3LK0A

X-ray structure of bovine sc0067,ca(2+)-s100b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
total genus 32
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk0A00
3IF7A 1Y0VH 2AUCA 4MVFA 2D8NA 4MZLA 1OQPA 2M1UA 2LNKA 5K89A 1DJWA 2K2AA 3BYAA 1SL9A 4I5KA 2RGIA 3OP0A 2MJWB 2JNFA 4M2PA 2LHIA 1CLBA 2F3ZA 2HF5A 2JT3A 2MRDA 2JULA 1K93D 1PK0D 1SY9A 4C0LA 3AKBA 1XVJA 2BBNA 3M0WA 2WORA 3SJSA 2KI4B 1S5GY 1CFPA 1DJIA 5DKRA 1QIWA 3OB2B 1TNXA 4GUKA 4AQJA 1BR4B 2EC6C 2HQ8A 2L4HA 1PVBA 2G2BA 3FWCA 3IQOA 1JC2A 1SK6D 4A4CA 1RFJA 3PALA 1XFXO 3ZWHA 2KNEA 1IQ3A 1ZACA 3AAJA 1RROA 3SG3A 3OB1B 5FYXA 2M7LA 4YGAA 4GGFA 1FF1A 4HRGA 1FBVA 4NDDA 2K8MB 3SG4A 1IG5A 1KFUS 1UURA 1LINA 4IL1A 2LV7A 1CDNA 3I5HC 3VRPA 2ZN9A 1YX8A 1A4PA 1XFWO 3DF0B 3EK7A 4TNCA 1CB1A 4QJ4B 4I5JA 4I5LB 2EGDA 2LCPA 1NYAA 2KHNA 5CSIA 4ETOA 4ORBB 1AP4A 1TRFA 1WY9A 3EKJA 1QLKA 1CMFA 5ER5A 4GAOA 4CPVA 1NX0A 2OS8C 1SYMA 3ZNIA 1M39A 1AUIB 3WHTB 1WLZA 1B7TZ 1IQ5A 1W7IB 2MA2A 4D1EA 1QLSA 3SIBA 3TUYC 2JRFA 1CDPA 1IGVA 2K7BA 2M29A 3O2PA 2KBMA 5CPVA 4N5XA 2LM5A 2B1UA 1BODA 1PULA 3HCMA 1PVAA 1J55A 1UP5A 2M8UA 1B9AA 1BU3A 1M31A 3AAKA 1OZOA 1TOPA 3LK0A 3JTDC 2FJUB 4PE0A 1MXEA 3WHUB 4PE4A 1L7ZA 1IJ5A 2I18A 3NSIA 2K7DA 1KK8B 2M7NA 3LL8B 1RECA 2EC6B 2R2IA 2MHHA 2KI4C 1KQMB 2F2OA 2LUXA 5DKNA 1DJZA 1QV0A 1NP8A 1NX1A 1W7JB 2AAOA 1QXPA 2TN4A 3D0YA 5KU1A 1UHJA 1CLMA 1NCZA 3KF9A 2KFFA 4A4BA 3LK1A 5DKQA 2CXJA 2BKIB 1U5IA 4CFQA 2H61C 2ZFDA 2PASA 1A29A 3KO0A 1XFUO 2KI6D 1SL8A 1IRJA 1DJHA 1TN4A 4GPLB 2IS9A 1LXFC 4ORAB 4DCKA 1M45A 1CFCA 5AXIA 4UPGA 4BY5A 1PSBA 2KQYA 2ZRSA 4QJ3B 3BOWB 2KOTA 1SBJA 1V1GA 1KFUL 1LVCD 3SG5A 2L50A 1F70A 2GV5A 3HX4A 4WRIA 4WQ2A 1CM1A 1KWOC 1F4QA 1L2OB 1GJYA 4GNKB 1MWNA 3D10A 1QX7A 1DJXA 2OTGB 1K2HA 1YRTB 3O78A 4N1FA 2JT0A 2WC8A 3BUWB 1ALWA 2E30A 1J1DA 1UWOA 2F2PA 3DVMA 1QS7A 2CBLA 3JVTB 2KI6C 1OOJA 4P5OE 3VGOA 1CLLA 1A75A 3OX6A 1H4BA 2Y4QA 2L2EA 3EVUA 2ZRTA 1FPWA 2HQWA 4GGNA 2BCXA 2JPTA 3VRNA 3NSLA 3JTDB 1KK7Z 3EK8A 1GGWA 1K94A 2LLTA 2WNDA 1QVIZ 1M46A 2Q4UA 5HKWA 2LAPA 4MZJA 1LKJA 1A03A 4JWQA 1XK4A 2JT8A 2K2FA 3LCPC 1DT7B 1KFXS 1KK7Y 1KK8C 1SL7A 2L51A 5D7FA 3WXAA 1EJ3A 5D69A 1Q80A 5I2QA 2O60A 1KQMC 1DTLA 5KSZA 1CFFA 2SASA 1YURA 4OV2A 2BE6A 3EVRA 2FCDA 2PVBA 2GGMA 1KSMA 1K9UA 1CNPA 3EK4A 1RWYA 1B8CA 1Y6WA 2LVKA 1NCXA 1TNWA 2NCOA 1MUXA 4XJKA 1MF8B 5G08A 2ISDA 1K95A 2BCAA 1WRKA 1YVLA 1DF0B 2M1KB 3QRXA 5AERA 1F71A 2KYCA 1C7VA 2F3YA 2KDHA 1ODBA 1B47A 3EKHA 3F45A 5CSFA 4YGCB 3IQQA 2CCMA 2V53A 2L0PA 1KWOB 3DD4A 1HT9A 2MLEC 2JNXA 1RTP1 3NSOA 4PHJA 3WNXB 2L4IA 4JPZB 1XFYO 1OZSA 1N2DA 1L2OC 3RM1A 1TIZA 2LVVA 4DUQA 1JWDA 4OVNF 1BR1B 1WRZA 1IWQA 2OTGC 3FWBA 1F8HA 1UHNA 1QJTA 4HSZA 4P2YB 4MEWA 1NIWA 1J7QA 1BOCA 1DJGA 2F8PA 2BKHB 2LC5A 2OPOA 2NCPA 1QIVA 2LMUA 1YRUB 3JVTC 1YUSA 4PHNA 1EL4A 2LP2A 5HKZA 4ICBA 4C0KA 5I8NA 1EH2A 3NXAA 1B7TY 1DGVA 1F55A 4MSPA 1YX7A 1B4CA 3FIAA 2FOTA 1SMGA 3O6BA 3SG6A 1CMGA 1BMOA 5PALA 2PSRA 1DJYA 2JTTA 3PSRA 3SG2A 4CFRA 5AFPA 4YGDB 1BT6A 3BUOB 1EG3A 3BUNB 2MLFC 2EHBA 1U5IB 2I2RE 4NDCA 1SNLA 2K61A 1JF2A 3BUMB 4YBHB 4GGFC 1PSRA 2BE4A 4WQ3A 1Y1UA 1A2XA 4DRWA 4E68A 3A8RA 1ZMZA 1TTXA 3RLZA 1AJ5A 1KFXL 5CSJA 4HRHA 1C7WA 1EXRA 1UHKA 4M2OA 1S6IA 1SPYA 1S6JA 1NX3A 1CKKA 3TDIA 4F0ZB 4MLWA 1K8UA 1NUBA 4YGBB 2LVIA 1DMOA 1K96A 3MSEB 1B8LA 1G4YR 1ZOTB 5J3XA 1PRWA 1R6PA 2LMVA 5HKYA 1FI5A 3TS5B 1S1EA 5AEQA 1RK9A 4YI9A 1BJFA 3GOFA 1M63B 3CLNA 3GK2A 2CT9A 4ZCVA 5F6TA 4CLNA 4CIDA 1DGUA 2LANA 1IH0A 2MAZA 1A75B 1WLMA 1J7OA 2FCEA 2GGZA 5ER4X 3PLFB 1NWDA 1ALVA 1EG4A 3C1VA 1XFVO 1OMDA 4USLA 1CDLA 4PHMA 1TCFA 1FI6A 3I5GB 4U8DA 2K7CA 1TCOB 1JFKA 1H8BA 2JXCA 1B8RA 4NQGA 4R1EA 1QATA 1AVSA 1K9KA 1SR6B 2A4JA 2CNPA 2Y1NA 5B8IB 2PRUA 4GFTA 1Y1AA 5HLOA 5TNCA 4QJ5B 3DVEA 3CTNA 3TDZA 1K9PA 2ZKMX 3BUXB 2K7OA 2BCBA 4ORCB 1JSAA 3H4SE 4MBEA 4XJKB 1MHOA 4PE7A 4PALA 4YGEB 5I2LA 1QVIY 4MRXA 2BBMA 4FQOA 1S5GZ 1BG1A 1NSHA 2AMIA 1Y1XA 1OMRA 2KFHA 1X02A 2PMYA 4PHKA 5KTYA 1MQ1A 4NDBA 1YTZC 3CR5X 2KBIA 2KAYA 1WDCB 2WOSA 1KQVA 1J1EA 1PALA 2Y5IA 3GK1A 3DVKA 1JFJA 2KYFA 2KQ6A 2LLSA 1NX2A 1J7RA 3VRQA 4OCIA 1SW8A 4DS7A 5HYDA 1ZUZA 3FS7A 4OR9B 4HREE 3DVJA 3VRRA 4OKHA 1YUTA 2BECA 4C0JA 1C07A 2BL0C 4Q04A 2CTNA 4ZCUA 2PALA 1DVIA 5IBWA 2JC2A 3TS5C 1IKUA 1NCYA 3CZTX 1XA5A 3CR4X 4XYNA 3I5FB 5I2OA 2WCBA 1AHRA 2QACA 2L5XB 4GBAA 4AQIA 3PATA 1K90D 1SCMB 2H61A 3K21A 3CGAA 3NSKA 2NZ0A 2L98A 2I7AA 3BQ3A 3PN7B 1NPQA 2HETA 2HPSA 1QTXA 1XFZO 4I5NB 2LUCA 2KFGA 1AK8A 2COLB 3AKAA 1DF0A 1S6CA 4M2QA 3DF0A 1WRLA 3I5GC 1QV1A 2NXQA 1KSOA 1R2UA 1G8IA 1XYDA 1XO5A 4AOMA 3GK4X 1S26D 2LMTA 4YRUA 3A4UB 4PCWA 2LE9B 3ICBA 3CWGA 1S36A 1XK4C 2LHLA 1CDMA 3I5IB 1S3PA 2K0JA 3D0YB 1LA3A 1QASA 3SG7A 1OSAA 1OMVA 3LLEA 1SR6C 2KGRA 1N0YA 1V1FA 1E8AA 2JZIA 2QPTA 1UHIA 4MZKA 2KAXA 4YI8A 1F54A 2ZNDA 3VROA 1MR8A 3BXKA 3TDUA 4DIRA 1SRAA 2Q91A 1BF5A 1CTRA 4PDZA 2ZNEA 1B1GA 5GQQC 2I94A 2LP3A 1F4OA 1WDCC 1YR5A 3E3RA 5JOLA 3CR2A 1CM4A 1OE9B 5BPJA 4JQ0D 4L9MA 1GGZA 2NLNA 5HLVA 4N1GA 1FW4A 2DOQA 2BL0B 2E6WA 1MXLC 1AJ4A 2H2KA 1UHHA 2M97A 3OX5A 2F33A 1N65A 2ZN8A 2O5GA 4FTGA 3TZ1A 3KEVA 2KAVA 2KGBC 2JQ6A 3PFVA 1LA0A 2JWWA 2M3WA 3CS1A 1HQVA 1ZFSA 3I5HB 2JOJA 3I5FC 1KCYA 1SCVA 1GQMA 3EVVA 4BY4A 1SCMC 4PE1A 2WCEA 2M49B 1YUUA 4MRYA 2M9GA 2WCFA 2G9BA 2KSPA 1TNQA 2MBXA 3PN7C 1SKTA 1G33A 2Y1MA 4MN0A 1J7PA 1JBAA 2M0RA 2LLUA 5AANA 1CFDA 1QX2A 1IJ6A 2JU0A 1VRKA 2OS8B 1BLQA 2VRGA 3BOWA 5JJGA 1QX5B 2P6BB 2JTZA 1D1OA 3PM8A 2LVJA 3KPXA 1TNPA 1UUSA 3OHMB 5CSNA 1RJVA 3TUYB 1YVHA 2JXLA 2SCPA 3I5IC 1JF0A 1JUOA 3KHEA 3SIAA 3O4YA
