3LK0A

X-ray structure of bovine sc0067,ca(2+)-s100b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 32
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk0A00
1KSMA 2L5XB 2KAYA 4PDZA 1CKKA 3SIBA 3TS5B 2AMIA 2CNPA 1KFXL 3WHUB 3EK7A 2F3YA 2I2RE 1PVAA 2PSRA 4PE1A 2JXLA 4MLWA 1KQMB 1LVCD 5DKQA 1CDNA 3HX4A 1EH2A 1SKTA 1XA5A 3PSRA 1UWOA 2BKIB 3H4SE 2LLSA 3BOWB 4OR9B 1KK7Z 5KSZA 1W7IB 3CR2A 5CSJA 2SASA 4GGNA 2JC2A 1XFUO 1WY9A 2COLB 3DF0B 2B1UA 3KEVA 3BQ3A 4AQIA 2KI6D 1RK9A 1K94A 5IBWA 3OHMB 2V53A 3LLEA 1XFZO 2LMTA 2BCBA 2DOQA 1JFKA 1DJIA 1SL9A 1S6CA 4USLA 4YI8A 1SCMB 4CPVA 1YX7A 4JWQA 1F54A 2KFGA 4MVFA 2K7BA 1MR8A 1EG3A 2BKHB 2KQ6A 2MA2A 2OS8C 3QRXA 4C0KA 3BUMB 5GQQC 2M29A 3NSKA 3CZTX 4PE4A 4OKHA 1SR6B 1QVIY 1JWDA 1BODA 1UHHA 5I2LA 4PHMA 3BUNB 1SL7A 1PALA 3AKAA 4M2QA 4ZCVA 3RLZA 3VGOA 4M2PA 3EVUA 4F0ZB 1Q80A 2CBLA 1BF5A 3SG4A 1QS7A 2L50A 5B8IB 2JTZA 2LP3A 1DMOA 1AVSA 2LMVA 2KSPA 5AANA 3KPXA 4MZKA 2M8UA 1B47A 4GBAA 4GFTA 1QLKA 3ZNIA 1CMFA 1SW8A 1F4QA 1CTRA 1QXPA 2JU0A 1DT7B 2JULA 1MUXA 1KK8B 1OQPA 2HPSA 4E68A 2I94A 4MZLA 3KF9A 4ORAB 3GK2A 4P2YB 3EVVA 2WCBA 2HQ8A 1QASA 4GUKA 1NWDA 1CDPA 1OMVA 1A4PA 1KWOC 4XJKB 1CDMA 4PHJA 1H8BA 5G08A 2MLFC 2NZ0A 3I5GC 3O2PA 3KHEA 4I5NB 3EKHA 1CMGA 1IJ5A 1G4YR 4HRHA 1YURA 1KFXS 1RROA 1NSHA 1FW4A 3JVTB 5PALA 1EXRA 2KBIA 1IKUA 3IQQA 3CTNA 3NSIA 4HSZA 5HKZA 3DVMA 1ALWA 1EG4A 1VRKA 1PK0D 5D69A 3I5FB 4TNCA 1MWNA 1MQ1A 2LVVA 3TS5C 3O4YA 1DJWA 1DGVA 1G8IA 2EGDA 1QTXA 4A4CA 1B4CA 2JT8A 4YRUA 1CM1A 1ZFSA 2ZKMX 4OV2A 3SG3A 4CFRA 2EC6B 1OSAA 4GAOA 1B8RA 1R2UA 4OVNF 2IS9A 3A4UB 3WXAA 5CSIA 1DF0B 4I5LB 1IQ3A 1H4BA 2K61A 2WNDA 2ZFDA 2LHLA 1B9AA 3VRQA 1QX7A 5ER5A 1XFVO 1Y0VH 2ZRSA 3IF7A 4DRWA 1J7PA 1BU3A 3BOWA 1XO5A 3BYAA 1FBVA 1F55A 3DVKA 5ER4X 2BL0B 1Y1AA 2JZIA 1CLLA 1UHJA 1M39A 1S6JA 1A75B 1EJ3A 1LKJA 1PVBA 1SCMC 5AEQA 5DKNA 3TZ1A 1B8CA 1XFWO 1CLMA 2K7DA 1AJ4A 1X02A 3VRRA 1BOCA 4PE7A 2NCPA 3OX5A 1F8HA 5F6TA 4ETOA 1OMDA 1NX1A 1KK7Y 1RFJA 1SR6C 2KDHA 1K9UA 1A03A 1J7QA 4JPZB 1GGWA 2JRFA 2OTGB 5CPVA 3LCPC 3FIAA 3VROA 1WLMA 1BJFA 1JUOA 1S5GZ 2M3WA 4BY5A 1NX2A 1QX5B 3BXKA 4DCKA 2E30A 1LA3A 1KFUL 3IQOA 1N65A 1FPWA 4YBHB 2M1UA 4DS7A 4L9MA 4CIDA 1GJYA 2FJUB 1PULA 4HRGA 2L98A 4XYNA 5CSFA 2HETA 4C0JA 3OB1B 1KK8C 4NDCA 4MRXA 1XFXO 2WCEA 4MRYA 4ORBB 4MEWA 1J1DA 1ZMZA 3CR4X 3GK4X 5TNCA 4UPGA 2Y5IA 2PRUA 3SG5A 5I8NA 1YR5A 3CGAA 1TN4A 1L2OB 3D10A 2R2IA 3DVEA 4U8DA 1U5IB 2NCOA 1SL8A 1CFPA 2GGMA 1S26D 2PASA 4XJKA 3VRNA 1L7ZA 1KSOA 1S36A 1K96A 2LLTA 3O78A 2LANA 1Y1UA 3I5FC 1OE9B 2F8PA 1RJVA 2KYFA 4D1EA 4FQOA 4N5XA 1MHOA 1MXEA 1OZOA 2JT3A 5AFPA 1ODBA 4FTGA 1E8AA 4NQGA 2QPTA 2F2OA 3PATA 5I2OA 1SYMA 3TDZA 3CR5X 1AP4A 1OMRA 1CFDA 4MBEA 4N1GA 2WC8A 3FWBA 3KO0A 1NIWA 1JC2A 1TTXA 1NCYA 1CDLA 3HCMA 4PHNA 4NDBA 1SRAA 3BUWB 1K2HA 2JNXA 3O6BA 2TN4A 1DF0A 2JOJA 3D0YB 2K7OA 2WCFA 2AAOA 2HF5A 1DJXA 2KI6C 2BL0C 3LK1A 4MZJA 2JWWA 4GNKB 5K89A 5FYXA 2G9BA 1YUTA 1N0YA 1AK8A 1N2DA 1LXFC 1TNWA 2LC5A 1Y1XA 2Y1NA 2KI4C 2MHHA 2KYCA 1NP8A 1V1FA 3GOFA 3CWGA 1DGUA 3NSLA 4I5JA 2CCMA 4N1FA 1RTP1 1IH0A 3K21A 4PE0A 1GQMA 1SK6D 2Y4QA 4AOMA 1CFCA 5BPJA 1PSBA 2M0RA 1KQVA 1QJTA 1KQMC 2PALA 1S1EA 2KOTA 1ALVA 2I7AA 1PSRA 2OTGC 2E6WA 1J55A 1XVJA 1JBAA 2MRDA 1F71A 1QV0A 3SJSA 2LVIA 2MJWB 2F33A 3TUYB 2I18A 2RGIA 4QJ4B 1S6IA 3JTDB 2LHIA 2KNEA 1A29A 4I5KA 4WQ2A 3A8RA 2JPTA 1NCXA 1NX3A 2KAVA 1CB1A 1G33A 2GV5A 5HLOA 5AXIA 1WRZA 1DTLA 2LVKA 3DF0A 2JNFA 2K0JA 4PHKA 4WQ3A 1DJGA 1MXLC 1OZSA 2F2PA 4C0LA 1K93D 3F45A 1WRLA 1EL4A 2M9GA 1GGZA 1BR1B 3LL8B 2KQYA 1TCOB 3TDUA 3CLNA 3AAKA 1SPYA 1L2OC 2NXQA 1QIVA 1CFFA 3BUOB 1KWOB 1UHNA 1S5GY 3PALA 3EVRA 3I5GB 3GK1A 1NCZA 4BY4A 1RECA 1QIWA 5JOLA 2LAPA 1C07A 1UHKA 2JTTA 1WDCB 1QV1A 1BLQA 2NLNA 4CLNA 1J7OA 2LUXA 1OOJA 1KCYA 3SIAA 3E3RA 3WNXB 2M7NA 1JSAA 1IJ6A 1TRFA 5D7FA 2LUCA 1B7TZ 1TNXA 3I5HB 2FCDA 1HT9A 1K9PA 1FI5A 1FI6A 2ZNDA 1UP5A 3LK0A 2KGRA 1PRWA 2F3ZA 1YVHA 3PFVA 4Q04A 3C1VA 2M1KB 1TCFA 1TNQA 2JT0A 2ZRTA 2L4IA 3CS1A 1K90D 1UHIA 1ZOTB 2CT9A 4A4BA 5AERA 1DJZA 4YGAA 2ZNEA 1BR4B 2Q4UA 2WORA 2BCXA 2MAZA 1M31A 4QJ3B 4AQJA 1FF1A 2L0PA 2HQWA 2BECA 4OCIA 1C7VA 4GGFC 2LLUA 1QX2A 5HKWA 3JVTC 4PCWA 3VRPA 5HKYA 1R6PA 1AUIB 1SNLA 2A4JA 3D0YA 3EK4A 3I5IB 3PN7B 4ZCUA 2ISDA 4PALA 4GGFA 5KU1A 4WRIA 2LP2A 1JF0A 2P6BB 2KFFA 3MSEB 1CLBA 5DKRA 3ZWHA 2L4HA 1RWYA 1V1GA 2BBMA 1XFYO 1M45A 2O60A 1K8UA 1AJ5A 2EC6C 2BE4A 2H2KA 4YGDB 1J7RA 2LV7A 3SG6A 1YUSA 4M2OA 2BCAA 2H61C 2G2BA 1M46A 2KHNA 4NDDA 5HLVA 2FOTA 1CNPA 1IQ5A 1TNPA 2KBMA 1S3PA 1B8LA 3TUYC 1LA0A 3JTDC 1LINA 1QVIZ 4YGEB 2JQ6A 1QLSA 1XYDA 2LMUA 1K9KA 2H61A 3NXAA 4CFQA 3FS7A 2CXJA 3AAJA 2MBXA 3ICBA 2L2EA 3DVJA 1F70A 1DJHA 1SMGA 1TOPA 2CTNA 3OB2B 2M7LA 4GPLB 2LCPA 3SG7A 3OX6A 1AHRA 1A2XA 1YVLA 2O5GA 1YRTB 1D1OA 2JXCA 5HYDA 4YI9A 1A75A 2EHBA 3AKBA 1BG1A 2D8NA 5JJGA 4IL1A 4YGBB 2K2FA 2Y1MA 1BMOA 3EK8A 1JF2A 1KFUS 2OS8B 2PMYA 1DVIA 1NYAA 4ICBA 2KGBC 3M0WA 3WHTB 1C7WA 1W7JB 2SCPA 1Y6WA 1SY9A 1M63B 2K7CA 2MLEC 2BE6A 1WDCC 1WRKA 4MSPA 3PM8A 5I2QA 3BUXB 2Q91A 4P5OE 3FWCA 3PLFB 3I5HC 3OP0A 1UUSA 2PVBA 1UURA 1NUBA 4QJ5B 4R1EA 3DD4A 1IRJA 4JQ0D 1JFJA 1YTZC 2L51A 1K95A 2KAXA 1WLZA 4DIRA 2LNKA 1TIZA 1BT6A 1SCVA 2GGZA 2LVJA 2ZN9A 1YRUB 1NX0A 3EKJA 1YX8A 2FCEA 2M97A 1F4OA 2WOSA 1IWQA 1ZUZA 2K2AA 2M49B 2BBNA 1NPQA 1YUUA 2OPOA 1SBJA 4ORCB 3RM1A 1B1GA 1J1EA 2QACA 2KFHA 2VRGA 2LM5A 4DUQA 1XK4C 1HQVA 2AUCA 1DJYA 3NSOA 1MF8B 5KTYA 4MN0A 2LE9B 5J3XA 1B7TY 2ZN8A 3I5IC 3TDIA 3PN7C 1QATA 4YGCB 1IG5A 1U5IA 1IGVA 3SG2A 1XK4A 2K8MB 2KI4B 5CSNA 1CM4A 1ZACA 4HREE
