3LK0A

X-ray structure of bovine sc0067,ca(2+)-s100b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 32
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk0A00
1ALVA 2K7OA 1K9KA 2KSPA 1AHRA 1N0YA 5F6TA 2BKHB 2VRGA 1FPWA 2ZN8A 2JC2A 5AXIA 1UHJA 4PE7A 1XK4C 4P5OE 1NUBA 2LVVA 2M1UA 3GK1A 3SIBA 2Q91A 4BY5A 1IJ5A 1ODBA 1ZACA 1F4OA 2BL0C 5AERA 1KFUS 1Y1XA 2KI6C 1TN4A 3I5GB 5CPVA 1UHKA 1TTXA 2LE9B 1J55A 3FWCA 4MRXA 2PMYA 1SL9A 2LVIA 4CIDA 1C7WA 1ZOTB 4YI9A 1NWDA 2I7AA 3PATA 1QLSA 1J7RA 1NIWA 1SY9A 2HETA 2Y5IA 1CKKA 2L98A 2LNKA 3KHEA 1KQMC 4OKHA 3TS5C 1NCXA 1ZFSA 2K2AA 3CR2A 1CDMA 1J1EA 2NCOA 4Q04A 4XJKA 5AANA 1BF5A 2KQ6A 1SK6D 5CSJA 3F45A 1Y1UA 2KI4B 1XK4A 1S6CA 2FJUB 1DTLA 2A4JA 2JQ6A 2Y1MA 3DVEA 4MSPA 4MZLA 1J7PA 4C0LA 2D8NA 4HRGA 2B1UA 4YGAA 5IBWA 1SR6B 4YGBB 1JUOA 2EC6B 3D0YB 1EL4A 1AK8A 3EVVA 2M1KB 1IWQA 2JZIA 1PVBA 4PE4A 3C1VA 2L50A 1GGZA 4QJ3B 2L4IA 2ZKMX 2WOSA 3NSKA 2K7DA 1NYAA 3EKJA 1IRJA 4UPGA 4DIRA 3PN7B 5TNCA 1NCYA 1UHIA 4YRUA 1DVIA 2LVKA 3BUWB 1A2XA 2K61A 2JXCA 4WRIA 2WC8A 3NXAA 4C0JA 1NX2A 2BECA 4GGFC 1ZUZA 2FCEA 1QIWA 1G33A 1PRWA 2M29A 1A4PA 1NX3A 1EXRA 2K0JA 4GNKB 4P2YB 1KQVA 2GV5A 3PM8A 1SRAA 3NSIA 1A75A 5CSNA 4WQ3A 2EGDA 2KFHA 4WQ2A 1MUXA 1CLLA 3M0WA 1XYDA 3SG7A 4GUKA 1XFXO 4ORCB 1QS7A 4NDCA 1M45A 1G4YR 3TUYB 1SL8A 1DF0A 2KFGA 4R1EA 4XYNA 4OR9B 2K2FA 1YTZC 2F3YA 4HREE 1XO5A 2Q4UA 2WCEA 3H4SE 2JT0A 2OPOA 3CZTX 3TDZA 2HF5A 1CLMA 2NZ0A 3EKHA 3RLZA 4ZCUA 3LK0A 1K2HA 2WCFA 3NSOA 1QV1A 1XFWO 1QXPA 3OB2B 4GGFA 3FWBA 1KSMA 1DGVA 1TNQA 3HCMA 1LKJA 3JVTB 2JOJA 2LP2A 1KK8C 1IG5A 2KGBC 1EG3A 1WLZA 1SL7A 3DVKA 3O4YA 4JPZB 3I5GC 4I5NB 1F71A 3CLNA 4PHNA 1BT6A 1QVIZ 3JTDB 1CFCA 1PVAA 2I94A 1YVLA 1XVJA 1S1EA 2NXQA 4GAOA 1IJ6A 4DCKA 3EK4A 1AJ4A 5HYDA 3BUMB 2LMTA 4A4BA 1FBVA 1N2DA 1ALWA 2F33A 1R2UA 3SG4A 2K8MB 4ETOA 2AUCA 2GGMA 5D69A 1CTRA 3IF7A 2KQYA 1QIVA 2IS9A 2OTGB 2KI4C 1S6JA 1YX8A 4PHKA 5KTYA 4MN0A 1WY9A 5I2LA 1LXFC 1SCVA 5AFPA 2KGRA 3I5IB 1WRKA 2DOQA 1XFYO 2LAPA 2M7LA 1N65A 1SR6C 2CXJA 3OHMB 2EC6C 1C7VA 4I5JA 1CFDA 2I2RE 3I5HC 1K9PA 2LCPA 3AKBA 2KYFA 4I5LB 1CDLA 3VRNA 5CSIA 1WLMA 2WNDA 1QX7A 2LVJA 4NDDA 3RM1A 3DVJA 5B8IB 3TDUA 2H61C 4FQOA 1AJ5A 1V1GA 1YUUA 2JWWA 1J1DA 5ER5A 4HRHA 2M0RA 1K94A 4MZJA 1DJHA 1G8IA 1UHNA 1A03A 1MXEA 3VGOA 1NX0A 1WDCB 1SCMB 2OS8B 1CFFA 4QJ5B 1OMDA 1R6PA 1J7OA 4MLWA 5HKYA 1QTXA 1BLQA 1XFVO 1JFJA 1KFXL 2LLUA 4JWQA 3I5FB 4PDZA 1TCFA 1CMGA 1DMOA 2HQ8A 2FCDA 2HPSA 5HLOA 3SJSA 4QJ4B 1PULA 1F54A 1S36A 2MRDA 4GPLB 2QACA 1DJXA 5G08A 1OE9B 3DF0A 3E3RA 3BUXB 1JC2A 1RWYA 4BY4A 1JF0A 3D0YA 1QJTA 1OQPA 4GBAA 2M49B 1M31A 1GJYA 1SNLA 1SPYA 1JFKA 1A29A 4PE0A 3TUYC 1IQ5A 5K89A 1DGUA 2MLFC 2P6BB 1SYMA 1B1GA 1KCYA 3VRQA 2LANA 1GQMA 3TDIA 1K96A 1NX1A 1TOPA 3LLEA 3CGAA 2F8PA 3JVTC 2GGZA 2BE6A 2BKIB 1BJFA 4ORAB 4PE1A 2QPTA 4DUQA 1K9UA 3ZNIA 2ZRSA 5CSFA 4CFQA 5HKWA 1YURA 5AEQA 1XFUO 2KYCA 1JF2A 3GK2A 1Y6WA 3FS7A 3KEVA 1GGWA 1YRUB 3K21A 2KBIA 2M8UA 5FYXA 1QASA 2TN4A 1CB1A 2KBMA 2I18A 3AAKA 1M63B 3CR5X 1ZMZA 2F2PA 1S5GY 2M3WA 2SCPA 4OVNF 1MXLC 1TIZA 2MLEC 4YI8A 3PFVA 4MZKA 2ZNEA 3I5IC 1F4QA 1CMFA 1YUSA 1U5IA 1S3PA 1L2OB 3SG6A 1NPQA 2KNEA 1NCZA 2PVBA 2K7CA 2JT3A 3BOWB 3VRRA 3O6BA 1B7TY 3KO0A 4PHJA 1AUIB 2MBXA 1UUSA 4ICBA 3EK7A 1EJ3A 3EVUA 5JJGA 1Y0VH 2ZFDA 3TS5B 2F3ZA 2KHNA 2L51A 2OS8C 1UWOA 5JOLA 5I2QA 3WHTB 4ORBB 1CDNA 4NDBA 2MHHA 4CPVA 1A75B 2KI6D 1EH2A 2MA2A 3I5FC 3VRPA 2PSRA 5DKNA 1YVHA 2M7NA 4N1GA 2O5GA 2RGIA 3AKAA 2JRFA 4CFRA 2COLB 1CLBA 5I8NA 2BCXA 2AAOA 5HKZA 1PSRA 1DF0B 1YX7A 4OCIA 1OSAA 1V1FA 2KOTA 3O78A 1B8CA 3GOFA 3PALA 2E30A 3DVMA 1LA0A 3OP0A 4OV2A 4CLNA 1DJWA 4YBHB 1CM1A 1HT9A 1MR8A 2FOTA 1X02A 4AQJA 1MWNA 1RTP1 2M9GA 5HLVA 1LA3A 2LHLA 3TZ1A 1UHHA 1TNXA 3A8RA 1K90D 2LUCA 2JXLA 4A4CA 3LK1A 1SBJA 1PK0D 1BU3A 5DKQA 4E68A 1IQ3A 2CNPA 1TCOB 5KU1A 3PN7C 4PHMA 3LL8B 1QX5B 5DKRA 2AMIA 4MRYA 4AQIA 3LCPC 4PALA 1XFZO 1SMGA 1DT7B 1XA5A 2KAXA 1C07A 4GGNA 2LP3A 1DJYA 1J7QA 1IKUA 1YUTA 1QLKA 2BCAA 2F2OA 2PASA 3CS1A 1WRZA 2G2BA 1KWOB 1YRTB 3BUNB 1QX2A 2JU0A 4IL1A 2HQWA 2KDHA 3KPXA 1BG1A 2WORA 1QATA 1L7ZA 3QRXA 4GFTA 1AP4A 5J3XA 3BYAA 3SG2A 1AVSA 2LM5A 2BBMA 1EG4A 2KAVA 2O60A 1DJZA 1KK8B 2PRUA 2SASA 1W7IB 1TRFA 1JBAA 1L2OC 2NCPA 3O2PA 3NSLA 2E6WA 2H61A 1E8AA 3OX6A 1FF1A 5PALA 3SG3A 1H4BA 3BQ3A 4M2QA 3SG5A 5BPJA 2JTZA 3VROA 2MJWB 1BR1B 4AOMA 1MHOA 1LVCD 2LV7A 4F0ZB 1BOCA 1CM4A 3ZWHA 1NP8A 3WHUB 2CBLA 2JNXA 1S5GZ 1CFPA 1OMRA 3IQOA 1KFXS 3JTDC 1OOJA 4JQ0D 2JTTA 1K8UA 3DF0B 3ICBA 1OZSA 2L0PA 1FI6A 1WRLA 1M46A 1B7TZ 3I5HB 4HSZA 2KFFA 4XJKB 3MSEB 5ER4X 2CT9A 4N1FA 1TNPA 1BODA 1PSBA 4FTGA 1SKTA 2G9BA 3CTNA 1JWDA 1QV0A 4DS7A 3BOWA 1IGVA 4NQGA 2K7BA 2OTGC 4YGEB 2BBNA 1F8HA 2JPTA 2ISDA 2BL0B 2Y4QA 2H2KA 4M2PA 1BR4B 3AAJA 2LHIA 3OB1B 1RJVA 5D7FA 1FI5A 1HQVA 1DJIA 1OZOA 3CR4X 1RFJA 2V53A 1IH0A 3HX4A 4I5KA 2MAZA 4ZCVA 2L2EA 2JT8A 2LLSA 4DRWA 2LUXA 1MQ1A 1B9AA 2LMVA 3A4UB 1S6IA 1LINA 2L4HA 1KK7Z 1KQMB 2JNFA 2Y1NA 3EVRA 1CDPA 1FW4A 1UP5A 1OMVA 1SW8A 1TNWA 1WDCC 1SCMC 2L5XB 2PALA 1DJGA 4MVFA 2LLTA 3DD4A 4YGCB 1RECA 1PALA 1UURA 1B47A 4MBEA 2EHBA 4C0KA 1KWOC 2ZN9A 1RK9A 3EK8A 1W7JB 2LMUA 4U8DA 3PLFB 2ZNDA 3WNXB 3PSRA 1KSOA 2CTNA 1KK7Y 1U5IB 1M39A 2BCBA 1JSAA 3WXAA 4D1EA 2M97A 5KSZA 1CNPA 2NLNA 4MEWA 1BMOA 4M2OA 2WCBA 3KF9A 3BXKA 4N5XA 4TNCA 1S26D 1F70A 5GQQC 1K93D 2KAYA 1KFUL 1VRKA 2CCMA 1B4CA 3CWGA 1K95A 3SIAA 3FIAA 2ZRTA 1B8RA 2R2IA 4L9MA 5I2OA 3GK4X 1MF8B 1D1OA 1F55A 2JULA 3BUOB 1YR5A 1B8LA 3OX5A 1RROA 2BE4A 1Y1AA 2LC5A 1H8BA 3IQQA 4YGDB 1NSHA 1Q80A 4PCWA 4USLA 1QVIY 3D10A
