2Q4UA

Ensemble refinement of the crystal structure of an ef-hand protein from danio rerio dr.36843
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
SAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Zgc:100843
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Danio rerio
molecule tags Structural genomics, unknown function
total genus 73
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q4uA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q4uA03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q4uA01
3OB2B 1SL9A 3E3RA 4OVNF 2JT3A 1DF0A 2KAXA 3TUYB 4YRUA 1U5IA 2PSRA 2SCPA 3DD4A 3OP0A 5HYDA 2JT0A 2JU0A 5DKQA 1YVLA 1K2HA 1TNQA 5I2OA 1K93D 1NYAA 1NIWA 1WDCC 1SKTA 2QPTA 1DMOA 2LP3A 1CNPA 2I2RE 2M1UA 1MXEA 4PCWA 1YUUA 2B1UA 5AEQA 2F3YA 4N5XA 1N65A 3I5GB 1DJHA 1K8UA 1MUXA 2LMVA 1UHKA 1EJ3A 3IQOA 2Y5IA 2CCMA 2OPOA 1CFDA 2KFHA 4E68A 1E8AA 2BCBA 1SK6D 2RGIA 1TNWA 1F4OA 2LVVA 1B4CA 1DJWA 2M9GA 5PALA 1KQMC 2BL0B 1DTLA 2CT9A 2JTTA 2PASA 3BUXB 3CLNA 4MZLA 5I8NA 3ZNIA 1F71A 1J7OA 1H4BA 1DJYA 3PLFB 1TTXA 1WRKA 5CSNA 3SG3A 1XYDA 3LCPC 2KQYA 3TUYC 1IG5A 1U5IB 4HREE 2LCPA 5D7FA 1IJ6A 3PM8A 2KGBC 2L4HA 1M31A 1IQ5A 2HETA 4MN0A 2LUXA 1PALA 2L2EA 1QVIZ 2MRDA 1Y1AA 1QX2A 1NPQA 3I5GC 3TS5B 3A8RA 2CXJA 2KGRA 2L51A 1DJIA 3TDZA 1DJGA 1H8BA 4CFRA 3CTNA 4N1FA 1BMOA 2L5XB 3CWGA 3PFVA 1B1GA 3EVUA 1UWOA 2IS9A 2MLFC 1BR4B 4MRYA 2LHIA 1DJZA 2JPTA 1OOJA 2LVJA 3BUOB 1AK8A 1JSAA 1SY9A 3CZTX 2BL0C 5I2QA 1YX7A 2I94A 2M0RA 3SG5A 2WCFA 1BODA 1SRAA 4C0JA 1B7TY 3SJSA 1SCMB 1YX8A 3JVTB 1PULA 4FTGA 1IKUA 4YBHB 4L9MA 2FOTA 2ZRTA 3WXAA 4GAOA 1S6JA 4DCKA 4DS7A 3FS7A 1IQ3A 1NP8A 2K7BA 4PE4A 1OMVA 1QX5B 2M1KB 5DKNA 1NCZA 1ZUZA 1KFUS 2JTZA 1XFUO 2JC2A 1OMDA 5ER5A 1JC2A 1XFWO 4PALA 3TS5C 3FIAA 1KWOB 1IJ5A 1CTRA 3JTDB 1YVHA 3EK4A 5JOLA 1UUSA 2EHBA 1SR6B 1NX3A 2L98A 1W7IB 2AAOA 2ZRSA 1ZFSA 2HPSA 2K7OA 1Y1UA 3I5FB 1QLKA 1A4PA 4QJ3B 3ZWHA 2FCDA 4M2OA 1QTXA 1SCMC 1CLBA 3TDIA 1SL7A 1V1FA 3JVTC 3HCMA 1SPYA 2NZ0A 4YI9A 3TDUA 4YGDB 3C1VA 4QJ5B 3OB1B 1ALVA 1S6CA 3BUWB 2TN4A 4R1EA 2KNEA 2LANA 4CPVA 1GJYA 4JWQA 3VRQA 3HX4A 2F8PA 3GOFA 1FPWA 1BU3A 2ZN8A 2EGDA 3DVEA 2KFGA 1EG3A 4YI8A 3VGOA 1A03A 1KWOC 1YR5A 3JTDC 1S26D 5CSJA 1QVIY 5F6TA 1RECA 1EH2A 1AHRA 3EK7A 1SR6C 4DIRA 3NSOA 2KBMA 1XFVO 3BQ3A 2QACA 1XFXO 2JNFA 4MZKA 3I5FC 1QXPA 4ZCUA 1A75A 1LKJA 1NUBA 1M45A 1S36A 3RM1A 4MVFA 1KSOA 3BXKA 2MBXA 1RWYA 2NXQA 5HKYA 4OCIA 4I5KA 1G4YR 5AFPA 1CDPA 4NDCA 3DVMA 1YRTB 3FWBA 1CLMA 2A4JA 4N1GA 1K96A 1AP4A 1XFZO 4BY5A 1K90D 1IGVA 5HKZA 1QIVA 4PE0A 2NCPA 1OZOA 4AQJA 2V53A 4YGEB 1QIWA 3ICBA 3OX6A 1QX7A 2OS8B 3I5HB 3OHMB 4M2PA 1PK0D 4GGNA 3O2PA 5AXIA 5TNCA 2I18A 4MEWA 2COLB 3PN7B 4PE1A 1A75B 1LVCD 1V1GA 1DGVA 2KHNA 3AKBA 1BOCA 1BF5A 4YGAA 3NXAA 4WRIA 1WRLA 1XO5A 1B47A 2BE6A 4HRGA 4C0KA 4DRWA 4PHJA 4XJKB 5KU1A 1FI6A 1RJVA 2JQ6A 1UHJA 4MSPA 3MSEB 1CM4A 1PSBA 5DKRA 2MAZA 1CMGA 1UHIA 4ETOA 1Q80A 2MLEC 1CLLA 1NCYA 1W7JB 2JZIA 1TNXA 2LP2A 1A2XA 1JFKA 1KK8B 2KSPA 4P2YB 1L7ZA 2KI6D 5HKWA 1FBVA 1AJ5A 4HSZA 2OS8C 3I5HC 1UP5A 4P5OE 1OMRA 1LXFC 1FI5A 1TCFA 2LVIA 3BUMB 1IWQA 2LLSA 3FWCA 4AQIA 2WNDA 3PN7C 3DF0B 4JQ0D 1XFYO 1NX2A 1TOPA 1XA5A 1KCYA 1MHOA 2VRGA 2HF5A 1MQ1A 3AAJA 2ISDA 1PSRA 1JF2A 4IL1A 5D69A 1M46A 2WOSA 2JXLA 3OX5A 1C7WA 2DOQA 1BG1A 1BR1B 1J55A 2Y4QA 1KFXS 2M97A 4GNKB 3CS1A 5CSIA 1ZACA 2WCEA 4JPZB 4BY4A 1K9UA 2KAVA 2PVBA 3CR2A 1KK8C 1JF0A 3SIAA 3NSLA 1GGWA 1MXLC 4YGCB 2JULA 1QJTA 1EG4A 5HLVA 4Q04A 3CR4X 4USLA 1NSHA 2JWWA 1C07A 3KF9A 3VRPA 4QJ4B 2R2IA 2BCAA 1MWNA 1OE9B 1OSAA 2KDHA 3GK4X 1JFJA 5BPJA 2KI6C 3F45A 1J1EA 2K61A 1SYMA 2FJUB 2M7LA 2F3ZA 2Y1NA 2ZN9A 3LL8B 4DUQA 2HQ8A 1M63B 1BJFA 3NSIA 2WC8A 2CTNA 1K9KA 2LMUA 1CMFA 3GK2A 1F8HA 2K2FA 5G08A 1TNPA 2L4IA 3WNXB 1CFFA 2LE9B 2WCBA 3M0WA 1RK9A 1Y1XA 4GGFC 4PHKA 3PATA 4PDZA 1R2UA 4CLNA 4GUKA 1LA0A 2AUCA 1DT7B 2BBMA 3D10A 4A4BA 2KAYA 2LM5A 3EVVA 4U8DA 3WHUB 1SW8A 2LVKA 1WLZA 2K7CA 3BOWA 4ICBA 1C7VA 5AERA 1F4QA 1FF1A 2HQWA 2K8MB 1CKKA 1KFUL 2GGZA 1K9PA 4ZCVA 1B7TZ 1BT6A 4XJKA 3VROA 2ZFDA 2FCEA 2KQ6A 2Y1MA 1SBJA 2KFFA 3KHEA 1CFPA 4OKHA 2M49B 4FQOA 1KFXL 1QATA 3D0YB 4MBEA 5CPVA 2BCXA 1QV0A 1TIZA 4WQ2A 1CB1A 1HT9A 2LLTA 1XVJA 2L50A 2JRFA 1AUIB 1TCOB 1ZOTB 1LINA 5FYXA 2EC6B 1N2DA 2LNKA 1OQPA 2NCOA 4GBAA 4XYNA 5I2LA 1NCXA 2GGMA 1SNLA 1J1DA 5GQQC 2JNXA 1B8CA 1B9AA 4I5JA 2H61A 1HQVA 1CDMA 1UHNA 1YTZC 2D8NA 3BYAA 3DF0A 4HRHA 4PHMA 2BKIB 3IF7A 2PRUA 1ZMZA 1IRJA 1YRUB 1B8RA 1CDLA 3BOWB 4OR9B 2K7DA 1G8IA 4NQGA 5CSFA 2F2OA 1YURA 3SIBA 1J7PA 2I7AA 3H4SE 3EKHA 2KYCA 1J7QA 1IH0A 3EKJA 1TRFA 1PVAA 2KBIA 4C0LA 3GK1A 4TNCA 3EVRA 3O78A 4OV2A 3DVKA 1D1OA 2BBNA 1DF0B 2MHHA 1ODBA 1NWDA 3NSKA 2CBLA 1S5GZ 4GGFA 1NX1A 1EL4A 1KK7Z 4I5LB 3SG2A 2EC6C 2G2BA 3O4YA 3TZ1A 2O5GA 2KOTA 1AVSA 2ZKMX 3BUNB 2M7NA 3VRRA 1EXRA 2K2AA 3DVJA 2WORA 2LLUA 1SCVA 4NDBA 1QASA 1MR8A 1L2OB 2GV5A 2NLNA 4UPGA 3KPXA 1QV1A 1S1EA 1K95A 2KYFA 1CDNA 2KI4B 1A29A 2F2PA 5B8IB 3LK0A 4PHNA 2M3WA 4A4CA 1RFJA 5ER4X 3IQQA 1XK4C 1PRWA 2Q4UA 5HLOA 3RLZA 4AOMA 2JT8A 1JBAA 2M29A 2BKHB 2Q91A 2K0JA 1MF8B 1DGUA 2H2KA 3KEVA 1DVIA 1NX0A 1J7RA 1S6IA 2PMYA 2LMTA 1B8LA 1TN4A 2MA2A 3LK1A 1QS7A 1LA3A 1Y6WA 2E6WA 4ORBB 1K94A 3I5IB 4GPLB 3PSRA 2O60A 1F55A 5KSZA 2E30A 1FW4A 2OTGB 1KQVA 4YGBB 1JUOA 1DJXA 1WLMA 2ZNDA 1L2OC 4ORAB 1F70A 2LC5A 4GFTA 4MZJA 1SMGA 1PVBA 2G9BA 2H61C 2KI4C 2MJWB 2LUCA 2P6BB 2CNPA 5AANA 1ALWA 5JJGA 1F54A 1UHHA 3D0YA 3QRXA 1UURA 1AJ4A 1N0YA 2F33A 1BLQA 1SL8A 3SG4A 4MRXA 5J3XA 2LAPA 1CM1A 3PALA 1YUSA 3WHTB 2M8UA 1WY9A 1R6PA 1YUTA 3CR5X 3O6BA 3SG6A 2JXCA 3AAKA 3AKAA 2PALA 3CGAA 4I5NB 3VRNA 1Y0VH 1WDCB 3EK8A 5K89A 1OZSA 1QLSA 4WQ3A 2SASA 3I5IC 1GQMA 3SG7A 2LV7A 1JWDA 4D1EA 2BECA 1KSMA 2OTGC 2JOJA 2LHLA 4CIDA 1S5GY 4PE7A 1KK7Y 1XK4A 1X02A 1GGZA 2ZNEA 3LLEA 5IBWA 5KTYA 1VRKA 3KO0A 1S3PA 1KQMB 4F0ZB 1RTP1 4MLWA 3A4UB 3K21A 4NDDA 1CFCA 1G33A 1M39A 4CFQA 2AMIA 2L0PA 2BE4A 1WRZA 1RROA 4ORCB 4M2QA