chains in the Genus database with same CATH superfamily
3IF7A 1Y0VH 2AUCA 4MVFA 2D8NA 4MZLA 1OQPA 2M1UA 2LNKA 5K89A 1DJWA 2QEBA 2K2AA 3BYAA 1SL9A 4I5KA 2RGIA 3OP0A 2MJWB 2JNFA 4M2PA 2LHIA 1CLBA 2F3ZA 2HF5A 2JT3A 3CZ2A 3DYEA 2MRDA 2JULA 1K93D 1PK0D 1SY9A 4C0LA 3AKBA 1XVJA 2BBNA 3M0WA 1CNPA 2WORA 3SJSA 2KI4B 1S5GY 4JKTA 3DY9A 1CFPA 1DJIA 5DKRA 1QIWA 3OB2B 4PT1A 1TNXA 4GUKA 4AQJA 1BR4B 2EC6C 2HQ8A 2L4HA 1PVBA 2G2BA 3FWCA 3IQOA 1JC2A 1SK6D 4A4CA 1RFJA 3PALA 1XFXO 3ZWHA 2KNEA 1IQ3A 1ZACA 3AAJA 1RROA 3SG3A 3OB1B 5FYXA 2M7LA 4YGAA 4GGFA 1FF1A 4HRGA 1FBVA 4NDDA 2K8MB 3SG4A 1OOFA 4INXA 1IG5A 1KFUS 1UURA 1LINA 4IL1A 2LV7A 1CDNA 3D78A 1C3YA 3I5HC 3VRPA 2ZN9A 1YX8A 1A4PA 1XFWO 3DF0B 3EK7A 3B7AA 4TNCA 1CB1A 4QJ4B 3N7HA 4I5JA 4I5LB 2QEVA 2EGDA 2LCPA 1NYAA 2KHNA 5CSIA 4ETOA 4ORBB 1AP4A 1TRFA 1WY9A 3EKJA 1QLKA 1CMFA 5ER5A 4GAOA 4CPVA 2WC6A 3O4XA 1NX0A 2OS8C 1SYMA 3ZNIA 1M39A 1AUIB 3WHTB 1WLZA 1B7TZ 1IQ5A 1W7IB 2MA2A 4D1EA 1QLSA 3SIBA 3TUYC 2JRFA 1CDPA 1IGVA 2K7BA 2M29A 3O2PA 2KBMA 5CPVA 3CABA 4N5XA 3D77A 2LM5A 3D75A 2B1UA 2PYQA 1PULA 1BODA 3HCMA 1PVAA 1J55A 1UP5A 2M8UA 1B9AA 1BU3A 5FI2A 1M31A 3AAKA 1OZOA 1TOPA 3LK0A 1TUZA 2FJUB 3JTDC 4PE0A 1MXEA 3WHUB 4PE4A 1L7ZA 1IJ5A 2I18A 3NSIA 2K7DA 1KK8B 2M7NA 3LL8B 1RECA 2EC6B 2R2IA 2MHHA 2KI4C 1KQMB 2F2OA 2LUXA 5DKNA 1DEKA 1DJZA 1QV0A 1NP8A 1NX1A 1W7JB 2AAOA 1QXPA 2TN4A 3D0YA 5KU1A 1UHJA 1CLMA 2KLEA 1NCZA 2H8VA 3KF9A 2KFFA 4A4BA 3LK1A 5DKQA 2CXJA 2BKIB 1U5IA 4CFQA 3S0EA 2H61C 2ZFDA 2PASA 1A29A 3KO0A 3D74A 1XFUO 2KI6D 1SL8A 1IRJA 3UO9A 1DJHA 1TN4A 4GPLB 2IS9A 1LXFC 4ORAB 4DCKA 1M45A 1CFCA 3EG5B 5AXIA 4UPGA 4BY5A 1PSBA 2KPHA 2KQYA 2ZRSA 3L4AA 4QJ3B 3BOWB 2KOTA 1SBJA 1V1GA 1KFUL 1LVCD 3SG5A 2L50A 1F70A 2P70A 2GV5A 3HX4A 4WRIA 4WQ2A 1CM1A 1KWOC 1F4QA 1L2OB 3CYZA 1GJYA 4GNKB 5FI6A 1MWNA 2GTEA 3D10A 1QX7A 1DJXA 2OTGB 1K2HA 1YRTB 3O78A 4N1FA 2JT0A 2WC8A 3BUWB 1ALWA 2E30A 3R1PA 2FJYA 1J1DA 1UWOA 2F2PA 3DVMA 1QS7A 2CBLA 3JVTB 2KI6C 1OOJA 4P5OE 3VGOA 1CLLA 1A75A 3OX6A 1H4BA 2Y4QA 2L2EA 3BJHA 3EVUA 3L4LA 3S0DA 2ZRTA 1FPWA 2HQWA 4GGNA 2BCXA 2JPTA 2L5YA 3NSLA 3JTDB 3VRNA 1KK7Z 3EK8A 5D3OA 1K94A 2LLTA 1GGWA 2WCJA 2WNDA 1QVIZ 1M46A 2Q4UA 5HKWA 2LAPA 4MZJA 1LKJA 1A03A 4JWQA 1XK4A 2JT8A 2K2FA 3LCPC 1DT7B 3D76A 1TWOA 1OW4A 1KFXS 1KK7Y 1KK8C 1SL7A 2L51A 5D7FA 3WXAA 1EJ3A 5D69A 1Q80A 5I2QA 2O60A 1KQMC 1DTLA 5KSZA 1CFFA 2SASA 1YURA 3B6XA 4OV2A 2BE6A 3FE6A 3EVRA 2FCDA 2PVBA 2GGMA 1KSMA 1K9UA 3B86A 3EK4A 1RWYA 3K1EA 4KYNA 3OBVA 1B8CA 1Y6WA 2LVKA 1NCXA 1TNWA 2NCOA 1MUXA 4XJKA 1MF8B 5G08A 2ISDA 1K95A 2BCAA 1WRKA 1YVLA 1DF0B 2M1KB 3QRXA 5AERA 1F71A 2KYCA 1C7VA 2F3YA 2KDHA 1ODBA 1B47A 3EKHA 3F45A 5CSFA 2WCMA 4YGCB 3IQQA 2CCMA 2V53A 2L0PA 1KWOB 3DD4A 1HT9A 1OOIX 2MLEC 2JNXA 1RTP1 3NSOA 4PHJA 3WNXB 2L4IA 4JPZB 1XFYO 1DQEA 1OZSA 1N2DA 1L2OC 3RM1A 3S0BA 1TIZA 2LVVA 4DUQA 1JWDA 4FQTA 4OVNF 1BR1B 3BFHA 1WRZA 1IWQA 2OTGC 3FWBA 1F8HA 1UHNA 2WC5A 1QJTA 4HSZA 4P2YB 4MEWA 1NIWA 1J7QA 1BOCA 1DJGA 2F8PA 2BKHB 2LC5A 2OPOA 2NCPA 3QMEA 1QIVA 2LMUA 1YRUB 3JVTC 1YUSA 4PHNA 1EL4A 2LP2A 3NHTA 4ICBA 5HKZA 4C0KA 5I8NA 1EH2A 3NXAA 1B7TY 1DGVA 1F55A 4MSPA 1SSEB 1YX7A 3FE9A 1B4CA 3FIAA 1C3ZA 1SMGA 2FOTA 3O6BA 3SG6A 3RZSA 1BMOA 1CMGA 2QEOA 5PALA 2PSRA 1DJYA 2JTTA 3PSRA 3SG2A 4CFRA 5AFPA 1OOHA 4YGDB 1BT6A 3BUOB 1EG3A 3BUNB 2MLFC 2EHBA 2QEHA 1U5IB 2I2RE 4NDCA 1SNLA 2K61A 1JF2A 3BUMB 4YBHB 3OGNA 4GGFC 4F7FA 1PSRA 2BE4A 4WQ3A 5HL1A 1Y1UA 1A2XA 4DRWA 3CZ0A 4E68A 3A8RA 1ZMZA 1TTXA 3RLZA 1AJ5A 1KFXL 2K60A 5CSJA 5I94A 4HRHA 1C7WA 1EXRA 1UHKA 4M2OA 1S6IA 1SPYA 2WCHA 1S6JA 1NX3A 1CKKA 3TDIA 4F0ZB 4MLWA 1K8UA 1NUBA 3DZTA 4YGBB 2LVIA 1DMOA 1K96A 2WCKA 3MSEB 1B8LA 1G4YR 1ZOTB 5J3XA 1PRWA 1R6PA 2LMVA 5HKYA 1FI5A 3TS5B 2WCLA 1S1EA 5AEQA 1RK9A 4YI9A 1BJFA 3GOFA 3R1OA 1M63B 3CLNA 3GK2A 2CT9A 4ZCVA 5F6TA 4CLNA 2BNXA 4CIDA 1DGUA 3R1VA 2LANA 1IH0A 2MAZA 1A75B 1WLMA 1J7OA 3IVTA 2FCEA 2GGZA 5ER4X 3PLFB 1NWDA 1ALVA 1EG4A 3V2LA 3C1VA 1XFVO 1OMDA 4USLA 1CDLA 4PHMA 1TCFA 1FI6A 3I5GB 4U8DA 2K7CA 1TCOB 1JFKA 3R72A 1H8BA 2JXCA 1B8RA 4NQGA 4R1EA 1QATA 1AVSA 1Z2CB 1K9KA 1SR6B 2A4JA 2CNPA 2Y1NA 5B8IB 2PRUA 4GFTA 1ORGA 1Y1AA 5HLOA 5TNCA 4QJ5B 3DVEA 3CTNA 3TDZA 5EL2A 1K9PA 2ZKMX 3BUXB 2K7OA 2BCBA 4ORCB 1JSAA 3H4SE 4MBEA 4XJKB 3SS5A 1MHOA 4PE7A 4PALA 4YGEB 5I2LA 1QVIY 3L47A 2BBMA 4FQOA 4MRXA 1S5GZ 1BG1A 1NSHA 2AMIA 2KLDA 1Y1XA 1OMRA 2KFHA 1X02A 2PMYA 4PHKA 5KTYA 1MQ1A 4NDBA 1YTZC 3CR5X 2KBIA 1OOGA 2KAYA 1WDCB 2WOSA 1KQVA 1J1EA 1PALA 3BFAA 2Y5IA 3NGVA 3GK1A 3DVKA 1JFJA 2KYFA 2KQ6A 2LLSA 1NX2A 1J7RA 3PM2A 4OCIA 1SW8A 3VRQA 4DS7A 5HYDA 1ZUZA 3FS7A 4OR9B 4HREE 3DVJA 3VB1A 3S0AA 3VRRA 4OKHA 1YUTA 2BECA 4IJ7A 4C0JA 1C07A 2BL0C 4Q04A 1T14A 2CTNA 4ZCUA 2PALA 1DVIA 5IBWA 2JC2A 3TS5C 1IKUA 1NCYA 3CZTX 1XA5A 3CR4X 4XYNA 3I5FB 5I2OA 2WCBA 1AHRA 2QACA 2L5XB 4GBAA 4AQIA 3PATA 1K90D 1SCMB 2H61A 3K21A 3CGAA 3NSKA 2NZ0A 2L98A 2I7AA 3BFBA 3BQ3A 3NHIA 1NPQA 2HETA 3PN7B 2HPSA 1QTXA 1XFZO 4I5NB 2LUCA 2KFGA 3DXLA 1AK8A 2COLB 3AKAA 1DF0A 2JPOA 1S6CA 1Z4HA 4M2QA 3DF0A 1WRLA 3I5GC 1QV1A 2NXQA 1KSOA 1R2UA 1G8IA 1XYDA 5DICA 1XO5A 4AOMA 3GK4X 1S26D 2LMTA 1W9ZA 4YRUA 3A4UB 4PCWA 1P28A 2LE9B 3ICBA 3CWGA 1S36A 1XK4C 