chains in the Genus database with same CATH superfamily
1ALVA 2K7OA 1K9KA 2KSPA 1AHRA 1N0YA 5F6TA 2BKHB 2VRGA 1FPWA 2ZN8A 2JC2A 5AXIA 1UHJA 4PE7A 1XK4C 4P5OE 1NUBA 2LVVA 2M1UA 3GK1A 3SIBA 2Q91A 4BY5A 1IJ5A 1ODBA 1ZACA 1F4OA 2BL0C 5AERA 1KFUS 1Y1XA 2KI6C 1TN4A 3I5GB 5CPVA 1UHKA 1TTXA 2LE9B 1J55A 3FWCA 4MRXA 2PMYA 1SL9A 2LVIA 2QEBA 4CIDA 1C7WA 1OW4A 1W9ZA 1ZOTB 4YI9A 1NWDA 2I7AA 3PATA 1QLSA 1J7RA 1TUJA 1NIWA 1SY9A 2HETA 2Y5IA 1CKKA 2L98A 2LNKA 3KHEA 1KQMC 4OKHA 3TS5C 1NCXA 1ZFSA 2K2AA 3CR2A 1CDMA 1J1EA 2NCOA 4Q04A 2WCKA 4XJKA 5AANA 3BFAA 1BF5A 2KQ6A 1SK6D 5CSJA 3F45A 1Y1UA 2KI4B 1XK4A 1S6CA 2FJUB 1DTLA 2A4JA 2JQ6A 2Y1MA 3DVEA 4MSPA 4MZLA 1J7PA 2QEOA 4C0LA 2D8NA 4HRGA 2B1UA 4YGAA 5FI6A 5IBWA 1SR6B 4YGBB 1C3YA 1JUOA 2EC6B 3D0YB 1EL4A 1AK8A 3EVVA 2M1KB 1IWQA 2JZIA 1PVBA 4PE4A 3C1VA 2L50A 1GGZA 4QJ3B 2L4IA 2ZKMX 2WOSA 3NSKA 2K7DA 1NYAA 3EKJA 1IRJA 4UPGA 4DIRA 3PN7B 5TNCA 1NCYA 1UHIA 4YRUA 1DVIA 2LVKA 3BUWB 2H8VA 3D76A 1A2XA 2K61A 1DEKA 2JXCA 4WRIA 2WC8A 3NXAA 4C0JA 1NX2A 2BECA 2QEHA 4GGFC 1ZUZA 2FCEA 3R72A 1QIWA 1G33A 4INWA 1PRWA 2M29A 1A4PA 1NX3A 1EXRA 2K0JA 4GNKB 4P2YB 1KQVA 2GV5A 3BJHA 3PM8A 1SRAA 3NSIA 1A75A 5CSNA 4WQ3A 2EGDA 2KFHA 4WQ2A 1MUXA 1CLLA 3Q8IA 3M0WA 1XYDA 3CDNA 4GUKA 3SG7A 1XFXO 4ORCB 1QS7A 4NDCA 1M45A 1G4YR 3TUYB 1SL8A 1DF0A 2KFGA 4R1EA 4XYNA 4OR9B 2K2FA 1YTZC 2F3YA 4HREE 1XO5A 2Q4UA 2WCEA 3H4SE 2JT0A 2OPOA 3CZTX 3TDZA 2HF5A 1CLMA 2NZ0A 3EKHA 3RLZA 4ZCUA 3LK0A 1K2HA 2WCFA 3NSOA 1QV1A 1XFWO 1QXPA 3OB2B 4GGFA 1F71A 3FWBA 1KSMA 3DY9A 1DGVA 1TNQA 3HCMA 1LKJA 3S0EA 1SSEB 3JVTB 2JOJA 2LP2A 1KK8C 1IG5A 2KGBC 1EG3A 1WLZA 1SL7A 3DVKA 3O4YA 4JPZB 3I5GC 4I5NB 5FI7A 3CLNA 1DELA 4PHNA 1BT6A 1QVIZ 3JTDB 1CFCA 1PVAA 2I94A 3K1EA 1YVLA 3O4XA 4IJ7A 1XVJA 1S1EA 2NXQA 3B87A 4GAOA 1IJ6A 1ORGA 4DCKA 3EK4A 1AJ4A 5HYDA 5FI2A 3BUMB 2LMTA 4A4BA 1FBVA 1N2DA 2WCHA 1ALWA 2F33A 1R2UA 3SG4A 2K8MB 4ETOA 2AUCA 2GGMA 3V2LA 5D69A 1CTRA 3IF7A 2KQYA 4KYNA 1QIVA 2IS9A 2OTGB 2KI4C 1S6JA 1YX8A 4PHKA 5KTYA 4MN0A 1WY9A 5I2LA 1LXFC 1SCVA 5AFPA 2KGRA 3I5IB 1WRKA 3BFBA 2DOQA 2JPOA 1XFYO 2LAPA 2M7LA 1N65A 1SR6C 2CXJA 3OHMB 2EC6C 1C7VA 4I5JA 1CFDA 2I2RE 3I5HC 1K9PA 2KLEA 2LCPA 3AKBA 2KYFA 4I5LB 1CDLA 3VRNA 5CSIA 1WLMA 2WNDA 1QX7A 2LVJA 4NDDA 3RM1A 3DVJA 5B8IB 3TDUA 2H61C 2QDIA 4FQOA 1AJ5A 1V1GA 1YUUA 2JWWA 1J1DA 5ER5A 4HRHA 2M0RA 1K94A 4MZJA 1DJHA 1G8IA 1UHNA 1A03A 1MXEA 3VGOA 2K60A 1NX0A 1WDCB 1SCMB 2OS8B 1CFFA 4QJ5B 1OMDA 1R6PA 1J7OA 1TUZA 4MLWA 5HKYA 1QTXA 1BLQA 1XFVO 1JFJA 1KFXL 2LLUA 4JWQA 3I5FB 4PDZA 1TCFA 3B7AA 1CMGA 1DMOA 2HQ8A 2FCDA 2HPSA 5HLOA 3SJSA 4QJ4B 1PULA 1F54A 1S36A 2MRDA 4GPLB 2QACA 1DJXA 3B88A 3R1OA 1OE9B 3DF0A 5G08A 3E3RA 3BUXB 3R1PA 1JC2A 1RWYA 3D75A 4BY4A 1JF0A 3D0YA 1QJTA 1OQPA 4GBAA 2M49B 1M31A 1GJYA 1SNLA 1SPYA 1JFKA 1A29A 2WC6A 4PE0A 3TUYC 4JKTA 1IQ5A 5K89A 1DGUA 2MLFC 2P6BB 1SYMA 3NGVA 2FJYA 1B1GA 1KCYA 3VRQA 2LANA 1GQMA 3TDIA 1K96A 1NX1A 1TOPA 3NHTA 3EG5B 3LLEA 3CGAA 1TWOA 2F8PA 3JVTC 2GGZA 2BE6A 2BKIB 1BJFA 4ORAB 4PE1A 3DYEA 2QPTA 4DUQA 1K9UA 2WCLA 3ZNIA 2ZRSA 5CSFA 4CFQA 5HKWA 1YURA 5AEQA 3S0AA 2P71A 1XFUO 2KYCA 2YGUA 1JF2A 3GK2A 1Y6WA 3FS7A 3KEVA 1GGWA 1YRUB 3K21A 2KBIA 2M8UA 5FYXA 1QASA 2TN4A 1CB1A 2KBMA 2I18A 3AAKA 1M63B 3B6XA 3CR5X 1ZMZA 2F2PA 1S5GY 2M3WA 2SCPA 4OVNF 1MXLC 1TIZA 2MLEC 4YI8A 3PFVA 4MZKA 2ZNEA 3I5IC 3CZ2A 1F4QA 3DXLA 1CMFA 1YUSA 1U5IA 1S3PA 1L2OB 3SG6A 1NPQA 2KNEA 1NCZA 2PVBA 2K7CA 2JT3A 3BOWB 3NHIA 3VRRA 1DQEA 3O6BA 1B7TY 3KO0A 4PHJA 1AUIB 2MBXA 1UUSA 4ICBA 3EK7A 1EJ3A 3EVUA 5JJGA 1Y0VH 2ZFDA 3TS5B 2F3ZA 3L4AA 2KHNA 2L51A 2OS8C 1UWOA 5JOLA 5I2QA 3WHTB 4ORBB 4JD9A 3D78A 1CDNA 4NDBA 2MHHA 1Z2CB 4CPVA 1A75B 2KI6D 1EH2A 2MA2A 1OOIX 3I5FC 3S0BA 3VRPA 2PSRA 5DKNA 1YVHA 2M7NA 4N1GA 2O5GA 2RGIA 3AKAA 2JRFA 4CFRA 2COLB 1CLBA 5I8NA 2AAOA 2BCXA 5HKZA 1PSRA 1DF0B 1YX7A 4OCIA 1DC1A 1OSAA 1V1FA 2KOTA 3O78A 1B8CA 3GOFA 3PALA 2E30A 3DVMA 1LA0A 3OP0A 4OV2A 3S0GA 3SS4A 4CLNA 1DJWA 4YBHB 1CM1A 1HT9A 1MR8A 3VB1A 3RZSA 1Z4HA 2FOTA 1X02A 3R1VA 1MWNA 4AQJA 1RTP1 2M9GA 5HLVA 1LA3A 2LHLA 3TZ1A 3CZ0A 1UHHA 1TNXA 3A8RA 1K90D 2LUCA 2JXLA 4A4CA 3LK1A 1SBJA 1PK0D 2PYQA 3FE9A 3OBVA 1BU3A 5DKQA 4E68A 1IQ3A 2CNPA 3FE8A 1TCOB 5KU1A 3PN7C 2L2CA 3PJIA 4PHMA 3LL8B 1QX5B 5DKRA 2AMIA 4MRYA 4AQIA 3LCPC 3OGNA 1XFZO 1SMGA 4PALA 1DT7B 1XA5A 2KAXA 1C07A 4GGNA 2LP3A 1DJYA 1J7QA 1IKUA 1YUTA 1QLKA 2BCAA 5DICA 2F2OA 2PASA 3CS1A 1WRZA 2G2BA 1KWOB 1YRTB 2BAPA 1QX2A 2P70A 3BUNB 3FE6A 2JU0A 4IL1A 2HQWA 2KDHA 3KPXA 5I94A 2WCJA 1BG1A 2WORA 3L47A 1QATA 1L7ZA 3QRXA 4GFTA 3CABA 1AP4A 5J3XA 3SS5A 3BYAA 3SG2A 1AVSA 3IVTA 2LM5A 5HL1A 2BBMA 1EG4A 2KAVA 2O60A 1DJZA 4INXA 1KK8B 2PRUA 2SASA 3D74A 2WCMA 1W7IB 1TRFA 1C3ZA 1JBAA 1L2OC 2NCPA 3O2PA 3NSLA 2E6WA 2H61A 1E8AA 3OX6A 1T14A 1FF1A 5PALA 3SG3A 1H4BA 1OOHA 3BQ3A 4M2QA 3SG5A 5BPJA 2JTZA 3VROA 2MJWB 1BR1B 4OZDA 4AOMA 1MHOA 1LVCD 2LV7A 4F0ZB 1BOCA 1CM4A 3ZWHA 1NP8A 3WHUB 4PT1A 2CBLA 2JNXA 3S0FA 1S5GZ 1OOGA 1CFPA 3UO9A 1OMRA 2WC5A 3IQOA 1KFXS 3JTDC 1IIOA 1OOJA 4JQ0D 3SS3A 2JTTA 1K8UA 3DF0B 3ICBA 1OZSA 2L0PA 1FI6A 1WRLA 1M46A 1B7TZ 3I5HB 4HSZA 2PQLA 2KFFA 4XJKB 3B86A 3MSEB 2CT9A 4N1FA 1TNPA 5ER4X 1BODA 1PSBA 4FTGA 1SKTA 2G9BA 1LS8A 