chains in the Genus database with same CATH superfamily
3OB2B 1SL9A 3E3RA 4OVNF 2JT3A 1DF0A 2KAXA 3BFAA 3TUYB 4YRUA 1U5IA 2PSRA 2SCPA 3DD4A 3OP0A 5HYDA 2JT0A 2JU0A 5DKQA 1IIOA 1YVLA 1K2HA 1TNQA 5I2OA 1K93D 1NYAA 1NIWA 1WDCC 1SKTA 2QPTA 1DMOA 2LP3A 1CNPA 2I2RE 2M1UA 1MXEA 4PCWA 1YUUA 2B1UA 5AEQA 2F3YA 4IJ7A 1N65A 4N5XA 3I5GB 1DJHA 1K8UA 1MUXA 2LMVA 1UHKA 1EJ3A 3IQOA 2Y5IA 2CCMA 2KLEA 2OPOA 3FE8A 3PM2A 1CFDA 2KFHA 4E68A 1E8AA 2BCBA 1SK6D 2RGIA 1TNWA 1F4OA 2LVVA 3L47A 1B4CA 1DJWA 2M9GA 5PALA 1KQMC 2BL0B 1DELA 1DTLA 2CT9A 2JTTA 2PASA 3BUXB 3CLNA 4MZLA 3ZNIA 5I8NA 1J7OA 1F71A 1H4BA 1DJYA 3PLFB 1DEKA 1TTXA 3VB1A 1WRKA 5CSNA 3SG3A 1XYDA 3LCPC 2KQYA 3D73A 3TUYC 1IG5A 1U5IB 4HREE 2LCPA 5D7FA 1IJ6A 3RZSA 3PM8A 2KGBC 2L4HA 1M31A 1IQ5A 2HETA 3K1EA 2LUXA 4MN0A 1PALA 3SS5A 2L2EA 1QVIZ 4F7FA 3CYZA 2MRDA 1Y1AA 1QX2A 1NPQA 3B88A 4INXA 3I5GC 3TS5B 3A8RA 2CXJA 2KGRA 2L51A 3IVTA 1DJIA 1W9ZA 1Z2CB 1DJGA 3TDZA 1H8BA 4CFRA 3CTNA 4N1FA 1BMOA 2L5XB 1TWOA 3CWGA 3PFVA 1B1GA 3EVUA 3BJHA 1UWOA 2IS9A 2MLFC 1BR4B 4MRYA 2LHIA 1DJZA 2JPTA 1OOJA 2LVJA 3BUOB 3S0DA 2GTEA 1SY9A 1AK8A 3NHTA 3CZTX 2BL0C 5I2QA 1YX7A 2I94A 2M0RA 3SG5A 2WCFA 1BODA 1SRAA 4C0JA 1B7TY 5DICA 3SJSA 1SCMB 1YX8A 3JVTB 1OOIX 1ORGA 1PULA 4FTGA 1IKUA 4YBHB 4L9MA 2FOTA 2ZRTA 3WXAA 4GAOA 1S6JA 4DCKA 4DS7A 3FS7A 1IQ3A 1NP8A 2K7BA 4PE4A 1OMVA 1QX5B 2M1KB 3DZTA 5DKNA 1NCZA 1ZUZA 1KFUS 2JTZA 1XFUO 2JC2A 1OMDA 3L4LA 4KYNA 5ER5A 1JC2A 1XFWO 4PALA 3TS5C 3FIAA 1KWOB 1IJ5A 1CTRA 2QEVA 3JTDB 1QWVA 1YVHA 3EK4A 3CDNA 5JOLA 3NGVA 1UUSA 2EHBA 1SR6B 1NX3A 2L98A 1W7IB 2AAOA 2ZRSA 1ZFSA 2HPSA 2K7OA 1Y1UA 3I5FB 1QLKA 1A4PA 5HL1A 4QJ3B 3ZWHA 2FCDA 3N7HA 4M2OA 1QTXA 1SCMC 4JD9A 1CLBA 3TDIA 1SL7A 1V1FA 3S0FA 3JVTC 3HCMA 1SPYA 2NZ0A 4YI9A 3TDUA 4YGDB 3C1VA 4QJ5B 3OB1B 1ALVA 1S6CA 2L5YA 3BUWB 2TN4A 4R1EA 2KNEA 2LANA 4CPVA 1GJYA 4JWQA 3VRQA 2WC6A 3HX4A 2F8PA 3GOFA 1FPWA 1BU3A 2ZN8A 2EGDA 3DVEA 2KFGA 1EG3A 4YI8A 3VGOA 1A03A 1KWOC 1YR5A 3JTDC 1S26D 1TUZA 1QVIY 5CSJA 1RECA 5F6TA 1EH2A 1AHRA 3EK7A 1SR6C 4DIRA 3NSOA 2KBMA 1XFVO 3BQ3A 3UNWA 2QACA 1XFXO 2JNFA 4MZKA 3I5FC 1QXPA 4ZCUA 1A75A 1LKJA 1NUBA 2QDIA 2QEOA 1M45A 1S36A 3R1OA 3RM1A 4MVFA 1KSOA 3BXKA 1GM0A 2MBXA 1RWYA 2WC5A 2NXQA 5HKYA 4OCIA 4I5KA 1G4YR 5AFPA 1OOFA 1CDPA 4NDCA 3V2LA 3DVMA 1YRTB 3FWBA 1CLMA 2A4JA 4N1GA 1K96A 1AP4A 1XFZO 4BY5A 1K90D 1IGVA 5HKZA 1QIVA 4PE0A 2NCPA 1OZOA 4AQJA 2V53A 4YGEB 1QIWA 2PYQA 3ICBA 3CZ2A 3OX6A 2KLDA 1QX7A 2OS8B 3I5HB 3OHMB 4M2PA 1PK0D 4GGNA 3O2PA 5AXIA 5TNCA 2I18A 4MEWA 2BAPA 2COLB 3PN7B 1LS8A 2WCMA 3R72A 1A75B 1LVCD 1V1GA 4PE1A 1DGVA 2KHNA 3AKBA 1C3YA 1BOCA 1BF5A 4YGAA 3NXAA 4WRIA 1WRLA 1XO5A 1B47A 2BE6A 4HRGA 4C0KA 4DRWA 4PHJA 4XJKB 5KU1A 1FI6A 1RJVA 2JQ6A 1UHJA 4MSPA 3MSEB 4FQTA 2WCJA 1CM4A 1PSBA 1Z4HA 5DKRA 2MAZA 1CMGA 1UHIA 5FI2A 4ETOA 1Q80A 2MLEC 1CLLA 1NCYA 1W7JB 2JZIA 1TNXA 2LP2A 1A2XA 1JFKA 1KK8B 2KSPA 2WCLA 4P2YB 1L7ZA 2KI6D 5HKWA 3SS4A 5I94A 1FBVA 1AJ5A 4HSZA 2OS8C 3I5HC 1UP5A 4P5OE 1OMRA 1LXFC 1FI5A 1TCFA 2LVIA 3BUMB 1IWQA 2LLSA 3FWCA 3S0EA 4AQIA 2WNDA 3PN7C 3DF0B 3L4AA 4JQ0D 1XFYO 3S0AA 1NX2A 1TOPA 1XA5A 1KCYA 1MHOA 2VRGA 2HF5A 1MQ1A 3AAJA 2ISDA 3D77A 1PSRA 1JF2A 4IL1A 5D69A 1M46A 2PQLA 2WOSA 4PT1A 2JXLA 3B7AA 1C7WA 2DOQA 3OX5A 4OZDA 1BG1A 1BR1B 3O4XA 1J55A 2Y4QA 3D74A 3B86A 1KFXS 2M97A 4GNKB 3CS1A 3DYEA 1ZACA 5CSIA 2WCEA 4JPZB 4BY4A 1K9UA 3DY9A 2KAVA 2PVBA 3CR2A 1KK8C 1JF0A 3SIAA 3NSLA 1GGWA 1MXLC 4YGCB 2JULA 1QJTA 1EG4A 5HLVA 4Q04A 3CR4X 4USLA 1NSHA 2JWWA 1C07A 3KF9A 3VRPA 4QJ4B 2R2IA 2BCAA 1MWNA 1OE9B 1OSAA 2KDHA 3GK4X 3B6XA 1JFJA 5BPJA 2ERBA 3CABA 2KI6C 3F45A 1J1EA 2K61A 1SYMA 2FJUB 2M7LA 2F3ZA 2Y1NA 2ZN9A 2FJYA 3LL8B 4DUQA 1C3ZA 2HQ8A 3BFHA 1M63B 1BJFA 3NSIA 2WC8A 2CTNA 1K9KA 2LMUA 1CMFA 3GK2A 1F8HA 2K2FA 5G08A 1TNPA 2QEHA 2L4IA 3WNXB 2P70A 1CFFA 3S0BA 2LE9B 2WCBA 3B87A 3M0WA 1RK9A 1Y1XA 4GGFC 4PHKA 3PATA 4PDZA 1R2UA 4CLNA 4GUKA 1LA0A 2AUCA 1DT7B 2BBMA 3D10A 4A4BA 2KAYA 2LM5A 3EVVA 3R1PA 4U8DA 3UO9A 3WHUB 1SW8A 2LVKA 1WLZA 2K7CA 3BOWA 4ICBA 1C7VA 5AERA 1F4QA 1FF1A 2HQWA 2K8MB 1CKKA 1KFUL 2GGZA 1K9PA 4ZCVA 1B7TZ 1BT6A 4XJKA 3VROA 2ZFDA 2FCEA 2KQ6A 3QMEA 2Y1MA 1SBJA 2KFFA 3KHEA 1CFPA 4OKHA 2L2CA 2M49B 4FQOA 1KFXL 1QATA 3D0YB 4MBEA 5CPVA 2BCXA 1QV0A 1TIZA 4WQ2A 1CB1A 1HT9A 2LLTA 1XVJA 2L50A 2JRFA 1AUIB 1TCOB 1ZOTB 1LINA 5FYXA 2EC6B 1N2DA 2LNKA 1OQPA 1P28A 2NCOA 4GBAA 4XYNA 5I2LA 1NCXA 2GGMA 1SNLA 1J1DA 5GQQC 2JNXA 1B8CA 1DC1A 1B9AA 4I5JA 2H61A 1HQVA 1CDMA 1UHNA 1YTZC 2D8NA 2WCKA 3BYAA 3DF0A 4HRHA 4PHMA 2BKIB 3IF7A 2PRUA 1ZMZA 1IRJA 1YRUB 1B8RA 1CDLA 3BOWB 3D78A 4OR9B 2K7DA 1G8IA 4NQGA 5CSFA 2F2OA 1YURA 3SIBA 1J7PA 2I7AA 3H4SE 3EKHA 2KYCA 1J7QA 1IH0A 3EKJA 1T14A 1TRFA 1PVAA 2KBIA 4C0LA 3GK1A 4TNCA 3EVRA 3O78A 4OV2A 3DVKA 3CZ1A 1D1OA 2BBNA 2H8VA 1DF0B 2MHHA 1ODBA 1NWDA 3NSKA 2CBLA 1S5GZ 4GGFA 1NX1A 1EL4A 1KK7Z 2WCHA 4I5LB 3SG2A 3R1VA 2EC6C 2G2BA 3O4YA 3TZ1A 2O5GA 