2BBMA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA02
1ALWA 1BJFA 1C7WA 1EL4A 1WDCC 2KI4B 1PALA 1DJXA 4GGFC 2EGDA 5PALA 3PFVA 1JFKA 3FS7A 1DF0B 2NCOA 1NPQA 3QRXA 1F71A 1YVLA 4U8DA 2BBNA 3BOWA 1DJYA 3CR2A 1CFFA 4C0JA 5DKRA 1QLKA 1TCOB 1IQ3A 1JC2A 1DGVA 2JULA 2BCBA 3NSOA 4PHJA 1DGUA 1PVAA 1QV1A 1KCYA 1QASA 2LMUA 2I18A 2MLEC 2LAPA 4PE1A 2M1UA 3KO0A 3WXAA 1AVSA 3CR4X 1SRAA 3CZTX 3BXKA 1TN4A 2ZNDA 5TNCA 2KHNA 2LMVA 1CLLA 1K93D 2FCEA 1K96A 2L50A 3CGAA 5K89A 1KFXS 1CMFA 2O5GA 3PATA 1KSOA 2CBLA 2M1KB 1F70A 2O60A 1YUUA 2BL0B 4XJKA 2OPOA 1N2DA 4GAOA 2KFFA 2QPTA 3BUNB 1IGVA 1YUSA 2B1UA 3SIAA 5HLVA 1SK6D 4ORCB 1OZSA 2JXCA 5KSZA 4ZCUA 1CB1A 2WNDA 1DMOA 1B7TZ 2I7AA 2PASA 1S6JA 2NZ0A 3WHUB 3SJSA 1NCYA 1XA5A 2LLSA 1SCVA 2WOSA 2BBMA 3I5IB 1B8RA 3FWCA 4YI9A 1J7RA 4QJ5B 3VRQA 4HRHA 1G4YR 3ZWHA 1A03A 1ALVA 3LK0A 1BODA 2AAOA 1TRFA 1F4QA 1UUSA 3SG7A 2ISDA 1QXPA 2VRGA 1QLSA 5AXIA 2IS9A 4DIRA 2KOTA 1AHRA 1KSMA 1OMVA 1VRKA 1CFDA 1MHOA 1DJHA 2DOQA 3BOWB 2SASA 1GGZA 4WQ3A 4MRYA 5HYDA 1M31A 2EC6C 1C07A 1F8HA 3I5GB 4ICBA 1UP5A 1XFYO 1YUTA 5I2LA 4OKHA 1OMRA 3OX5A 3AKBA 2F3YA 1YRTB 2GGZA 4I5JA 3E3RA 3SIBA 1NX3A 1MR8A 2LV7A 3JTDC 3O2PA 5DKQA 4R1EA 1ZFSA 1MXEA 1SMGA 4ETOA 1XK4A 1OQPA 2G2BA 1JF2A 1NUBA 5CPVA 3FWBA 5D69A 5I2OA 4M2QA 3IQQA 3LK1A 3EKHA 4YI8A 3TUYC 3EVVA 1W7IB 1IKUA 1L2OB 4YGDB 2LVVA 1QX5B 1XVJA 1WRZA 4OVNF 1OOJA 1J7QA 3D10A 1CDMA 1A4PA 2LC5A 3DF0B 4F0ZB 3GK4X 3NSKA 3D0YA 4YGEB 1H8BA 4GUKA 1Q80A 3EK8A 1XFXO 2K0JA 5GQQC 5KU1A 1EG4A 2JOJA 2M9GA 2M0RA 2KI6D 3PLFB 3RLZA 2WCBA 4MVFA 2KYFA 2ZRTA 2LCPA 1B47A 3KHEA 2KNEA 2OS8B 3MSEB 3CLNA 3A4UB 4OV2A 2LP3A 1JSAA 3TS5B 1WLMA 1SR6B 4E68A 2JT8A 2KGRA 3IQOA 2FJUB 1UHHA 4MZKA 3CR5X 2FCDA 1ZMZA 3BYAA 1PVBA 2MLFC 3GK1A 2AMIA 2SCPA 1FI6A 2KQYA 4PE7A 2H61A 1NX2A 1ZACA 4N5XA 1FPWA 4I5NB 2ZFDA 