chains in the Genus database with same CATH superfamily
3D75A 1KSMA 2L5XB 2KAYA 4PT1A 4PDZA 1CKKA 3SIBA 3TS5B 2AMIA 2CNPA 1KFXL 1TWOA 3WHUB 3EK7A 2F3YA 2I2RE 1PVAA 2PSRA 4PE1A 2JXLA 4MLWA 3S0GA 1KQMB 2KPHA 1LVCD 5DKQA 1CDNA 3HX4A 1EH2A 1SKTA 1XA5A 3PSRA 3S0AA 1UWOA 2BKIB 3H4SE 2LLSA 3BFBA 3BOWB 4OR9B 1KK7Z 5KSZA 1W7IB 3CR2A 5CSJA 2L5YA 2SASA 4GGNA 2JC2A 1XFUO 1WY9A 2COLB 3DF0B 2B1UA 3KEVA 3BQ3A 1OOIX 2KI6D 1RK9A 4AQIA 1K94A 5IBWA 3OHMB 2V53A 3LLEA 1XFZO 2LMTA 2BCBA 2DOQA 1JFKA 2QDIA 1DJIA 1SL9A 1S6CA 4USLA 4YI8A 1SCMB 4CPVA 3DZTA 1YX7A 4IJ7A 4JWQA 1F54A 2KFGA 4MVFA 2K7BA 1MR8A 1EG3A 2BKHB 2KQ6A 2MA2A 2OS8C 3QRXA 4INWA 4C0KA 3BUMB 5GQQC 2M29A 3NSKA 3CZTX 4PE4A 4OKHA 3BFHA 1SR6B 1QVIY 1JWDA 3R1OA 3S0FA 1BODA 1UHHA 5I2LA 4PHMA 3BUNB 1SL7A 1PALA 3AKAA 4M2QA 5EL2A 4ZCVA 2PYQA 4M2PA 3EVUA 3RLZA 1Q80A 2CBLA 4F0ZB 1BF5A 3SG4A 1QS7A 2L50A 5B8IB 2JTZA 2LP3A 5D3OA 1DMOA 1AVSA 2LMVA 2KSPA 5AANA 3KPXA 4MZKA 2M8UA 1B47A 4GBAA 4GFTA 1QLKA 3CDNA 3ZNIA 1XFRA 1CMFA 1SW8A 1F4QA 2QEHA 1CTRA 1QXPA 2JU0A 2P71A 3S0BA 1DT7B 2JULA 1MUXA 1KK8B 1OQPA 3UNWA 4F7FA 2HPSA 4E68A 5FI2A 2I94A 4MZLA 3B6XA 3DYEA 3KF9A 4ORAB 2WCMA 3GK2A 4P2YB 3EVVA 2WCBA 2HQ8A 1QASA 4GUKA 1NWDA 1CDPA 1OMVA 1A4PA 1KWOC 4XJKB 1CDMA 4PHJA 1H8BA 5G08A 2MLFC 2NZ0A 3I5GC 3O2PA 3KHEA 4I5NB 3EKHA 1CMGA 1IJ5A 1G4YR 4HRHA 1YURA 1KFXS 1RROA 1NSHA 1FW4A 3JVTB 5PALA 1EXRA 2KBIA 1IKUA 5DICA 3IQQA 3CTNA 3NSIA 3VGOA 1DQEA 1OW4A 3NGVA 4HSZA 5HKZA 3DVMA 1ALWA 1EG4A 1VRKA 2JPOA 1PK0D 3B87A 5D69A 3I5FB 4TNCA 1MWNA 1MQ1A 2LVVA 3TS5C 3DY9A 2P70A 3O4YA 1DJWA 1C3ZA 1DGVA 1G8IA 2WC5A 2EGDA 1QTXA 4A4CA 3OGNA 1W9ZA 2JT8A 4YRUA 1B4CA 1CM1A 1ZFSA 2ZKMX 4JD9A 4OV2A 3SG3A 4CFRA 1TUZA 2EC6B 1OSAA 3CZ2A 3FE8A 4GAOA 1B8RA 1R2UA 4OVNF 2IS9A 3A4UB 3WXAA 5CSIA 1DF0B 2FJYA 4I5LB 1IQ3A 2K61A 1H4BA 2WNDA 2ZFDA 1SSEB 2LHLA 1B9AA 3VRQA 2QEBA 3V2LA 1QX7A 5ER5A 3UO9A 1XFVO 1Y0VH 2ZRSA 1DC1A 3IF7A 4DRWA 1J7PA 1BU3A 3BOWA 1XO5A 3BYAA 1FBVA 1F55A 3DVKA 5ER4X 2BL0B 1Y1AA 3B7AA 2JZIA 1CLLA 1UHJA 1M39A 1S6JA 1A75B 1EJ3A 1LKJA 1PVBA 1SCMC 5AEQA 2KLEA 5DKNA 3TZ1A 1B8CA 3NHIA 1XFWO 1CLMA 2K7DA 1AJ4A 1X02A 3VRRA 1BOCA 4PE7A 2NCPA 3OX5A 1F8HA 5F6TA 4ETOA 1OMDA 1NX1A 1KK7Y 1RFJA 1SR6C 2KDHA 1K9UA 1A03A 1J7QA 3PM2A 4JPZB 1GGWA 2JRFA 2OTGB 5CPVA 3LCPC 3FIAA 3O4XA 3VROA 1WLMA 4JKTA 1BJFA 1JUOA 1S5GZ 2M3WA 4BY5A 1NX2A 1QX5B 3BXKA 4DCKA 2E30A 1LA3A 1KFUL 3IQOA 1N65A 1FPWA 4YBHB 1IIOA 2M1UA 4DS7A 4L9MA 4CIDA 1GJYA 2FJUB 1PULA 4HRGA 2L98A 4XYNA 5CSFA 3S0DA 2HETA 4C0JA 3OB1B 1KK8C 4NDCA 4MRXA 3D76A 1XFXO 3B86A 2WCEA 4MRYA 4ORBB 4MEWA 1J1DA 1ZMZA 3CR4X 3GK4X 5TNCA 4UPGA 1Z2CB 2Y5IA 2PRUA 3SG5A 5I8NA 2WCJA 1ORGA 1YR5A 3CGAA 1TN4A 1L2OB 3D10A 2R2IA 3DVEA 4U8DA 1U5IB 2NCOA 1SL8A 1CFPA 2GGMA 1S26D 2PASA 4XJKA 3VRNA 1L7ZA 1KSOA 1S36A 3NHTA 3BJHA 1K96A 2H8VA 2LLTA 3O78A 2LANA 1Y1UA 3I5FC 3L47A 3K1EA 1OE9B 3IVTA 2F8PA 1RJVA 2KYFA 4D1EA 4FQOA 4N5XA 1MHOA 1MXEA 1OZOA 2JT3A 5AFPA 1ODBA 2YGUA 3Q8IA 4FTGA 1E8AA 4NQGA 2QPTA 2F2OA 3PATA 5I2OA 1SYMA 3TDZA 3CR5X 1AP4A 1OMRA 1CFDA 1OOHA 4MBEA 4N1GA 2WC8A 3FWBA 3KO0A 1NIWA 1JC2A 1TTXA 1NCYA 1CDLA 3HCMA 4PHNA 4NDBA 1SRAA 3BUWB 3SS5A 1K2HA 2JNXA 3O6BA 2TN4A 1DF0A 2JOJA 3D0YB 2K7OA 2WCFA 2AAOA 2HF5A 1DJXA 2KI6C 2BL0C 3LK1A 4MZJA 2JWWA 4GNKB 5K89A 5FYXA 2G9BA 1YUTA 1N0YA 1AK8A 1N2DA 1LXFC 1TNWA 2LC5A 2WCLA 1Y1XA 2Y1NA 2KI4C 2MHHA 2KYCA 1NP8A 1V1FA 3GOFA 3CWGA 1DGUA 3NSLA 4I5JA 2CCMA 4N1FA 1RTP1 1IH0A 3VB1A 3K21A 4PE0A 1GQMA 1SK6D 2Y4QA 4AOMA 1CFCA 5BPJA 1PSBA 2M0RA 1KQVA 1QJTA 1KQMC 2PALA 1S1EA 2KOTA 1ALVA 2I7AA 1PSRA 2OTGC 2E6WA 1J55A 1XVJA 1JBAA 2MRDA 1F71A 1QV0A 3SJSA 2LVIA 2MJWB 2F33A 3TUYB 2I18A 2RGIA 4QJ4B 1S6IA 3JTDB 2LHIA 5I94A 1P28A 2KNEA 1A29A 4I5KA 4WQ2A 3A8RA 2JPTA 1NCXA 1NX3A 2KAVA 1CB1A 1G33A 2GV5A 5HLOA 5AXIA 1WRZA 1DTLA 2LVKA 3DF0A 2JNFA 2K0JA 4PHKA 4WQ3A 1DJGA 1MXLC 1OZSA 2F2PA 4C0LA 2QEVA 1K93D 3F45A 1WRLA 1EL4A 2WCHA 2M9GA 1GGZA 1BR1B 3LL8B 2KQYA 1TCOB 3TDUA 3CLNA 3AAKA 3SS4A 1SPYA 1L2OC 2NXQA 1QIVA 1CFFA 3BUOB 1KWOB 1UHNA 1S5GY 3N7HA 3PALA 3EVRA 3I5GB 3GK1A 1NCZA 4OZDA 4BY4A 1T14A 1RECA 1QIWA 5JOLA 2LAPA 3R1VA 1UHKA 2JTTA 1C07A 3S0EA 1WDCB 1QV1A 1BLQA 2NLNA 4CLNA 1J7OA 2LUXA 1OOJA 3B88A 1KCYA 3SIAA 3E3RA 3WNXB 2M7NA 2K60A 1JSAA 1IJ6A 1TRFA 5D7FA 2LUCA 1B7TZ 1TNXA 3I5HB 2FCDA 1HT9A 5FI7A 1K9PA 1FI5A 2WC6A 2ZNDA 1FI6A 1UP5A 3LK0A 2KGRA 1PRWA 2F3ZA 1YVHA 1OOGA 3PFVA 4Q04A 3C1VA 2M1KB 1OOFA 1TCFA 1TNQA 2JT0A 2ZRTA 2L4IA 3CS1A 3PJIA 3BFAA 3DXLA 1K90D 1UHIA 1ZOTB 2CT9A 4A4BA 5AERA 1DJZA 4YGAA 2ZNEA 1BR4B 2Q4UA 2WORA 2BCXA 1Z4HA 2MAZA 1M31A 4QJ3B 4AQJA 1FF1A 2L0PA 2HQWA 2BECA 4OCIA 1C7VA 4GGFC 2LLUA 1GM0A 1QX2A 3FE6A 3JVTC 5HKWA 4PCWA 3VRPA 5HKYA 1R6PA 2QEOA 1AUIB 1SNLA 2A4JA 3D0YA 3EK4A 3I5IB 3PN7B 4INXA 4ZCUA 2ISDA 4PALA 3SS3A 4GGFA 5KU1A 4WRIA 2LP2A 1JF0A 2L2CA 2P6BB 2KFFA 3MSEB 1QWVA 1CLBA 3OBVA 5DKRA 3ZWHA 2L4HA 1RWYA 1V1GA 2BBMA 1XFYO 1M45A 2O60A 1K8UA 1AJ5A 2EC6C 2BE4A 2H2KA 4YGDB 1J7RA 2LV7A 4FQTA 3SG6A 1YUSA 3CZ1A 4M2OA 1DEKA 2BCAA 2H61C 2G2BA 1M46A 2KHNA 4NDDA 5HLVA 2FOTA 1CNPA 1IQ5A 1TNPA 2KBMA 1S3PA 1B8LA 3TUYC 2PQLA 1LA0A 3JTDC 1LINA 1QVIZ 4YGEB 2JQ6A 1QLSA 1XYDA 2LMUA 1K9KA 2H61A 3NXAA 2BNXA 