2KOTA 1AVSA 2ZKMX 3BFBA 2M7NA 3BUNB 3VRRA 1EXRA 2K2AA 3Q8IA 3DVJA 2WORA 2LLUA 1SCVA 4NDBA 1QASA 1MR8A 1L2OB 2GV5A 2NLNA 4UPGA 3KPXA 1QV1A 1S1EA 3EG5B 1K95A 2KYFA 1CDNA 2KI4B 1A29A 2KPHA 2F2PA 5B8IB 3LK0A 4JKTA 4PHNA 1DQEA 2M3WA 4A4CA 5D3OA 3DXLA 1RFJA 5ER4X 3OBVA 3IQQA 1XK4C 1PRWA 2Q4UA 5HLOA 3RLZA 4AOMA 2JT8A 1JBAA 2M29A 2BKHB 2Q91A 2K0JA 1MF8B 1DGUA 2H2KA 3KEVA 1DVIA 1NX0A 1J7RA 1S6IA 2PMYA 2LMTA 3D75A 1B8LA 1TN4A 2MA2A 3LK1A 1QS7A 1LA3A 1Y6WA 2E6WA 4ORBB 3PJIA 1K94A 3I5IB 4GPLB 5FI6A 3PSRA 2O60A 1F55A 5KSZA 1OOGA 1FW4A 1SSEB 2E30A 2OTGB 1KQVA 4YGBB 1JUOA 1DJXA 1WLMA 1OOHA 2ZNDA 3SS3A 1L2OC 4ORAB 1F70A 2LC5A 3FE6A 4GFTA 4MZJA 1SMGA 1PVBA 2G9BA 2H61C 2KI4C 2MJWB 2LUCA 1TUJA 2CNPA 2P6BB 1ALWA 5AANA 5JJGA 2BNXA 1UHHA 1XFRA 1F54A 3D0YA 3QRXA 1UURA 1AJ4A 1N0YA 5EL2A 2F33A 1BLQA 3OGNA 1SL8A 3SG4A 4MRXA 2YGUA 5J3XA 2LAPA 1CM1A 3PALA 1YUSA 3S0GA 3WHTB 2M8UA 1WY9A 1R6PA 1YUTA 3CR5X 3O6BA 3SG6A 2JXCA 3AAKA 3FE9A 3AKAA 2PALA 3CGAA 4I5NB 3VRNA 1Y0VH 1WDCB 3EK8A 2JPOA 5FI7A 1OW4A 5K89A 1OZSA 1QLSA 4WQ3A 2QEBA 2SASA 3I5IC 1GQMA 3SG7A 2LV7A 1JWDA 4D1EA 3D76A 2BECA 1KSMA 2OTGC 2JOJA 2K60A 2LHLA 4CIDA 1S5GY 4PE7A 1KK7Y 3CZ0A 1XK4A 1X02A 1GGZA 2P71A 2ZNEA 3LLEA 5IBWA 5KTYA 1VRKA 3KO0A 3NHIA 4INWA 1S3PA 1KQMB 4F0ZB 1RTP1 4MLWA 3A4UB 3K21A 4NDDA 1CFCA 1G33A 1M39A 1JSAA 4CFQA 2AMIA 2L0PA 2BE4A 1WRZA 1RROA 4ORCB 4M2QA
chains in the Genus database with same CATH topology
3OB2B 1SL9A 3E3RA 4OVNF 2JT3A 1DF0A 2KAXA 3TUYB 4YRUA 1U5IA 2PSRA 2SCPA 3DD4A 3OP0A 5HYDA 2JT0A 2JU0A 5DKQA 1YVLA 1K2HA 1TNQA 5I2OA 1K93D 1NYAA 1NIWA 1WDCC 1SKTA 2QPTA 1DMOA 2LP3A 1CNPA 2I2RE 2M1UA 1MXEA 4PCWA 1YUUA 2B1UA 5AEQA 2F3YA 4N5XA 1N65A 3I5GB 1DJHA 1K8UA 1MUXA 2LMVA 1UHKA 1EJ3A 3IQOA 2Y5IA 2CCMA 2OPOA 1CFDA 2KFHA 4E68A 1E8AA 2BCBA 1SK6D 2RGIA 1TNWA 1F4OA 2LVVA 1B4CA 1DJWA 2M9GA 5PALA 1KQMC 2BL0B 1DTLA 2CT9A 2JTTA 2PASA 3BUXB 3CLNA 4MZLA 5I8NA 3ZNIA 1F71A 1J7OA 1H4BA 1DJYA 3PLFB 1TTXA 1WRKA 5CSNA 3SG3A 1XYDA 3LCPC 2KQYA 3TUYC 1IG5A 1U5IB 4HREE 2LCPA 5D7FA 1IJ6A 3PM8A 2KGBC 2L4HA 1M31A 1IQ5A 2HETA 4MN0A 2LUXA 1PALA 2L2EA 1QVIZ 2MRDA 1Y1AA 1QX2A 1NPQA 3I5GC 3TS5B 3A8RA 2CXJA 2KGRA 2L51A 1DJIA 3TDZA 1DJGA 1H8BA 4CFRA 3CTNA 4N1FA 1BMOA 2L5XB 3CWGA 3PFVA 1B1GA 3EVUA 1UWOA 2IS9A 2MLFC 1BR4B 4MRYA 2LHIA 1DJZA 2JPTA 1OOJA 2LVJA 3BUOB 1AK8A 1JSAA 1SY9A 3CZTX 2BL0C 5I2QA 1YX7A 2I94A 2M0RA 3SG5A 2WCFA 1BODA 1SRAA 4C0JA 1B7TY 3SJSA 1SCMB 1YX8A 3JVTB 1PULA 4FTGA 1IKUA 4YBHB 4L9MA 2FOTA 2ZRTA 3WXAA 4GAOA 1S6JA 4DCKA 4DS7A 3FS7A 1IQ3A 1NP8A 2K7BA 4PE4A 1OMVA 1QX5B 2M1KB 5DKNA 1NCZA 1ZUZA 1KFUS 2JTZA 1XFUO 2JC2A 1OMDA 5ER5A 1JC2A 1XFWO 4PALA 3TS5C 3FIAA 1KWOB 1IJ5A 1CTRA 3JTDB 1YVHA 3EK4A 5JOLA 1UUSA 2EHBA 1SR6B 1NX3A 2L98A 1W7IB 2AAOA 2ZRSA 1ZFSA 2HPSA 2K7OA 1Y1UA 3I5FB 1QLKA 1A4PA 4QJ3B 3ZWHA 2FCDA 4M2OA 1QTXA 1SCMC 1CLBA 3TDIA 1SL7A 1V1FA 3JVTC 3HCMA 1SPYA 2NZ0A 4YI9A 3TDUA 4YGDB 3C1VA 4QJ5B 3OB1B 1ALVA 1S6CA 3BUWB 2TN4A 4R1EA 2KNEA 2LANA 4CPVA 1GJYA 4JWQA 3VRQA 3HX4A 2F8PA 3GOFA 1FPWA 1BU3A 2ZN8A 2EGDA 3DVEA 2KFGA 1EG3A 4YI8A 3VGOA 1A03A 1KWOC 1YR5A 3JTDC 1S26D 5CSJA 1QVIY 5F6TA 1RECA 1EH2A 1AHRA 3EK7A 1SR6C 4DIRA 3NSOA 2KBMA 1XFVO 3BQ3A 2QACA 1XFXO 2JNFA 4MZKA 3I5FC 1QXPA 4ZCUA 1A75A 1LKJA 1NUBA 1M45A 1S36A 3RM1A 4MVFA 1KSOA 3BXKA 2MBXA 1RWYA 2NXQA 5HKYA 4OCIA 4I5KA 1G4YR 5AFPA 1CDPA 4NDCA 3DVMA 1YRTB 3FWBA 1CLMA 2A4JA 4N1GA 1K96A 1AP4A 1XFZO 4BY5A 1K90D 1IGVA 5HKZA 1QIVA 4PE0A 2NCPA 1OZOA 4AQJA 2V53A 4YGEB 1QIWA 3ICBA 3OX6A 1QX7A 2OS8B 3I5HB 3OHMB 4M2PA 1PK0D 4GGNA 3O2PA 5AXIA 5TNCA 2I18A 4MEWA 2COLB 3PN7B 4PE1A 1A75B 1LVCD 1V1GA 1DGVA 2KHNA 3AKBA 1BOCA 1BF5A 4YGAA 3NXAA 4WRIA 1WRLA 1XO5A 1B47A 2BE6A 4HRGA 4C0KA 4DRWA 4PHJA 4XJKB 5KU1A 1FI6A 1RJVA 2JQ6A 1UHJA 4MSPA 3MSEB 1CM4A 1PSBA 5DKRA 2MAZA 1CMGA 1UHIA 4ETOA 1Q80A 2MLEC 1CLLA 1NCYA 1W7JB 2JZIA 1TNXA 2LP2A 1A2XA 1JFKA 1KK8B 2KSPA 4P2YB 1L7ZA 2KI6D 5HKWA 1FBVA 1AJ5A 4HSZA 2OS8C 3I5HC 1UP5A 4P5OE 1OMRA 1LXFC 1FI5A 1TCFA 2LVIA 3BUMB 1IWQA 2LLSA 3FWCA 4AQIA 2WNDA 3PN7C 3DF0B 4JQ0D 1XFYO 1NX2A 1TOPA 1XA5A 1KCYA 1MHOA 2VRGA 2HF5A 1MQ1A 3AAJA 2ISDA 1PSRA 1JF2A 4IL1A 5D69A 1M46A 2WOSA 2JXLA 3OX5A 1C7WA 2DOQA 1BG1A 1BR1B 1J55A 2Y4QA 1KFXS 2M97A 4GNKB 3CS1A 5CSIA 1ZACA 2WCEA 4JPZB 4BY4A 1K9UA 2KAVA 2PVBA 3CR2A 1KK8C 1JF0A 3SIAA 3NSLA 1GGWA 1MXLC 4YGCB 2JULA 1QJTA 1EG4A 5HLVA 4Q04A 3CR4X 4USLA 1NSHA 2JWWA 1C07A 3KF9A 3VRPA 4QJ4B 2R2IA 2BCAA 1MWNA 1OE9B 1OSAA 2KDHA 3GK4X 1JFJA 5BPJA 2KI6C 3F45A 1J1EA 2K61A 1SYMA 2FJUB 2M7LA 2F3ZA 2Y1NA 2ZN9A 3LL8B 4DUQA 2HQ8A 1M63B 1BJFA 3NSIA 2WC8A 2CTNA 1K9KA 2LMUA 1CMFA 3GK2A 1F8HA 2K2FA 5G08A 1TNPA 2L4IA 3WNXB 1CFFA 2LE9B 2WCBA 3M0WA 1RK9A 1Y1XA 4GGFC 4PHKA 3PATA 4PDZA 1R2UA 4CLNA 4GUKA 1LA0A 2AUCA 1DT7B 2BBMA 3D10A 4A4BA 2KAYA 2LM5A 3EVVA 4U8DA 3WHUB 1SW8A 2LVKA 1WLZA 2K7CA 3BOWA 4ICBA 1C7VA 5AERA 1F4QA 1FF1A 2HQWA 2K8MB 1CKKA 1KFUL 2GGZA 1K9PA 4ZCVA 1B7TZ 1BT6A 4XJKA 3VROA 2ZFDA 2FCEA 2KQ6A 2Y1MA 1SBJA 2KFFA 3KHEA 1CFPA 4OKHA 2M49B 4FQOA 1KFXL 1QATA 3D0YB 4MBEA 5CPVA 2BCXA 1QV0A 1TIZA 4WQ2A 1CB1A 1HT9A 2LLTA 1XVJA 2L50A 2JRFA 1AUIB 1TCOB 1ZOTB 1LINA 5FYXA 2EC6B 1N2DA 2LNKA 1OQPA 2NCOA 4GBAA 4XYNA 5I2LA 1NCXA 2GGMA 1SNLA 1J1DA 5GQQC 2JNXA 1B8CA 1B9AA 4I5JA 2H61A 1HQVA 1CDMA 1UHNA 1YTZC 2D8NA 3BYAA 3DF0A 4HRHA 4PHMA 2BKIB 3IF7A 2PRUA 1ZMZA 1IRJA 1YRUB 1B8RA 1CDLA 3BOWB 4OR9B 2K7DA 1G8IA 4NQGA 5CSFA 2F2OA 1YURA 3SIBA 1J7PA 