3LCPC 4P2YB 3TZ1A 1M63B 1BF5A 1KK7Z 4FQOA 4I5LB 2KI4C 2BKHB 2P6BB 5G08A 1Y0VH 1B9AA 1M46A 1NCXA 5CSJA 1DJWA 1TNXA 2BECA 1IRJA 4CFRA 4CFQA 2LUXA 1XFUO 1TIZA 2CTNA 1YURA 1RTP1 1NYAA 2KFHA 2L98A 4CPVA 1AP4A 1KFUS 4OCIA 1UHKA 4OR9B 2H2KA 5DKNA 4A4CA 4DUQA 5I2QA 2HQ8A 2RGIA 2NXQA 1SL7A 1MWNA 3KPXA 2A4JA 3K21A 1W7JB 1KK8B 3SG4A 2F8PA 1C7VA 1G33A 1JWDA 4QJ3B 1AUIB 1PRWA 2FOTA 4YGCB 3A8RA 2BL0C 1UWOA 3I5HB 2PMYA 3O78A 2E6WA 4M2OA 2K7DA 5CSFA 1RECA 1JFJA 2L51A 1SPYA 1K8UA 1KK7Y 1F54A 1WLZA 1IJ5A 4BY4A 1DT7B 1TNWA 1PULA 1J7PA 2WC8A 3EVRA 1KWOB 4PHMA 1HQVA 3I5FB 3I5IC 3TDZA 5AANA 2HETA 1IJ6A 1UHJA 4C0LA 4PCWA 1KFXL 1J1EA 2LLUA 1UHIA 2M97A 1A75A 4L9MA 4NDCA 1NIWA 5AFPA 1KQVA 2HPSA 4CLNA 1OE9B 3SG6A 1ZUZA 2BKIB 1LA3A 2L5XB 4GFTA 1NP8A 1SL9A 2JT3A 2LVKA 1R2UA 1RK9A 1K9UA 3M0WA 3BQ3A 3NSLA 3PM8A 2LHIA 5I8NA 2QACA 3DVEA 4NDDA 5BPJA 2Q4UA 1XFVO 4DS7A 2ZRSA 1QATA 4A4BA 5IBWA 1CDLA 3VGOA 2F33A 2K61A 3DVJA 3I5GC 3ZNIA 4BY5A 1QJTA 2PALA 4C0KA 2KBIA 3VRPA 1CM1A 1QX2A 2JTTA 1V1FA 3O6BA 1B8CA 4ZCVA 1K9KA 2MHHA 1M45A 3DD4A 5ER4X 2BE6A 1OZOA 2WORA 1X02A 1G8IA 4AQJA 3AKAA 1EG3A 1J7OA 2NCPA 4XJKB 1ZOTB 3BUOB 1CDNA 4GGFA 2K2AA 2ZN8A 5J3XA 1SL8A 2Y1NA 4USLA 4MLWA 1S3PA 2F3ZA 1N0YA 1DJGA 4PE0A 1L2OC 4ORBB 1RJVA 3EKJA 3HX4A 5CSNA 1DJIA 3VRRA 1YTZC 1CFPA 1ODBA 2WCFA 4QJ4B 3LLEA 1DF0A 1IG5A 4I5KA 2CNPA 2TN4A 2KDHA 4ORAB 1JF0A 2JWWA 1FF1A 1QV0A 3VRNA 1IWQA 1EJ3A 2ZKMX 1IH0A 5FYXA 1RROA 3BUMB 1YVHA 1YX8A 1U5IA 2L0PA 1AK8A 1EXRA 1MUXA 1SYMA 1LA0A 1A75B 2KAYA 4MRXA 4PDZA 2K2FA 4WRIA 1KQMB 4WQ2A 3VROA 4DCKA 5HKZA 2OS8C 2JT0A 1TCFA 4MSPA 2JC2A 4DRWA 2LUCA 3PN7B 3TS5C 3OP0A 3JVTB 1SR6C 1XFZO 2LM5A 3NXAA 4D1EA 2D8NA 2K7OA 1OSAA 3NSIA 2KAVA 1LXFC 4FTGA 1TTXA 3TDUA 1LVCD 2MRDA 1HT9A 1TNQA 1B4CA 2JU0A 1S26D 3ICBA 1J1DA 1K9PA 1XO5A 3WNXB 4NQGA 2LLTA 2LHLA 2L4HA 