4CFQA 3FS7A 2CXJA 3AAJA 2MBXA 3ICBA 2L2EA 3CZ0A 3DVJA 1F70A 1DJHA 1SMGA 1DELA 1TOPA 2CTNA 3CYZA 3OB2B 2M7LA 4GPLB 2LCPA 3SG7A 3OX6A 1AHRA 3D73A 1A2XA 1YVLA 2O5GA 1YRTB 2WCKA 1D1OA 2JXCA 5HYDA 4YI9A 1A75A 2EHBA 3AKBA 5FI6A 1BG1A 2D8NA 4KYNA 5JJGA 4IL1A 4YGBB 2K2FA 2Y1MA 1BMOA 3EK8A 3D74A 1JF2A 1KFUS 2OS8B 2PMYA 5HL1A 1DVIA 1NYAA 4ICBA 2KGBC 3M0WA 3WHTB 1C7WA 1W7JB 3EG5B 2SCPA 1Y6WA 1SY9A 1LS8A 1M63B 2K7CA 2BE6A 2MLEC 3D77A 1WDCC 1WRKA 3D78A 4MSPA 2BAPA 3PM8A 3QMEA 5I2QA 1C3YA 3BUXB 2Q91A 4P5OE 3FWCA 3FE9A 3PLFB 1TUJA 3I5HC 3L4LA 3OP0A 1UUSA 2PVBA 1UURA 1NUBA 4QJ5B 4R1EA 3DD4A 1IRJA 3CABA 4JQ0D 1JFJA 1YTZC 2L51A 1K95A 2KAXA 1WLZA 4DIRA 2LNKA 1TIZA 1BT6A 1SCVA 2GGZA 2LVJA 2ZN9A 1YRUB 1NX0A 3EKJA 1YX8A 2FCEA 2M97A 1F4OA 2ERBA 2WOSA 1IWQA 1ZUZA 2K2AA 2M49B 2KLDA 2BBNA 1NPQA 1YUUA 3RZSA 2OPOA 1SBJA 4ORCB 3RM1A 1B1GA 1J1EA 2QACA 2KFHA 2VRGA 2LM5A 4DUQA 3R1PA 1XK4C 1HQVA 2AUCA 1DJYA 3NSOA 3R72A 3L4AA 1MF8B 5KTYA 4MN0A 2LE9B 5J3XA 2GTEA 1B7TY 2ZN8A 3I5IC 3TDIA 3PN7C 1QATA 4YGCB 1IG5A 1U5IA 1IGVA 3SG2A 1XK4A 2K8MB 2KI4B 5CSNA 1CM4A 1ZACA 4HREE
chains in the Genus database with same CATH topology
1KSMA 2L5XB 2KAYA 4PDZA 1CKKA 3SIBA 3TS5B 2AMIA 2CNPA 1KFXL 3WHUB 3EK7A 2F3YA 2I2RE 1PVAA 2PSRA 4PE1A 2JXLA 4MLWA 1KQMB 1LVCD 5DKQA 1CDNA 3HX4A 1EH2A 1SKTA 1XA5A 3PSRA 1UWOA 2BKIB 3H4SE 2LLSA 3BOWB 4OR9B 1KK7Z 5KSZA 1W7IB 3CR2A 5CSJA 2SASA 4GGNA 2JC2A 1XFUO 1WY9A 2COLB 3DF0B 2B1UA 3KEVA 3BQ3A 4AQIA 2KI6D 1RK9A 1K94A 5IBWA 3OHMB 2V53A 3LLEA 1XFZO 2LMTA 2BCBA 2DOQA 1JFKA 1DJIA 1SL9A 1S6CA 4USLA 4YI8A 1SCMB 4CPVA 1YX7A 4JWQA 1F54A 2KFGA 4MVFA 2K7BA 1MR8A 1EG3A 2BKHB 2KQ6A 2MA2A 2OS8C 3QRXA 4C0KA 3BUMB 5GQQC 2M29A 3NSKA 3CZTX 4PE4A 4OKHA 1SR6B 1QVIY 1JWDA 1BODA 1UHHA 5I2LA 4PHMA 3BUNB 1SL7A 1PALA 3AKAA 4M2QA 4ZCVA 3RLZA 3VGOA 4M2PA 3EVUA 4F0ZB 1Q80A 2CBLA 1BF5A 3SG4A 1QS7A 2L50A 5B8IB 2JTZA 2LP3A 1DMOA 1AVSA 2LMVA 2KSPA 5AANA 3KPXA 4MZKA 2M8UA 1B47A 4GBAA 4GFTA 1QLKA 3ZNIA 1CMFA 1SW8A 1F4QA 1CTRA 1QXPA 2JU0A 1DT7B 2JULA 1MUXA 1KK8B 1OQPA 2HPSA 4E68A 2I94A 4MZLA 3KF9A 4ORAB 3GK2A 4P2YB 3EVVA 2WCBA 2HQ8A 1QASA 4GUKA 1NWDA 1CDPA 1OMVA 1A4PA 1KWOC 4XJKB 1CDMA 4PHJA 1H8BA 5G08A 2MLFC 2NZ0A 3I5GC 3O2PA 3KHEA 4I5NB 3EKHA 1CMGA 1IJ5A 1G4YR 4HRHA 1YURA 1KFXS 1RROA 1NSHA 1FW4A 3JVTB 5PALA 1EXRA 2KBIA 1IKUA 3IQQA 3CTNA 3NSIA 4HSZA 5HKZA 3DVMA 1ALWA 1EG4A 1VRKA 1PK0D 5D69A 3I5FB 4TNCA 1MWNA 1MQ1A 2LVVA 3TS5C 3O4YA 1DJWA 1DGVA 1G8IA 2EGDA 1QTXA 4A4CA 1B4CA 2JT8A 4YRUA 1CM1A 1ZFSA 2ZKMX 4OV2A 3SG3A 4CFRA 2EC6B 1OSAA 4GAOA 1B8RA 1R2UA 4OVNF 2IS9A 3A4UB 3WXAA 5CSIA 1DF0B 4I5LB 1IQ3A 1H4BA 2K61A 2WNDA 2ZFDA 2LHLA 1B9AA 3VRQA 1QX7A 5ER5A 1XFVO 1Y0VH 2ZRSA 3IF7A 4DRWA 1J7PA 1BU3A 3BOWA 1XO5A 3BYAA 1FBVA 1F55A 3DVKA 5ER4X 2BL0B 1Y1AA 2JZIA 1CLLA 1UHJA 1M39A 1S6JA 1A75B 1EJ3A 1LKJA 1PVBA 1SCMC 5AEQA 5DKNA 3TZ1A 1B8CA 1XFWO 1CLMA 2K7DA 1AJ4A 1X02A 3VRRA 1BOCA 4PE7A 2NCPA 3OX5A 1F8HA 5F6TA 4ETOA 1OMDA 1NX1A 1KK7Y 1RFJA 1SR6C 2KDHA 1K9UA 1A03A 1J7QA 4JPZB 1GGWA 2JRFA 2OTGB 5CPVA 3LCPC 3FIAA 3VROA 1WLMA 1BJFA 1JUOA 1S5GZ 2M3WA 4BY5A 1NX2A 1QX5B 3BXKA 4DCKA 2E30A 1LA3A 1KFUL 3IQOA 1N65A 1FPWA 4YBHB 2M1UA 4DS7A 4L9MA 4CIDA 1GJYA 2FJUB 1PULA 4HRGA 2L98A 4XYNA 5CSFA 2HETA 4C0JA 3OB1B 1KK8C 4NDCA 4MRXA 1XFXO 2WCEA 4MRYA 4ORBB 4MEWA 1J1DA 1ZMZA 3CR4X 3GK4X 5TNCA 4UPGA 2Y5IA 2PRUA 3SG5A 5I8NA 1YR5A 3CGAA 1TN4A 1L2OB 3D10A 2R2IA 3DVEA 4U8DA 1U5IB 2NCOA 1SL8A 1CFPA 2GGMA 1S26D 2PASA 4XJKA 3VRNA 1L7ZA 1KSOA 1S36A 1K96A 2LLTA 3O78A 2LANA 1Y1UA 3I5FC 1OE9B 2F8PA 1RJVA 2KYFA 4D1EA 4FQOA 4N5XA 1MHOA 1MXEA 1OZOA 2JT3A 5AFPA 1ODBA 4FTGA 1E8AA 4NQGA 2QPTA 2F2OA 3PATA 5I2OA 1SYMA 3TDZA 3CR5X 1AP4A 1OMRA 1CFDA 4MBEA 4N1GA 2WC8A 3FWBA 3KO0A 1NIWA 1JC2A 1TTXA 1NCYA 1CDLA 3HCMA 4PHNA 4NDBA 1SRAA 3BUWB 1K2HA 2JNXA 3O6BA 2TN4A 1DF0A 2JOJA 3D0YB 2K7OA 2WCFA 2AAOA 2HF5A 1DJXA 2KI6C 2BL0C 3LK1A 4MZJA 2JWWA 4GNKB 5K89A 5FYXA 2G9BA 1YUTA 1N0YA 1AK8A 1N2DA 1LXFC 1TNWA 2LC5A 1Y1XA 2Y1NA 2KI4C 2MHHA 2KYCA 1NP8A 1V1FA 3GOFA 3CWGA 1DGUA 3NSLA 4I5JA 2CCMA 4N1FA 1RTP1 1IH0A 3K21A 4PE0A 1GQMA 1SK6D 2Y4QA 4AOMA 1CFCA 5BPJA 1PSBA 2M0RA 1KQVA 1QJTA 1KQMC 2PALA 1S1EA 2KOTA 1ALVA 2I7AA 1PSRA 2OTGC 2E6WA 1J55A 1XVJA 1JBAA 2MRDA 1F71A 1QV0A 3SJSA 2LVIA 2MJWB 2F33A 3TUYB 2I18A 2RGIA 4QJ4B 1S6IA 3JTDB 2LHIA 2KNEA 1A29A 4I5KA 4WQ2A 3A8RA 2JPTA 1NCXA 1NX3A 2KAVA 1CB1A 1G33A 2GV5A 5HLOA 5AXIA 1WRZA 1DTLA 2LVKA 3DF0A 2JNFA 2K0JA 4PHKA 4WQ3A 1DJGA 1MXLC 1OZSA 2F2PA 4C0LA 1K93D 3F45A 1WRLA 1EL4A 2M9GA 1GGZA 1BR1B 3LL8B 2KQYA 1TCOB 3TDUA 3CLNA 3AAKA 1SPYA 1L2OC 2NXQA 1QIVA 1CFFA 3BUOB 1KWOB 1UHNA 1S5GY 3PALA 3EVRA 3I5GB 3GK1A 1NCZA 4BY4A 1RECA 1QIWA 5JOLA 2LAPA 1C07A 1UHKA 2JTTA 1WDCB 1QV1A 1BLQA 2NLNA 4CLNA 1J7OA 2LUXA 1OOJA 1KCYA 3SIAA 3E3RA 3WNXB 2M7NA 1JSAA 1IJ6A 1TRFA 5D7FA 2LUCA 1B7TZ 1TNXA 3I5HB 2FCDA 1HT9A 1K9PA 1FI5A 1FI6A 2ZNDA 1UP5A 3LK0A 2KGRA 1PRWA 2F3ZA 1YVHA 3PFVA 4Q04A 3C1VA 2M1KB 1TCFA 1TNQA 2JT0A 2ZRTA 2L4IA 3CS1A 1K90D 1UHIA 1ZOTB 2CT9A 4A4BA 5AERA 1DJZA 4YGAA 2ZNEA 1BR4B 2Q4UA 2WORA 2BCXA 2MAZA 1M31A 4QJ3B 4AQJA 1FF1A 2L0PA 2HQWA 2BECA 4OCIA 1C7VA 4GGFC 2LLUA 1QX2A 5HKWA 3JVTC 4PCWA 3VRPA 5HKYA 1R6PA 1AUIB 1SNLA 2A4JA 3D0YA 3EK4A 3I5IB 3PN7B 4ZCUA 2ISDA 4PALA 4GGFA 5KU1A 4WRIA 2LP2A 1JF0A 2P6BB 2KFFA 3MSEB 1CLBA 5DKRA 3ZWHA 2L4HA 1RWYA 1V1GA 2BBMA 1XFYO 1M45A 2O60A 1K8UA 1AJ5A 2EC6C 