2I7AA 3H4SE 3EKHA 2KYCA 1J7QA 1IH0A 3EKJA 1TRFA 1PVAA 2KBIA 4C0LA 3GK1A 4TNCA 3EVRA 3O78A 4OV2A 3DVKA 1D1OA 2BBNA 1DF0B 2MHHA 1ODBA 1NWDA 3NSKA 2CBLA 1S5GZ 4GGFA 1NX1A 1EL4A 1KK7Z 4I5LB 3SG2A 2EC6C 2G2BA 3O4YA 3TZ1A 2O5GA 2KOTA 1AVSA 2ZKMX 3BUNB 2M7NA 3VRRA 1EXRA 2K2AA 3DVJA 2WORA 2LLUA 1SCVA 4NDBA 1QASA 1MR8A 1L2OB 2GV5A 2NLNA 4UPGA 3KPXA 1QV1A 1S1EA 1K95A 2KYFA 1CDNA 2KI4B 1A29A 2F2PA 5B8IB 3LK0A 4PHNA 2M3WA 4A4CA 1RFJA 5ER4X 3IQQA 1XK4C 1PRWA 2Q4UA 5HLOA 3RLZA 4AOMA 2JT8A 1JBAA 2M29A 2BKHB 2Q91A 2K0JA 1MF8B 1DGUA 2H2KA 3KEVA 1DVIA 1NX0A 1J7RA 1S6IA 2PMYA 2LMTA 1B8LA 1TN4A 2MA2A 3LK1A 1QS7A 1LA3A 1Y6WA 2E6WA 4ORBB 1K94A 3I5IB 4GPLB 3PSRA 2O60A 1F55A 5KSZA 2E30A 1FW4A 2OTGB 1KQVA 4YGBB 1JUOA 1DJXA 1WLMA 2ZNDA 1L2OC 4ORAB 1F70A 2LC5A 4GFTA 4MZJA 1SMGA 1PVBA 2G9BA 2H61C 2KI4C 2MJWB 2LUCA 2P6BB 2CNPA 5AANA 1ALWA 5JJGA 1F54A 1UHHA 3D0YA 3QRXA 1UURA 1AJ4A 1N0YA 2F33A 1BLQA 1SL8A 3SG4A 4MRXA 5J3XA 2LAPA 1CM1A 3PALA 1YUSA 3WHTB 2M8UA 1WY9A 1R6PA 1YUTA 3CR5X 3O6BA 3SG6A 2JXCA 3AAKA 3AKAA 2PALA 3CGAA 4I5NB 3VRNA 1Y0VH 1WDCB 3EK8A 5K89A 1OZSA 1QLSA 4WQ3A 2SASA 3I5IC 1GQMA 3SG7A 2LV7A 1JWDA 4D1EA 2BECA 1KSMA 2OTGC 2JOJA 2LHLA 4CIDA 1S5GY 4PE7A 1KK7Y 1XK4A 1X02A 1GGZA 2ZNEA 3LLEA 5IBWA 5KTYA 1VRKA 3KO0A 1S3PA 1KQMB 4F0ZB 1RTP1 4MLWA 3A4UB 3K21A 4NDDA 1CFCA 1G33A 1M39A 4CFQA 2AMIA 2L0PA 2BE4A 1WRZA 1RROA 4ORCB 4M2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB2 B;  1SL9 A;  3E3R A;  4OVN F;  2JT3 A;  1DF0 A;  2KAX A;  3TUY B;  4YRU A;  1U5I A;  2PSR A;  2SCP A;  3DD4 A;  3OP0 A;  5HYD A;  2JT0 A;  2JU0 A;  5DKQ A;  1YVL A;  1K2H A;  1TNQ A;  5I2O A;  1K93 D;  1NYA A;  1NIW A;  1WDC C;  1SKT A;  2QPT A;  1DMO A;  2LP3 A;  1CNP A;  2I2R E;  2M1U A;  1MXE A;  4PCW A;  1YUU A;  2B1U A;  5AEQ A;  2F3Y A;  4N5X A;  1N65 A;  3I5G B;  1DJH A;  1K8U A;  1MUX A;  2LMV A;  1UHK A;  1EJ3 A;  3IQO A;  2Y5I A;  2CCM A;  2OPO A;  1CFD A;  2KFH A;  4E68 A;  1E8A A;  2BCB A;  1SK6 D;  2RGI A;  1TNW A;  1F4O A;  2LVV A;  1B4C A;  1DJW A;  2M9G A;  5PAL A;  1KQM C;  2BL0 B;  1DTL A;  2CT9 A;  2JTT A;  2PAS A;  3BUX B;  3CLN A;  4MZL A;  5I8N A;  3ZNI A;  1F71 A;  1J7O A;  1H4B A;  1DJY A;  3PLF B;  1TTX A;  1WRK A;  5CSN A;  3SG3 A;  1XYD A;  3LCP C;  2KQY A;  3TUY C;  1IG5 A;  1U5I B;  4HRE E;  2LCP A;  5D7F A;  1IJ6 A;  3PM8 A;  2KGB C;  2L4H A;  1M31 A;  1IQ5 A;  2HET A;  4MN0 A;  2LUX A;  1PAL A;  2L2E A;  1QVI Z;  2MRD A;  1Y1A A;  1QX2 A;  1NPQ A;  3I5G C;  3TS5 B;  3A8R A;  2CXJ A;  2KGR A;  2L51 A;  1DJI A;  3TDZ A;  1DJG A;  1H8B A;  4CFR A;  3CTN A;  4N1F A;  1BMO A;  2L5X B;  3CWG A;  3PFV A;  1B1G A;  3EVU A;  1UWO A;  2IS9 A;  2MLF C;  1BR4 B;  4MRY A;  2LHI A;  1DJZ A;  2JPT A;  1OOJ A;  2LVJ A;  3BUO B;  1AK8 A;  1JSA A;  1SY9 A;  3CZT X;  2BL0 C;  5I2Q A;  1YX7 A;  2I94 A;  2M0R A;  3SG5 A;  2WCF A;  1BOD A;  1SRA A;  4C0J A;  1B7T Y;  3SJS A;  1SCM B;  1YX8 A;  3JVT B;  1PUL A;  4FTG A;  1IKU A;  4YBH B;  4L9M A;  2FOT A;  2ZRT A;  3WXA A;  4GAO A;  1S6J A;  4DCK A;  4DS7 A;  3FS7 A;  1IQ3 A;  1NP8 A;  2K7B A;  4PE4 A;  1OMV A;  1QX5 B;  2M1K B;  5DKN A;  1NCZ A;  1ZUZ A;  1KFU S;  2JTZ A;  1XFU O;  2JC2 A;  1OMD A;  5ER5 A;  1JC2 A;  1XFW O;  4PAL A;  3TS5 C;  3FIA A;  1KWO B;  1IJ5 A;  1CTR A;  3JTD B;  1YVH A;  3EK4 A;  5JOL A;  1UUS A;  2EHB A;  1SR6 B;  1NX3 A;  2L98 A;  1W7I B;  2AAO A;  2ZRS A;  1ZFS A;  2HPS A;  2K7O A;  1Y1U A;  3I5F B;  1QLK A;  1A4P A;  4QJ3 B;  3ZWH A;  2FCD A;  4M2O A;  1QTX A;  1SCM C;  1CLB A;  3TDI A;  1SL7 A;  1V1F A;  3JVT C;  3HCM A;  1SPY A;  2NZ0 A;  4YI9 A;  3TDU A;  4YGD B;  3C1V A;  4QJ5 B;  3OB1 B;  1ALV A;  1S6C A;  3BUW B;  2TN4 A;  4R1E A;  2KNE A;  2LAN A;  4CPV A;  1GJY A;  4JWQ A;  3VRQ A;  3HX4 A;  2F8P A;  3GOF A;  1FPW A;  1BU3 A;  2ZN8 A;  2EGD A;  3DVE A;  2KFG A;  1EG3 A;  4YI8 A;  3VGO A;  1A03 A;  1KWO C;  1YR5 A;  3JTD C;  1S26 D;  5CSJ A;  1QVI Y;  5F6T A;  1REC A;  1EH2 A;  1AHR A;  3EK7 A;  1SR6 C;  4DIR A;  3NSO A;  2KBM A;  1XFV O;  3BQ3 A;  2QAC A;  1XFX O;  2JNF A;  4MZK A;  3I5F C;  1QXP A;  4ZCU A;  1A75 A;  1LKJ A;  1NUB A;  1M45 A;  1S36 A;  3RM1 A;  4MVF A;  1KSO A;  3BXK A;  2MBX A;  1RWY A;  2NXQ A;  5HKY A;  4OCI A;  4I5K A;  1G4Y R;  5AFP A;  1CDP A;  4NDC A;  3DVM A;  1YRT B;  3FWB A;  1CLM A;  2A4J A;  4N1G A;  1K96 A;  1AP4 A;  1XFZ O;  4BY5 A;  1K90 D;  1IGV A;  5HKZ A;  1QIV A;  4PE0 A;  2NCP A;  1OZO A;  4AQJ A;  2V53 A;  4YGE B;  1QIW A;  3ICB A;  3OX6 A;  1QX7 A;  2OS8 B;  3I5H B;  3OHM B;  4M2P A;  1PK0 D;  4GGN A;  3O2P A;  5AXI A;  5TNC A;  2I18 A;  4MEW A;  2COL B;  3PN7 B;  4PE1 A;  1A75 B;  1LVC D;  1V1G A;  1DGV A;  2KHN A;  3AKB A;  1BOC A;  1BF5 A;  4YGA A;  3NXA A;  4WRI A;  1WRL A;  1XO5 A;  1B47 A;  2BE6 A;  4HRG A;  4C0K A;  4DRW A;  4PHJ A;  4XJK B;  5KU1 A;  1FI6 A;  1RJV A;  2JQ6 A;  1UHJ A;  4MSP A;  3MSE B;  1CM4 A;  1PSB A;  5DKR A;  2MAZ A;  1CMG A;  1UHI A;  4ETO A;  1Q80 A;  2MLE C;  1CLL A;  1NCY A;  1W7J B;  2JZI A;  1TNX A;  2LP2 A;  1A2X A;  1JFK A;  1KK8 B;  2KSP A;  4P2Y B;  1L7Z A;  2KI6 D;  5HKW A;  1FBV A;  1AJ5 A;  4HSZ A;  2OS8 C;  3I5H C;  1UP5 A;  4P5O E;  1OMR A;  1LXF C;  1FI5 A;  1TCF A;  2LVI A;  3BUM B;  1IWQ A;  2LLS A;  3FWC A;  4AQI A;  2WND A;  3PN7 C;  3DF0 B;  4JQ0 D;  1XFY O;  1NX2 A;  1TOP A;  1XA5 A;  1KCY A;  1MHO A;  