1LS8A 1CDMA 1DELA 1S3PA 2LHLA 3I5IB 2K0JA 3D0YB 1LA3A 1QASA 3FE8A 3SG7A 1OSAA 1OMVA 3CDNA 3LLEA 3SS3A 1SR6C 2KGRA 1N0YA 1QWVA 1V1FA 1XFRA 2ERBA 1E8AA 2JZIA 2QPTA 1UHIA 2PQLA 4MZKA 2KAXA 3B88A 4YI8A 1F54A 2ZNDA 3VROA 1MR8A 3BXKA 3TDUA 4DIRA 3CZ1A 1SRAA 2Q91A 3PJIA 1BF5A 1CTRA 4PDZA 2ZNEA 1B1GA 5GQQC 2I94A 2LP3A 1F4OA 1WDCC 1YR5A 3E3RA 5JOLA 2P71A 3CR2A 1CM4A 1OE9B 5BPJA 4JD9A 4JQ0D 1GGZA 4L9MA 2NLNA 4OZDA 5HLVA 4N1GA 1FW4A 2DOQA 2BL0B 2E6WA 1MXLC 1AJ4A 3D73A 2H2KA 1UHHA 2M97A 3OX5A 2F33A 1N65A 1DC1A 2ZN8A 1GM0A 2O5GA 3S0GA 4FTGA 1IIOA 3TZ1A 2QDIA 3KEVA 2KAVA 2KGBC 2JQ6A 3PFVA 1LA0A 2JWWA 2M3WA 3CS1A 4INWA 1HQVA 1ZFSA 3I5HB 5FI7A 2JOJA 3I5FC 3B87A 1KCYA 1SCVA 1GQMA 3Q8IA 2L2CA 3EVVA 4BY4A 1SCMC 4PE1A 2WCEA 2M49B 1YUUA 4MRYA 2M9GA 2WCFA 3S0FA 2G9BA 2KSPA 1TNQA 2MBXA 3PN7C 1SKTA 1G33A 2Y1MA 4MN0A 1J7PA 1JBAA 2M0RA 2LLUA 5AANA 1CFDA 1QX2A 1IJ6A 2JU0A 1VRKA 2OS8B 1BLQA 2VRGA 3BOWA 2BAPA 5JJGA 1QX5B 2P6BB 2JTZA 1D1OA 3PM8A 2LVJA 3KPXA 1TNPA 1UUSA 3OHMB 1TUJA 1RJVA 5CSNA 3UNWA 3TUYB 1YVHA 3SS4A 2JXLA 2SCPA 3I5IC 2YGUA 1JF0A 1JUOA 3KHEA 3SIAA 3O4YA
chains in the Genus database with same CATH topology
3IF7A 1Y0VH 2AUCA 4MVFA 2D8NA 4MZLA 1OQPA 2M1UA 2LNKA 5K89A 1DJWA 2K2AA 3BYAA 1SL9A 4I5KA 2RGIA 3OP0A 2MJWB 2JNFA 4M2PA 2LHIA 1CLBA 2F3ZA 2HF5A 2JT3A 2MRDA 2JULA 1K93D 1PK0D 1SY9A 4C0LA 3AKBA 1XVJA 2BBNA 3M0WA 2WORA 3SJSA 2KI4B 1S5GY 1CFPA 1DJIA 5DKRA 1QIWA 3OB2B 1TNXA 4GUKA 4AQJA 1BR4B 2EC6C 2HQ8A 2L4HA 1PVBA 2G2BA 3FWCA 3IQOA 1JC2A 1SK6D 4A4CA 1RFJA 3PALA 1XFXO 3ZWHA 2KNEA 1IQ3A 1ZACA 3AAJA 1RROA 3SG3A 3OB1B 5FYXA 2M7LA 4YGAA 4GGFA 1FF1A 4HRGA 1FBVA 4NDDA 2K8MB 3SG4A 1IG5A 1KFUS 1UURA 1LINA 4IL1A 2LV7A 1CDNA 3I5HC 3VRPA 2ZN9A 1YX8A 1A4PA 1XFWO 3DF0B 3EK7A 4TNCA 1CB1A 4QJ4B 4I5JA 4I5LB 2EGDA 2LCPA 1NYAA 2KHNA 5CSIA 4ETOA 4ORBB 1AP4A 1TRFA 1WY9A 3EKJA 1QLKA 1CMFA 5ER5A 4GAOA 4CPVA 1NX0A 2OS8C 1SYMA 3ZNIA 1M39A 1AUIB 3WHTB 1WLZA 1B7TZ 1IQ5A 1W7IB 2MA2A 4D1EA 1QLSA 3SIBA 3TUYC 2JRFA 1CDPA 1IGVA 2K7BA 2M29A 3O2PA 2KBMA 5CPVA 4N5XA 2LM5A 2B1UA 1BODA 1PULA 3HCMA 1PVAA 1J55A 1UP5A 2M8UA 1B9AA 1BU3A 1M31A 3AAKA 1OZOA 1TOPA 3LK0A 3JTDC 2FJUB 4PE0A 1MXEA 3WHUB 4PE4A 1L7ZA 1IJ5A 2I18A 3NSIA 2K7DA 1KK8B 2M7NA 3LL8B 1RECA 2EC6B 2R2IA 2MHHA 2KI4C 1KQMB 2F2OA 2LUXA 5DKNA 1DJZA 1QV0A 1NP8A 1NX1A 1W7JB 2AAOA 1QXPA 2TN4A 3D0YA 5KU1A 1UHJA 1CLMA 1NCZA 3KF9A 2KFFA 4A4BA 3LK1A 5DKQA 2CXJA 2BKIB 1U5IA 4CFQA 2H61C 2ZFDA 2PASA 1A29A 3KO0A 1XFUO 2KI6D 1SL8A 1IRJA 1DJHA 1TN4A 4GPLB 2IS9A 1LXFC 4ORAB 4DCKA 1M45A 1CFCA 5AXIA 4UPGA 4BY5A 1PSBA 2KQYA 2ZRSA 4QJ3B 3BOWB 2KOTA 1SBJA 1V1GA 1KFUL 1LVCD 3SG5A 2L50A 1F70A 2GV5A 3HX4A 4WRIA 4WQ2A 1CM1A 1KWOC 1F4QA 1L2OB 1GJYA 4GNKB 1MWNA 3D10A 1QX7A 1DJXA 2OTGB 1K2HA 1YRTB 3O78A 4N1FA 2JT0A 2WC8A 3BUWB 1ALWA 2E30A 1J1DA 1UWOA 2F2PA 3DVMA 1QS7A 2CBLA 3JVTB 2KI6C 1OOJA 4P5OE 3VGOA 1CLLA 1A75A 3OX6A 1H4BA 2Y4QA 2L2EA 3EVUA 2ZRTA 1FPWA 2HQWA 4GGNA 2BCXA 2JPTA 3VRNA 3NSLA 3JTDB 1KK7Z 3EK8A 1GGWA 1K94A 2LLTA 2WNDA 1QVIZ 1M46A 2Q4UA 5HKWA 2LAPA 4MZJA 1LKJA 1A03A 4JWQA 1XK4A 2JT8A 2K2FA 3LCPC 1DT7B 1KFXS 1KK7Y 1KK8C 1SL7A 2L51A 5D7FA 3WXAA 1EJ3A 5D69A 1Q80A 5I2QA 2O60A 1KQMC 1DTLA 5KSZA 1CFFA 2SASA 1YURA 4OV2A 2BE6A 3EVRA 2FCDA 2PVBA 2GGMA 1KSMA 1K9UA 1CNPA 3EK4A 1RWYA 1B8CA 1Y6WA 2LVKA 1NCXA 1TNWA 2NCOA 1MUXA 4XJKA 1MF8B 5G08A 2ISDA 1K95A 2BCAA 1WRKA 1YVLA 1DF0B 2M1KB 3QRXA 5AERA 1F71A 2KYCA 1C7VA 2F3YA 2KDHA 1ODBA 1B47A 3EKHA 3F45A 5CSFA 4YGCB 3IQQA 2CCMA 2V53A 2L0PA 1KWOB 3DD4A 1HT9A 2MLEC 2JNXA 1RTP1 3NSOA 4PHJA 3WNXB 2L4IA 4JPZB 1XFYO 1OZSA 1N2DA 1L2OC 3RM1A 1TIZA 2LVVA 4DUQA 1JWDA 4OVNF 1BR1B 1WRZA 1IWQA 2OTGC 3FWBA 1F8HA 1UHNA 1QJTA 4HSZA 4P2YB 4MEWA 1NIWA 1J7QA 1BOCA 1DJGA 2F8PA 2BKHB 2LC5A 2OPOA 2NCPA 1QIVA 2LMUA 1YRUB 3JVTC 1YUSA 4PHNA 1EL4A 2LP2A 5HKZA 4ICBA 4C0KA 5I8NA 1EH2A 3NXAA 1B7TY 1DGVA 1F55A 4MSPA 1YX7A 1B4CA 3FIAA 2FOTA 1SMGA 3O6BA 3SG6A 1CMGA 1BMOA 5PALA 2PSRA 1DJYA 2JTTA 3PSRA 3SG2A 4CFRA 5AFPA 4YGDB 1BT6A 3BUOB 1EG3A 3BUNB 2MLFC 2EHBA 1U5IB 2I2RE 4NDCA 1SNLA 2K61A 1JF2A 3BUMB 4YBHB 4GGFC 1PSRA 2BE4A 4WQ3A 1Y1UA 1A2XA 4DRWA 4E68A 3A8RA 1ZMZA 1TTXA 3RLZA 1AJ5A 1KFXL 5CSJA 4HRHA 1C7WA 1EXRA 1UHKA 4M2OA 1S6IA 1SPYA 1S6JA 1NX3A 1CKKA 3TDIA 4F0ZB 4MLWA 1K8UA 1NUBA 4YGBB 2LVIA 1DMOA 1K96A 3MSEB 1B8LA 1G4YR 1ZOTB 5J3XA 1PRWA 1R6PA 2LMVA 5HKYA 1FI5A 3TS5B 1S1EA 5AEQA 1RK9A 4YI9A 1BJFA 3GOFA 1M63B 3CLNA 3GK2A 2CT9A 4ZCVA 5F6TA 4CLNA 4CIDA 1DGUA 2LANA 1IH0A 2MAZA 1A75B 1WLMA 1J7OA 2FCEA 2GGZA 5ER4X 3PLFB 1NWDA 1ALVA 1EG4A 3C1VA 1XFVO 1OMDA 4USLA 1CDLA 4PHMA 1TCFA 1FI6A 3I5GB 4U8DA 2K7CA 1TCOB 1JFKA 1H8BA 2JXCA 1B8RA 4NQGA 4R1EA 1QATA 1AVSA 1K9KA 1SR6B 2A4JA 2CNPA 2Y1NA 5B8IB 2PRUA 4GFTA 1Y1AA 5HLOA 5TNCA 4QJ5B 3DVEA 3CTNA 3TDZA 1K9PA 2ZKMX 3BUXB 2K7OA 2BCBA 4ORCB 1JSAA 3H4SE 4MBEA 4XJKB 1MHOA 4PE7A 4PALA 4YGEB 5I2LA 1QVIY 4MRXA 2BBMA 4FQOA 1S5GZ 1BG1A 1NSHA 2AMIA 1Y1XA 1OMRA 2KFHA 1X02A 2PMYA 4PHKA 5KTYA 1MQ1A 4NDBA 1YTZC 3CR5X 2KBIA 2KAYA 1WDCB 2WOSA 1KQVA 1J1EA 1PALA 2Y5IA 3GK1A 3DVKA 1JFJA 2KYFA 2KQ6A 2LLSA 1NX2A 1J7RA 3VRQA 4OCIA 1SW8A 4DS7A 5HYDA 1ZUZA 3FS7A 4OR9B 4HREE 3DVJA 3VRRA 4OKHA 1YUTA 2BECA 4C0JA 1C07A 2BL0C 4Q04A 2CTNA 4ZCUA 2PALA 1DVIA 5IBWA 2JC2A 3TS5C 1IKUA 1NCYA 3CZTX 1XA5A 3CR4X 4XYNA 3I5FB 5I2OA 2WCBA 1AHRA 2QACA 2L5XB 4GBAA 4AQIA 3PATA 1K90D 1SCMB 2H61A 3K21A 3CGAA 3NSKA 