2BE4A 2H2KA 4YGDB 1J7RA 2LV7A 3SG6A 1YUSA 4M2OA 2BCAA 2H61C 2G2BA 1M46A 2KHNA 4NDDA 5HLVA 2FOTA 1CNPA 1IQ5A 1TNPA 2KBMA 1S3PA 1B8LA 3TUYC 1LA0A 3JTDC 1LINA 1QVIZ 4YGEB 2JQ6A 1QLSA 1XYDA 2LMUA 1K9KA 2H61A 3NXAA 4CFQA 3FS7A 2CXJA 3AAJA 2MBXA 3ICBA 2L2EA 3DVJA 1F70A 1DJHA 1SMGA 1TOPA 2CTNA 3OB2B 2M7LA 4GPLB 2LCPA 3SG7A 3OX6A 1AHRA 1A2XA 1YVLA 2O5GA 1YRTB 1D1OA 2JXCA 5HYDA 4YI9A 1A75A 2EHBA 3AKBA 1BG1A 2D8NA 5JJGA 4IL1A 4YGBB 2K2FA 2Y1MA 1BMOA 3EK8A 1JF2A 1KFUS 2OS8B 2PMYA 1DVIA 1NYAA 4ICBA 2KGBC 3M0WA 3WHTB 1C7WA 1W7JB 2SCPA 1Y6WA 1SY9A 1M63B 2K7CA 2MLEC 2BE6A 1WDCC 1WRKA 4MSPA 3PM8A 5I2QA 3BUXB 2Q91A 4P5OE 3FWCA 3PLFB 3I5HC 3OP0A 1UUSA 2PVBA 1UURA 1NUBA 4QJ5B 4R1EA 3DD4A 1IRJA 4JQ0D 1JFJA 1YTZC 2L51A 1K95A 2KAXA 1WLZA 4DIRA 2LNKA 1TIZA 1BT6A 1SCVA 2GGZA 2LVJA 2ZN9A 1YRUB 1NX0A 3EKJA 1YX8A 2FCEA 2M97A 1F4OA 2WOSA 1IWQA 1ZUZA 2K2AA 2M49B 2BBNA 1NPQA 1YUUA 2OPOA 1SBJA 4ORCB 3RM1A 1B1GA 1J1EA 2QACA 2KFHA 2VRGA 2LM5A 4DUQA 1XK4C 1HQVA 2AUCA 1DJYA 3NSOA 1MF8B 5KTYA 4MN0A 2LE9B 5J3XA 1B7TY 2ZN8A 3I5IC 3TDIA 3PN7C 1QATA 4YGCB 1IG5A 1U5IA 1IGVA 3SG2A 1XK4A 2K8MB 2KI4B 5CSNA 1CM4A 1ZACA 4HREE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSM A;  2L5X B;  2KAY A;  4PDZ A;  1CKK A;  3SIB A;  3TS5 B;  2AMI A;  2CNP A;  1KFX L;  3WHU B;  3EK7 A;  2F3Y A;  2I2R E;  1PVA A;  2PSR A;  4PE1 A;  2JXL A;  4MLW A;  1KQM B;  1LVC D;  5DKQ A;  1CDN A;  3HX4 A;  1EH2 A;  1SKT A;  1XA5 A;  3PSR A;  1UWO A;  2BKI B;  3H4S E;  2LLS A;  3BOW B;  4OR9 B;  1KK7 Z;  5KSZ A;  1W7I B;  3CR2 A;  5CSJ A;  2SAS A;  4GGN A;  2JC2 A;  1XFU O;  1WY9 A;  2COL B;  3DF0 B;  2B1U A;  3KEV A;  3BQ3 A;  4AQI A;  2KI6 D;  1RK9 A;  1K94 A;  5IBW A;  3OHM B;  2V53 A;  3LLE A;  1XFZ O;  2LMT A;  2BCB A;  2DOQ A;  1JFK A;  1DJI A;  1SL9 A;  1S6C A;  4USL A;  4YI8 A;  1SCM B;  4CPV A;  1YX7 A;  4JWQ A;  1F54 A;  2KFG A;  4MVF A;  2K7B A;  1MR8 A;  1EG3 A;  2BKH B;  2KQ6 A;  2MA2 A;  2OS8 C;  3QRX A;  4C0K A;  3BUM B;  5GQQ C;  2M29 A;  3NSK A;  3CZT X;  4PE4 A;  4OKH A;  1SR6 B;  1QVI Y;  1JWD A;  1BOD A;  1UHH A;  5I2L A;  4PHM A;  3BUN B;  1SL7 A;  1PAL A;  3AKA A;  4M2Q A;  4ZCV A;  3RLZ A;  3VGO A;  4M2P A;  3EVU A;  4F0Z B;  1Q80 A;  2CBL A;  1BF5 A;  3SG4 A;  1QS7 A;  2L50 A;  5B8I B;  2JTZ A;  2LP3 A;  1DMO A;  1AVS A;  2LMV A;  2KSP A;  5AAN A;  3KPX A;  4MZK A;  2M8U A;  1B47 A;  4GBA A;  4GFT A;  1QLK A;  3ZNI A;  1CMF A;  1SW8 A;  1F4Q A;  1CTR A;  1QXP A;  2JU0 A;  1DT7 B;  2JUL A;  1MUX A;  1KK8 B;  1OQP A;  2HPS A;  4E68 A;  2I94 A;  4MZL A;  3KF9 A;  4ORA B;  3GK2 A;  4P2Y B;  3EVV A;  2WCB A;  2HQ8 A;  1QAS A;  4GUK A;  1NWD A;  1CDP A;  1OMV A;  1A4P A;  1KWO C;  4XJK B;  1CDM A;  4PHJ A;  1H8B A;  5G08 A;  2MLF C;  2NZ0 A;  3I5G C;  3O2P A;  3KHE A;  4I5N B;  3EKH A;  1CMG A;  1IJ5 A;  1G4Y R;  4HRH A;  1YUR A;  1KFX S;  1RRO A;  1NSH A;  1FW4 A;  3JVT B;  5PAL A;  1EXR A;  2KBI A;  1IKU A;  3IQQ A;  3CTN A;  3NSI A;  4HSZ A;  5HKZ A;  3DVM A;  1ALW A;  1EG4 A;  1VRK A;  1PK0 D;  5D69 A;  3I5F B;  4TNC A;  1MWN A;  1MQ1 A;  2LVV A;  3TS5 C;  3O4Y A;  1DJW A;  1DGV A;  1G8I A;  2EGD A;  1QTX A;  4A4C A;  1B4C A;  2JT8 A;  4YRU A;  1CM1 A;  1ZFS A;  2ZKM X;  4OV2 A;  3SG3 A;  4CFR A;  2EC6 B;  1OSA A;  4GAO A;  1B8R A;  1R2U A;  4OVN F;  2IS9 A;  3A4U B;  3WXA A;  5CSI A;  1DF0 B;  4I5L B;  1IQ3 A;  1H4B A;  2K61 A;  2WND A;  2ZFD A;  2LHL A;  1B9A A;  3VRQ A;  1QX7 A;  5ER5 A;  1XFV O;  1Y0V H;  2ZRS A;  3IF7 A;  4DRW A;  1J7P A;  1BU3 A;  3BOW A;  1XO5 A;  3BYA A;  1FBV A;  1F55 A;  3DVK A;  5ER4 X;  2BL0 B;  1Y1A A;  2JZI A;  1CLL A;  1UHJ A;  1M39 A;  1S6J A;  1A75 B;  1EJ3 A;  1LKJ A;  1PVB A;  1SCM C;  5AEQ A;  5DKN A;  3TZ1 A;  1B8C A;  1XFW O;  1CLM A;  2K7D A;  1AJ4 A;  1X02 A;  3VRR A;  1BOC A;  4PE7 A;  2NCP A;  3OX5 A;  1F8H A;  5F6T A;  4ETO A;  1OMD A;  1NX1 A;  1KK7 Y;  1RFJ A;  1SR6 C;  2KDH A;  1K9U A;  1A03 A;  1J7Q A;  4JPZ B;  1GGW A;  2JRF A;  2OTG B;  5CPV A;  3LCP C;  3FIA A;  3VRO A;  1WLM A;  1BJF A;  1JUO A;  1S5G Z;  2M3W A;  4BY5 A;  1NX2 A;  1QX5 B;  3BXK A;  4DCK A;  2E30 A;  1LA3 A;  1KFU L;  3IQO A;  1N65 A;  1FPW A;  4YBH B;  2M1U A;  4DS7 A;  4L9M A;  4CID A;  1GJY A;  2FJU B;  1PUL A;  4HRG A;  2L98 A;  4XYN A;  5CSF A;  2HET A;  4C0J A;  3OB1 B;  1KK8 C;  4NDC A;  4MRX A;  1XFX O;  2WCE A;  4MRY A;  4ORB B;  4MEW A;  1J1D A;  1ZMZ A;  3CR4 X;  3GK4 X;  5TNC A;  4UPG A;  2Y5I A;  2PRU A;  3SG5 A;  5I8N A;  1YR5 A;  3CGA A;  1TN4 A;  1L2O B;  3D10 A;  2R2I A;  3DVE A;  4U8D A;  1U5I B;  2NCO A;  1SL8 A;  1CFP A;  2GGM A;  1S26 D;  2PAS A;  4XJK A;  3VRN A;  1L7Z A;  1KSO A;  1S36 A;  1K96 A;  2LLT A;  3O78 A;  2LAN A;  1Y1U A;  3I5F C;  1OE9 B;  2F8P A;  1RJV A;  2KYF A;  4D1E A;  4FQO A;  4N5X A;  1MHO A;  1MXE A;  1OZO A;  2JT3 A;  5AFP A;  1ODB A;  4FTG A;  1E8A A;  4NQG A;  2QPT A;  2F2O A;  3PAT A;  5I2O A;  1SYM A;  3TDZ A;  3CR5 X;  1AP4 A;  1OMR A;  1CFD A;  4MBE A;  4N1G A;  2WC8 A;  3FWB A;  3KO0 A;  1NIW A;  1JC2 A;  1TTX A;  1NCY A;  1CDL A;  3HCM A;  4PHN A;  4NDB A;  1SRA A;  3BUW B;  1K2H A;  2JNX A;  3O6B A;  2TN4 A;  1DF0 A;  2JOJ A;  3D0Y B;  2K7O A;  2WCF A;  2AAO A;  2HF5 A;  1DJX A;  2KI6 C;  2BL0 C;  3LK1 A;  4MZJ A;  2JWW A;  4GNK B;  5K89 A;  5FYX A;  2G9B A;  1YUT A;  