2VRG A;  2HF5 A;  1MQ1 A;  3AAJ A;  2ISD A;  1PSR A;  1JF2 A;  4IL1 A;  5D69 A;  1M46 A;  2WOS A;  2JXL A;  3OX5 A;  1C7W A;  2DOQ A;  1BG1 A;  1BR1 B;  1J55 A;  2Y4Q A;  1KFX S;  2M97 A;  4GNK B;  3CS1 A;  5CSI A;  1ZAC A;  2WCE A;  4JPZ B;  4BY4 A;  1K9U A;  2KAV A;  2PVB A;  3CR2 A;  1KK8 C;  1JF0 A;  3SIA A;  3NSL A;  1GGW A;  1MXL C;  4YGC B;  2JUL A;  1QJT A;  1EG4 A;  5HLV A;  4Q04 A;  3CR4 X;  4USL A;  1NSH A;  2JWW A;  1C07 A;  3KF9 A;  3VRP A;  4QJ4 B;  2R2I A;  2BCA A;  1MWN A;  1OE9 B;  1OSA A;  2KDH A;  3GK4 X;  1JFJ A;  5BPJ A;  2KI6 C;  3F45 A;  1J1E A;  2K61 A;  1SYM A;  2FJU B;  2M7L A;  2F3Z A;  2Y1N A;  2ZN9 A;  3LL8 B;  4DUQ A;  2HQ8 A;  1M63 B;  1BJF A;  3NSI A;  2WC8 A;  2CTN A;  1K9K A;  2LMU A;  1CMF A;  3GK2 A;  1F8H A;  2K2F A;  5G08 A;  1TNP A;  2L4I A;  3WNX B;  1CFF A;  2LE9 B;  2WCB A;  3M0W A;  1RK9 A;  1Y1X A;  4GGF C;  4PHK A;  3PAT A;  4PDZ A;  1R2U A;  4CLN A;  4GUK A;  1LA0 A;  2AUC A;  1DT7 B;  2BBM A;  3D10 A;  4A4B A;  2KAY A;  2LM5 A;  3EVV A;  4U8D A;  3WHU B;  1SW8 A;  2LVK A;  1WLZ A;  2K7C A;  3BOW A;  4ICB A;  1C7V A;  5AER A;  1F4Q A;  1FF1 A;  2HQW A;  2K8M B;  1CKK A;  1KFU L;  2GGZ A;  1K9P A;  4ZCV A;  1B7T Z;  1BT6 A;  4XJK A;  3VRO A;  2ZFD A;  2FCE A;  2KQ6 A;  2Y1M A;  1SBJ A;  2KFF A;  3KHE A;  1CFP A;  4OKH A;  2M49 B;  4FQO A;  1KFX L;  1QAT A;  3D0Y B;  4MBE A;  5CPV A;  2BCX A;  1QV0 A;  1TIZ A;  4WQ2 A;  1CB1 A;  1HT9 A;  2LLT A;  1XVJ A;  2L50 A;  2JRF A;  1AUI B;  1TCO B;  1ZOT B;  1LIN A;  5FYX A;  2EC6 B;  1N2D A;  2LNK A;  1OQP A;  2NCO A;  4GBA A;  4XYN A;  5I2L A;  1NCX A;  2GGM A;  1SNL A;  1J1D A;  5GQQ C;  2JNX A;  1B8C A;  1B9A A;  4I5J A;  2H61 A;  1HQV A;  1CDM A;  1UHN A;  1YTZ C;  2D8N A;  3BYA A;  3DF0 A;  4HRH A;  4PHM A;  2BKI B;  3IF7 A;  2PRU A;  1ZMZ A;  1IRJ A;  1YRU B;  1B8R A;  1CDL A;  3BOW B;  4OR9 B;  2K7D A;  1G8I A;  4NQG A;  5CSF A;  2F2O A;  1YUR A;  3SIB A;  1J7P A;  2I7A A;  3H4S E;  3EKH A;  2KYC A;  1J7Q A;  1IH0 A;  3EKJ A;  1TRF A;  1PVA A;  2KBI A;  4C0L A;  3GK1 A;  4TNC A;  3EVR A;  3O78 A;  4OV2 A;  3DVK A;  1D1O A;  2BBN A;  1DF0 B;  2MHH A;  1ODB A;  1NWD A;  3NSK A;  2CBL A;  1S5G Z;  4GGF A;  1NX1 A;  1EL4 A;  1KK7 Z;  4I5L B;  3SG2 A;  2EC6 C;  2G2B A;  3O4Y A;  3TZ1 A;  2O5G A;  2KOT A;  1AVS A;  2ZKM X;  3BUN B;  2M7N A;  3VRR A;  1EXR A;  2K2A A;  3DVJ A;  2WOR A;  2LLU A;  1SCV A;  4NDB A;  1QAS A;  1MR8 A;  1L2O B;  2GV5 A;  2NLN A;  4UPG A;  3KPX A;  1QV1 A;  1S1E A;  1K95 A;  2KYF A;  1CDN A;  2KI4 B;  1A29 A;  2F2P A;  5B8I B;  3LK0 A;  4PHN A;  2M3W A;  4A4C A;  1RFJ A;  5ER4 X;  3IQQ A;  1XK4 C;  1PRW A;  2Q4U A;  5HLO A;  3RLZ A;  4AOM A;  2JT8 A;  1JBA A;  2M29 A;  2BKH B;  2Q91 A;  2K0J A;  1MF8 B;  1DGU A;  2H2K A;  3KEV A;  1DVI A;  1NX0 A;  1J7R A;  1S6I A;  2PMY A;  2LMT A;  1B8L A;  1TN4 A;  2MA2 A;  3LK1 A;  1QS7 A;  1LA3 A;  1Y6W A;  2E6W A;  4ORB B;  1K94 A;  3I5I B;  4GPL B;  3PSR A;  2O60 A;  1F55 A;  5KSZ A;  2E30 A;  1FW4 A;  2OTG B;  1KQV A;  4YGB B;  1JUO A;  1DJX A;  1WLM A;  2ZND A;  1L2O C;  4ORA B;  1F70 A;  2LC5 A;  4GFT A;  4MZJ A;  1SMG A;  1PVB A;  2G9B A;  2H61 C;  2KI4 C;  2MJW B;  2LUC A;  2P6B B;  2CNP A;  5AAN A;  1ALW A;  5JJG A;  1F54 A;  1UHH A;  3D0Y A;  3QRX A;  1UUR A;  1AJ4 A;  1N0Y A;  2F33 A;  1BLQ A;  1SL8 A;  3SG4 A;  4MRX A;  5J3X A;  2LAP A;  1CM1 A;  3PAL A;  1YUS A;  3WHT B;  2M8U A;  1WY9 A;  1R6P A;  1YUT A;  3CR5 X;  3O6B A;  3SG6 A;  2JXC A;  3AAK A;  3AKA A;  2PAL A;  3CGA A;  4I5N B;  3VRN A;  1Y0V H;  1WDC B;  3EK8 A;  5K89 A;  1OZS A;  1QLS A;  4WQ3 A;  2SAS A;  3I5I C;  1GQM A;  3SG7 A;  2LV7 A;  1JWD A;  4D1E A;  2BEC A;  1KSM A;  2OTG C;  2JOJ A;  2LHL A;  4CID A;  1S5G Y;  4PE7 A;  1KK7 Y;  1XK4 A;  1X02 A;  1GGZ A;  2ZNE A;  3LLE A;  5IBW A;  5KTY A;  1VRK A;  3KO0 A;  1S3P A;  1KQM B;  4F0Z B;  1RTP 1;  4MLW A;  3A4U B;  3K21 A;  4NDD A;  1CFC A;  1G33 A;  1M39 A;  4CFQ A;  2AMI A;  2L0P A;  2BE4 A;  1WRZ A;  1RRO A;  4ORC B;  4M2Q A; 
#chains in the Genus database with same CATH topology
 3OB2 B;  1SL9 A;  3E3R A;  4OVN F;  2JT3 A;  1DF0 A;  2KAX A;  3BFA A;  3TUY B;  4YRU A;  1U5I A;  2PSR A;  2SCP A;  3DD4 A;  3OP0 A;  5HYD A;  2JT0 A;  2JU0 A;  5DKQ A;  1IIO A;  1YVL A;  1K2H A;  1TNQ A;  5I2O A;  1K93 D;  1NYA A;  1NIW A;  1WDC C;  1SKT A;  2QPT A;  1DMO A;  2LP3 A;  1CNP A;  2I2R E;  2M1U A;  1MXE A;  4PCW A;  1YUU A;  2B1U A;  5AEQ A;  2F3Y A;  4IJ7 A;  1N65 A;  4N5X A;  3I5G B;  1DJH A;  1K8U A;  1MUX A;  2LMV A;  1UHK A;  1EJ3 A;  3IQO A;  2Y5I A;  2CCM A;  2KLE A;  2OPO A;  3FE8 A;  3PM2 A;  1CFD A;  2KFH A;  4E68 A;  1E8A A;  2BCB A;  1SK6 D;  2RGI A;  1TNW A;  1F4O A;  2LVV A;  3L47 A;  1B4C A;  1DJW A;  2M9G A;  5PAL A;  1KQM C;  2BL0 B;  1DEL A;  1DTL A;  2CT9 A;  2JTT A;  2PAS A;  3BUX B;  3CLN A;  4MZL A;  3ZNI A;  5I8N A;  1J7O A;  1F71 A;  1H4B A;  1DJY A;  3PLF B;  1DEK A;  1TTX A;  3VB1 A;  1WRK A;  5CSN A;  3SG3 A;  1XYD A;  3LCP C;  2KQY A;  3D73 A;  3TUY C;  1IG5 A;  1U5I B;  4HRE E;  2LCP A;  5D7F A;  1IJ6 A;  3RZS A;  3PM8 A;  2KGB C;  2L4H A;  1M31 A;  1IQ5 A;  2HET A;  3K1E A;  2LUX A;  4MN0 A;  1PAL A;  3SS5 A;  2L2E A;  1QVI Z;  4F7F A;  3CYZ A;  2MRD A;  1Y1A A;  1QX2 A;  1NPQ A;  3B88 A;  4INX A;  3I5G C;  3TS5 B;  3A8R A;  2CXJ A;  2KGR A;  