2NZ0A 2L98A 2I7AA 3BQ3A 3PN7B 1NPQA 2HETA 2HPSA 1QTXA 1XFZO 4I5NB 2LUCA 2KFGA 1AK8A 2COLB 3AKAA 1DF0A 1S6CA 4M2QA 3DF0A 1WRLA 3I5GC 1QV1A 2NXQA 1KSOA 1R2UA 1G8IA 1XYDA 1XO5A 4AOMA 3GK4X 1S26D 2LMTA 4YRUA 3A4UB 4PCWA 2LE9B 3ICBA 3CWGA 1S36A 1XK4C 2LHLA 1CDMA 3I5IB 1S3PA 2K0JA 3D0YB 1LA3A 1QASA 3SG7A 1OSAA 1OMVA 3LLEA 1SR6C 2KGRA 1N0YA 1V1FA 1E8AA 2JZIA 2QPTA 1UHIA 4MZKA 2KAXA 4YI8A 1F54A 2ZNDA 3VROA 1MR8A 3BXKA 3TDUA 4DIRA 1SRAA 2Q91A 1BF5A 1CTRA 4PDZA 2ZNEA 1B1GA 5GQQC 2I94A 2LP3A 1F4OA 1WDCC 1YR5A 3E3RA 5JOLA 3CR2A 1CM4A 1OE9B 5BPJA 4JQ0D 4L9MA 1GGZA 2NLNA 5HLVA 4N1GA 1FW4A 2DOQA 2BL0B 2E6WA 1MXLC 1AJ4A 2H2KA 1UHHA 2M97A 3OX5A 2F33A 1N65A 2ZN8A 2O5GA 4FTGA 3TZ1A 3KEVA 2KAVA 2KGBC 2JQ6A 3PFVA 1LA0A 2JWWA 2M3WA 3CS1A 1HQVA 1ZFSA 3I5HB 2JOJA 3I5FC 1KCYA 1SCVA 1GQMA 3EVVA 4BY4A 1SCMC 4PE1A 2WCEA 2M49B 1YUUA 4MRYA 2M9GA 2WCFA 2G9BA 2KSPA 1TNQA 2MBXA 3PN7C 1SKTA 1G33A 2Y1MA 4MN0A 1J7PA 1JBAA 2M0RA 2LLUA 5AANA 1CFDA 1QX2A 1IJ6A 2JU0A 1VRKA 2OS8B 1BLQA 2VRGA 3BOWA 5JJGA 1QX5B 2P6BB 2JTZA 1D1OA 3PM8A 2LVJA 3KPXA 1TNPA 1UUSA 3OHMB 5CSNA 1RJVA 3TUYB 1YVHA 2JXLA 2SCPA 3I5IC 1JF0A 1JUOA 3KHEA 3SIAA 3O4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF7 A;  1Y0V H;  2AUC A;  4MVF A;  2D8N A;  4MZL A;  1OQP A;  2M1U A;  2LNK A;  5K89 A;  1DJW A;  2K2A A;  3BYA A;  1SL9 A;  4I5K A;  2RGI A;  3OP0 A;  2MJW B;  2JNF A;  4M2P A;  2LHI A;  1CLB A;  2F3Z A;  2HF5 A;  2JT3 A;  2MRD A;  2JUL A;  1K93 D;  1PK0 D;  1SY9 A;  4C0L A;  3AKB A;  1XVJ A;  2BBN A;  3M0W A;  2WOR A;  3SJS A;  2KI4 B;  1S5G Y;  1CFP A;  1DJI A;  5DKR A;  1QIW A;  3OB2 B;  1TNX A;  4GUK A;  4AQJ A;  1BR4 B;  2EC6 C;  2HQ8 A;  2L4H A;  1PVB A;  2G2B A;  3FWC A;  3IQO A;  1JC2 A;  1SK6 D;  4A4C A;  1RFJ A;  3PAL A;  1XFX O;  3ZWH A;  2KNE A;  1IQ3 A;  1ZAC A;  3AAJ A;  1RRO A;  3SG3 A;  3OB1 B;  5FYX A;  2M7L A;  4YGA A;  4GGF A;  1FF1 A;  4HRG A;  1FBV A;  4NDD A;  2K8M B;  3SG4 A;  1IG5 A;  1KFU S;  1UUR A;  1LIN A;  4IL1 A;  2LV7 A;  1CDN A;  3I5H C;  3VRP A;  2ZN9 A;  1YX8 A;  1A4P A;  1XFW O;  3DF0 B;  3EK7 A;  4TNC A;  1CB1 A;  4QJ4 B;  4I5J A;  4I5L B;  2EGD A;  2LCP A;  1NYA A;  2KHN A;  5CSI A;  4ETO A;  4ORB B;  1AP4 A;  1TRF A;  1WY9 A;  3EKJ A;  1QLK A;  1CMF A;  5ER5 A;  4GAO A;  4CPV A;  1NX0 A;  2OS8 C;  1SYM A;  3ZNI A;  1M39 A;  1AUI B;  3WHT B;  1WLZ A;  1B7T Z;  1IQ5 A;  1W7I B;  2MA2 A;  4D1E A;  1QLS A;  3SIB A;  3TUY C;  2JRF A;  1CDP A;  1IGV A;  2K7B A;  2M29 A;  3O2P A;  2KBM A;  5CPV A;  4N5X A;  2LM5 A;  2B1U A;  1BOD A;  1PUL A;  3HCM A;  1PVA A;  1J55 A;  1UP5 A;  2M8U A;  1B9A A;  1BU3 A;  1M31 A;  3AAK A;  1OZO A;  1TOP A;  3LK0 A;  3JTD C;  2FJU B;  4PE0 A;  1MXE A;  3WHU B;  4PE4 A;  1L7Z A;  1IJ5 A;  2I18 A;  3NSI A;  2K7D A;  1KK8 B;  2M7N A;  3LL8 B;  1REC A;  2EC6 B;  2R2I A;  2MHH A;  2KI4 C;  1KQM B;  2F2O A;  2LUX A;  5DKN A;  1DJZ A;  1QV0 A;  1NP8 A;  1NX1 A;  1W7J B;  2AAO A;  1QXP A;  2TN4 A;  3D0Y A;  5KU1 A;  1UHJ A;  1CLM A;  1NCZ A;  3KF9 A;  2KFF A;  4A4B A;  3LK1 A;  5DKQ A;  2CXJ A;  2BKI B;  1U5I A;  4CFQ A;  2H61 C;  2ZFD A;  2PAS A;  1A29 A;  3KO0 A;  1XFU O;  2KI6 D;  1SL8 A;  1IRJ A;  1DJH A;  1TN4 A;  4GPL B;  2IS9 A;  1LXF C;  4ORA B;  4DCK A;  1M45 A;  1CFC A;  5AXI A;  4UPG A;  4BY5 A;  1PSB A;  2KQY A;  2ZRS A;  4QJ3 B;  3BOW B;  2KOT A;  1SBJ A;  1V1G A;  1KFU L;  1LVC D;  3SG5 A;  2L50 A;  1F70 A;  2GV5 A;  3HX4 A;  4WRI A;  4WQ2 A;  1CM1 A;  1KWO C;  1F4Q A;  1L2O B;  1GJY A;  4GNK B;  1MWN A;  3D10 A;  1QX7 A;  1DJX A;  2OTG B;  1K2H A;  1YRT B;  3O78 A;  4N1F A;  2JT0 A;  2WC8 A;  3BUW B;  1ALW A;  2E30 A;  1J1D A;  1UWO A;  2F2P A;  3DVM A;  1QS7 A;  2CBL A;  3JVT B;  2KI6 C;  1OOJ A;  4P5O E;  3VGO A;  1CLL A;  1A75 A;  3OX6 A;  1H4B A;  2Y4Q A;  2L2E A;  3EVU A;  2ZRT A;  1FPW A;  2HQW A;  4GGN A;  2BCX A;  2JPT A;  3VRN A;  3NSL A;  3JTD B;  1KK7 Z;  3EK8 A;  1GGW A;  1K94 A;  2LLT A;  2WND A;  1QVI Z;  1M46 A;  2Q4U A;  5HKW A;  2LAP A;  4MZJ A;  1LKJ A;  1A03 A;  4JWQ A;  1XK4 A;  2JT8 A;  2K2F A;  3LCP C;  1DT7 B;  1KFX S;  1KK7 Y;  1KK8 C;  1SL7 A;  2L51 A;  5D7F A;  3WXA A;  1EJ3 A;  5D69 A;  1Q80 A;  5I2Q A;  2O60 A;  1KQM C;  1DTL A;  5KSZ A;  1CFF A;  2SAS A;  1YUR A;  4OV2 A;  2BE6 A;  3EVR A;  2FCD A;  2PVB A;  2GGM A;  1KSM A;  1K9U A;  1CNP A;  3EK4 A;  1RWY A;  1B8C A;  1Y6W A;  2LVK A;  1NCX A;  1TNW A;  2NCO A;  1MUX A;  4XJK A;  1MF8 B;  5G08 A;  2ISD A;  1K95 A;  2BCA A;  1WRK A;  1YVL A;  1DF0 B;  2M1K B;  3QRX A;  5AER A;  1F71 A;  2KYC A;  1C7V A;  2F3Y A;  2KDH A;  1ODB A;  1B47 A;  3EKH A;  3F45 A;  5CSF A;  4YGC B;  3IQQ A;  2CCM A;  2V53 A;  2L0P A;  1KWO B;  3DD4 A;  1HT9 A;  2MLE C;  2JNX A;  1RTP 1;  3NSO A;  4PHJ A;  3WNX B;  2L4I A;  4JPZ B;  1XFY O;  1OZS A;  1N2D A;  1L2O C;  3RM1 A;  1TIZ A;  2LVV A;  4DUQ A;  1JWD A;  4OVN F;  1BR1 B;  1WRZ A;  1IWQ A;  2OTG C;  3FWB A;  1F8H A;  1UHN A;  1QJT A;  4HSZ A;  4P2Y B;  4MEW A;  1NIW A;  1J7Q A;  1BOC A;  1DJG A;  2F8P A;  2BKH B;  2LC5 A;  2OPO A;  2NCP A;  1QIV A;  2LMU A;  1YRU B;  3JVT C;  1YUS A;  4PHN A;  1EL4 A;  2LP2 A;  5HKZ A;  4ICB A;  4C0K A;  5I8N A;  1EH2 A;  3NXA A;  1B7T Y;  1DGV A;  1F55 A;  4MSP A;  1YX7 A;  1B4C A;  3FIA A;  2FOT A;  1SMG A;  3O6B A;  3SG6 A;  1CMG A;  1BMO A;  5PAL