3CTNA 3N7HA 1JWDA 1QV0A 4DS7A 3BOWA 1IGVA 4NQGA 2K7BA 2OTGC 4YGEB 2BBNA 1F8HA 2JPTA 2ISDA 2BL0B 3CYZA 2Y4QA 2H2KA 4M2PA 1BR4B 3AAJA 2LHIA 3OB1B 1RJVA 5D7FA 5EL2A 1FI5A 1HQVA 1DJIA 4FQTA 2ERBA 1OZOA 3CR4X 1RFJA 2V53A 1IH0A 3HX4A 4I5KA 2MAZA 4ZCVA 2L2EA 2JT8A 2LLSA 4DRWA 2LUXA 1MQ1A 1B9AA 2LMVA 3A4UB 1S6IA 1LINA 2QEVA 2L4HA 1KK7Z 1KQMB 2JNFA 2Y1NA 3EVRA 1CDPA 1FW4A 1OOFA 1UP5A 1OMVA 1SW8A 1TNWA 1WDCC 1SCMC 2L5XB 2PALA 3D77A 1DJGA 4MVFA 2LLTA 3DD4A 4YGCB 1RECA 1PALA 1UURA 1B47A 4MBEA 2EHBA 2GTEA 4C0KA 1KWOC 1P28A 2KPHA 2ZN9A 1RK9A 3EK8A 1GM0A 1W7JB 2LMUA 4U8DA 3QMEA 3PLFB 2ZNDA 3PM2A 3WNXB 3PSRA 1KSOA 2CTNA 1KK7Y 1U5IB 1M39A 2BCBA 3S0DA 1JSAA 3WXAA 4D1EA 2M97A 5KSZA 1CNPA 2NLNA 5D3OA 4MEWA 1BMOA 4M2OA 2KLDA 2WCBA 3KF9A 3BXKA 4N5XA 4TNCA 3BFHA 1S26D 1F70A 1XFRA 5GQQC 1K93D 2KAYA 3CZ1A 1KFUL 3D73A 1VRKA 2CCMA 1B4CA 3CWGA 1K95A 3L4LA 3SIAA 3FIAA 2ZRTA 1B8RA 2R2IA 4L9MA 5I2OA 3GK4X 1MF8B 1D1OA 1F55A 2JULA 3UNWA 3BUOB 1YR5A 1B8LA 3OX5A 1QWVA 1RROA 2BE4A 3DZTA 1Y1AA 2LC5A 1H8BA 3IQQA 4YGDB 1NSHA 1Q80A 4PCWA 4USLA 1QVIY 2BNXA 2L5YA 4F7FA 3D10A
chains in the Genus database with same CATH topology
1ALVA 2K7OA 1K9KA 2KSPA 1AHRA 1N0YA 5F6TA 2BKHB 2VRGA 1FPWA 2ZN8A 2JC2A 5AXIA 1UHJA 4PE7A 1XK4C 4P5OE 1NUBA 2LVVA 2M1UA 3GK1A 3SIBA 2Q91A 4BY5A 1IJ5A 1ODBA 1ZACA 1F4OA 2BL0C 5AERA 1KFUS 1Y1XA 2KI6C 1TN4A 3I5GB 5CPVA 1UHKA 1TTXA 2LE9B 1J55A 3FWCA 4MRXA 2PMYA 1SL9A 2LVIA 4CIDA 1C7WA 1ZOTB 4YI9A 1NWDA 2I7AA 3PATA 1QLSA 1J7RA 1NIWA 1SY9A 2HETA 2Y5IA 1CKKA 2L98A 2LNKA 3KHEA 1KQMC 4OKHA 3TS5C 1NCXA 1ZFSA 2K2AA 3CR2A 1CDMA 1J1EA 2NCOA 4Q04A 4XJKA 5AANA 1BF5A 2KQ6A 1SK6D 5CSJA 3F45A 1Y1UA 2KI4B 1XK4A 1S6CA 2FJUB 1DTLA 2A4JA 2JQ6A 2Y1MA 3DVEA 4MSPA 4MZLA 1J7PA 4C0LA 2D8NA 4HRGA 2B1UA 4YGAA 5IBWA 1SR6B 4YGBB 1JUOA 2EC6B 3D0YB 1EL4A 1AK8A 3EVVA 2M1KB 1IWQA 2JZIA 1PVBA 4PE4A 3C1VA 2L50A 1GGZA 4QJ3B 2L4IA 2ZKMX 2WOSA 3NSKA 2K7DA 1NYAA 3EKJA 1IRJA 4UPGA 4DIRA 3PN7B 5TNCA 1NCYA 1UHIA 4YRUA 1DVIA 2LVKA 3BUWB 1A2XA 2K61A 2JXCA 4WRIA 2WC8A 3NXAA 4C0JA 1NX2A 2BECA 4GGFC 1ZUZA 2FCEA 1QIWA 1G33A 1PRWA 2M29A 1A4PA 1NX3A 1EXRA 2K0JA 4GNKB 4P2YB 1KQVA 2GV5A 3PM8A 1SRAA 3NSIA 1A75A 5CSNA 4WQ3A 2EGDA 2KFHA 4WQ2A 1MUXA 1CLLA 3M0WA 1XYDA 3SG7A 4GUKA 1XFXO 4ORCB 1QS7A 4NDCA 1M45A 1G4YR 3TUYB 1SL8A 1DF0A 2KFGA 4R1EA 4XYNA 4OR9B 2K2FA 1YTZC 2F3YA 4HREE 1XO5A 2Q4UA 2WCEA 3H4SE 2JT0A 2OPOA 3CZTX 3TDZA 2HF5A 1CLMA 2NZ0A 3EKHA 3RLZA 4ZCUA 3LK0A 1K2HA 2WCFA 3NSOA 1QV1A 1XFWO 1QXPA 3OB2B 4GGFA 3FWBA 1KSMA 1DGVA 1TNQA 3HCMA 1LKJA 3JVTB 2JOJA 2LP2A 1KK8C 1IG5A 2KGBC 1EG3A 1WLZA 1SL7A 3DVKA 3O4YA 4JPZB 3I5GC 4I5NB 1F71A 3CLNA 4PHNA 1BT6A 1QVIZ 3JTDB 1CFCA 1PVAA 2I94A 1YVLA 1XVJA 1S1EA 2NXQA 4GAOA 1IJ6A 4DCKA 3EK4A 1AJ4A 5HYDA 3BUMB 2LMTA 4A4BA 1FBVA 1N2DA 1ALWA 2F33A 1R2UA 3SG4A 2K8MB 4ETOA 2AUCA 2GGMA 5D69A 1CTRA 3IF7A 2KQYA 1QIVA 2IS9A 2OTGB 2KI4C 1S6JA 1YX8A 4PHKA 5KTYA 4MN0A 1WY9A 5I2LA 1LXFC 1SCVA 5AFPA 2KGRA 3I5IB 1WRKA 2DOQA 1XFYO 2LAPA 2M7LA 1N65A 1SR6C 2CXJA 3OHMB 2EC6C 1C7VA 4I5JA 1CFDA 2I2RE 3I5HC 1K9PA 2LCPA 3AKBA 2KYFA 4I5LB 1CDLA 3VRNA 5CSIA 1WLMA 2WNDA 1QX7A 2LVJA 4NDDA 3RM1A 3DVJA 5B8IB 3TDUA 2H61C 4FQOA 1AJ5A 1V1GA 1YUUA 2JWWA 1J1DA 5ER5A 4HRHA 2M0RA 1K94A 4MZJA 1DJHA 1G8IA 1UHNA 1A03A 1MXEA 3VGOA 1NX0A 1WDCB 1SCMB 2OS8B 1CFFA 4QJ5B 1OMDA 1R6PA 1J7OA 4MLWA 5HKYA 1QTXA 1BLQA 1XFVO 1JFJA 1KFXL 2LLUA 4JWQA 3I5FB 4PDZA 1TCFA 1CMGA 1DMOA 2HQ8A 2FCDA 2HPSA 5HLOA 3SJSA 4QJ4B 1PULA 1F54A 1S36A 2MRDA 4GPLB 2QACA 1DJXA 5G08A 1OE9B 3DF0A 3E3RA 3BUXB 1JC2A 1RWYA 4BY4A 1JF0A 3D0YA 1QJTA 1OQPA 4GBAA 2M49B 1M31A 1GJYA 1SNLA 1SPYA 1JFKA 1A29A 4PE0A 3TUYC 1IQ5A 5K89A 1DGUA 2MLFC 2P6BB 1SYMA 1B1GA 1KCYA 3VRQA 2LANA 1GQMA 3TDIA 1K96A 1NX1A 1TOPA 3LLEA 3CGAA 2F8PA 3JVTC 2GGZA 2BE6A 2BKIB 1BJFA 4ORAB 4PE1A 2QPTA 4DUQA 1K9UA 3ZNIA 2ZRSA 5CSFA 4CFQA 5HKWA 1YURA 5AEQA 1XFUO 2KYCA 1JF2A 3GK2A 1Y6WA 3FS7A 3KEVA 1GGWA 1YRUB 3K21A 2KBIA 2M8UA 5FYXA 1QASA 2TN4A 1CB1A 2KBMA 2I18A 3AAKA 1M63B 3CR5X 1ZMZA 2F2PA 1S5GY 2M3WA 2SCPA 4OVNF 1MXLC 1TIZA 2MLEC 4YI8A 3PFVA 4MZKA 2ZNEA 3I5IC 1F4QA 1CMFA 1YUSA 1U5IA 1S3PA 1L2OB 3SG6A 1NPQA 2KNEA 1NCZA 2PVBA 2K7CA 2JT3A 3BOWB 3VRRA 3O6BA 1B7TY 3KO0A 4PHJA 1AUIB 2MBXA 1UUSA 4ICBA 3EK7A 1EJ3A 3EVUA 5JJGA 1Y0VH 2ZFDA 3TS5B 2F3ZA 2KHNA 2L51A 2OS8C 1UWOA 5JOLA 5I2QA 3WHTB 4ORBB 1CDNA 4NDBA 2MHHA 4CPVA 1A75B 2KI6D 1EH2A 2MA2A 3I5FC 3VRPA 2PSRA 5DKNA 1YVHA 2M7NA 4N1GA 2O5GA 2RGIA 3AKAA 2JRFA 4CFRA 2COLB 1CLBA 5I8NA 2BCXA 2AAOA 5HKZA 1PSRA 1DF0B 1YX7A 4OCIA 1OSAA 1V1FA 2KOTA 3O78A 1B8CA 3GOFA 3PALA 2E30A 3DVMA 1LA0A 3OP0A 4OV2A 4CLNA 1DJWA 4YBHB 1CM1A 1HT9A 1MR8A 2FOTA 1X02A 4AQJA 1MWNA 1RTP1 2M9GA 5HLVA 1LA3A 2LHLA 3TZ1A 1UHHA 1TNXA 3A8RA 1K90D 2LUCA 2JXLA 4A4CA 3LK1A 1SBJA 1PK0D 1BU3A 5DKQA 4E68A 1IQ3A 2CNPA 1TCOB 5KU1A 3PN7C 4PHMA 3LL8B 1QX5B 5DKRA 2AMIA 4MRYA 4AQIA 3LCPC 4PALA 1XFZO 1SMGA 1DT7B 1XA5A 2KAXA 1C07A 4GGNA 2LP3A 1DJYA 1J7QA 1IKUA 1YUTA 1QLKA 2BCAA 2F2OA 2PASA 3CS1A 1WRZA 2G2BA 1KWOB 1YRTB 3BUNB 1QX2A 2JU0A 4IL1A 2HQWA 2KDHA 3KPXA 1BG1A 2WORA 1QATA 1L7ZA 3QRXA 4GFTA 1AP4A 5J3XA 3BYAA 3SG2A 1AVSA 2LM5A 2BBMA 1EG4A 2KAVA 2O60A 1DJZA 1KK8B 2PRUA 2SASA 1W7IB 1TRFA 1JBAA 1L2OC 2NCPA 3O2PA 3NSLA 2E6WA 2H61A 1E8AA 3OX6A 1FF1A 5PALA 3SG3A 1H4BA 3BQ3A 4M2QA 3SG5A 5BPJA 2JTZA 3VROA 2MJWB 1BR1B 4AOMA 1MHOA 1LVCD 2LV7A 4F0ZB 1BOCA 1CM4A 