2L51 A;  3IVT A;  1DJI A;  1W9Z A;  1Z2C B;  1DJG A;  3TDZ A;  1H8B A;  4CFR A;  3CTN A;  4N1F A;  1BMO A;  2L5X B;  1TWO A;  3CWG A;  3PFV A;  1B1G A;  3EVU A;  3BJH A;  1UWO A;  2IS9 A;  2MLF C;  1BR4 B;  4MRY A;  2LHI A;  1DJZ A;  2JPT A;  1OOJ A;  2LVJ A;  3BUO B;  3S0D A;  2GTE A;  1SY9 A;  1AK8 A;  3NHT A;  3CZT X;  2BL0 C;  5I2Q A;  1YX7 A;  2I94 A;  2M0R A;  3SG5 A;  2WCF A;  1BOD A;  1SRA A;  4C0J A;  1B7T Y;  5DIC A;  3SJS A;  1SCM B;  1YX8 A;  3JVT B;  1OOI X;  1ORG A;  1PUL A;  4FTG A;  1IKU A;  4YBH B;  4L9M A;  2FOT A;  2ZRT A;  3WXA A;  4GAO A;  1S6J A;  4DCK A;  4DS7 A;  3FS7 A;  1IQ3 A;  1NP8 A;  2K7B A;  4PE4 A;  1OMV A;  1QX5 B;  2M1K B;  3DZT A;  5DKN A;  1NCZ A;  1ZUZ A;  1KFU S;  2JTZ A;  1XFU O;  2JC2 A;  1OMD A;  3L4L A;  4KYN A;  5ER5 A;  1JC2 A;  1XFW O;  4PAL A;  3TS5 C;  3FIA A;  1KWO B;  1IJ5 A;  1CTR A;  2QEV A;  3JTD B;  1QWV A;  1YVH A;  3EK4 A;  3CDN A;  5JOL A;  3NGV A;  1UUS A;  2EHB A;  1SR6 B;  1NX3 A;  2L98 A;  1W7I B;  2AAO A;  2ZRS A;  1ZFS A;  2HPS A;  2K7O A;  1Y1U A;  3I5F B;  1QLK A;  1A4P A;  5HL1 A;  4QJ3 B;  3ZWH A;  2FCD A;  3N7H A;  4M2O A;  1QTX A;  1SCM C;  4JD9 A;  1CLB A;  3TDI A;  1SL7 A;  1V1F A;  3S0F A;  3JVT C;  3HCM A;  1SPY A;  2NZ0 A;  4YI9 A;  3TDU A;  4YGD B;  3C1V A;  4QJ5 B;  3OB1 B;  1ALV A;  1S6C A;  2L5Y A;  3BUW B;  2TN4 A;  4R1E A;  2KNE A;  2LAN A;  4CPV A;  1GJY A;  4JWQ A;  3VRQ A;  2WC6 A;  3HX4 A;  2F8P A;  3GOF A;  1FPW A;  1BU3 A;  2ZN8 A;  2EGD A;  3DVE A;  2KFG A;  1EG3 A;  4YI8 A;  3VGO A;  1A03 A;  1KWO C;  1YR5 A;  3JTD C;  1S26 D;  1TUZ A;  1QVI Y;  5CSJ A;  1REC A;  5F6T A;  1EH2 A;  1AHR A;  3EK7 A;  1SR6 C;  4DIR A;  3NSO A;  2KBM A;  1XFV O;  3BQ3 A;  3UNW A;  2QAC A;  1XFX O;  2JNF A;  4MZK A;  3I5F C;  1QXP A;  4ZCU A;  1A75 A;  1LKJ A;  1NUB A;  2QDI A;  2QEO A;  1M45 A;  1S36 A;  3R1O A;  3RM1 A;  4MVF A;  1KSO A;  3BXK A;  1GM0 A;  2MBX A;  1RWY A;  2WC5 A;  2NXQ A;  5HKY A;  4OCI A;  4I5K A;  1G4Y R;  5AFP A;  1OOF A;  1CDP A;  4NDC A;  3V2L A;  3DVM A;  1YRT B;  3FWB A;  1CLM A;  2A4J A;  4N1G A;  1K96 A;  1AP4 A;  1XFZ O;  4BY5 A;  1K90 D;  1IGV A;  5HKZ A;  1QIV A;  4PE0 A;  2NCP A;  1OZO A;  4AQJ A;  2V53 A;  4YGE B;  1QIW A;  2PYQ A;  3ICB A;  3CZ2 A;  3OX6 A;  2KLD A;  1QX7 A;  2OS8 B;  3I5H B;  3OHM B;  4M2P A;  1PK0 D;  4GGN A;  3O2P A;  5AXI A;  5TNC A;  2I18 A;  4MEW A;  2BAP A;  2COL B;  3PN7 B;  1LS8 A;  2WCM A;  3R72 A;  1A75 B;  1LVC D;  1V1G A;  4PE1 A;  1DGV A;  2KHN A;  3AKB A;  1C3Y A;  1BOC A;  1BF5 A;  4YGA A;  3NXA A;  4WRI A;  1WRL A;  1XO5 A;  1B47 A;  2BE6 A;  4HRG A;  4C0K A;  4DRW A;  4PHJ A;  4XJK B;  5KU1 A;  1FI6 A;  1RJV A;  2JQ6 A;  1UHJ A;  4MSP A;  3MSE B;  4FQT A;  2WCJ A;  1CM4 A;  1PSB A;  1Z4H A;  5DKR A;  2MAZ A;  1CMG A;  1UHI A;  5FI2 A;  4ETO A;  1Q80 A;  2MLE C;  1CLL A;  1NCY A;  1W7J B;  2JZI A;  1TNX A;  2LP2 A;  1A2X A;  1JFK A;  1KK8 B;  2KSP A;  2WCL A;  4P2Y B;  1L7Z A;  2KI6 D;  5HKW A;  3SS4 A;  5I94 A;  1FBV A;  1AJ5 A;  4HSZ A;  2OS8 C;  3I5H C;  1UP5 A;  4P5O E;  1OMR A;  1LXF C;  1FI5 A;  1TCF A;  2LVI A;  3BUM B;  1IWQ A;  2LLS A;  3FWC A;  3S0E A;  4AQI A;  2WND A;  3PN7 C;  3DF0 B;  3L4A A;  4JQ0 D;  1XFY O;  3S0A A;  1NX2 A;  1TOP A;  1XA5 A;  1KCY A;  1MHO A;  2VRG A;  2HF5 A;  1MQ1 A;  3AAJ A;  2ISD A;  3D77 A;  1PSR A;  1JF2 A;  4IL1 A;  5D69 A;  1M46 A;  2PQL A;  2WOS A;  4PT1 A;  2JXL A;  3B7A A;  1C7W A;  2DOQ A;  3OX5 A;  4OZD A;  1BG1 A;  1BR1 B;  3O4X A;  1J55 A;  2Y4Q A;  3D74 A;  3B86 A;  1KFX S;  2M97 A;  4GNK B;  3CS1 A;  3DYE A;  1ZAC A;  5CSI A;  2WCE A;  4JPZ B;  4BY4 A;  1K9U A;  3DY9 A;  2KAV A;  2PVB A;  3CR2 A;  1KK8 C;  1JF0 A;  3SIA A;  3NSL A;  1GGW A;  1MXL C;  4YGC B;  2JUL A;  1QJT A;  1EG4 A;  5HLV A;  4Q04 A;  3CR4 X;  4USL A;  1NSH A;  2JWW A;  1C07 A;  3KF9 A;  3VRP A;  4QJ4 B;  2R2I A;  2BCA A;  1MWN A;  1OE9 B;  1OSA A;  2KDH A;  3GK4 X;  3B6X A;  1JFJ A;  5BPJ A;  2ERB A;  3CAB A;  2KI6 C;  3F45 A;  1J1E A;  2K61 A;  1SYM A;  2FJU B;  2M7L A;  2F3Z A;  2Y1N A;  2ZN9 A;  2FJY A;  3LL8 B;  4DUQ A;  1C3Z A;  2HQ8 A;  3BFH A;  1M63 B;  1BJF A;  3NSI A;  2WC8 A;  2CTN A;  1K9K A;  2LMU A;  1CMF A;  3GK2 A;  1F8H A;  2K2F A;  5G08 A;  1TNP A;  2QEH A;  2L4I A;  3WNX B;  2P70 A;  1CFF A;  3S0B A;  2LE9 B;  2WCB A;  3B87 A;  3M0W A;  1RK9 A;  1Y1X A;  4GGF C;  4PHK A;  3PAT A;  4PDZ A;  1R2U A;  4CLN A;  4GUK A;  1LA0 A;  2AUC A;  1DT7 B;  2BBM A;  3D10 A;  4A4B A;  2KAY A;  2LM5 A;  3EVV A;  3R1P A;  4U8D A;  3UO9 A;  3WHU B;  1SW8 A;  2LVK A;  1WLZ A;  2K7C A;  3BOW A;  4ICB A;  1C7V A;  5AER A;  1F4Q A;  1FF1 A;  2HQW A;  2K8M B;  1CKK A;  1KFU L;  2GGZ A;  1K9P A;  4ZCV A;  1B7T Z;  1BT6 A;  4XJK A;  3VRO A;  2ZFD A;  2FCE A;  2KQ6 A;  3QME A;  2Y1M A;  1SBJ A;  2KFF A;  3KHE A;  1CFP A;  4OKH A;  2L2C A;  2M49 B;  4FQO A;  1KFX L;  1QAT A;  3D0Y B;  4MBE A;  5CPV A;  2BCX A;  1QV0 A;  1TIZ A;  4WQ2 A;  1CB1 A;  1HT9 A;  2LLT A;  1XVJ A;  2L50 A;  2JRF A;  1AUI B;  1TCO B;  1ZOT B;  1LIN A;  5FYX A;  2EC6 B;  1N2D A;  2LNK A;  1OQP A;  1P28 A;  2NCO A;  4GBA A;  4XYN A;  5I2L A;  1NCX A;  2GGM A;  1SNL A;  1J1D A;  5GQQ C;  2JNX A;  1B8C A;  1DC1 A;  1B9A A;  4I5J A;  2H61 A;  1HQV A;  1CDM A;  1UHN A;  1YTZ C;  2D8N A;  2WCK A;  3BYA A;  3DF0 A;  4HRH A;  4PHM A;  