1N0Y A;  1AK8 A;  1N2D A;  1LXF C;  1TNW A;  2LC5 A;  1Y1X A;  2Y1N A;  2KI4 C;  2MHH A;  2KYC A;  1NP8 A;  1V1F A;  3GOF A;  3CWG A;  1DGU A;  3NSL A;  4I5J A;  2CCM A;  4N1F A;  1RTP 1;  1IH0 A;  3K21 A;  4PE0 A;  1GQM A;  1SK6 D;  2Y4Q A;  4AOM A;  1CFC A;  5BPJ A;  1PSB A;  2M0R A;  1KQV A;  1QJT A;  1KQM C;  2PAL A;  1S1E A;  2KOT A;  1ALV A;  2I7A A;  1PSR A;  2OTG C;  2E6W A;  1J55 A;  1XVJ A;  1JBA A;  2MRD A;  1F71 A;  1QV0 A;  3SJS A;  2LVI A;  2MJW B;  2F33 A;  3TUY B;  2I18 A;  2RGI A;  4QJ4 B;  1S6I A;  3JTD B;  2LHI A;  2KNE A;  1A29 A;  4I5K A;  4WQ2 A;  3A8R A;  2JPT A;  1NCX A;  1NX3 A;  2KAV A;  1CB1 A;  1G33 A;  2GV5 A;  5HLO A;  5AXI A;  1WRZ A;  1DTL A;  2LVK A;  3DF0 A;  2JNF A;  2K0J A;  4PHK A;  4WQ3 A;  1DJG A;  1MXL C;  1OZS A;  2F2P A;  4C0L A;  1K93 D;  3F45 A;  1WRL A;  1EL4 A;  2M9G A;  1GGZ A;  1BR1 B;  3LL8 B;  2KQY A;  1TCO B;  3TDU A;  3CLN A;  3AAK A;  1SPY A;  1L2O C;  2NXQ A;  1QIV A;  1CFF A;  3BUO B;  1KWO B;  1UHN A;  1S5G Y;  3PAL A;  3EVR A;  3I5G B;  3GK1 A;  1NCZ A;  4BY4 A;  1REC A;  1QIW A;  5JOL A;  2LAP A;  1C07 A;  1UHK A;  2JTT A;  1WDC B;  1QV1 A;  1BLQ A;  2NLN A;  4CLN A;  1J7O A;  2LUX A;  1OOJ A;  1KCY A;  3SIA A;  3E3R A;  3WNX B;  2M7N A;  1JSA A;  1IJ6 A;  1TRF A;  5D7F A;  2LUC A;  1B7T Z;  1TNX A;  3I5H B;  2FCD A;  1HT9 A;  1K9P A;  1FI5 A;  1FI6 A;  2ZND A;  1UP5 A;  3LK0 A;  2KGR A;  1PRW A;  2F3Z A;  1YVH A;  3PFV A;  4Q04 A;  3C1V A;  2M1K B;  1TCF A;  1TNQ A;  2JT0 A;  2ZRT A;  2L4I A;  3CS1 A;  1K90 D;  1UHI A;  1ZOT B;  2CT9 A;  4A4B A;  5AER A;  1DJZ A;  4YGA A;  2ZNE A;  1BR4 B;  2Q4U A;  2WOR A;  2BCX A;  2MAZ A;  1M31 A;  4QJ3 B;  4AQJ A;  1FF1 A;  2L0P A;  2HQW A;  2BEC A;  4OCI A;  1C7V A;  4GGF C;  2LLU A;  1QX2 A;  5HKW A;  3JVT C;  4PCW A;  3VRP A;  5HKY A;  1R6P A;  1AUI B;  1SNL A;  2A4J A;  3D0Y A;  3EK4 A;  3I5I B;  3PN7 B;  4ZCU A;  2ISD A;  4PAL A;  4GGF A;  5KU1 A;  4WRI A;  2LP2 A;  1JF0 A;  2P6B B;  2KFF A;  3MSE B;  1CLB A;  5DKR A;  3ZWH A;  2L4H A;  1RWY A;  1V1G A;  2BBM A;  1XFY O;  1M45 A;  2O60 A;  1K8U A;  1AJ5 A;  2EC6 C;  2BE4 A;  2H2K A;  4YGD B;  1J7R A;  2LV7 A;  3SG6 A;  1YUS A;  4M2O A;  2BCA A;  2H61 C;  2G2B A;  1M46 A;  2KHN A;  4NDD A;  5HLV A;  2FOT A;  1CNP A;  1IQ5 A;  1TNP A;  2KBM A;  1S3P A;  1B8L A;  3TUY C;  1LA0 A;  3JTD C;  1LIN A;  1QVI Z;  4YGE B;  2JQ6 A;  1QLS A;  1XYD A;  2LMU A;  1K9K A;  2H61 A;  3NXA A;  4CFQ A;  3FS7 A;  2CXJ A;  3AAJ A;  2MBX A;  3ICB A;  2L2E A;  3DVJ A;  1F70 A;  1DJH A;  1SMG A;  1TOP A;  2CTN A;  3OB2 B;  2M7L A;  4GPL B;  2LCP A;  3SG7 A;  3OX6 A;  1AHR A;  1A2X A;  1YVL A;  2O5G A;  1YRT B;  1D1O A;  2JXC A;  5HYD A;  4YI9 A;  1A75 A;  2EHB A;  3AKB A;  1BG1 A;  2D8N A;  5JJG A;  4IL1 A;  4YGB B;  2K2F A;  2Y1M A;  1BMO A;  3EK8 A;  1JF2 A;  1KFU S;  2OS8 B;  2PMY A;  1DVI A;  1NYA A;  4ICB A;  2KGB C;  3M0W A;  3WHT B;  1C7W A;  1W7J B;  2SCP A;  1Y6W A;  1SY9 A;  1M63 B;  2K7C A;  2MLE C;  2BE6 A;  1WDC C;  1WRK A;  4MSP A;  3PM8 A;  5I2Q A;  3BUX B;  2Q91 A;  4P5O E;  3FWC A;  3PLF B;  3I5H C;  3OP0 A;  1UUS A;  2PVB A;  1UUR A;  1NUB A;  4QJ5 B;  4R1E A;  3DD4 A;  1IRJ A;  4JQ0 D;  1JFJ A;  1YTZ C;  2L51 A;  1K95 A;  2KAX A;  1WLZ A;  4DIR A;  2LNK A;  1TIZ A;  1BT6 A;  1SCV A;  2GGZ A;  2LVJ A;  2ZN9 A;  1YRU B;  1NX0 A;  3EKJ A;  1YX8 A;  2FCE A;  2M97 A;  1F4O A;  2WOS A;  1IWQ A;  1ZUZ A;  2K2A A;  2M49 B;  2BBN A;  1NPQ A;  1YUU A;  2OPO A;  1SBJ A;  4ORC B;  3RM1 A;  1B1G A;  1J1E A;  2QAC A;  2KFH A;  2VRG A;  2LM5 A;  4DUQ A;  1XK4 C;  1HQV A;  2AUC A;  1DJY A;  3NSO A;  1MF8 B;  5KTY A;  4MN0 A;  2LE9 B;  5J3X A;  1B7T Y;  2ZN8 A;  3I5I C;  3TDI A;  3PN7 C;  1QAT A;  4YGC B;  1IG5 A;  1U5I A;  1IGV A;  3SG2 A;  1XK4 A;  2K8M B;  2KI4 B;  5CSN A;  1CM4 A;  1ZAC A;  4HRE E; 
#chains in the Genus database with same CATH topology
 3D75 A;  1KSM A;  2L5X B;  2KAY A;  4PT1 A;  4PDZ A;  1CKK A;  3SIB A;  3TS5 B;  2AMI A;  2CNP A;  1KFX L;  1TWO A;  3WHU B;  3EK7 A;  2F3Y A;  2I2R E;  1PVA A;  2PSR A;  4PE1 A;  2JXL A;  4MLW A;  3S0G A;  1KQM B;  2KPH A;  1LVC D;  5DKQ A;  1CDN A;  3HX4 A;  1EH2 A;  1SKT A;  1XA5 A;  3PSR A;  3S0A A;  1UWO A;  2BKI B;  3H4S E;  2LLS A;  3BFB A;  3BOW B;  4OR9 B;  1KK7 Z;  5KSZ A;  1W7I B;  3CR2 A;  5CSJ A;  2L5Y A;  2SAS A;  4GGN A;  2JC2 A;  1XFU O;  1WY9 A;  2COL B;  3DF0 B;  2B1U A;  3KEV A;  3BQ3 A;  1OOI X;  2KI6 D;  1RK9 A;  4AQI A;  1K94 A;  5IBW A;  3OHM B;  2V53 A;  3LLE A;  1XFZ O;  2LMT A;  2BCB A;  2DOQ A;  1JFK A;  2QDI A;  1DJI A;  1SL9 A;  1S6C A;  4USL A;  4YI8 A;  1SCM B;  4CPV A;  3DZT A;  1YX7 A;  4IJ7 A;  4JWQ A;  1F54 A;  2KFG A;  4MVF A;  2K7B A;  1MR8 A;  1EG3 A;  2BKH B;  2KQ6 A;  2MA2 A;  2OS8 C;  3QRX A;  4INW A;  4C0K A;  3BUM B;  5GQQ C;  2M29 A;  3NSK A;  3CZT X;  4PE4 A;  4OKH A;  3BFH A;  1SR6 B;  1QVI Y;  1JWD A;  3R1O A;  3S0F A;  1BOD A;  1UHH A;  5I2L A;  4PHM A;  3BUN B;  1SL7 A;  1PAL A;  3AKA A;  4M2Q A;  5EL2 A;  4ZCV A;  2PYQ A;  4M2P A;  3EVU A;  3RLZ A;  1Q80 A;  2CBL A;  4F0Z B;  1BF5 A;  3SG4 A;  1QS7 A;  2L50 A;  5B8I B;  2JTZ A;  2LP3 A;  5D3O A;  1DMO A;  1AVS A;  2LMV A;  2KSP A;  5AAN A;  3KPX A;  4MZK A;  2M8U A;  1B47 A;  4GBA A;  4GFT A;  1QLK A;  3CDN A;  3ZNI A;  