3ZWHA 1NP8A 3WHUB 2CBLA 2JNXA 1S5GZ 1CFPA 1OMRA 3IQOA 1KFXS 3JTDC 1OOJA 4JQ0D 2JTTA 1K8UA 3DF0B 3ICBA 1OZSA 2L0PA 1FI6A 1WRLA 1M46A 1B7TZ 3I5HB 4HSZA 2KFFA 4XJKB 3MSEB 5ER4X 2CT9A 4N1FA 1TNPA 1BODA 1PSBA 4FTGA 1SKTA 2G9BA 3CTNA 1JWDA 1QV0A 4DS7A 3BOWA 1IGVA 4NQGA 2K7BA 2OTGC 4YGEB 2BBNA 1F8HA 2JPTA 2ISDA 2BL0B 2Y4QA 2H2KA 4M2PA 1BR4B 3AAJA 2LHIA 3OB1B 1RJVA 5D7FA 1FI5A 1HQVA 1DJIA 1OZOA 3CR4X 1RFJA 2V53A 1IH0A 3HX4A 4I5KA 2MAZA 4ZCVA 2L2EA 2JT8A 2LLSA 4DRWA 2LUXA 1MQ1A 1B9AA 2LMVA 3A4UB 1S6IA 1LINA 2L4HA 1KK7Z 1KQMB 2JNFA 2Y1NA 3EVRA 1CDPA 1FW4A 1UP5A 1OMVA 1SW8A 1TNWA 1WDCC 1SCMC 2L5XB 2PALA 1DJGA 4MVFA 2LLTA 3DD4A 4YGCB 1RECA 1PALA 1UURA 1B47A 4MBEA 2EHBA 4C0KA 1KWOC 2ZN9A 1RK9A 3EK8A 1W7JB 2LMUA 4U8DA 3PLFB 2ZNDA 3WNXB 3PSRA 1KSOA 2CTNA 1KK7Y 1U5IB 1M39A 2BCBA 1JSAA 3WXAA 4D1EA 2M97A 5KSZA 1CNPA 2NLNA 4MEWA 1BMOA 4M2OA 2WCBA 3KF9A 3BXKA 4N5XA 4TNCA 1S26D 1F70A 5GQQC 1K93D 2KAYA 1KFUL 1VRKA 2CCMA 1B4CA 3CWGA 1K95A 3SIAA 3FIAA 2ZRTA 1B8RA 2R2IA 4L9MA 5I2OA 3GK4X 1MF8B 1D1OA 1F55A 2JULA 3BUOB 1YR5A 1B8LA 3OX5A 1RROA 2BE4A 1Y1AA 2LC5A 1H8BA 3IQQA 4YGDB 1NSHA 1Q80A 4PCWA 4USLA 1QVIY 3D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALV A;  2K7O A;  1K9K A;  2KSP A;  1AHR A;  1N0Y A;  5F6T A;  2BKH B;  2VRG A;  1FPW A;  2ZN8 A;  2JC2 A;  5AXI A;  1UHJ A;  4PE7 A;  1XK4 C;  4P5O E;  1NUB A;  2LVV A;  2M1U A;  3GK1 A;  3SIB A;  2Q91 A;  4BY5 A;  1IJ5 A;  1ODB A;  1ZAC A;  1F4O A;  2BL0 C;  5AER A;  1KFU S;  1Y1X A;  2KI6 C;  1TN4 A;  3I5G B;  5CPV A;  1UHK A;  1TTX A;  2LE9 B;  1J55 A;  3FWC A;  4MRX A;  2PMY A;  1SL9 A;  2LVI A;  4CID A;  1C7W A;  1ZOT B;  4YI9 A;  1NWD A;  2I7A A;  3PAT A;  1QLS A;  1J7R A;  1NIW A;  1SY9 A;  2HET A;  2Y5I A;  1CKK A;  2L98 A;  2LNK A;  3KHE A;  1KQM C;  4OKH A;  3TS5 C;  1NCX A;  1ZFS A;  2K2A A;  3CR2 A;  1CDM A;  1J1E A;  2NCO A;  4Q04 A;  4XJK A;  5AAN A;  1BF5 A;  2KQ6 A;  1SK6 D;  5CSJ A;  3F45 A;  1Y1U A;  2KI4 B;  1XK4 A;  1S6C A;  2FJU B;  1DTL A;  2A4J A;  2JQ6 A;  2Y1M A;  3DVE A;  4MSP A;  4MZL A;  1J7P A;  4C0L A;  2D8N A;  4HRG A;  2B1U A;  4YGA A;  5IBW A;  1SR6 B;  4YGB B;  1JUO A;  2EC6 B;  3D0Y B;  1EL4 A;  1AK8 A;  3EVV A;  2M1K B;  1IWQ A;  2JZI A;  1PVB A;  4PE4 A;  3C1V A;  2L50 A;  1GGZ A;  4QJ3 B;  2L4I A;  2ZKM X;  2WOS A;  3NSK A;  2K7D A;  1NYA A;  3EKJ A;  1IRJ A;  4UPG A;  4DIR A;  3PN7 B;  5TNC A;  1NCY A;  1UHI A;  4YRU A;  1DVI A;  2LVK A;  3BUW B;  1A2X A;  2K61 A;  2JXC A;  4WRI A;  2WC8 A;  3NXA A;  4C0J A;  1NX2 A;  2BEC A;  4GGF C;  1ZUZ A;  2FCE A;  1QIW A;  1G33 A;  1PRW A;  2M29 A;  1A4P A;  1NX3 A;  1EXR A;  2K0J A;  4GNK B;  4P2Y B;  1KQV A;  2GV5 A;  3PM8 A;  1SRA A;  3NSI A;  1A75 A;  5CSN A;  4WQ3 A;  2EGD A;  2KFH A;  4WQ2 A;  1MUX A;  1CLL A;  3M0W A;  1XYD A;  3SG7 A;  4GUK A;  1XFX O;  4ORC B;  1QS7 A;  4NDC A;  1M45 A;  1G4Y R;  3TUY B;  1SL8 A;  1DF0 A;  2KFG A;  4R1E A;  4XYN A;  4OR9 B;  2K2F A;  1YTZ C;  2F3Y A;  4HRE E;  1XO5 A;  2Q4U A;  2WCE A;  3H4S E;  2JT0 A;  2OPO A;  3CZT X;  3TDZ A;  2HF5 A;  1CLM A;  2NZ0 A;  3EKH A;  3RLZ A;  4ZCU A;  3LK0 A;  1K2H A;  2WCF A;  3NSO A;  1QV1 A;  1XFW O;  1QXP A;  3OB2 B;  4GGF A;  3FWB A;  1KSM A;  1DGV A;  1TNQ A;  3HCM A;  1LKJ A;  3JVT B;  2JOJ A;  2LP2 A;  1KK8 C;  1IG5 A;  2KGB C;  1EG3 A;  1WLZ A;  1SL7 A;  3DVK A;  3O4Y A;  4JPZ B;  3I5G C;  4I5N B;  1F71 A;  3CLN A;  4PHN A;  1BT6 A;  1QVI Z;  3JTD B;  1CFC A;  1PVA A;  2I94 A;  1YVL A;  1XVJ A;  1S1E A;  2NXQ A;  4GAO A;  1IJ6 A;  4DCK A;  3EK4 A;  1AJ4 A;  5HYD A;  3BUM B;  2LMT A;  4A4B A;  1FBV A;  1N2D A;  1ALW A;  2F33 A;  1R2U A;  3SG4 A;  2K8M B;  4ETO A;  2AUC A;  2GGM A;  5D69 A;  1CTR A;  3IF7 A;  2KQY A;  1QIV A;  2IS9 A;  2OTG B;  2KI4 C;  1S6J A;  1YX8 A;  4PHK A;  5KTY A;  4MN0 A;  1WY9 A;  5I2L A;  1LXF C;  1SCV A;  5AFP A;  2KGR A;  3I5I B;  1WRK A;  2DOQ A;  1XFY O;  2LAP A;  2M7L A;  1N65 A;  1SR6 C;  2CXJ A;  3OHM B;  2EC6 C;  1C7V A;  4I5J A;  1CFD A;  2I2R E;  3I5H C;  1K9P A;  2LCP A;  3AKB A;  2KYF A;  4I5L B;  1CDL A;  3VRN A;  5CSI A;  1WLM A;  2WND A;  1QX7 A;  2LVJ A;  4NDD A;  3RM1 A;  3DVJ A;  5B8I B;  3TDU A;  2H61 C;  4FQO A;  1AJ5 A;  1V1G A;  1YUU A;  2JWW A;  1J1D A;  5ER5 A;  4HRH A;  2M0R A;  1K94 A;  4MZJ A;  1DJH A;  1G8I A;  1UHN A;  1A03 A;  1MXE A;  3VGO A;  1NX0 A;  1WDC B;  1SCM B;  2OS8 B;  1CFF A;  4QJ5 B;  1OMD A;  1R6P A;  1J7O A;  4MLW A;  5HKY A;  1QTX A;  1BLQ A;  1XFV O;  1JFJ A;  1KFX L;  2LLU A;  4JWQ A;  3I5F B;  4PDZ A;  1TCF A;  1CMG A;  1DMO A;  2HQ8 A;  2FCD A;  2HPS A;  5HLO A;  3SJS A;  4QJ4 B;  1PUL A;  1F54 A;  1S36 A;  2MRD A;  4GPL B;  2QAC A;  1DJX A;  5G08 A;  1OE9 B;  3DF0 A;  3E3R A;  3BUX B;  1JC2 A;  1RWY A;  4BY4 A;  1JF0 A;  3D0Y A;  1QJT A;  1OQP A;  4GBA A;  2M49 B;  1M31 A;  1GJY A;  1SNL A;  1SPY A;  1JFK A;  1A29 A;  4PE0 A;  3TUY C;  1IQ5 A;  5K89 A;  1DGU A;  2MLF C;  2P6B B;  1SYM A;  1B1G A;  1KCY A;  3VRQ A;  2LAN A;  1GQM A;  3TDI A;  1K96 A;  1NX1 A;  1TOP A;  3LLE A;  3CGA A;  2F8P A;  3JVT C;  2GGZ A;  2BE6 A;  2BKI B;  1BJF A;  4ORA B;  4PE1 A;  2QPT A;  4DUQ A;  1K9U A;  3ZNI A;  2ZRS A;  5CSF A;  4CFQ A;  5HKW A;  1YUR A;  5AEQ A;  1XFU O;  2KYC A;  1JF2 A;  3GK2 A;  1Y6W A;  3FS7 A;  3KEV A;  1GGW A;  1YRU B;  3K21 A;  