2BKI B;  3IF7 A;  2PRU A;  1ZMZ A;  1IRJ A;  1YRU B;  1B8R A;  1CDL A;  3BOW B;  3D78 A;  4OR9 B;  2K7D A;  1G8I A;  4NQG A;  5CSF A;  2F2O A;  1YUR A;  3SIB A;  1J7P A;  2I7A A;  3H4S E;  3EKH A;  2KYC A;  1J7Q A;  1IH0 A;  3EKJ A;  1T14 A;  1TRF A;  1PVA A;  2KBI A;  4C0L A;  3GK1 A;  4TNC A;  3EVR A;  3O78 A;  4OV2 A;  3DVK A;  3CZ1 A;  1D1O A;  2BBN A;  2H8V A;  1DF0 B;  2MHH A;  1ODB A;  1NWD A;  3NSK A;  2CBL A;  1S5G Z;  4GGF A;  1NX1 A;  1EL4 A;  1KK7 Z;  2WCH A;  4I5L B;  3SG2 A;  3R1V A;  2EC6 C;  2G2B A;  3O4Y A;  3TZ1 A;  2O5G A;  2KOT A;  1AVS A;  2ZKM X;  3BFB A;  2M7N A;  3BUN B;  3VRR A;  1EXR A;  2K2A A;  3Q8I A;  3DVJ A;  2WOR A;  2LLU A;  1SCV A;  4NDB A;  1QAS A;  1MR8 A;  1L2O B;  2GV5 A;  2NLN A;  4UPG A;  3KPX A;  1QV1 A;  1S1E A;  3EG5 B;  1K95 A;  2KYF A;  1CDN A;  2KI4 B;  1A29 A;  2KPH A;  2F2P A;  5B8I B;  3LK0 A;  4JKT A;  4PHN A;  1DQE A;  2M3W A;  4A4C A;  5D3O A;  3DXL A;  1RFJ A;  5ER4 X;  3OBV A;  3IQQ A;  1XK4 C;  1PRW A;  2Q4U A;  5HLO A;  3RLZ A;  4AOM A;  2JT8 A;  1JBA A;  2M29 A;  2BKH B;  2Q91 A;  2K0J A;  1MF8 B;  1DGU A;  2H2K A;  3KEV A;  1DVI A;  1NX0 A;  1J7R A;  1S6I A;  2PMY A;  2LMT A;  3D75 A;  1B8L A;  1TN4 A;  2MA2 A;  3LK1 A;  1QS7 A;  1LA3 A;  1Y6W A;  2E6W A;  4ORB B;  3PJI A;  1K94 A;  3I5I B;  4GPL B;  5FI6 A;  3PSR A;  2O60 A;  1F55 A;  5KSZ A;  1OOG A;  1FW4 A;  1SSE B;  2E30 A;  2OTG B;  1KQV A;  4YGB B;  1JUO A;  1DJX A;  1WLM A;  1OOH A;  2ZND A;  3SS3 A;  1L2O C;  4ORA B;  1F70 A;  2LC5 A;  3FE6 A;  4GFT A;  4MZJ A;  1SMG A;  1PVB A;  2G9B A;  2H61 C;  2KI4 C;  2MJW B;  2LUC A;  1TUJ A;  2CNP A;  2P6B B;  1ALW A;  5AAN A;  5JJG A;  2BNX A;  1UHH A;  1XFR A;  1F54 A;  3D0Y A;  3QRX A;  1UUR A;  1AJ4 A;  1N0Y A;  5EL2 A;  2F33 A;  1BLQ A;  3OGN A;  1SL8 A;  3SG4 A;  4MRX A;  2YGU A;  5J3X A;  2LAP A;  1CM1 A;  3PAL A;  1YUS A;  3S0G A;  3WHT B;  2M8U A;  1WY9 A;  1R6P A;  1YUT A;  3CR5 X;  3O6B A;  3SG6 A;  2JXC A;  3AAK A;  3FE9 A;  3AKA A;  2PAL A;  3CGA A;  4I5N B;  3VRN A;  1Y0V H;  1WDC B;  3EK8 A;  2JPO A;  5FI7 A;  1OW4 A;  5K89 A;  1OZS A;  1QLS A;  4WQ3 A;  2QEB A;  2SAS A;  3I5I C;  1GQM A;  3SG7 A;  2LV7 A;  1JWD A;  4D1E A;  3D76 A;  2BEC A;  1KSM A;  2OTG C;  2JOJ A;  2K60 A;  2LHL A;  4CID A;  1S5G Y;  4PE7 A;  1KK7 Y;  3CZ0 A;  1XK4 A;  1X02 A;  1GGZ A;  2P71 A;  2ZNE A;  3LLE A;  5IBW A;  5KTY A;  1VRK A;  3KO0 A;  3NHI A;  4INW A;  1S3P A;  1KQM B;  4F0Z B;  1RTP 1;  4MLW A;  3A4U B;  3K21 A;  4NDD A;  1CFC A;  1G33 A;  1M39 A;  1JSA A;  4CFQ A;  2AMI A;  2L0P A;  2BE4 A;  1WRZ A;  1RRO A;  4ORC B;  4M2Q A; 
#chains in the Genus database with same CATH homology
 3OB2 B;  1SL9 A;  3E3R A;  4OVN F;  2JT3 A;  1DF0 A;  2KAX A;  3TUY B;  4YRU A;  1U5I A;  2PSR A;  2SCP A;  3DD4 A;  3OP0 A;  5HYD A;  2JT0 A;  2JU0 A;  5DKQ A;  1YVL A;  1K2H A;  1TNQ A;  5I2O A;  1K93 D;  1NYA A;  1NIW A;  1WDC C;  1SKT A;  2QPT A;  1DMO A;  2LP3 A;  1CNP A;  2I2R E;  2M1U A;  1MXE A;  4PCW A;  1YUU A;  2B1U A;  5AEQ A;  2F3Y A;  4N5X A;  1N65 A;  3I5G B;  1DJH A;  1K8U A;  1MUX A;  2LMV A;  1UHK A;  1EJ3 A;  3IQO A;  2Y5I A;  2CCM A;  2OPO A;  1CFD A;  2KFH A;  4E68 A;  1E8A A;  2BCB A;  1SK6 D;  2RGI A;  1TNW A;  1F4O A;  2LVV A;  1B4C A;  1DJW A;  2M9G A;  5PAL A;  1KQM C;  2BL0 B;  1DTL A;  2CT9 A;  2JTT A;  2PAS A;  3BUX B;  3CLN A;  4MZL A;  5I8N A;  3ZNI A;  1F71 A;  1J7O A;  1H4B A;  1DJY A;  3PLF B;  1TTX A;  1WRK A;  5CSN A;  3SG3 A;  1XYD A;  3LCP C;  2KQY A;  3TUY C;  1IG5 A;  1U5I B;  4HRE E;  2LCP A;  5D7F A;  1IJ6 A;  3PM8 A;  2KGB C;  2L4H A;  1M31 A;  1IQ5 A;  2HET A;  4MN0 A;  2LUX A;  1PAL A;  2L2E A;  1QVI Z;  2MRD A;  1Y1A A;  1QX2 A;  1NPQ A;  3I5G C;  3TS5 B;  3A8R A;  2CXJ A;  2KGR A;  2L51 A;  1DJI A;  3TDZ A;  1DJG A;  1H8B A;  4CFR A;  3CTN A;  4N1F A;  1BMO A;  2L5X B;  3CWG A;  3PFV A;  1B1G A;  3EVU A;  1UWO A;  2IS9 A;  2MLF C;  1BR4 B;  4MRY A;  2LHI A;  1DJZ A;  2JPT A;  1OOJ A;  2LVJ A;  3BUO B;  1AK8 A;  1JSA A;  1SY9 A;  3CZT X;  2BL0 C;  5I2Q A;  1YX7 A;  2I94 A;  2M0R A;  3SG5 A;  2WCF A;  1BOD A;  1SRA A;  4C0J A;  1B7T Y;  3SJS A;  1SCM B;  1YX8 A;  3JVT B;  1PUL A;  4FTG A;  1IKU A;  4YBH B;  4L9M A;  2FOT A;  2ZRT A;  3WXA A;  4GAO A;  1S6J A;  4DCK A;  4DS7 A;  3FS7 A;  1IQ3 A;  1NP8 A;  2K7B A;  4PE4 A;  1OMV A;  1QX5 B;  2M1K B;  5DKN A;  1NCZ A;  1ZUZ A;  1KFU S;  2JTZ A;  1XFU O;  2JC2 A;  1OMD A;  5ER5 A;  1JC2 A;  1XFW O;  4PAL A;  3TS5 C;  3FIA A;  1KWO B;  1IJ5 A;  1CTR A;  3JTD B;  1YVH A;  3EK4 A;  5JOL A;  1UUS A;  2EHB A;  1SR6 B;  1NX3 A;  2L98 A;  1W7I B;  2AAO A;  2ZRS A;  1ZFS A;  2HPS A;  2K7O A;  1Y1U A;  3I5F B;  1QLK A;  1A4P A;  4QJ3 B;  3ZWH A;  2FCD A;  4M2O A;  1QTX A;  1SCM C;  1CLB A;  3TDI A;  1SL7 A;  1V1F A;  3JVT C;  3HCM A;  1SPY A;  2NZ0 A;  4YI9 A;  3TDU A;  4YGD B;  3C1V A;  4QJ5 B;  3OB1 B;  1ALV A;  1S6C A;  3BUW B;  2TN4 A;  4R1E A;  2KNE A;  2LAN A;  4CPV A;  1GJY A;  4JWQ A;  3VRQ A;  3HX4 A;  2F8P A;  3GOF A;  1FPW A;  1BU3 A;  2ZN8 A;  2EGD A;  3DVE A;  2KFG A;  1EG3 A;  4YI8 A;  3VGO A;  1A03 A;  1KWO C;  1YR5 A;  3JTD C;  1S26 D;  5CSJ A;  1QVI Y;  5F6T A;  1REC A;  1EH2 A;  1AHR A;  3EK7 A;  1SR6 C;  4DIR A;  3NSO A;  2KBM A;  1XFV O;  3BQ3 A;  2QAC A;  1XFX O;  2JNF A;  4MZK A;  3I5F C;  1QXP A;  4ZCU