A;  2PSR A;  1DJY A;  2JTT A;  3PSR A;  3SG2 A;  4CFR A;  5AFP A;  4YGD B;  1BT6 A;  3BUO B;  1EG3 A;  3BUN B;  2MLF C;  2EHB A;  1U5I B;  2I2R E;  4NDC A;  1SNL A;  2K61 A;  1JF2 A;  3BUM B;  4YBH B;  4GGF C;  1PSR A;  2BE4 A;  4WQ3 A;  1Y1U A;  1A2X A;  4DRW A;  4E68 A;  3A8R A;  1ZMZ A;  1TTX A;  3RLZ A;  1AJ5 A;  1KFX L;  5CSJ A;  4HRH A;  1C7W A;  1EXR A;  1UHK A;  4M2O A;  1S6I A;  1SPY A;  1S6J A;  1NX3 A;  1CKK A;  3TDI A;  4F0Z B;  4MLW A;  1K8U A;  1NUB A;  4YGB B;  2LVI A;  1DMO A;  1K96 A;  3MSE B;  1B8L A;  1G4Y R;  1ZOT B;  5J3X A;  1PRW A;  1R6P A;  2LMV A;  5HKY A;  1FI5 A;  3TS5 B;  1S1E A;  5AEQ A;  1RK9 A;  4YI9 A;  1BJF A;  3GOF A;  1M63 B;  3CLN A;  3GK2 A;  2CT9 A;  4ZCV A;  5F6T A;  4CLN A;  4CID A;  1DGU A;  2LAN A;  1IH0 A;  2MAZ A;  1A75 B;  1WLM A;  1J7O A;  2FCE A;  2GGZ A;  5ER4 X;  3PLF B;  1NWD A;  1ALV A;  1EG4 A;  3C1V A;  1XFV O;  1OMD A;  4USL A;  1CDL A;  4PHM A;  1TCF A;  1FI6 A;  3I5G B;  4U8D A;  2K7C A;  1TCO B;  1JFK A;  1H8B A;  2JXC A;  1B8R A;  4NQG A;  4R1E A;  1QAT A;  1AVS A;  1K9K A;  1SR6 B;  2A4J A;  2CNP A;  2Y1N A;  5B8I B;  2PRU A;  4GFT A;  1Y1A A;  5HLO A;  5TNC A;  4QJ5 B;  3DVE A;  3CTN A;  3TDZ A;  1K9P A;  2ZKM X;  3BUX B;  2K7O A;  2BCB A;  4ORC B;  1JSA A;  3H4S E;  4MBE A;  4XJK B;  1MHO A;  4PE7 A;  4PAL A;  4YGE B;  5I2L A;  1QVI Y;  4MRX A;  2BBM A;  4FQO A;  1S5G Z;  1BG1 A;  1NSH A;  2AMI A;  1Y1X A;  1OMR A;  2KFH A;  1X02 A;  2PMY A;  4PHK A;  5KTY A;  1MQ1 A;  4NDB A;  1YTZ C;  3CR5 X;  2KBI A;  2KAY A;  1WDC B;  2WOS A;  1KQV A;  1J1E A;  1PAL A;  2Y5I A;  3GK1 A;  3DVK A;  1JFJ A;  2KYF A;  2KQ6 A;  2LLS A;  1NX2 A;  1J7R A;  3VRQ A;  4OCI A;  1SW8 A;  4DS7 A;  5HYD A;  1ZUZ A;  3FS7 A;  4OR9 B;  4HRE E;  3DVJ A;  3VRR A;  4OKH A;  1YUT A;  2BEC A;  4C0J A;  1C07 A;  2BL0 C;  4Q04 A;  2CTN A;  4ZCU A;  2PAL A;  1DVI A;  5IBW A;  2JC2 A;  3TS5 C;  1IKU A;  1NCY A;  3CZT X;  1XA5 A;  3CR4 X;  4XYN A;  3I5F B;  5I2O A;  2WCB A;  1AHR A;  2QAC A;  2L5X B;  4GBA A;  4AQI A;  3PAT A;  1K90 D;  1SCM B;  2H61 A;  3K21 A;  3CGA A;  3NSK A;  2NZ0 A;  2L98 A;  2I7A A;  3BQ3 A;  3PN7 B;  1NPQ A;  2HET A;  2HPS A;  1QTX A;  1XFZ O;  4I5N B;  2LUC A;  2KFG A;  1AK8 A;  2COL B;  3AKA A;  1DF0 A;  1S6C A;  4M2Q A;  3DF0 A;  1WRL A;  3I5G C;  1QV1 A;  2NXQ A;  1KSO A;  1R2U A;  1G8I A;  1XYD A;  1XO5 A;  4AOM A;  3GK4 X;  1S26 D;  2LMT A;  4YRU A;  3A4U B;  4PCW A;  2LE9 B;  3ICB A;  3CWG A;  1S36 A;  1XK4 C;  2LHL A;  1CDM A;  3I5I B;  1S3P A;  2K0J A;  3D0Y B;  1LA3 A;  1QAS A;  3SG7 A;  1OSA A;  1OMV A;  3LLE A;  1SR6 C;  2KGR A;  1N0Y A;  1V1F A;  1E8A A;  2JZI A;  2QPT A;  1UHI A;  4MZK A;  2KAX A;  4YI8 A;  1F54 A;  2ZND A;  3VRO A;  1MR8 A;  3BXK A;  3TDU A;  4DIR A;  1SRA A;  2Q91 A;  1BF5 A;  1CTR A;  4PDZ A;  2ZNE A;  1B1G A;  5GQQ C;  2I94 A;  2LP3 A;  1F4O A;  1WDC C;  1YR5 A;  3E3R A;  5JOL A;  3CR2 A;  1CM4 A;  1OE9 B;  5BPJ A;  4JQ0 D;  4L9M A;  1GGZ A;  2NLN A;  5HLV A;  4N1G A;  1FW4 A;  2DOQ A;  2BL0 B;  2E6W A;  1MXL C;  1AJ4 A;  2H2K A;  1UHH A;  2M97 A;  3OX5 A;  2F33 A;  1N65 A;  2ZN8 A;  2O5G A;  4FTG A;  3TZ1 A;  3KEV A;  2KAV A;  2KGB C;  2JQ6 A;  3PFV A;  1LA0 A;  2JWW A;  2M3W A;  3CS1 A;  1HQV A;  1ZFS A;  3I5H B;  2JOJ A;  3I5F C;  1KCY A;  1SCV A;  1GQM A;  3EVV A;  4BY4 A;  1SCM C;  4PE1 A;  2WCE A;  2M49 B;  1YUU A;  4MRY A;  2M9G A;  2WCF A;  2G9B A;  2KSP A;  1TNQ A;  2MBX A;  3PN7 C;  1SKT A;  1G33 A;  2Y1M A;  4MN0 A;  1J7P A;  1JBA A;  2M0R A;  2LLU A;  5AAN A;  1CFD A;  1QX2 A;  1IJ6 A;  2JU0 A;  1VRK A;  2OS8 B;  1BLQ A;  2VRG A;  3BOW A;  5JJG A;  1QX5 B;  2P6B B;  2JTZ A;  1D1O A;  3PM8 A;  2LVJ A;  3KPX A;  1TNP A;  1UUS A;  3OHM B;  5CSN A;  1RJV A;  3TUY B;  1YVH A;  2JXL A;  2SCP A;  3I5I C;  1JF0 A;  1JUO A;  3KHE A;  3SIA A;  3O4Y A; 
#chains in the Genus database with same CATH topology
 3IF7 A;  1Y0V H;  2AUC A;  4MVF A;  2D8N A;  4MZL A;  1OQP A;  2M1U A;  2LNK A;  5K89 A;  1DJW A;  2QEB A;  2K2A A;  3BYA A;  1SL9 A;  4I5K A;  2RGI A;  3OP0 A;  2MJW B;  2JNF A;  4M2P A;  2LHI A;  1CLB A;  2F3Z A;  2HF5 A;  2JT3 A;  3CZ2 A;  3DYE A;  2MRD A;  2JUL A;  1K93 D;  1PK0 D;  1SY9 A;  4C0L A;  3AKB A;  1XVJ A;  2BBN A;  3M0W A;  1CNP A;  2WOR A;  3SJS A;  2KI4 B;  1S5G Y;  4JKT A;  3DY9 A;  1CFP A;  1DJI A;  5DKR A;  1QIW A;  3OB2 B;  4PT1 A;  1TNX A;  4GUK A;  4AQJ A;  1BR4 B;  2EC6 C;  2HQ8 A;  2L4H A;  1PVB A;  2G2B A;  3FWC A;  3IQO A;  1JC2 A;  1SK6 D;  4A4C A;  1RFJ A;  3PAL A;  1XFX O;  3ZWH A;  2KNE A;  1IQ3 A;  1ZAC A;  3AAJ A;  1RRO A;  3SG3 A;  3OB1 B;  5FYX A;  2M7L A;  4YGA A;  4GGF A;  1FF1 A;  4HRG A;  1FBV A;  4NDD A;  2K8M B;  3SG4 A;  1OOF A;  4INX A;  1IG5 A;  1KFU S;  1UUR A;  1LIN A;  4IL1 A;  2LV7 A;  1CDN A;  3D78 A;  1C3Y A;  3I5H C;  3VRP A;  2ZN9 A;  1YX8 A;  1A4P A;  1XFW O;  3DF0 B;  3EK7 A;  3B7A A;  4TNC A;  1CB1 A;  4QJ4 B;  3N7H A;  4I5J A;  4I5L B;  2QEV A;  2EGD A;  2LCP A;  1NYA A;  2KHN A;  5CSI A;  4ETO A;  4ORB B;  1AP4 A;  1TRF A;  1WY9 A;  3EKJ A;  1QLK A;  1CMF A;  5ER5 A;  4GAO A;  4CPV A;  2WC6 A;  3O4X A;  1NX0 A;  2OS8 C;  1SYM A;  3ZNI A;  1M39 A;  1AUI B;  3WHT B;  1WLZ A;  1B7T Z;  1IQ5 A;  1W7I B;  2MA2 A;  4D1E A;  1QLS A;  3SIB A;  3TUY C;  2JRF A;  1CDP