2KBI A;  2M8U A;  5FYX A;  1QAS A;  2TN4 A;  1CB1 A;  2KBM A;  2I18 A;  3AAK A;  1M63 B;  3CR5 X;  1ZMZ A;  2F2P A;  1S5G Y;  2M3W A;  2SCP A;  4OVN F;  1MXL C;  1TIZ A;  2MLE C;  4YI8 A;  3PFV A;  4MZK A;  2ZNE A;  3I5I C;  1F4Q A;  1CMF A;  1YUS A;  1U5I A;  1S3P A;  1L2O B;  3SG6 A;  1NPQ A;  2KNE A;  1NCZ A;  2PVB A;  2K7C A;  2JT3 A;  3BOW B;  3VRR A;  3O6B A;  1B7T Y;  3KO0 A;  4PHJ A;  1AUI B;  2MBX A;  1UUS A;  4ICB A;  3EK7 A;  1EJ3 A;  3EVU A;  5JJG A;  1Y0V H;  2ZFD A;  3TS5 B;  2F3Z A;  2KHN A;  2L51 A;  2OS8 C;  1UWO A;  5JOL A;  5I2Q A;  3WHT B;  4ORB B;  1CDN A;  4NDB A;  2MHH A;  4CPV A;  1A75 B;  2KI6 D;  1EH2 A;  2MA2 A;  3I5F C;  3VRP A;  2PSR A;  5DKN A;  1YVH A;  2M7N A;  4N1G A;  2O5G A;  2RGI A;  3AKA A;  2JRF A;  4CFR A;  2COL B;  1CLB A;  5I8N A;  2BCX A;  2AAO A;  5HKZ A;  1PSR A;  1DF0 B;  1YX7 A;  4OCI A;  1OSA A;  1V1F A;  2KOT A;  3O78 A;  1B8C A;  3GOF A;  3PAL A;  2E30 A;  3DVM A;  1LA0 A;  3OP0 A;  4OV2 A;  4CLN A;  1DJW A;  4YBH B;  1CM1 A;  1HT9 A;  1MR8 A;  2FOT A;  1X02 A;  4AQJ A;  1MWN A;  1RTP 1;  2M9G A;  5HLV A;  1LA3 A;  2LHL A;  3TZ1 A;  1UHH A;  1TNX A;  3A8R A;  1K90 D;  2LUC A;  2JXL A;  4A4C A;  3LK1 A;  1SBJ A;  1PK0 D;  1BU3 A;  5DKQ A;  4E68 A;  1IQ3 A;  2CNP A;  1TCO B;  5KU1 A;  3PN7 C;  4PHM A;  3LL8 B;  1QX5 B;  5DKR A;  2AMI A;  4MRY A;  4AQI A;  3LCP C;  4PAL A;  1XFZ O;  1SMG A;  1DT7 B;  1XA5 A;  2KAX A;  1C07 A;  4GGN A;  2LP3 A;  1DJY A;  1J7Q A;  1IKU A;  1YUT A;  1QLK A;  2BCA A;  2F2O A;  2PAS A;  3CS1 A;  1WRZ A;  2G2B A;  1KWO B;  1YRT B;  3BUN B;  1QX2 A;  2JU0 A;  4IL1 A;  2HQW A;  2KDH A;  3KPX A;  1BG1 A;  2WOR A;  1QAT A;  1L7Z A;  3QRX A;  4GFT A;  1AP4 A;  5J3X A;  3BYA A;  3SG2 A;  1AVS A;  2LM5 A;  2BBM A;  1EG4 A;  2KAV A;  2O60 A;  1DJZ A;  1KK8 B;  2PRU A;  2SAS A;  1W7I B;  1TRF A;  1JBA A;  1L2O C;  2NCP A;  3O2P A;  3NSL A;  2E6W A;  2H61 A;  1E8A A;  3OX6 A;  1FF1 A;  5PAL A;  3SG3 A;  1H4B A;  3BQ3 A;  4M2Q A;  3SG5 A;  5BPJ A;  2JTZ A;  3VRO A;  2MJW B;  1BR1 B;  4AOM A;  1MHO A;  1LVC D;  2LV7 A;  4F0Z B;  1BOC A;  1CM4 A;  3ZWH A;  1NP8 A;  3WHU B;  2CBL A;  2JNX A;  1S5G Z;  1CFP A;  1OMR A;  3IQO A;  1KFX S;  3JTD C;  1OOJ A;  4JQ0 D;  2JTT A;  1K8U A;  3DF0 B;  3ICB A;  1OZS A;  2L0P A;  1FI6 A;  1WRL A;  1M46 A;  1B7T Z;  3I5H B;  4HSZ A;  2KFF A;  4XJK B;  3MSE B;  5ER4 X;  2CT9 A;  4N1F A;  1TNP A;  1BOD A;  1PSB A;  4FTG A;  1SKT A;  2G9B A;  3CTN A;  1JWD A;  1QV0 A;  4DS7 A;  3BOW A;  1IGV A;  4NQG A;  2K7B A;  2OTG C;  4YGE B;  2BBN A;  1F8H A;  2JPT A;  2ISD A;  2BL0 B;  2Y4Q A;  2H2K A;  4M2P A;  1BR4 B;  3AAJ A;  2LHI A;  3OB1 B;  1RJV A;  5D7F A;  1FI5 A;  1HQV A;  1DJI A;  1OZO A;  3CR4 X;  1RFJ A;  2V53 A;  1IH0 A;  3HX4 A;  4I5K A;  2MAZ A;  4ZCV A;  2L2E A;  2JT8 A;  2LLS A;  4DRW A;  2LUX A;  1MQ1 A;  1B9A A;  2LMV A;  3A4U B;  1S6I A;  1LIN A;  2L4H A;  1KK7 Z;  1KQM B;  2JNF A;  2Y1N A;  3EVR A;  1CDP A;  1FW4 A;  1UP5 A;  1OMV A;  1SW8 A;  1TNW A;  1WDC C;  1SCM C;  2L5X B;  2PAL A;  1DJG A;  4MVF A;  2LLT A;  3DD4 A;  4YGC B;  1REC A;  1PAL A;  1UUR A;  1B47 A;  4MBE A;  2EHB A;  4C0K A;  1KWO C;  2ZN9 A;  1RK9 A;  3EK8 A;  1W7J B;  2LMU A;  4U8D A;  3PLF B;  2ZND A;  3WNX B;  3PSR A;  1KSO A;  2CTN A;  1KK7 Y;  1U5I B;  1M39 A;  2BCB A;  1JSA A;  3WXA A;  4D1E A;  2M97 A;  5KSZ A;  1CNP A;  2NLN A;  4MEW A;  1BMO A;  4M2O A;  2WCB A;  3KF9 A;  3BXK A;  4N5X A;  4TNC A;  1S26 D;  1F70 A;  5GQQ C;  1K93 D;  2KAY A;  1KFU L;  1VRK A;  2CCM A;  1B4C A;  3CWG A;  1K95 A;  3SIA A;  3FIA A;  2ZRT A;  1B8R A;  2R2I A;  4L9M A;  5I2O A;  3GK4 X;  1MF8 B;  1D1O A;  1F55 A;  2JUL A;  3BUO B;  1YR5 A;  1B8L A;  3OX5 A;  1RRO A;  2BE4 A;  1Y1A A;  2LC5 A;  1H8B A;  3IQQ A;  4YGD B;  1NSH A;  1Q80 A;  4PCW A;  4USL A;  1QVI Y;  3D10 A; 
#chains in the Genus database with same CATH topology
 1ALV A;  2K7O A;  1K9K A;  2KSP A;  1AHR A;  1N0Y A;  5F6T A;  2BKH B;  2VRG A;  1FPW A;  2ZN8 A;  2JC2 A;  5AXI A;  1UHJ A;  4PE7 A;  1XK4 C;  4P5O E;  1NUB A;  2LVV A;  2M1U A;  3GK1 A;  3SIB A;  2Q91 A;  4BY5 A;  1IJ5 A;  1ODB A;  1ZAC A;  1F4O A;  2BL0 C;  5AER A;  1KFU S;  1Y1X A;  2KI6 C;  1TN4 A;  3I5G B;  5CPV A;  1UHK A;  1TTX A;  2LE9 B;  1J55 A;  3FWC A;  4MRX A;  2PMY A;  1SL9 A;  2LVI A;  2QEB A;  4CID A;  1C7W A;  1OW4 A;  1W9Z A;  1ZOT B;  4YI9 A;  1NWD A;  2I7A A;  3PAT A;  1QLS A;  1J7R A;  1TUJ A;  1NIW A;  1SY9 A;  2HET A;  2Y5I A;  1CKK A;  2L98 A;  2LNK A;  3KHE A;  1KQM C;  4OKH A;  3TS5 C;  1NCX A;  1ZFS A;  2K2A A;  3CR2 A;  1CDM A;  1J1E A;  2NCO A;  4Q04 A;  2WCK A;  4XJK A;  5AAN A;  3BFA A;  1BF5 A;  2KQ6 A;  1SK6 D;  5CSJ A;  3F45 A;  1Y1U A;  2KI4 B;  1XK4 A;  1S6C A;  2FJU B;  1DTL A;  2A4J A;  2JQ6 A;  2Y1M A;  3DVE A;  4MSP A;  4MZL A;  1J7P A;  2QEO A;  4C0L A;  2D8N A;  4HRG A;  2B1U A;  4YGA A;  5FI6 A;  5IBW A;  1SR6 B;  4YGB B;  1C3Y A;  1JUO A;  2EC6 B;  3D0Y B;  1EL4 A;  1AK8 A;  3EVV A;  2M1K B;  1IWQ A;  2JZI A;  1PVB A;  4PE4 A;  3C1V A;  2L50 A;  1GGZ A;  4QJ3 B;  2L4I A;  2ZKM X;  2WOS A;  3NSK A;  2K7D A;  1NYA A;  3EKJ A;  1IRJ A;  4UPG A;  4DIR A;  3PN7 B;  5TNC A;  1NCY A;  1UHI A;  4YRU A;  1DVI A;  2LVK A;  3BUW B;  2H8V A;  3D76 A;  1A2X A;  2K61 A;  1DEK A;  2JXC A;  