A;  1A75 A;  1LKJ A;  1NUB A;  1M45 A;  1S36 A;  3RM1 A;  4MVF A;  1KSO A;  3BXK A;  2MBX A;  1RWY A;  2NXQ A;  5HKY A;  4OCI A;  4I5K A;  1G4Y R;  5AFP A;  1CDP A;  4NDC A;  3DVM A;  1YRT B;  3FWB A;  1CLM A;  2A4J A;  4N1G A;  1K96 A;  1AP4 A;  1XFZ O;  4BY5 A;  1K90 D;  1IGV A;  5HKZ A;  1QIV A;  4PE0 A;  2NCP A;  1OZO A;  4AQJ A;  2V53 A;  4YGE B;  1QIW A;  3ICB A;  3OX6 A;  1QX7 A;  2OS8 B;  3I5H B;  3OHM B;  4M2P A;  1PK0 D;  4GGN A;  3O2P A;  5AXI A;  5TNC A;  2I18 A;  4MEW A;  2COL B;  3PN7 B;  4PE1 A;  1A75 B;  1LVC D;  1V1G A;  1DGV A;  2KHN A;  3AKB A;  1BOC A;  1BF5 A;  4YGA A;  3NXA A;  4WRI A;  1WRL A;  1XO5 A;  1B47 A;  2BE6 A;  4HRG A;  4C0K A;  4DRW A;  4PHJ A;  4XJK B;  5KU1 A;  1FI6 A;  1RJV A;  2JQ6 A;  1UHJ A;  4MSP A;  3MSE B;  1CM4 A;  1PSB A;  5DKR A;  2MAZ A;  1CMG A;  1UHI A;  4ETO A;  1Q80 A;  2MLE C;  1CLL A;  1NCY A;  1W7J B;  2JZI A;  1TNX A;  2LP2 A;  1A2X A;  1JFK A;  1KK8 B;  2KSP A;  4P2Y B;  1L7Z A;  2KI6 D;  5HKW A;  1FBV A;  1AJ5 A;  4HSZ A;  2OS8 C;  3I5H C;  1UP5 A;  4P5O E;  1OMR A;  1LXF C;  1FI5 A;  1TCF A;  2LVI A;  3BUM B;  1IWQ A;  2LLS A;  3FWC A;  4AQI A;  2WND A;  3PN7 C;  3DF0 B;  4JQ0 D;  1XFY O;  1NX2 A;  1TOP A;  1XA5 A;  1KCY A;  1MHO A;  2VRG A;  2HF5 A;  1MQ1 A;  3AAJ A;  2ISD A;  1PSR A;  1JF2 A;  4IL1 A;  5D69 A;  1M46 A;  2WOS A;  2JXL A;  3OX5 A;  1C7W A;  2DOQ A;  1BG1 A;  1BR1 B;  1J55 A;  2Y4Q A;  1KFX S;  2M97 A;  4GNK B;  3CS1 A;  5CSI A;  1ZAC A;  2WCE A;  4JPZ B;  4BY4 A;  1K9U A;  2KAV A;  2PVB A;  3CR2 A;  1KK8 C;  1JF0 A;  3SIA A;  3NSL A;  1GGW A;  1MXL C;  4YGC B;  2JUL A;  1QJT A;  1EG4 A;  5HLV A;  4Q04 A;  3CR4 X;  4USL A;  1NSH A;  2JWW A;  1C07 A;  3KF9 A;  3VRP A;  4QJ4 B;  2R2I A;  2BCA A;  1MWN A;  1OE9 B;  1OSA A;  2KDH A;  3GK4 X;  1JFJ A;  5BPJ A;  2KI6 C;  3F45 A;  1J1E A;  2K61 A;  1SYM A;  2FJU B;  2M7L A;  2F3Z A;  2Y1N A;  2ZN9 A;  3LL8 B;  4DUQ A;  2HQ8 A;  1M63 B;  1BJF A;  3NSI A;  2WC8 A;  2CTN A;  1K9K A;  2LMU A;  1CMF A;  3GK2 A;  1F8H A;  2K2F A;  5G08 A;  1TNP A;  2L4I A;  3WNX B;  1CFF A;  2LE9 B;  2WCB A;  3M0W A;  1RK9 A;  1Y1X A;  4GGF C;  4PHK A;  3PAT A;  4PDZ A;  1R2U A;  4CLN A;  4GUK A;  1LA0 A;  2AUC A;  1DT7 B;  2BBM A;  3D10 A;  4A4B A;  2KAY A;  2LM5 A;  3EVV A;  4U8D A;  3WHU B;  1SW8 A;  2LVK A;  1WLZ A;  2K7C A;  3BOW A;  4ICB A;  1C7V A;  5AER A;  1F4Q A;  1FF1 A;  2HQW A;  2K8M B;  1CKK A;  1KFU L;  2GGZ A;  1K9P A;  4ZCV A;  1B7T Z;  1BT6 A;  4XJK A;  3VRO A;  2ZFD A;  2FCE A;  2KQ6 A;  2Y1M A;  1SBJ A;  2KFF A;  3KHE A;  1CFP A;  4OKH A;  2M49 B;  4FQO A;  1KFX L;  1QAT A;  3D0Y B;  4MBE A;  5CPV A;  2BCX A;  1QV0 A;  1TIZ A;  4WQ2 A;  1CB1 A;  1HT9 A;  2LLT A;  1XVJ A;  2L50 A;  2JRF A;  1AUI B;  1TCO B;  1ZOT B;  1LIN A;  5FYX A;  2EC6 B;  1N2D A;  2LNK A;  1OQP A;  2NCO A;  4GBA A;  4XYN A;  5I2L A;  1NCX A;  2GGM A;  1SNL A;  1J1D A;  5GQQ C;  2JNX A;  1B8C A;  1B9A A;  4I5J A;  2H61 A;  1HQV A;  1CDM A;  1UHN A;  1YTZ C;  2D8N A;  3BYA A;  3DF0 A;  4HRH A;  4PHM A;  2BKI B;  3IF7 A;  2PRU A;  1ZMZ A;  1IRJ A;  1YRU B;  1B8R A;  1CDL A;  3BOW B;  4OR9 B;  2K7D A;  1G8I A;  4NQG A;  5CSF A;  2F2O A;  1YUR A;  3SIB A;  1J7P A;  2I7A A;  3H4S E;  3EKH A;  2KYC A;  1J7Q A;  1IH0 A;  3EKJ A;  1TRF A;  1PVA A;  2KBI A;  4C0L A;  3GK1 A;  4TNC A;  3EVR A;  3O78 A;  4OV2 A;  3DVK A;  1D1O A;  2BBN A;  1DF0 B;  2MHH A;  1ODB A;  1NWD A;  3NSK A;  2CBL A;  1S5G Z;  4GGF A;  1NX1 A;  1EL4 A;  1KK7 Z;  4I5L B;  3SG2 A;  2EC6 C;  2G2B A;  3O4Y A;  3TZ1 A;  2O5G A;  2KOT A;  1AVS A;  2ZKM X;  3BUN B;  2M7N A;  3VRR A;  1EXR A;  2K2A A;  3DVJ A;  2WOR A;  2LLU A;  1SCV A;  4NDB A;  1QAS A;  1MR8 A;  1L2O B;  2GV5 A;  2NLN A;  4UPG A;  3KPX A;  1QV1 A;  1S1E A;  1K95 A;  2KYF A;  1CDN A;  2KI4 B;  1A29 A;  2F2P A;  5B8I B;  3LK0 A;  4PHN A;  2M3W A;  4A4C A;  1RFJ A;  5ER4 X;  3IQQ A;  1XK4 C;  1PRW A;  2Q4U A;  5HLO A;  3RLZ A;  4AOM A;  2JT8 A;  1JBA A;  2M29 A;  2BKH B;  2Q91 A;  2K0J A;  1MF8 B;  1DGU A;  2H2K A;  3KEV A;  1DVI A;  1NX0 A;  1J7R A;  1S6I A;  2PMY A;  2LMT A;  1B8L A;  1TN4 A;  2MA2 A;  3LK1 A;  1QS7 A;  1LA3 A;  1Y6W A;  2E6W A;  4ORB B;  1K94 A;  3I5I B;  4GPL B;  3PSR A;  2O60 A;  1F55 A;  5KSZ A;  2E30 A;  1FW4 A;  2OTG B;  1KQV A;  4YGB B;  1JUO A;  1DJX A;  1WLM A;  2ZND A;  1L2O C;  4ORA B;  1F70 A;  2LC5 A;  4GFT A;  4MZJ A;  1SMG A;  1PVB A;  2G9B A;  2H61 C;  2KI4 C;  2MJW B;  2LUC A;  2P6B B;  2CNP A;  5AAN A;  1ALW A;  5JJG A;  1F54 A;  1UHH A;  3D0Y A;  3QRX A;  1UUR A;  1AJ4 A;  1N0Y A;  2F33 A;  1BLQ A;  1SL8 A;  3SG4 A;  4MRX A;  5J3X A;  2LAP A;  1CM1 A;  3PAL A;  1YUS A;  3WHT B;  2M8U A;  1WY9 A;  1R6P A;  1YUT A;  3CR5 X;  3O6B A;  3SG6 A;  2JXC A;  3AAK A;  3AKA A;  2PAL A;  3CGA A;  4I5N B;  3VRN A;  1Y0V H;  1WDC B;  3EK8 A;  5K89 A;  1OZS A;  1QLS A;  4WQ3 A;  2SAS A;  3I5I C;  1GQM A;  3SG7 A;  2LV7 A;  1JWD A;  4D1E A;  2BEC A;  1KSM A;  2OTG C;  2JOJ A;  2LHL A;  4CID A;  1S5G Y;  4PE7 A;  1KK7 Y;  1XK4 A;  1X02 A;  1GGZ A;  2ZNE A;  3LLE A;  5IBW A;  5KTY A;  1VRK A;  3KO0 A;  1S3P A;  1KQM B;  4F0Z B;  1RTP 1;  4MLW A;  3A4U B;  3K21 A;  4NDD A;  1CFC A;  1G33 A;  1M39 A;  4CFQ A;  2AMI A;  2L0P A;  2BE4 A;  1WRZ A;  1RRO A;  4ORC B;  4M2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...