1XFR A;  1CMF A;  1SW8 A;  1F4Q A;  2QEH A;  1CTR A;  1QXP A;  2JU0 A;  2P71 A;  3S0B A;  1DT7 B;  2JUL A;  1MUX A;  1KK8 B;  1OQP A;  3UNW A;  4F7F A;  2HPS A;  4E68 A;  5FI2 A;  2I94 A;  4MZL A;  3B6X A;  3DYE A;  3KF9 A;  4ORA B;  2WCM A;  3GK2 A;  4P2Y B;  3EVV A;  2WCB A;  2HQ8 A;  1QAS A;  4GUK A;  1NWD A;  1CDP A;  1OMV A;  1A4P A;  1KWO C;  4XJK B;  1CDM A;  4PHJ A;  1H8B A;  5G08 A;  2MLF C;  2NZ0 A;  3I5G C;  3O2P A;  3KHE A;  4I5N B;  3EKH A;  1CMG A;  1IJ5 A;  1G4Y R;  4HRH A;  1YUR A;  1KFX S;  1RRO A;  1NSH A;  1FW4 A;  3JVT B;  5PAL A;  1EXR A;  2KBI A;  1IKU A;  5DIC A;  3IQQ A;  3CTN A;  3NSI A;  3VGO A;  1DQE A;  1OW4 A;  3NGV A;  4HSZ A;  5HKZ A;  3DVM A;  1ALW A;  1EG4 A;  1VRK A;  2JPO A;  1PK0 D;  3B87 A;  5D69 A;  3I5F B;  4TNC A;  1MWN A;  1MQ1 A;  2LVV A;  3TS5 C;  3DY9 A;  2P70 A;  3O4Y A;  1DJW A;  1C3Z A;  1DGV A;  1G8I A;  2WC5 A;  2EGD A;  1QTX A;  4A4C A;  3OGN A;  1W9Z A;  2JT8 A;  4YRU A;  1B4C A;  1CM1 A;  1ZFS A;  2ZKM X;  4JD9 A;  4OV2 A;  3SG3 A;  4CFR A;  1TUZ A;  2EC6 B;  1OSA A;  3CZ2 A;  3FE8 A;  4GAO A;  1B8R A;  1R2U A;  4OVN F;  2IS9 A;  3A4U B;  3WXA A;  5CSI A;  1DF0 B;  2FJY A;  4I5L B;  1IQ3 A;  2K61 A;  1H4B A;  2WND A;  2ZFD A;  1SSE B;  2LHL A;  1B9A A;  3VRQ A;  2QEB A;  3V2L A;  1QX7 A;  5ER5 A;  3UO9 A;  1XFV O;  1Y0V H;  2ZRS A;  1DC1 A;  3IF7 A;  4DRW A;  1J7P A;  1BU3 A;  3BOW A;  1XO5 A;  3BYA A;  1FBV A;  1F55 A;  3DVK A;  5ER4 X;  2BL0 B;  1Y1A A;  3B7A A;  2JZI A;  1CLL A;  1UHJ A;  1M39 A;  1S6J A;  1A75 B;  1EJ3 A;  1LKJ A;  1PVB A;  1SCM C;  5AEQ A;  2KLE A;  5DKN A;  3TZ1 A;  1B8C A;  3NHI A;  1XFW O;  1CLM A;  2K7D A;  1AJ4 A;  1X02 A;  3VRR A;  1BOC A;  4PE7 A;  2NCP A;  3OX5 A;  1F8H A;  5F6T A;  4ETO A;  1OMD A;  1NX1 A;  1KK7 Y;  1RFJ A;  1SR6 C;  2KDH A;  1K9U A;  1A03 A;  1J7Q A;  3PM2 A;  4JPZ B;  1GGW A;  2JRF A;  2OTG B;  5CPV A;  3LCP C;  3FIA A;  3O4X A;  3VRO A;  1WLM A;  4JKT A;  1BJF A;  1JUO A;  1S5G Z;  2M3W A;  4BY5 A;  1NX2 A;  1QX5 B;  3BXK A;  4DCK A;  2E30 A;  1LA3 A;  1KFU L;  3IQO A;  1N65 A;  1FPW A;  4YBH B;  1IIO A;  2M1U A;  4DS7 A;  4L9M A;  4CID A;  1GJY A;  2FJU B;  1PUL A;  4HRG A;  2L98 A;  4XYN A;  5CSF A;  3S0D A;  2HET A;  4C0J A;  3OB1 B;  1KK8 C;  4NDC A;  4MRX A;  3D76 A;  1XFX O;  3B86 A;  2WCE A;  4MRY A;  4ORB B;  4MEW A;  1J1D A;  1ZMZ A;  3CR4 X;  3GK4 X;  5TNC A;  4UPG A;  1Z2C B;  2Y5I A;  2PRU A;  3SG5 A;  5I8N A;  2WCJ A;  1ORG A;  1YR5 A;  3CGA A;  1TN4 A;  1L2O B;  3D10 A;  2R2I A;  3DVE A;  4U8D A;  1U5I B;  2NCO A;  1SL8 A;  1CFP A;  2GGM A;  1S26 D;  2PAS A;  4XJK A;  3VRN A;  1L7Z A;  1KSO A;  1S36 A;  3NHT A;  3BJH A;  1K96 A;  2H8V A;  2LLT A;  3O78 A;  2LAN A;  1Y1U A;  3I5F C;  3L47 A;  3K1E A;  1OE9 B;  3IVT A;  2F8P A;  1RJV A;  2KYF A;  4D1E A;  4FQO A;  4N5X A;  1MHO A;  1MXE A;  1OZO A;  2JT3 A;  5AFP A;  1ODB A;  2YGU A;  3Q8I A;  4FTG A;  1E8A A;  4NQG A;  2QPT A;  2F2O A;  3PAT A;  5I2O A;  1SYM A;  3TDZ A;  3CR5 X;  1AP4 A;  1OMR A;  1CFD A;  1OOH A;  4MBE A;  4N1G A;  2WC8 A;  3FWB A;  3KO0 A;  1NIW A;  1JC2 A;  1TTX A;  1NCY A;  1CDL A;  3HCM A;  4PHN A;  4NDB A;  1SRA A;  3BUW B;  3SS5 A;  1K2H A;  2JNX A;  3O6B A;  2TN4 A;  1DF0 A;  2JOJ A;  3D0Y B;  2K7O A;  2WCF A;  2AAO A;  2HF5 A;  1DJX A;  2KI6 C;  2BL0 C;  3LK1 A;  4MZJ A;  2JWW A;  4GNK B;  5K89 A;  5FYX A;  2G9B A;  1YUT A;  1N0Y A;  1AK8 A;  1N2D A;  1LXF C;  1TNW A;  2LC5 A;  2WCL A;  1Y1X A;  2Y1N A;  2KI4 C;  2MHH A;  2KYC A;  1NP8 A;  1V1F A;  3GOF A;  3CWG A;  1DGU A;  3NSL A;  4I5J A;  2CCM A;  4N1F A;  1RTP 1;  1IH0 A;  3VB1 A;  3K21 A;  4PE0 A;  1GQM A;  1SK6 D;  2Y4Q A;  4AOM A;  1CFC A;  5BPJ A;  1PSB A;  2M0R A;  1KQV A;  1QJT A;  1KQM C;  2PAL A;  1S1E A;  2KOT A;  1ALV A;  2I7A A;  1PSR A;  2OTG C;  2E6W A;  1J55 A;  1XVJ A;  1JBA A;  2MRD A;  1F71 A;  1QV0 A;  3SJS A;  2LVI A;  2MJW B;  2F33 A;  3TUY B;  2I18 A;  2RGI A;  4QJ4 B;  1S6I A;  3JTD B;  2LHI A;  5I94 A;  1P28 A;  2KNE A;  1A29 A;  4I5K A;  4WQ2 A;  3A8R A;  2JPT A;  1NCX A;  1NX3 A;  2KAV A;  1CB1 A;  1G33 A;  2GV5 A;  5HLO A;  5AXI A;  1WRZ A;  1DTL A;  2LVK A;  3DF0 A;  2JNF A;  2K0J A;  4PHK A;  4WQ3 A;  1DJG A;  1MXL C;  1OZS A;  2F2P A;  4C0L A;  2QEV A;  1K93 D;  3F45 A;  1WRL A;  1EL4 A;  2WCH A;  2M9G A;  1GGZ A;  1BR1 B;  3LL8 B;  2KQY A;  1TCO B;  3TDU A;  3CLN A;  3AAK A;  3SS4 A;  1SPY A;  1L2O C;  2NXQ A;  1QIV A;  1CFF A;  3BUO B;  1KWO B;  1UHN A;  1S5G Y;  3N7H A;  3PAL A;  3EVR A;  3I5G B;  3GK1 A;  1NCZ A;  4OZD A;  4BY4 A;  1T14 A;  1REC A;  1QIW A;  5JOL A;  2LAP A;  3R1V A;  1UHK A;  2JTT A;  1C07 A;  3S0E A;  1WDC B;  1QV1 A;  1BLQ A;  2NLN A;  4CLN A;  1J7O A;  2LUX A;  1OOJ A;  3B88 A;  1KCY A;  3SIA A;  3E3R A;  3WNX B;  2M7N A;  2K60 A;  1JSA A;  1IJ6 A;  1TRF A;  5D7F A;  2LUC A;  1B7T Z;  1TNX A;  3I5H B;  2FCD A;  1HT9 A;  5FI7 A;  1K9P A;  1FI5 A;  2WC6 A;  2ZND A;  1FI6 A;  1UP5 A;  3LK0 A;  2KGR A;  1PRW A;  2F3Z A;  1YVH A;  1OOG A;  3PFV A;  4Q04 A;  3C1V A;  2M1K B;  1OOF A;  1TCF A;  1TNQ A;  2JT0 A;  2ZRT A;  2L4I A;  3CS1 A;  3PJI A;  3BFA A;  3DXL A;  1K90 D;  1UHI A;  1ZOT B;  2CT9 A;  4A4B A;  5AER A;  1DJZ A;  4YGA A;  2ZNE A;  1BR4 B;  2Q4U A;  2WOR A;  2BCX A;  1Z4H A;  2MAZ A;  1M31 A;  