4WRI A;  2WC8 A;  3NXA A;  4C0J A;  1NX2 A;  2BEC A;  2QEH A;  4GGF C;  1ZUZ A;  2FCE A;  3R72 A;  1QIW A;  1G33 A;  4INW A;  1PRW A;  2M29 A;  1A4P A;  1NX3 A;  1EXR A;  2K0J A;  4GNK B;  4P2Y B;  1KQV A;  2GV5 A;  3BJH A;  3PM8 A;  1SRA A;  3NSI A;  1A75 A;  5CSN A;  4WQ3 A;  2EGD A;  2KFH A;  4WQ2 A;  1MUX A;  1CLL A;  3Q8I A;  3M0W A;  1XYD A;  3CDN A;  4GUK A;  3SG7 A;  1XFX O;  4ORC B;  1QS7 A;  4NDC A;  1M45 A;  1G4Y R;  3TUY B;  1SL8 A;  1DF0 A;  2KFG A;  4R1E A;  4XYN A;  4OR9 B;  2K2F A;  1YTZ C;  2F3Y A;  4HRE E;  1XO5 A;  2Q4U A;  2WCE A;  3H4S E;  2JT0 A;  2OPO A;  3CZT X;  3TDZ A;  2HF5 A;  1CLM A;  2NZ0 A;  3EKH A;  3RLZ A;  4ZCU A;  3LK0 A;  1K2H A;  2WCF A;  3NSO A;  1QV1 A;  1XFW O;  1QXP A;  3OB2 B;  4GGF A;  1F71 A;  3FWB A;  1KSM A;  3DY9 A;  1DGV A;  1TNQ A;  3HCM A;  1LKJ A;  3S0E A;  1SSE B;  3JVT B;  2JOJ A;  2LP2 A;  1KK8 C;  1IG5 A;  2KGB C;  1EG3 A;  1WLZ A;  1SL7 A;  3DVK A;  3O4Y A;  4JPZ B;  3I5G C;  4I5N B;  5FI7 A;  3CLN A;  1DEL A;  4PHN A;  1BT6 A;  1QVI Z;  3JTD B;  1CFC A;  1PVA A;  2I94 A;  3K1E A;  1YVL A;  3O4X A;  4IJ7 A;  1XVJ A;  1S1E A;  2NXQ A;  3B87 A;  4GAO A;  1IJ6 A;  1ORG A;  4DCK A;  3EK4 A;  1AJ4 A;  5HYD A;  5FI2 A;  3BUM B;  2LMT A;  4A4B A;  1FBV A;  1N2D A;  2WCH A;  1ALW A;  2F33 A;  1R2U A;  3SG4 A;  2K8M B;  4ETO A;  2AUC A;  2GGM A;  3V2L A;  5D69 A;  1CTR A;  3IF7 A;  2KQY A;  4KYN A;  1QIV A;  2IS9 A;  2OTG B;  2KI4 C;  1S6J A;  1YX8 A;  4PHK A;  5KTY A;  4MN0 A;  1WY9 A;  5I2L A;  1LXF C;  1SCV A;  5AFP A;  2KGR A;  3I5I B;  1WRK A;  3BFB A;  2DOQ A;  2JPO A;  1XFY O;  2LAP A;  2M7L A;  1N65 A;  1SR6 C;  2CXJ A;  3OHM B;  2EC6 C;  1C7V A;  4I5J A;  1CFD A;  2I2R E;  3I5H C;  1K9P A;  2KLE A;  2LCP A;  3AKB A;  2KYF A;  4I5L B;  1CDL A;  3VRN A;  5CSI A;  1WLM A;  2WND A;  1QX7 A;  2LVJ A;  4NDD A;  3RM1 A;  3DVJ A;  5B8I B;  3TDU A;  2H61 C;  2QDI A;  4FQO A;  1AJ5 A;  1V1G A;  1YUU A;  2JWW A;  1J1D A;  5ER5 A;  4HRH A;  2M0R A;  1K94 A;  4MZJ A;  1DJH A;  1G8I A;  1UHN A;  1A03 A;  1MXE A;  3VGO A;  2K60 A;  1NX0 A;  1WDC B;  1SCM B;  2OS8 B;  1CFF A;  4QJ5 B;  1OMD A;  1R6P A;  1J7O A;  1TUZ A;  4MLW A;  5HKY A;  1QTX A;  1BLQ A;  1XFV O;  1JFJ A;  1KFX L;  2LLU A;  4JWQ A;  3I5F B;  4PDZ A;  1TCF A;  3B7A A;  1CMG A;  1DMO A;  2HQ8 A;  2FCD A;  2HPS A;  5HLO A;  3SJS A;  4QJ4 B;  1PUL A;  1F54 A;  1S36 A;  2MRD A;  4GPL B;  2QAC A;  1DJX A;  3B88 A;  3R1O A;  1OE9 B;  3DF0 A;  5G08 A;  3E3R A;  3BUX B;  3R1P A;  1JC2 A;  1RWY A;  3D75 A;  4BY4 A;  1JF0 A;  3D0Y A;  1QJT A;  1OQP A;  4GBA A;  2M49 B;  1M31 A;  1GJY A;  1SNL A;  1SPY A;  1JFK A;  1A29 A;  2WC6 A;  4PE0 A;  3TUY C;  4JKT A;  1IQ5 A;  5K89 A;  1DGU A;  2MLF C;  2P6B B;  1SYM A;  3NGV A;  2FJY A;  1B1G A;  1KCY A;  3VRQ A;  2LAN A;  1GQM A;  3TDI A;  1K96 A;  1NX1 A;  1TOP A;  3NHT A;  3EG5 B;  3LLE A;  3CGA A;  1TWO A;  2F8P A;  3JVT C;  2GGZ A;  2BE6 A;  2BKI B;  1BJF A;  4ORA B;  4PE1 A;  3DYE A;  2QPT A;  4DUQ A;  1K9U A;  2WCL A;  3ZNI A;  2ZRS A;  5CSF A;  4CFQ A;  5HKW A;  1YUR A;  5AEQ A;  3S0A A;  2P71 A;  1XFU O;  2KYC A;  2YGU A;  1JF2 A;  3GK2 A;  1Y6W A;  3FS7 A;  3KEV A;  1GGW A;  1YRU B;  3K21 A;  2KBI A;  2M8U A;  5FYX A;  1QAS A;  2TN4 A;  1CB1 A;  2KBM A;  2I18 A;  3AAK A;  1M63 B;  3B6X A;  3CR5 X;  1ZMZ A;  2F2P A;  1S5G Y;  2M3W A;  2SCP A;  4OVN F;  1MXL C;  1TIZ A;  2MLE C;  4YI8 A;  3PFV A;  4MZK A;  2ZNE A;  3I5I C;  3CZ2 A;  1F4Q A;  3DXL A;  1CMF A;  1YUS A;  1U5I A;  1S3P A;  1L2O B;  3SG6 A;  1NPQ A;  2KNE A;  1NCZ A;  2PVB A;  2K7C A;  2JT3 A;  3BOW B;  3NHI A;  3VRR A;  1DQE A;  3O6B A;  1B7T Y;  3KO0 A;  4PHJ A;  1AUI B;  2MBX A;  1UUS A;  4ICB A;  3EK7 A;  1EJ3 A;  3EVU A;  5JJG A;  1Y0V H;  2ZFD A;  3TS5 B;  2F3Z A;  3L4A A;  2KHN A;  2L51 A;  2OS8 C;  1UWO A;  5JOL A;  5I2Q A;  3WHT B;  4ORB B;  4JD9 A;  3D78 A;  1CDN A;  4NDB A;  2MHH A;  1Z2C B;  4CPV A;  1A75 B;  2KI6 D;  1EH2 A;  2MA2 A;  1OOI X;  3I5F C;  3S0B A;  3VRP A;  2PSR A;  5DKN A;  1YVH A;  2M7N A;  4N1G A;  2O5G A;  2RGI A;  3AKA A;  2JRF A;  4CFR A;  2COL B;  1CLB A;  5I8N A;  2AAO A;  2BCX A;  5HKZ A;  1PSR A;  1DF0 B;  1YX7 A;  4OCI A;  1DC1 A;  1OSA A;  1V1F A;  2KOT A;  3O78 A;  1B8C A;  3GOF A;  3PAL A;  2E30 A;  3DVM A;  1LA0 A;  3OP0 A;  4OV2 A;  3S0G A;  3SS4 A;  4CLN A;  1DJW A;  4YBH B;  1CM1 A;  1HT9 A;  1MR8 A;  3VB1 A;  3RZS A;  1Z4H A;  2FOT A;  1X02 A;  3R1V A;  1MWN A;  4AQJ A;  1RTP 1;  2M9G A;  5HLV A;  1LA3 A;  2LHL A;  3TZ1 A;  3CZ0 A;  1UHH A;  1TNX A;  3A8R A;  1K90 D;  2LUC A;  2JXL A;  4A4C A;  3LK1 A;  1SBJ A;  1PK0 D;  2PYQ A;  3FE9 A;  3OBV A;  1BU3 A;  5DKQ A;  4E68 A;  1IQ3 A;  2CNP A;  3FE8 A;  1TCO B;  5KU1 A;  3PN7 C;  2L2C A;  3PJI A;  4PHM A;  3LL8 B;  1QX5 B;  5DKR A;  2AMI A;  4MRY A;  4AQI A;  3LCP C;  3OGN A;  1XFZ O;  1SMG A;  4PAL A;  1DT7 B;  1XA5 A;  2KAX A;  1C07 A;  4GGN A;  2LP3 A;  1DJY A;  1J7Q A;  1IKU A;  1YUT A;  1QLK A;  2BCA A;  5DIC A;  2F2O A;  2PAS A;  3CS1 A;  1WRZ A;  2G2B A;  1KWO B;  1YRT B;  2BAP A;  1QX2 A;  2P70 A;  3BUN B;  3FE6 A;  2JU0 A;  4IL1 A;  2HQW A;  2KDH A;  3KPX A;  5I94 A;  2WCJ A;  1BG1 A;  2WOR A;  3L47 A;  1QAT A;  1L7Z A;  3QRX A;  4GFT A;  3CAB A;  1AP4 A;  5J3X A;  3SS5 A;  3BYA A;  3SG2 