A;  1IGV A;  2K7B A;  2M29 A;  3O2P A;  2KBM A;  5CPV A;  3CAB A;  4N5X A;  3D77 A;  2LM5 A;  3D75 A;  2B1U A;  2PYQ A;  1PUL A;  1BOD A;  3HCM A;  1PVA A;  1J55 A;  1UP5 A;  2M8U A;  1B9A A;  1BU3 A;  5FI2 A;  1M31 A;  3AAK A;  1OZO A;  1TOP A;  3LK0 A;  1TUZ A;  2FJU B;  3JTD C;  4PE0 A;  1MXE A;  3WHU B;  4PE4 A;  1L7Z A;  1IJ5 A;  2I18 A;  3NSI A;  2K7D A;  1KK8 B;  2M7N A;  3LL8 B;  1REC A;  2EC6 B;  2R2I A;  2MHH A;  2KI4 C;  1KQM B;  2F2O A;  2LUX A;  5DKN A;  1DEK A;  1DJZ A;  1QV0 A;  1NP8 A;  1NX1 A;  1W7J B;  2AAO A;  1QXP A;  2TN4 A;  3D0Y A;  5KU1 A;  1UHJ A;  1CLM A;  2KLE A;  1NCZ A;  2H8V A;  3KF9 A;  2KFF A;  4A4B A;  3LK1 A;  5DKQ A;  2CXJ A;  2BKI B;  1U5I A;  4CFQ A;  3S0E A;  2H61 C;  2ZFD A;  2PAS A;  1A29 A;  3KO0 A;  3D74 A;  1XFU O;  2KI6 D;  1SL8 A;  1IRJ A;  3UO9 A;  1DJH A;  1TN4 A;  4GPL B;  2IS9 A;  1LXF C;  4ORA B;  4DCK A;  1M45 A;  1CFC A;  3EG5 B;  5AXI A;  4UPG A;  4BY5 A;  1PSB A;  2KPH A;  2KQY A;  2ZRS A;  3L4A A;  4QJ3 B;  3BOW B;  2KOT A;  1SBJ A;  1V1G A;  1KFU L;  1LVC D;  3SG5 A;  2L50 A;  1F70 A;  2P70 A;  2GV5 A;  3HX4 A;  4WRI A;  4WQ2 A;  1CM1 A;  1KWO C;  1F4Q A;  1L2O B;  3CYZ A;  1GJY A;  4GNK B;  5FI6 A;  1MWN A;  2GTE A;  3D10 A;  1QX7 A;  1DJX A;  2OTG B;  1K2H A;  1YRT B;  3O78 A;  4N1F A;  2JT0 A;  2WC8 A;  3BUW B;  1ALW A;  2E30 A;  3R1P A;  2FJY A;  1J1D A;  1UWO A;  2F2P A;  3DVM A;  1QS7 A;  2CBL A;  3JVT B;  2KI6 C;  1OOJ A;  4P5O E;  3VGO A;  1CLL A;  1A75 A;  3OX6 A;  1H4B A;  2Y4Q A;  2L2E A;  3BJH A;  3EVU A;  3L4L A;  3S0D A;  2ZRT A;  1FPW A;  2HQW A;  4GGN A;  2BCX A;  2JPT A;  2L5Y A;  3NSL A;  3JTD B;  3VRN A;  1KK7 Z;  3EK8 A;  5D3O A;  1K94 A;  2LLT A;  1GGW A;  2WCJ A;  2WND A;  1QVI Z;  1M46 A;  2Q4U A;  5HKW A;  2LAP A;  4MZJ A;  1LKJ A;  1A03 A;  4JWQ A;  1XK4 A;  2JT8 A;  2K2F A;  3LCP C;  1DT7 B;  3D76 A;  1TWO A;  1OW4 A;  1KFX S;  1KK7 Y;  1KK8 C;  1SL7 A;  2L51 A;  5D7F A;  3WXA A;  1EJ3 A;  5D69 A;  1Q80 A;  5I2Q A;  2O60 A;  1KQM C;  1DTL A;  5KSZ A;  1CFF A;  2SAS A;  1YUR A;  3B6X A;  4OV2 A;  2BE6 A;  3FE6 A;  3EVR A;  2FCD A;  2PVB A;  2GGM A;  1KSM A;  1K9U A;  3B86 A;  3EK4 A;  1RWY A;  3K1E A;  4KYN A;  3OBV A;  1B8C A;  1Y6W A;  2LVK A;  1NCX A;  1TNW A;  2NCO A;  1MUX A;  4XJK A;  1MF8 B;  5G08 A;  2ISD A;  1K95 A;  2BCA A;  1WRK A;  1YVL A;  1DF0 B;  2M1K B;  3QRX A;  5AER A;  1F71 A;  2KYC A;  1C7V A;  2F3Y A;  2KDH A;  1ODB A;  1B47 A;  3EKH A;  3F45 A;  5CSF A;  2WCM A;  4YGC B;  3IQQ A;  2CCM A;  2V53 A;  2L0P A;  1KWO B;  3DD4 A;  1HT9 A;  1OOI X;  2MLE C;  2JNX A;  1RTP 1;  3NSO A;  4PHJ A;  3WNX B;  2L4I A;  4JPZ B;  1XFY O;  1DQE A;  1OZS A;  1N2D A;  1L2O C;  3RM1 A;  3S0B A;  1TIZ A;  2LVV A;  4DUQ A;  1JWD A;  4FQT A;  4OVN F;  1BR1 B;  3BFH A;  1WRZ A;  1IWQ A;  2OTG C;  3FWB A;  1F8H A;  1UHN A;  2WC5 A;  1QJT A;  4HSZ A;  4P2Y B;  4MEW A;  1NIW A;  1J7Q A;  1BOC A;  1DJG A;  2F8P A;  2BKH B;  2LC5 A;  2OPO A;  2NCP A;  3QME A;  1QIV A;  2LMU A;  1YRU B;  3JVT C;  1YUS A;  4PHN A;  1EL4 A;  2LP2 A;  3NHT A;  4ICB A;  5HKZ A;  4C0K A;  5I8N A;  1EH2 A;  3NXA A;  1B7T Y;  1DGV A;  1F55 A;  4MSP A;  1SSE B;  1YX7 A;  3FE9 A;  1B4C A;  3FIA A;  1C3Z A;  1SMG A;  2FOT A;  3O6B A;  3SG6 A;  3RZS A;  1BMO A;  1CMG A;  2QEO A;  5PAL A;  2PSR A;  1DJY A;  2JTT A;  3PSR A;  3SG2 A;  4CFR A;  5AFP A;  1OOH A;  4YGD B;  1BT6 A;  3BUO B;  1EG3 A;  3BUN B;  2MLF C;  2EHB A;  2QEH A;  1U5I B;  2I2R E;  4NDC A;  1SNL A;  2K61 A;  1JF2 A;  3BUM B;  4YBH B;  3OGN A;  4GGF C;  4F7F A;  1PSR A;  2BE4 A;  4WQ3 A;  5HL1 A;  1Y1U A;  1A2X A;  4DRW A;  3CZ0 A;  4E68 A;  3A8R A;  1ZMZ A;  1TTX A;  3RLZ A;  1AJ5 A;  1KFX L;  2K60 A;  5CSJ A;  5I94 A;  4HRH A;  1C7W A;  1EXR A;  1UHK A;  4M2O A;  1S6I A;  1SPY A;  2WCH A;  1S6J A;  1NX3 A;  1CKK A;  3TDI A;  4F0Z B;  4MLW A;  1K8U A;  1NUB A;  3DZT A;  4YGB B;  2LVI A;  1DMO A;  1K96 A;  2WCK A;  3MSE B;  1B8L A;  1G4Y R;  1ZOT B;  5J3X A;  1PRW A;  1R6P A;  2LMV A;  5HKY A;  1FI5 A;  3TS5 B;  2WCL A;  1S1E A;  5AEQ A;  1RK9 A;  4YI9 A;  1BJF A;  3GOF A;  3R1O A;  1M63 B;  3CLN A;  3GK2 A;  2CT9 A;  4ZCV A;  5F6T A;  4CLN A;  2BNX A;  4CID A;  1DGU A;  3R1V A;  2LAN A;  1IH0 A;  2MAZ A;  1A75 B;  1WLM A;  1J7O A;  3IVT A;  2FCE A;  2GGZ A;  5ER4 X;  3PLF B;  1NWD A;  1ALV A;  1EG4 A;  3V2L A;  3C1V A;  1XFV O;  1OMD A;  4USL A;  1CDL A;  4PHM A;  1TCF A;  1FI6 A;  3I5G B;  4U8D A;  2K7C A;  1TCO B;  1JFK A;  3R72 A;  1H8B A;  2JXC A;  1B8R A;  4NQG A;  4R1E A;  1QAT A;  1AVS A;  1Z2C B;  1K9K A;  1SR6 B;  2A4J A;  2CNP A;  2Y1N A;  5B8I B;  2PRU A;  4GFT A;  1ORG A;  1Y1A A;  5HLO A;  5TNC A;  4QJ5 B;  3DVE A;  3CTN A;  3TDZ A;  5EL2 A;  1K9P A;  2ZKM X;  3BUX B;  2K7O A;  2BCB A;  4ORC B;  1JSA A;  3H4S E;  4MBE A;  4XJK B;  3SS5 A;  1MHO A;  4PE7 A;  4PAL A;  4YGE B;  5I2L A;  1QVI Y;  3L47 A;  2BBM A;  4FQO A;  4MRX A;  1S5G Z;  1BG1 A;  1NSH A;  2AMI A;  2KLD A;  1Y1X A;  1OMR A;  2KFH A;  1X02 A;  2PMY A;  4PHK A;  5KTY A;  1MQ1 A;  4NDB A;  1YTZ C;  3CR5 X;  2KBI A;  1OOG A;  2KAY A;  1WDC B;  2WOS A;  1KQV A;  1J1E A;  1PAL A;  3BFA A;  2Y5I A;  3NGV A;  3GK1 A;  3DVK A;  1JFJ A;  2KYF A;  2KQ6 A;  2LLS A;  1NX2 A;  1J7R A;  3PM2 A;  4OCI A;  1SW8 A;  3VRQ A;  4DS7 