4QJ3 B;  4AQJ A;  1FF1 A;  2L0P A;  2HQW A;  2BEC A;  4OCI A;  1C7V A;  4GGF C;  2LLU A;  1GM0 A;  1QX2 A;  3FE6 A;  3JVT C;  5HKW A;  4PCW A;  3VRP A;  5HKY A;  1R6P A;  2QEO A;  1AUI B;  1SNL A;  2A4J A;  3D0Y A;  3EK4 A;  3I5I B;  3PN7 B;  4INX A;  4ZCU A;  2ISD A;  4PAL A;  3SS3 A;  4GGF A;  5KU1 A;  4WRI A;  2LP2 A;  1JF0 A;  2L2C A;  2P6B B;  2KFF A;  3MSE B;  1QWV A;  1CLB A;  3OBV A;  5DKR A;  3ZWH A;  2L4H A;  1RWY A;  1V1G A;  2BBM A;  1XFY O;  1M45 A;  2O60 A;  1K8U A;  1AJ5 A;  2EC6 C;  2BE4 A;  2H2K A;  4YGD B;  1J7R A;  2LV7 A;  4FQT A;  3SG6 A;  1YUS A;  3CZ1 A;  4M2O A;  1DEK A;  2BCA A;  2H61 C;  2G2B A;  1M46 A;  2KHN A;  4NDD A;  5HLV A;  2FOT A;  1CNP A;  1IQ5 A;  1TNP A;  2KBM A;  1S3P A;  1B8L A;  3TUY C;  2PQL A;  1LA0 A;  3JTD C;  1LIN A;  1QVI Z;  4YGE B;  2JQ6 A;  1QLS A;  1XYD A;  2LMU A;  1K9K A;  2H61 A;  3NXA A;  2BNX A;  4CFQ A;  3FS7 A;  2CXJ A;  3AAJ A;  2MBX A;  3ICB A;  2L2E A;  3CZ0 A;  3DVJ A;  1F70 A;  1DJH A;  1SMG A;  1DEL A;  1TOP A;  2CTN A;  3CYZ A;  3OB2 B;  2M7L A;  4GPL B;  2LCP A;  3SG7 A;  3OX6 A;  1AHR A;  3D73 A;  1A2X A;  1YVL A;  2O5G A;  1YRT B;  2WCK A;  1D1O A;  2JXC A;  5HYD A;  4YI9 A;  1A75 A;  2EHB A;  3AKB A;  5FI6 A;  1BG1 A;  2D8N A;  4KYN A;  5JJG A;  4IL1 A;  4YGB B;  2K2F A;  2Y1M A;  1BMO A;  3EK8 A;  3D74 A;  1JF2 A;  1KFU S;  2OS8 B;  2PMY A;  5HL1 A;  1DVI A;  1NYA A;  4ICB A;  2KGB C;  3M0W A;  3WHT B;  1C7W A;  1W7J B;  3EG5 B;  2SCP A;  1Y6W A;  1SY9 A;  1LS8 A;  1M63 B;  2K7C A;  2BE6 A;  2MLE C;  3D77 A;  1WDC C;  1WRK A;  3D78 A;  4MSP A;  2BAP A;  3PM8 A;  3QME A;  5I2Q A;  1C3Y A;  3BUX B;  2Q91 A;  4P5O E;  3FWC A;  3FE9 A;  3PLF B;  1TUJ A;  3I5H C;  3L4L A;  3OP0 A;  1UUS A;  2PVB A;  1UUR A;  1NUB A;  4QJ5 B;  4R1E A;  3DD4 A;  1IRJ A;  3CAB A;  4JQ0 D;  1JFJ A;  1YTZ C;  2L51 A;  1K95 A;  2KAX A;  1WLZ A;  4DIR A;  2LNK A;  1TIZ A;  1BT6 A;  1SCV A;  2GGZ A;  2LVJ A;  2ZN9 A;  1YRU B;  1NX0 A;  3EKJ A;  1YX8 A;  2FCE A;  2M97 A;  1F4O A;  2ERB A;  2WOS A;  1IWQ A;  1ZUZ A;  2K2A A;  2M49 B;  2KLD A;  2BBN A;  1NPQ A;  1YUU A;  3RZS A;  2OPO A;  1SBJ A;  4ORC B;  3RM1 A;  1B1G A;  1J1E A;  2QAC A;  2KFH A;  2VRG A;  2LM5 A;  4DUQ A;  3R1P A;  1XK4 C;  1HQV A;  2AUC A;  1DJY A;  3NSO A;  3R72 A;  3L4A A;  1MF8 B;  5KTY A;  4MN0 A;  2LE9 B;  5J3X A;  2GTE A;  1B7T Y;  2ZN8 A;  3I5I C;  3TDI A;  3PN7 C;  1QAT A;  4YGC B;  1IG5 A;  1U5I A;  1IGV A;  3SG2 A;  1XK4 A;  2K8M B;  2KI4 B;  5CSN A;  1CM4 A;  1ZAC A;  4HRE E; 
#chains in the Genus database with same CATH homology
 1KSM A;  2L5X B;  2KAY A;  4PDZ A;  1CKK A;  3SIB A;  3TS5 B;  2AMI A;  2CNP A;  1KFX L;  3WHU B;  3EK7 A;  2F3Y A;  2I2R E;  1PVA A;  2PSR A;  4PE1 A;  2JXL A;  4MLW A;  1KQM B;  1LVC D;  5DKQ A;  1CDN A;  3HX4 A;  1EH2 A;  1SKT A;  1XA5 A;  3PSR A;  1UWO A;  2BKI B;  3H4S E;  2LLS A;  3BOW B;  4OR9 B;  1KK7 Z;  5KSZ A;  1W7I B;  3CR2 A;  5CSJ A;  2SAS A;  4GGN A;  2JC2 A;  1XFU O;  1WY9 A;  2COL B;  3DF0 B;  2B1U A;  3KEV A;  3BQ3 A;  4AQI A;  2KI6 D;  1RK9 A;  1K94 A;  5IBW A;  3OHM B;  2V53 A;  3LLE A;  1XFZ O;  2LMT A;  2BCB A;  2DOQ A;  1JFK A;  1DJI A;  1SL9 A;  1S6C A;  4USL A;  4YI8 A;  1SCM B;  4CPV A;  1YX7 A;  4JWQ A;  1F54 A;  2KFG A;  4MVF A;  2K7B A;  1MR8 A;  1EG3 A;  2BKH B;  2KQ6 A;  2MA2 A;  2OS8 C;  3QRX A;  4C0K A;  3BUM B;  5GQQ C;  2M29 A;  3NSK A;  3CZT X;  4PE4 A;  4OKH A;  1SR6 B;  1QVI Y;  1JWD A;  1BOD A;  1UHH A;  5I2L A;  4PHM A;  3BUN B;  1SL7 A;  1PAL A;  3AKA A;  4M2Q A;  4ZCV A;  3RLZ A;  3VGO A;  4M2P A;  3EVU A;  4F0Z B;  1Q80 A;  2CBL A;  1BF5 A;  3SG4 A;  1QS7 A;  2L50 A;  5B8I B;  2JTZ A;  2LP3 A;  1DMO A;  1AVS A;  2LMV A;  2KSP A;  5AAN A;  3KPX A;  4MZK A;  2M8U A;  1B47 A;  4GBA A;  4GFT A;  1QLK A;  3ZNI A;  1CMF A;  1SW8 A;  1F4Q A;  1CTR A;  1QXP A;  2JU0 A;  1DT7 B;  2JUL A;  1MUX A;  1KK8 B;  1OQP A;  2HPS A;  4E68 A;  2I94 A;  4MZL A;  3KF9 A;  4ORA B;  3GK2 A;  4P2Y B;  3EVV A;  2WCB A;  2HQ8 A;  1QAS A;  4GUK A;  1NWD A;  1CDP A;  1OMV A;  1A4P A;  1KWO C;  4XJK B;  1CDM A;  4PHJ A;  1H8B A;  5G08 A;  2MLF C;  2NZ0 A;  3I5G C;  3O2P A;  3KHE A;  4I5N B;  3EKH A;  1CMG A;  1IJ5 A;  1G4Y R;  4HRH A;  1YUR A;  1KFX S;  1RRO A;  1NSH A;  1FW4 A;  3JVT B;  5PAL A;  1EXR A;  2KBI A;  1IKU A;  3IQQ A;  3CTN A;  3NSI A;  4HSZ A;  5HKZ A;  3DVM A;  1ALW A;  1EG4 A;  1VRK A;  1PK0 D;  5D69 A;  3I5F B;  4TNC A;  1MWN A;  1MQ1 A;  2LVV A;  3TS5 C;  3O4Y A;  1DJW A;  1DGV A;  1G8I A;  2EGD A;  1QTX A;  4A4C A;  1B4C A;  2JT8 A;  4YRU A;  1CM1 A;  1ZFS A;  2ZKM X;  4OV2 A;  3SG3 A;  4CFR A;  2EC6 B;  1OSA A;  4GAO A;  1B8R A;  1R2U A;  4OVN F;  2IS9 A;  3A4U B;  3WXA A;  5CSI A;  1DF0 B;  4I5L B;  1IQ3 A;  1H4B A;  2K61 A;  2WND A;  2ZFD A;  2LHL A;  1B9A A;  3VRQ A;  1QX7 A;  5ER5 A;  1XFV O;  1Y0V H;  2ZRS A;  3IF7 A;  4DRW A;  1J7P A;  1BU3 A;  3BOW A;  1XO5 A;  3BYA A;  1FBV A;  1F55 A;  3DVK A;  5ER4 X;  2BL0 B;  1Y1A A;  2JZI A;  1CLL A;  1UHJ A;  1M39 A;  1S6J A;  1A75 B;  1EJ3 A;  1LKJ A;  1PVB A;  1SCM C;  5AEQ A;  5DKN A;  3TZ1 A;  1B8C A;  1XFW O;  1CLM A;  2K7D A;  1AJ4 A;  1X02 A;  3VRR A;  1BOC A;  4PE7 A;  2NCP A;  3OX5 A;  1F8H A;  5F6T A;  4ETO A;  1OMD A;  1NX1 A;  1KK7 Y;  1RFJ A;  1SR6 C;  2KDH