A;  1AVS A;  3IVT A;  2LM5 A;  5HL1 A;  2BBM A;  1EG4 A;  2KAV A;  2O60 A;  1DJZ A;  4INX A;  1KK8 B;  2PRU A;  2SAS A;  3D74 A;  2WCM A;  1W7I B;  1TRF A;  1C3Z A;  1JBA A;  1L2O C;  2NCP A;  3O2P A;  3NSL A;  2E6W A;  2H61 A;  1E8A A;  3OX6 A;  1T14 A;  1FF1 A;  5PAL A;  3SG3 A;  1H4B A;  1OOH A;  3BQ3 A;  4M2Q A;  3SG5 A;  5BPJ A;  2JTZ A;  3VRO A;  2MJW B;  1BR1 B;  4OZD A;  4AOM A;  1MHO A;  1LVC D;  2LV7 A;  4F0Z B;  1BOC A;  1CM4 A;  3ZWH A;  1NP8 A;  3WHU B;  4PT1 A;  2CBL A;  2JNX A;  3S0F A;  1S5G Z;  1OOG A;  1CFP A;  3UO9 A;  1OMR A;  2WC5 A;  3IQO A;  1KFX S;  3JTD C;  1IIO A;  1OOJ A;  4JQ0 D;  3SS3 A;  2JTT A;  1K8U A;  3DF0 B;  3ICB A;  1OZS A;  2L0P A;  1FI6 A;  1WRL A;  1M46 A;  1B7T Z;  3I5H B;  4HSZ A;  2PQL A;  2KFF A;  4XJK B;  3B86 A;  3MSE B;  2CT9 A;  4N1F A;  1TNP A;  5ER4 X;  1BOD A;  1PSB A;  4FTG A;  1SKT A;  2G9B A;  1LS8 A;  3CTN A;  3N7H A;  1JWD A;  1QV0 A;  4DS7 A;  3BOW A;  1IGV A;  4NQG A;  2K7B A;  2OTG C;  4YGE B;  2BBN A;  1F8H A;  2JPT A;  2ISD A;  2BL0 B;  3CYZ A;  2Y4Q A;  2H2K A;  4M2P A;  1BR4 B;  3AAJ A;  2LHI A;  3OB1 B;  1RJV A;  5D7F A;  5EL2 A;  1FI5 A;  1HQV A;  1DJI A;  4FQT A;  2ERB A;  1OZO A;  3CR4 X;  1RFJ A;  2V53 A;  1IH0 A;  3HX4 A;  4I5K A;  2MAZ A;  4ZCV A;  2L2E A;  2JT8 A;  2LLS A;  4DRW A;  2LUX A;  1MQ1 A;  1B9A A;  2LMV A;  3A4U B;  1S6I A;  1LIN A;  2QEV A;  2L4H A;  1KK7 Z;  1KQM B;  2JNF A;  2Y1N A;  3EVR A;  1CDP A;  1FW4 A;  1OOF A;  1UP5 A;  1OMV A;  1SW8 A;  1TNW A;  1WDC C;  1SCM C;  2L5X B;  2PAL A;  3D77 A;  1DJG A;  4MVF A;  2LLT A;  3DD4 A;  4YGC B;  1REC A;  1PAL A;  1UUR A;  1B47 A;  4MBE A;  2EHB A;  2GTE A;  4C0K A;  1KWO C;  1P28 A;  2KPH A;  2ZN9 A;  1RK9 A;  3EK8 A;  1GM0 A;  1W7J B;  2LMU A;  4U8D A;  3QME A;  3PLF B;  2ZND A;  3PM2 A;  3WNX B;  3PSR A;  1KSO A;  2CTN A;  1KK7 Y;  1U5I B;  1M39 A;  2BCB A;  3S0D A;  1JSA A;  3WXA A;  4D1E A;  2M97 A;  5KSZ A;  1CNP A;  2NLN A;  5D3O A;  4MEW A;  1BMO A;  4M2O A;  2KLD A;  2WCB A;  3KF9 A;  3BXK A;  4N5X A;  4TNC A;  3BFH A;  1S26 D;  1F70 A;  1XFR A;  5GQQ C;  1K93 D;  2KAY A;  3CZ1 A;  1KFU L;  3D73 A;  1VRK A;  2CCM A;  1B4C A;  3CWG A;  1K95 A;  3L4L A;  3SIA A;  3FIA A;  2ZRT A;  1B8R A;  2R2I A;  4L9M A;  5I2O A;  3GK4 X;  1MF8 B;  1D1O A;  1F55 A;  2JUL A;  3UNW A;  3BUO B;  1YR5 A;  1B8L A;  3OX5 A;  1QWV A;  1RRO A;  2BE4 A;  3DZT A;  1Y1A A;  2LC5 A;  1H8B A;  3IQQ A;  4YGD B;  1NSH A;  1Q80 A;  4PCW A;  4USL A;  1QVI Y;  2BNX A;  2L5Y A;  4F7F A;  3D10 A; 
#chains in the Genus database with same CATH homology
 1ALV A;  2K7O A;  1K9K A;  2KSP A;  1AHR A;  1N0Y A;  5F6T A;  2BKH B;  2VRG A;  1FPW A;  2ZN8 A;  2JC2 A;  5AXI A;  1UHJ A;  4PE7 A;  1XK4 C;  4P5O E;  1NUB A;  2LVV A;  2M1U A;  3GK1 A;  3SIB A;  2Q91 A;  4BY5 A;  1IJ5 A;  1ODB A;  1ZAC A;  1F4O A;  2BL0 C;  5AER A;  1KFU S;  1Y1X A;  2KI6 C;  1TN4 A;  3I5G B;  5CPV A;  1UHK A;  1TTX A;  2LE9 B;  1J55 A;  3FWC A;  4MRX A;  2PMY A;  1SL9 A;  2LVI A;  4CID A;  1C7W A;  1ZOT B;  4YI9 A;  1NWD A;  2I7A A;  3PAT A;  1QLS A;  1J7R A;  1NIW A;  1SY9 A;  2HET A;  2Y5I A;  1CKK A;  2L98 A;  2LNK A;  3KHE A;  1KQM C;  4OKH A;  3TS5 C;  1NCX A;  1ZFS A;  2K2A A;  3CR2 A;  1CDM A;  1J1E A;  2NCO A;  4Q04 A;  4XJK A;  5AAN A;  1BF5 A;  2KQ6 A;  1SK6 D;  5CSJ A;  3F45 A;  1Y1U A;  2KI4 B;  1XK4 A;  1S6C A;  2FJU B;  1DTL A;  2A4J A;  2JQ6 A;  2Y1M A;  3DVE A;  4MSP A;  4MZL A;  1J7P A;  4C0L A;  2D8N A;  4HRG A;  2B1U A;  4YGA A;  5IBW A;  1SR6 B;  4YGB B;  1JUO A;  2EC6 B;  3D0Y B;  1EL4 A;  1AK8 A;  3EVV A;  2M1K B;  1IWQ A;  2JZI A;  1PVB A;  4PE4 A;  3C1V A;  2L50 A;  1GGZ A;  4QJ3 B;  2L4I A;  2ZKM X;  2WOS A;  3NSK A;  2K7D A;  1NYA A;  3EKJ A;  1IRJ A;  4UPG A;  4DIR A;  3PN7 B;  5TNC A;  1NCY A;  1UHI A;  4YRU A;  1DVI A;  2LVK A;  3BUW B;  1A2X A;  2K61 A;  2JXC A;  4WRI A;  2WC8 A;  3NXA A;  4C0J A;  1NX2 A;  2BEC A;  4GGF C;  1ZUZ A;  2FCE A;  1QIW A;  1G33 A;  1PRW A;  2M29 A;  1A4P A;  1NX3 A;  1EXR A;  2K0J A;  4GNK B;  4P2Y B;  1KQV A;  2GV5 A;  3PM8 A;  1SRA A;  3NSI A;  1A75 A;  5CSN A;  4WQ3 A;  2EGD A;  2KFH A;  4WQ2 A;  1MUX A;  1CLL A;  3M0W A;  1XYD A;  3SG7 A;  4GUK A;  1XFX O;  4ORC B;  1QS7 A;  4NDC A;  1M45 A;  1G4Y R;  3TUY B;  1SL8 A;  1DF0 A;  2KFG A;  4R1E A;  4XYN A;  4OR9 B;  2K2F A;  1YTZ C;  2F3Y A;  4HRE E;  1XO5 A;  2Q4U A;  2WCE A;  3H4S E;  2JT0 A;  2OPO A;  3CZT X;  3TDZ A;  2HF5 A;  1CLM A;  2NZ0 A;  3EKH A;  3RLZ A;  4ZCU A;  3LK0 A;  1K2H A;  2WCF A;  3NSO A;  1QV1 A;  1XFW O;  1QXP A;  3OB2 B;  4GGF A;  3FWB A;  1KSM A;  1DGV A;  1TNQ A;  3HCM A;  1LKJ A;  3JVT B;  2JOJ A;  2LP2 A;  1KK8 C;  1IG5 A;  2KGB C;  1EG3 A;  1WLZ A;  1SL7 A;  3DVK A;  3O4Y A;  4JPZ B;  3I5G C;  4I5N B;  1F71 A;  3CLN A;  4PHN A;  1BT6 A;  1QVI Z;  3JTD B;  1CFC A;  1PVA A;  2I94 A;  1YVL A;  1XVJ A;  1S1E A;  2NXQ A;  4GAO A;  1IJ6 A;  4DCK A;  3EK4 A;  1AJ4 A;  5HYD A;  3BUM B;  2LMT A;  4A4B A;  1FBV A;  1N2D A;  1ALW A;  2F33 A;  1R2U A;  3SG4 A;  2K8M B;  4ETO A;  2AUC A;  2GGM A;  5D69 A;  1CTR A;  3IF7 A;  2KQY A;  1QIV A;  2IS9 A;  2OTG B;  2KI4 C;  1S6J A;  1YX8 A;  4PHK A;  5KTY A;  4MN0 A;  1WY9 A;  5I2L A;  1LXF C;  1SCV A;  5AFP A;  2KGR A;  3I5I B;  1WRK A;  2DOQ A;  1XFY O;  2LAP