A;  5HYD A;  1ZUZ A;  3FS7 A;  4OR9 B;  4HRE E;  3DVJ A;  3VB1 A;  3S0A A;  3VRR A;  4OKH A;  1YUT A;  2BEC A;  4IJ7 A;  4C0J A;  1C07 A;  2BL0 C;  4Q04 A;  1T14 A;  2CTN A;  4ZCU A;  2PAL A;  1DVI A;  5IBW A;  2JC2 A;  3TS5 C;  1IKU A;  1NCY A;  3CZT X;  1XA5 A;  3CR4 X;  4XYN A;  3I5F B;  5I2O A;  2WCB A;  1AHR A;  2QAC A;  2L5X B;  4GBA A;  4AQI A;  3PAT A;  1K90 D;  1SCM B;  2H61 A;  3K21 A;  3CGA A;  3NSK A;  2NZ0 A;  2L98 A;  2I7A A;  3BFB A;  3BQ3 A;  3NHI A;  1NPQ A;  2HET A;  3PN7 B;  2HPS A;  1QTX A;  1XFZ O;  4I5N B;  2LUC A;  2KFG A;  3DXL A;  1AK8 A;  2COL B;  3AKA A;  1DF0 A;  2JPO A;  1S6C A;  1Z4H A;  4M2Q A;  3DF0 A;  1WRL A;  3I5G C;  1QV1 A;  2NXQ A;  1KSO A;  1R2U A;  1G8I A;  1XYD A;  5DIC A;  1XO5 A;  4AOM A;  3GK4 X;  1S26 D;  2LMT A;  1W9Z A;  4YRU A;  3A4U B;  4PCW A;  1P28 A;  2LE9 B;  3ICB A;  3CWG A;  1S36 A;  1XK4 C;  1LS8 A;  1CDM A;  1DEL A;  1S3P A;  2LHL A;  3I5I B;  2K0J A;  3D0Y B;  1LA3 A;  1QAS A;  3FE8 A;  3SG7 A;  1OSA A;  1OMV A;  3CDN A;  3LLE A;  3SS3 A;  1SR6 C;  2KGR A;  1N0Y A;  1QWV A;  1V1F A;  1XFR A;  2ERB A;  1E8A A;  2JZI A;  2QPT A;  1UHI A;  2PQL A;  4MZK A;  2KAX A;  3B88 A;  4YI8 A;  1F54 A;  2ZND A;  3VRO A;  1MR8 A;  3BXK A;  3TDU A;  4DIR A;  3CZ1 A;  1SRA A;  2Q91 A;  3PJI A;  1BF5 A;  1CTR A;  4PDZ A;  2ZNE A;  1B1G A;  5GQQ C;  2I94 A;  2LP3 A;  1F4O A;  1WDC C;  1YR5 A;  3E3R A;  5JOL A;  2P71 A;  3CR2 A;  1CM4 A;  1OE9 B;  5BPJ A;  4JD9 A;  4JQ0 D;  1GGZ A;  4L9M A;  2NLN A;  4OZD A;  5HLV A;  4N1G A;  1FW4 A;  2DOQ A;  2BL0 B;  2E6W A;  1MXL C;  1AJ4 A;  3D73 A;  2H2K A;  1UHH A;  2M97 A;  3OX5 A;  2F33 A;  1N65 A;  1DC1 A;  2ZN8 A;  1GM0 A;  2O5G A;  3S0G A;  4FTG A;  1IIO A;  3TZ1 A;  2QDI A;  3KEV A;  2KAV A;  2KGB C;  2JQ6 A;  3PFV A;  1LA0 A;  2JWW A;  2M3W A;  3CS1 A;  4INW A;  1HQV A;  1ZFS A;  3I5H B;  5FI7 A;  2JOJ A;  3I5F C;  3B87 A;  1KCY A;  1SCV A;  1GQM A;  3Q8I A;  2L2C A;  3EVV A;  4BY4 A;  1SCM C;  4PE1 A;  2WCE A;  2M49 B;  1YUU A;  4MRY A;  2M9G A;  2WCF A;  3S0F A;  2G9B A;  2KSP A;  1TNQ A;  2MBX A;  3PN7 C;  1SKT A;  1G33 A;  2Y1M A;  4MN0 A;  1J7P A;  1JBA A;  2M0R A;  2LLU A;  5AAN A;  1CFD A;  1QX2 A;  1IJ6 A;  2JU0 A;  1VRK A;  2OS8 B;  1BLQ A;  2VRG A;  3BOW A;  2BAP A;  5JJG A;  1QX5 B;  2P6B B;  2JTZ A;  1D1O A;  3PM8 A;  2LVJ A;  3KPX A;  1TNP A;  1UUS A;  3OHM B;  1TUJ A;  1RJV A;  5CSN A;  3UNW A;  3TUY B;  1YVH A;  3SS4 A;  2JXL A;  2SCP A;  3I5I C;  2YGU A;  1JF0 A;  1JUO A;  3KHE A;  3SIA A;  3O4Y A; 
#chains in the Genus database with same CATH homology
 3IF7 A;  1Y0V H;  2AUC A;  4MVF A;  2D8N A;  4MZL A;  1OQP A;  2M1U A;  2LNK A;  5K89 A;  1DJW A;  2K2A A;  3BYA A;  1SL9 A;  4I5K A;  2RGI A;  3OP0 A;  2MJW B;  2JNF A;  4M2P A;  2LHI A;  1CLB A;  2F3Z A;  2HF5 A;  2JT3 A;  2MRD A;  2JUL A;  1K93 D;  1PK0 D;  1SY9 A;  4C0L A;  3AKB A;  1XVJ A;  2BBN A;  3M0W A;  2WOR A;  3SJS A;  2KI4 B;  1S5G Y;  1CFP A;  1DJI A;  5DKR A;  1QIW A;  3OB2 B;  1TNX A;  4GUK A;  4AQJ A;  1BR4 B;  2EC6 C;  2HQ8 A;  2L4H A;  1PVB A;  2G2B A;  3FWC A;  3IQO A;  1JC2 A;  1SK6 D;  4A4C A;  1RFJ A;  3PAL A;  1XFX O;  3ZWH A;  2KNE A;  1IQ3 A;  1ZAC A;  3AAJ A;  1RRO A;  3SG3 A;  3OB1 B;  5FYX A;  2M7L A;  4YGA A;  4GGF A;  1FF1 A;  4HRG A;  1FBV A;  4NDD A;  2K8M B;  3SG4 A;  1IG5 A;  1KFU S;  1UUR A;  1LIN A;  4IL1 A;  2LV7 A;  1CDN A;  3I5H C;  3VRP A;  2ZN9 A;  1YX8 A;  1A4P A;  1XFW O;  3DF0 B;  3EK7 A;  4TNC A;  1CB1 A;  4QJ4 B;  4I5J A;  4I5L B;  2EGD A;  2LCP A;  1NYA A;  2KHN A;  5CSI A;  4ETO A;  4ORB B;  1AP4 A;  1TRF A;  1WY9 A;  3EKJ A;  1QLK A;  1CMF A;  5ER5 A;  4GAO A;  4CPV A;  1NX0 A;  2OS8 C;  1SYM A;  3ZNI A;  1M39 A;  1AUI B;  3WHT B;  1WLZ A;  1B7T Z;  1IQ5 A;  1W7I B;  2MA2 A;  4D1E A;  1QLS A;  3SIB A;  3TUY C;  2JRF A;  1CDP A;  1IGV A;  2K7B A;  2M29 A;  3O2P A;  2KBM A;  5CPV A;  4N5X A;  2LM5 A;  2B1U A;  1BOD A;  1PUL A;  3HCM A;  1PVA A;  1J55 A;  1UP5 A;  2M8U A;  1B9A A;  1BU3 A;  1M31 A;  3AAK A;  1OZO A;  1TOP A;  3LK0 A;  3JTD C;  2FJU B;  4PE0 A;  1MXE A;  3WHU B;  4PE4 A;  1L7Z A;  1IJ5 A;  2I18 A;  3NSI A;  2K7D A;  1KK8 B;  2M7N A;  3LL8 B;  1REC A;  2EC6 B;  2R2I A;  2MHH A;  2KI4 C;  1KQM B;  2F2O A;  2LUX A;  5DKN A;  1DJZ A;  1QV0 A;  1NP8 A;  1NX1 A;  1W7J B;  2AAO A;  1QXP A;  2TN4 A;  3D0Y A;  5KU1 A;  1UHJ A;  1CLM A;  1NCZ A;  3KF9 A;  2KFF A;  4A4B A;  3LK1 A;  5DKQ A;  2CXJ A;  2BKI B;  1U5I A;  4CFQ A;  2H61 C;  2ZFD A;  2PAS A;  1A29 A;  3KO0 A;  1XFU O;  2KI6 D;  1SL8 A;  1IRJ A;  1DJH A;  1TN4 A;  4GPL B;  2IS9 A;  1LXF C;  4ORA B;  4DCK A;  1M45 A;  1CFC A;  5AXI A;  4UPG A;  4BY5 A;  1PSB A;  2KQY A;  2ZRS A;  4QJ3 B;  3BOW B;  2KOT A;  1SBJ A;  1V1G A;  1KFU L;  1LVC D;  3SG5 A;  2L50 A;  1F70 A;  2GV5 A;  3HX4 A;  4WRI A;  4WQ2 A;  1CM1 A;  1KWO C;  1F4Q A;  1L2O B;  1GJY A;  4GNK B;  1MWN A;  3D10 A;  1QX7 A;  1DJX A;  2OTG B;  1K2H A;  1YRT B;  3O78 A;  4N1F A;  2JT0 A;  2WC8 A;  3BUW B;  1ALW A;  2E30 A;  1J1D A;  1UWO A;  2F2P A;  3DVM A;  1QS7 A;  2CBL A;  3JVT B;  2KI6 C;  1OOJ A;  4P5O E;  3VGO A;  1CLL A;  1A75 A;  3OX6 A;  1H4B A;  2Y4Q A;  2L2E A;  3EVU A;  2ZRT A;  1FPW A;  2HQW A;  4GGN A;  2BCX A;  2JPT A;  3VRN A;  3NSL A;  3JTD B;  1KK7 Z;  3EK8 A;  1GGW