4 A;  1R2U A;  5I8N A;  2DOQ A;  3SG2 A;  3SG5 A;  3VRP A;  3OX5 A;  1TNX A;  3PN7 C;  1JUO A;  2M7N A;  1W7I B;  2PVB A;  2F33 A;  3KEV A;  4MZK A;  3LK0 A;  1OMD A;  4CFR A;  1MQ1 A;  1K8U A;  1RFJ A;  5KTY A;  2KSP A;  3BUW B;  3I5F C;  2NLN A;  1WRK A;  2R2I A;  3GK4 X;  1IH0 A;  1QLS A;  2G9B A;  1C07 A;  1H4B A;  1LIN A;  1KCY A;  4JQ0 D;  3PAT A;  3BOW B;  4DRW A;  3SG3 A;  1NUB A;  2QAC A;  1K9P A;  3JTD C;  4BY4 A;  3DF0 B;  1UUR A;  1OZS A;  2BE6 A;  1AP4 A;  2LVK A;  1KK8 B;  1Y6W A;  3I5H B;  2IS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...