A;  2M7L A;  1N65 A;  1SR6 C;  2CXJ A;  3OHM B;  2EC6 C;  1C7V A;  4I5J A;  1CFD A;  2I2R E;  3I5H C;  1K9P A;  2LCP A;  3AKB A;  2KYF A;  4I5L B;  1CDL A;  3VRN A;  5CSI A;  1WLM A;  2WND A;  1QX7 A;  2LVJ A;  4NDD A;  3RM1 A;  3DVJ A;  5B8I B;  3TDU A;  2H61 C;  4FQO A;  1AJ5 A;  1V1G A;  1YUU A;  2JWW A;  1J1D A;  5ER5 A;  4HRH A;  2M0R A;  1K94 A;  4MZJ A;  1DJH A;  1G8I A;  1UHN A;  1A03 A;  1MXE A;  3VGO A;  1NX0 A;  1WDC B;  1SCM B;  2OS8 B;  1CFF A;  4QJ5 B;  1OMD A;  1R6P A;  1J7O A;  4MLW A;  5HKY A;  1QTX A;  1BLQ A;  1XFV O;  1JFJ A;  1KFX L;  2LLU A;  4JWQ A;  3I5F B;  4PDZ A;  1TCF A;  1CMG A;  1DMO A;  2HQ8 A;  2FCD A;  2HPS A;  5HLO A;  3SJS A;  4QJ4 B;  1PUL A;  1F54 A;  1S36 A;  2MRD A;  4GPL B;  2QAC A;  1DJX A;  5G08 A;  1OE9 B;  3DF0 A;  3E3R A;  3BUX B;  1JC2 A;  1RWY A;  4BY4 A;  1JF0 A;  3D0Y A;  1QJT A;  1OQP A;  4GBA A;  2M49 B;  1M31 A;  1GJY A;  1SNL A;  1SPY A;  1JFK A;  1A29 A;  4PE0 A;  3TUY C;  1IQ5 A;  5K89 A;  1DGU A;  2MLF C;  2P6B B;  1SYM A;  1B1G A;  1KCY A;  3VRQ A;  2LAN A;  1GQM A;  3TDI A;  1K96 A;  1NX1 A;  1TOP A;  3LLE A;  3CGA A;  2F8P A;  3JVT C;  2GGZ A;  2BE6 A;  2BKI B;  1BJF A;  4ORA B;  4PE1 A;  2QPT A;  4DUQ A;  1K9U A;  3ZNI A;  2ZRS A;  5CSF A;  4CFQ A;  5HKW A;  1YUR A;  5AEQ A;  1XFU O;  2KYC A;  1JF2 A;  3GK2 A;  1Y6W A;  3FS7 A;  3KEV A;  1GGW A;  1YRU B;  3K21 A;  2KBI A;  2M8U A;  5FYX A;  1QAS A;  2TN4 A;  1CB1 A;  2KBM A;  2I18 A;  3AAK A;  1M63 B;  3CR5 X;  1ZMZ A;  2F2P A;  1S5G Y;  2M3W A;  2SCP A;  4OVN F;  1MXL C;  1TIZ A;  2MLE C;  4YI8 A;  3PFV A;  4MZK A;  2ZNE A;  3I5I C;  1F4Q A;  1CMF A;  1YUS A;  1U5I A;  1S3P A;  1L2O B;  3SG6 A;  1NPQ A;  2KNE A;  1NCZ A;  2PVB A;  2K7C A;  2JT3 A;  3BOW B;  3VRR A;  3O6B A;  1B7T Y;  3KO0 A;  4PHJ A;  1AUI B;  2MBX A;  1UUS A;  4ICB A;  3EK7 A;  1EJ3 A;  3EVU A;  5JJG A;  1Y0V H;  2ZFD A;  3TS5 B;  2F3Z A;  2KHN A;  2L51 A;  2OS8 C;  1UWO A;  5JOL A;  5I2Q A;  3WHT B;  4ORB B;  1CDN A;  4NDB A;  2MHH A;  4CPV A;  1A75 B;  2KI6 D;  1EH2 A;  2MA2 A;  3I5F C;  3VRP A;  2PSR A;  5DKN A;  1YVH A;  2M7N A;  4N1G A;  2O5G A;  2RGI A;  3AKA A;  2JRF A;  4CFR A;  2COL B;  1CLB A;  5I8N A;  2BCX A;  2AAO A;  5HKZ A;  1PSR A;  1DF0 B;  1YX7 A;  4OCI A;  1OSA A;  1V1F A;  2KOT A;  3O78 A;  1B8C A;  3GOF A;  3PAL A;  2E30 A;  3DVM A;  1LA0 A;  3OP0 A;  4OV2 A;  4CLN A;  1DJW A;  4YBH B;  1CM1 A;  1HT9 A;  1MR8 A;  2FOT A;  1X02 A;  4AQJ A;  1MWN A;  1RTP 1;  2M9G A;  5HLV A;  1LA3 A;  2LHL A;  3TZ1 A;  1UHH A;  1TNX A;  3A8R A;  1K90 D;  2LUC A;  2JXL A;  4A4C A;  3LK1 A;  1SBJ A;  1PK0 D;  1BU3 A;  5DKQ A;  4E68 A;  1IQ3 A;  2CNP A;  1TCO B;  5KU1 A;  3PN7 C;  4PHM A;  3LL8 B;  1QX5 B;  5DKR A;  2AMI A;  4MRY A;  4AQI A;  3LCP C;  4PAL A;  1XFZ O;  1SMG A;  1DT7 B;  1XA5 A;  2KAX A;  1C07 A;  4GGN A;  2LP3 A;  1DJY A;  1J7Q A;  1IKU A;  1YUT A;  1QLK A;  2BCA A;  2F2O A;  2PAS A;  3CS1 A;  1WRZ A;  2G2B A;  1KWO B;  1YRT B;  3BUN B;  1QX2 A;  2JU0 A;  4IL1 A;  2HQW A;  2KDH A;  3KPX A;  1BG1 A;  2WOR A;  1QAT A;  1L7Z A;  3QRX A;  4GFT A;  1AP4 A;  5J3X A;  3BYA A;  3SG2 A;  1AVS A;  2LM5 A;  2BBM A;  1EG4 A;  2KAV A;  2O60 A;  1DJZ A;  1KK8 B;  2PRU A;  2SAS A;  1W7I B;  1TRF A;  1JBA A;  1L2O C;  2NCP A;  3O2P A;  3NSL A;  2E6W A;  2H61 A;  1E8A A;  3OX6 A;  1FF1 A;  5PAL A;  3SG3 A;  1H4B A;  3BQ3 A;  4M2Q A;  3SG5 A;  5BPJ A;  2JTZ A;  3VRO A;  2MJW B;  1BR1 B;  4AOM A;  1MHO A;  1LVC D;  2LV7 A;  4F0Z B;  1BOC A;  1CM4 A;  3ZWH A;  1NP8 A;  3WHU B;  2CBL A;  2JNX A;  1S5G Z;  1CFP A;  1OMR A;  3IQO A;  1KFX S;  3JTD C;  1OOJ A;  4JQ0 D;  2JTT A;  1K8U A;  3DF0 B;  3ICB A;  1OZS A;  2L0P A;  1FI6 A;  1WRL A;  1M46 A;  1B7T Z;  3I5H B;  4HSZ A;  2KFF A;  4XJK B;  3MSE B;  5ER4 X;  2CT9 A;  4N1F A;  1TNP A;  1BOD A;  1PSB A;  4FTG A;  1SKT A;  2G9B A;  3CTN A;  1JWD A;  1QV0 A;  4DS7 A;  3BOW A;  1IGV A;  4NQG A;  2K7B A;  2OTG C;  4YGE B;  2BBN A;  1F8H A;  2JPT A;  2ISD A;  2BL0 B;  2Y4Q A;  2H2K A;  4M2P A;  1BR4 B;  3AAJ A;  2LHI A;  3OB1 B;  1RJV A;  5D7F A;  1FI5 A;  1HQV A;  1DJI A;  1OZO A;  3CR4 X;  1RFJ A;  2V53 A;  1IH0 A;  3HX4 A;  4I5K A;  2MAZ A;  4ZCV A;  2L2E A;  2JT8 A;  2LLS A;  4DRW A;  2LUX A;  1MQ1 A;  1B9A A;  2LMV A;  3A4U B;  1S6I A;  1LIN A;  2L4H A;  1KK7 Z;  1KQM B;  2JNF A;  2Y1N A;  3EVR A;  1CDP A;  1FW4 A;  1UP5 A;  1OMV A;  1SW8 A;  1TNW A;  1WDC C;  1SCM C;  2L5X B;  2PAL A;  1DJG A;  4MVF A;  2LLT A;  3DD4 A;  4YGC B;  1REC A;  1PAL A;  1UUR A;  1B47 A;  4MBE A;  2EHB A;  4C0K A;  1KWO C;  2ZN9 A;  1RK9 A;  3EK8 A;  1W7J B;  2LMU A;  4U8D A;  3PLF B;  2ZND A;  3WNX B;  3PSR A;  1KSO A;  2CTN A;  1KK7 Y;  1U5I B;  1M39 A;  2BCB A;  1JSA A;  3WXA A;  4D1E A;  2M97 A;  5KSZ A;  1CNP A;  2NLN A;  4MEW A;  1BMO A;  4M2O A;  2WCB A;  3KF9 A;  3BXK A;  4N5X A;  4TNC A;  1S26 D;  1F70 A;  5GQQ C;  1K93 D;  2KAY A;  1KFU L;  1VRK A;  2CCM A;  1B4C A;  3CWG A;  1K95 A;  3SIA A;  3FIA A;  2ZRT A;  1B8R A;  2R2I A;  4L9M A;  5I2O A;  3GK4 X;  1MF8 B;  1D1O A;  1F55 A;  2JUL A;  3BUO B;  1YR5 A;  1B8L A;  3OX5 A;  1RRO A;  2BE4 A;  1Y1A A;  2LC5 A;  1H8B A;  3IQQ A;  4YGD B;  1NSH A;  1Q80 A;  4PCW A;  4USL A;  1QVI Y;  3D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...