A;  1K9U A;  1A03 A;  1J7Q A;  4JPZ B;  1GGW A;  2JRF A;  2OTG B;  5CPV A;  3LCP C;  3FIA A;  3VRO A;  1WLM A;  1BJF A;  1JUO A;  1S5G Z;  2M3W A;  4BY5 A;  1NX2 A;  1QX5 B;  3BXK A;  4DCK A;  2E30 A;  1LA3 A;  1KFU L;  3IQO A;  1N65 A;  1FPW A;  4YBH B;  2M1U A;  4DS7 A;  4L9M A;  4CID A;  1GJY A;  2FJU B;  1PUL A;  4HRG A;  2L98 A;  4XYN A;  5CSF A;  2HET A;  4C0J A;  3OB1 B;  1KK8 C;  4NDC A;  4MRX A;  1XFX O;  2WCE A;  4MRY A;  4ORB B;  4MEW A;  1J1D A;  1ZMZ A;  3CR4 X;  3GK4 X;  5TNC A;  4UPG A;  2Y5I A;  2PRU A;  3SG5 A;  5I8N A;  1YR5 A;  3CGA A;  1TN4 A;  1L2O B;  3D10 A;  2R2I A;  3DVE A;  4U8D A;  1U5I B;  2NCO A;  1SL8 A;  1CFP A;  2GGM A;  1S26 D;  2PAS A;  4XJK A;  3VRN A;  1L7Z A;  1KSO A;  1S36 A;  1K96 A;  2LLT A;  3O78 A;  2LAN A;  1Y1U A;  3I5F C;  1OE9 B;  2F8P A;  1RJV A;  2KYF A;  4D1E A;  4FQO A;  4N5X A;  1MHO A;  1MXE A;  1OZO A;  2JT3 A;  5AFP A;  1ODB A;  4FTG A;  1E8A A;  4NQG A;  2QPT A;  2F2O A;  3PAT A;  5I2O A;  1SYM A;  3TDZ A;  3CR5 X;  1AP4 A;  1OMR A;  1CFD A;  4MBE A;  4N1G A;  2WC8 A;  3FWB A;  3KO0 A;  1NIW A;  1JC2 A;  1TTX A;  1NCY A;  1CDL A;  3HCM A;  4PHN A;  4NDB A;  1SRA A;  3BUW B;  1K2H A;  2JNX A;  3O6B A;  2TN4 A;  1DF0 A;  2JOJ A;  3D0Y B;  2K7O A;  2WCF A;  2AAO A;  2HF5 A;  1DJX A;  2KI6 C;  2BL0 C;  3LK1 A;  4MZJ A;  2JWW A;  4GNK B;  5K89 A;  5FYX A;  2G9B A;  1YUT A;  1N0Y A;  1AK8 A;  1N2D A;  1LXF C;  1TNW A;  2LC5 A;  1Y1X A;  2Y1N A;  2KI4 C;  2MHH A;  2KYC A;  1NP8 A;  1V1F A;  3GOF A;  3CWG A;  1DGU A;  3NSL A;  4I5J A;  2CCM A;  4N1F A;  1RTP 1;  1IH0 A;  3K21 A;  4PE0 A;  1GQM A;  1SK6 D;  2Y4Q A;  4AOM A;  1CFC A;  5BPJ A;  1PSB A;  2M0R A;  1KQV A;  1QJT A;  1KQM C;  2PAL A;  1S1E A;  2KOT A;  1ALV A;  2I7A A;  1PSR A;  2OTG C;  2E6W A;  1J55 A;  1XVJ A;  1JBA A;  2MRD A;  1F71 A;  1QV0 A;  3SJS A;  2LVI A;  2MJW B;  2F33 A;  3TUY B;  2I18 A;  2RGI A;  4QJ4 B;  1S6I A;  3JTD B;  2LHI A;  2KNE A;  1A29 A;  4I5K A;  4WQ2 A;  3A8R A;  2JPT A;  1NCX A;  1NX3 A;  2KAV A;  1CB1 A;  1G33 A;  2GV5 A;  5HLO A;  5AXI A;  1WRZ A;  1DTL A;  2LVK A;  3DF0 A;  2JNF A;  2K0J A;  4PHK A;  4WQ3 A;  1DJG A;  1MXL C;  1OZS A;  2F2P A;  4C0L A;  1K93 D;  3F45 A;  1WRL A;  1EL4 A;  2M9G A;  1GGZ A;  1BR1 B;  3LL8 B;  2KQY A;  1TCO B;  3TDU A;  3CLN A;  3AAK A;  1SPY A;  1L2O C;  2NXQ A;  1QIV A;  1CFF A;  3BUO B;  1KWO B;  1UHN A;  1S5G Y;  3PAL A;  3EVR A;  3I5G B;  3GK1 A;  1NCZ A;  4BY4 A;  1REC A;  1QIW A;  5JOL A;  2LAP A;  1C07 A;  1UHK A;  2JTT A;  1WDC B;  1QV1 A;  1BLQ A;  2NLN A;  4CLN A;  1J7O A;  2LUX A;  1OOJ A;  1KCY A;  3SIA A;  3E3R A;  3WNX B;  2M7N A;  1JSA A;  1IJ6 A;  1TRF A;  5D7F A;  2LUC A;  1B7T Z;  1TNX A;  3I5H B;  2FCD A;  1HT9 A;  1K9P A;  1FI5 A;  1FI6 A;  2ZND A;  1UP5 A;  3LK0 A;  2KGR A;  1PRW A;  2F3Z A;  1YVH A;  3PFV A;  4Q04 A;  3C1V A;  2M1K B;  1TCF A;  1TNQ A;  2JT0 A;  2ZRT A;  2L4I A;  3CS1 A;  1K90 D;  1UHI A;  1ZOT B;  2CT9 A;  4A4B A;  5AER A;  1DJZ A;  4YGA A;  2ZNE A;  1BR4 B;  2Q4U A;  2WOR A;  2BCX A;  2MAZ A;  1M31 A;  4QJ3 B;  4AQJ A;  1FF1 A;  2L0P A;  2HQW A;  2BEC A;  4OCI A;  1C7V A;  4GGF C;  2LLU A;  1QX2 A;  5HKW A;  3JVT C;  4PCW A;  3VRP A;  5HKY A;  1R6P A;  1AUI B;  1SNL A;  2A4J A;  3D0Y A;  3EK4 A;  3I5I B;  3PN7 B;  4ZCU A;  2ISD A;  4PAL A;  4GGF A;  5KU1 A;  4WRI A;  2LP2 A;  1JF0 A;  2P6B B;  2KFF A;  3MSE B;  1CLB A;  5DKR A;  3ZWH A;  2L4H A;  1RWY A;  1V1G A;  2BBM A;  1XFY O;  1M45 A;  2O60 A;  1K8U A;  1AJ5 A;  2EC6 C;  2BE4 A;  2H2K A;  4YGD B;  1J7R A;  2LV7 A;  3SG6 A;  1YUS A;  4M2O A;  2BCA A;  2H61 C;  2G2B A;  1M46 A;  2KHN A;  4NDD A;  5HLV A;  2FOT A;  1CNP A;  1IQ5 A;  1TNP A;  2KBM A;  1S3P A;  1B8L A;  3TUY C;  1LA0 A;  3JTD C;  1LIN A;  1QVI Z;  4YGE B;  2JQ6 A;  1QLS A;  1XYD A;  2LMU A;  1K9K A;  2H61 A;  3NXA A;  4CFQ A;  3FS7 A;  2CXJ A;  3AAJ A;  2MBX A;  3ICB A;  2L2E A;  3DVJ A;  1F70 A;  1DJH A;  1SMG A;  1TOP A;  2CTN A;  3OB2 B;  2M7L A;  4GPL B;  2LCP A;  3SG7 A;  3OX6 A;  1AHR A;  1A2X A;  1YVL A;  2O5G A;  1YRT B;  1D1O A;  2JXC A;  5HYD A;  4YI9 A;  1A75 A;  2EHB A;  3AKB A;  1BG1 A;  2D8N A;  5JJG A;  4IL1 A;  4YGB B;  2K2F A;  2Y1M A;  1BMO A;  3EK8 A;  1JF2 A;  1KFU S;  2OS8 B;  2PMY A;  1DVI A;  1NYA A;  4ICB A;  2KGB C;  3M0W A;  3WHT B;  1C7W A;  1W7J B;  2SCP A;  1Y6W A;  1SY9 A;  1M63 B;  2K7C A;  2MLE C;  2BE6 A;  1WDC C;  1WRK A;  4MSP A;  3PM8 A;  5I2Q A;  3BUX B;  2Q91 A;  4P5O E;  3FWC A;  3PLF B;  3I5H C;  3OP0 A;  1UUS A;  2PVB A;  1UUR A;  1NUB A;  4QJ5 B;  4R1E A;  3DD4 A;  1IRJ A;  4JQ0 D;  1JFJ A;  1YTZ C;  2L51 A;  1K95 A;  2KAX A;  1WLZ A;  4DIR A;  2LNK A;  1TIZ A;  1BT6 A;  1SCV A;  2GGZ A;  2LVJ A;  2ZN9 A;  1YRU B;  1NX0 A;  3EKJ A;  1YX8 A;  2FCE A;  2M97 A;  1F4O A;  2WOS A;  1IWQ A;  1ZUZ A;  2K2A A;  2M49 B;  2BBN A;  1NPQ A;  1YUU A;  2OPO A;  1SBJ A;  4ORC B;  3RM1 A;  1B1G A;  1J1E A;  2QAC A;  2KFH A;  2VRG A;  2LM5 A;  4DUQ A;  1XK4 C;  1HQV A;  2AUC A;  1DJY A;  3NSO A;  1MF8 B;  5KTY A;  4MN0 A;  2LE9 B;  5J3X A;  1B7T Y;  2ZN8 A;  3I5I C;  3TDI A;  3PN7 C;  1QAT A;  4YGC B;  1IG5 A;  1U5I A;  1IGV A;  3SG2 A;  1XK4 A;  2K8M B;  2KI4 B;  5CSN A;  1CM4 A;  1ZAC A;  4HRE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...