A;  1K94 A;  2LLT A;  2WND A;  1QVI Z;  1M46 A;  2Q4U A;  5HKW A;  2LAP A;  4MZJ A;  1LKJ A;  1A03 A;  4JWQ A;  1XK4 A;  2JT8 A;  2K2F A;  3LCP C;  1DT7 B;  1KFX S;  1KK7 Y;  1KK8 C;  1SL7 A;  2L51 A;  5D7F A;  3WXA A;  1EJ3 A;  5D69 A;  1Q80 A;  5I2Q A;  2O60 A;  1KQM C;  1DTL A;  5KSZ A;  1CFF A;  2SAS A;  1YUR A;  4OV2 A;  2BE6 A;  3EVR A;  2FCD A;  2PVB A;  2GGM A;  1KSM A;  1K9U A;  1CNP A;  3EK4 A;  1RWY A;  1B8C A;  1Y6W A;  2LVK A;  1NCX A;  1TNW A;  2NCO A;  1MUX A;  4XJK A;  1MF8 B;  5G08 A;  2ISD A;  1K95 A;  2BCA A;  1WRK A;  1YVL A;  1DF0 B;  2M1K B;  3QRX A;  5AER A;  1F71 A;  2KYC A;  1C7V A;  2F3Y A;  2KDH A;  1ODB A;  1B47 A;  3EKH A;  3F45 A;  5CSF A;  4YGC B;  3IQQ A;  2CCM A;  2V53 A;  2L0P A;  1KWO B;  3DD4 A;  1HT9 A;  2MLE C;  2JNX A;  1RTP 1;  3NSO A;  4PHJ A;  3WNX B;  2L4I A;  4JPZ B;  1XFY O;  1OZS A;  1N2D A;  1L2O C;  3RM1 A;  1TIZ A;  2LVV A;  4DUQ A;  1JWD A;  4OVN F;  1BR1 B;  1WRZ A;  1IWQ A;  2OTG C;  3FWB A;  1F8H A;  1UHN A;  1QJT A;  4HSZ A;  4P2Y B;  4MEW A;  1NIW A;  1J7Q A;  1BOC A;  1DJG A;  2F8P A;  2BKH B;  2LC5 A;  2OPO A;  2NCP A;  1QIV A;  2LMU A;  1YRU B;  3JVT C;  1YUS A;  4PHN A;  1EL4 A;  2LP2 A;  5HKZ A;  4ICB A;  4C0K A;  5I8N A;  1EH2 A;  3NXA A;  1B7T Y;  1DGV A;  1F55 A;  4MSP A;  1YX7 A;  1B4C A;  3FIA A;  2FOT A;  1SMG A;  3O6B A;  3SG6 A;  1CMG A;  1BMO A;  5PAL A;  2PSR A;  1DJY A;  2JTT A;  3PSR A;  3SG2 A;  4CFR A;  5AFP A;  4YGD B;  1BT6 A;  3BUO B;  1EG3 A;  3BUN B;  2MLF C;  2EHB A;  1U5I B;  2I2R E;  4NDC A;  1SNL A;  2K61 A;  1JF2 A;  3BUM B;  4YBH B;  4GGF C;  1PSR A;  2BE4 A;  4WQ3 A;  1Y1U A;  1A2X A;  4DRW A;  4E68 A;  3A8R A;  1ZMZ A;  1TTX A;  3RLZ A;  1AJ5 A;  1KFX L;  5CSJ A;  4HRH A;  1C7W A;  1EXR A;  1UHK A;  4M2O A;  1S6I A;  1SPY A;  1S6J A;  1NX3 A;  1CKK A;  3TDI A;  4F0Z B;  4MLW A;  1K8U A;  1NUB A;  4YGB B;  2LVI A;  1DMO A;  1K96 A;  3MSE B;  1B8L A;  1G4Y R;  1ZOT B;  5J3X A;  1PRW A;  1R6P A;  2LMV A;  5HKY A;  1FI5 A;  3TS5 B;  1S1E A;  5AEQ A;  1RK9 A;  4YI9 A;  1BJF A;  3GOF A;  1M63 B;  3CLN A;  3GK2 A;  2CT9 A;  4ZCV A;  5F6T A;  4CLN A;  4CID A;  1DGU A;  2LAN A;  1IH0 A;  2MAZ A;  1A75 B;  1WLM A;  1J7O A;  2FCE A;  2GGZ A;  5ER4 X;  3PLF B;  1NWD A;  1ALV A;  1EG4 A;  3C1V A;  1XFV O;  1OMD A;  4USL A;  1CDL A;  4PHM A;  1TCF A;  1FI6 A;  3I5G B;  4U8D A;  2K7C A;  1TCO B;  1JFK A;  1H8B A;  2JXC A;  1B8R A;  4NQG A;  4R1E A;  1QAT A;  1AVS A;  1K9K A;  1SR6 B;  2A4J A;  2CNP A;  2Y1N A;  5B8I B;  2PRU A;  4GFT A;  1Y1A A;  5HLO A;  5TNC A;  4QJ5 B;  3DVE A;  3CTN A;  3TDZ A;  1K9P A;  2ZKM X;  3BUX B;  2K7O A;  2BCB A;  4ORC B;  1JSA A;  3H4S E;  4MBE A;  4XJK B;  1MHO A;  4PE7 A;  4PAL A;  4YGE B;  5I2L A;  1QVI Y;  4MRX A;  2BBM A;  4FQO A;  1S5G Z;  1BG1 A;  1NSH A;  2AMI A;  1Y1X A;  1OMR A;  2KFH A;  1X02 A;  2PMY A;  4PHK A;  5KTY A;  1MQ1 A;  4NDB A;  1YTZ C;  3CR5 X;  2KBI A;  2KAY A;  1WDC B;  2WOS A;  1KQV A;  1J1E A;  1PAL A;  2Y5I A;  3GK1 A;  3DVK A;  1JFJ A;  2KYF A;  2KQ6 A;  2LLS A;  1NX2 A;  1J7R A;  3VRQ A;  4OCI A;  1SW8 A;  4DS7 A;  5HYD A;  1ZUZ A;  3FS7 A;  4OR9 B;  4HRE E;  3DVJ A;  3VRR A;  4OKH A;  1YUT A;  2BEC A;  4C0J A;  1C07 A;  2BL0 C;  4Q04 A;  2CTN A;  4ZCU A;  2PAL A;  1DVI A;  5IBW A;  2JC2 A;  3TS5 C;  1IKU A;  1NCY A;  3CZT X;  1XA5 A;  3CR4 X;  4XYN A;  3I5F B;  5I2O A;  2WCB A;  1AHR A;  2QAC A;  2L5X B;  4GBA A;  4AQI A;  3PAT A;  1K90 D;  1SCM B;  2H61 A;  3K21 A;  3CGA A;  3NSK A;  2NZ0 A;  2L98 A;  2I7A A;  3BQ3 A;  3PN7 B;  1NPQ A;  2HET A;  2HPS A;  1QTX A;  1XFZ O;  4I5N B;  2LUC A;  2KFG A;  1AK8 A;  2COL B;  3AKA A;  1DF0 A;  1S6C A;  4M2Q A;  3DF0 A;  1WRL A;  3I5G C;  1QV1 A;  2NXQ A;  1KSO A;  1R2U A;  1G8I A;  1XYD A;  1XO5 A;  4AOM A;  3GK4 X;  1S26 D;  2LMT A;  4YRU A;  3A4U B;  4PCW A;  2LE9 B;  3ICB A;  3CWG A;  1S36 A;  1XK4 C;  2LHL A;  1CDM A;  3I5I B;  1S3P A;  2K0J A;  3D0Y B;  1LA3 A;  1QAS A;  3SG7 A;  1OSA A;  1OMV A;  3LLE A;  1SR6 C;  2KGR A;  1N0Y A;  1V1F A;  1E8A A;  2JZI A;  2QPT A;  1UHI A;  4MZK A;  2KAX A;  4YI8 A;  1F54 A;  2ZND A;  3VRO A;  1MR8 A;  3BXK A;  3TDU A;  4DIR A;  1SRA A;  2Q91 A;  1BF5 A;  1CTR A;  4PDZ A;  2ZNE A;  1B1G A;  5GQQ C;  2I94 A;  2LP3 A;  1F4O A;  1WDC C;  1YR5 A;  3E3R A;  5JOL A;  3CR2 A;  1CM4 A;  1OE9 B;  5BPJ A;  4JQ0 D;  4L9M A;  1GGZ A;  2NLN A;  5HLV A;  4N1G A;  1FW4 A;  2DOQ A;  2BL0 B;  2E6W A;  1MXL C;  1AJ4 A;  2H2K A;  1UHH A;  2M97 A;  3OX5 A;  2F33 A;  1N65 A;  2ZN8 A;  2O5G A;  4FTG A;  3TZ1 A;  3KEV A;  2KAV A;  2KGB C;  2JQ6 A;  3PFV A;  1LA0 A;  2JWW A;  2M3W A;  3CS1 A;  1HQV A;  1ZFS A;  3I5H B;  2JOJ A;  3I5F C;  1KCY A;  1SCV A;  1GQM A;  3EVV A;  4BY4 A;  1SCM C;  4PE1 A;  2WCE A;  2M49 B;  1YUU A;  4MRY A;  2M9G A;  2WCF A;  2G9B A;  2KSP A;  1TNQ A;  2MBX A;  3PN7 C;  1SKT A;  1G33 A;  2Y1M A;  4MN0 A;  1J7P A;  1JBA A;  2M0R A;  2LLU A;  5AAN A;  1CFD A;  1QX2 A;  1IJ6 A;  2JU0 A;  1VRK A;  2OS8 B;  1BLQ A;  2VRG A;  3BOW A;  5JJG A;  1QX5 B;  2P6B B;  2JTZ A;  1D1O A;  3PM8 A;  2LVJ A;  3KPX A;  1TNP A;  1UUS A;  3OHM B;  5CSN A;  1RJV A;  3TUY B;  1YVH A;  2JXL A;  2SCP A;  3I5I C;  1JF0 A;  1JUO A;  3KHE A;  3SIA A;  3O4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...