1EH2A 3BUWB 2F2PA 3KEVA 1YRUB 2COLB 2LVIA 1BU3A 4UPGA 3EK7A 1XK4C 1YX7A 1WDCB 3SG5A 1MXLC 1S6IA 4YBHB 4YGBB 2MAZA 1CLMA 4PHKA 1QIVA 4YRUA 3FIAA 4N1FA 1A2XA 4Q04A 1D1OA 2HQWA 5AERA 3TDIA 1B1GA 3O4YA 1RFJA 1PK0D 3D0YB 1CM4A 2PRUA 4PE4A 1FW4A 3OX6A 1QVIZ 1LKJA 2AUCA 1UHNA 2Y1MA 3HCMA 1L7ZA 1U5IB 1MF8B 4GPLB 2LANA 1S5GZ 1NX1A 1K90D 4HREE 1SNLA 1BOCA 1KK8C 4PHNA 4JWQA 1UURA 1BR1B 2KGBC 2GGMA 2Y4QA 1DVIA 2K7CA 3OB2B 4MZLA 3RM1A 2ZNEA 2OTGB 2BCXA 5CSIA 5HKWA 2JZIA 1CNPA 3I5HC 5AEQA 1GQMA 1S1EA 1XYDA 2KSPA 2EHBA 3GK2A 1KFUL 1R6PA 2LNKA 1QS7A 2OTGC 2K8MB 3CTNA 3F45A 1CFCA 1QX7A 3LL8B 1LINA 1WRLA 1KWOC 2G9BA 3OB1B 1SW8A 1RWYA 2H61C 3I5FC 3DVMA 4JQ0D 2CT9A 2E30A 1BLQA 2KBMA 1JUOA 3AAJA 1N65A 5ER5A 1Y6WA 1JBAA 3DF0A 1GGWA 1SY9A 2JRFA 2JXLA 1GJYA 2LMTA 1TNPA 1E8AA 2ZN9A 1QVIY 2PVBA 4HRGA 1Y1UA 1PSRA 1DTLA 1NCZA 1QTXA 2KAXA 2R2IA 2I2RE 2Y5IA 4CIDA 1CLBA 1S5GY 3SG3A 2EC6B 1K2HA 2L4IA 3PSRA 1WRKA 1CKKA 3CWGA 1DJZA 2MA2A 2M3WA 5HKYA 1PSBA 2MJWB 2CCMA 3BUXB 5KTYA 3JTDB 3CS1A 1YR5A 2JPTA 4AQIA 1WY9A 1CTRA 1AJ4A 1IQ5A 1S36A 2JNXA 4MEWA 3AAKA 4TNCA 2V53A 4GGNA 1AJ5A 2BE4A 3EK4A 3TUYB 1QIWA 3OHMB 1FI5A 2NLNA 4JPZB 1Y1XA 1B7TY 2BCAA 5HLOA 5JJGA 2JQ6A 2LVJA 4GNKB 5F6TA 1Y1AA 1F55A 3GOFA 1F4OA 4HSZA 2MBXA 2KFGA 2HF5A 3H4SE 1TOPA 2JNFA 2LP2A 2M29A 4M2PA 1M39A 1CMGA 3DVKA 5B8IB 3C1VA 4IL1A 1A29A 1KQMC 2K7BA 4PALA 2GV5A 2KQ6A 2JTZA 4MN0A 5D7FA 1BR4B 2M8UA 1B8LA 1XFWO 2I94A 3KF9A 1SBJA 4MZJA 3PN7C 1CDPA 3JVTC 3PALA 4N1GA 1BG1A 2CXJA 1OMDA 2F2OA 3EVUA 1J55A 1BMOA 1MQ1A 2KI6C 1BT6A 1SCMB 2M7LA 2M7NA 2Q91A 4P5OE 1V1GA 1K95A 1NX0A 1S6CA 2PSRA 2WCEA 4GBAA 4AOMA 1SCMC 2LE9B 4NDBA 4MBEA 1NSHA 1NWDA 2M49B 1FBVA 4XYNA 5JOLA 3SG2A 4YGAA 3WHTB 2L2EA 1K94A 1H4BA 2KYCA 1SKTA 3IF7A
chains in the Genus database with same CATH superfamily
1ALWA 1BJFA 1C7WA 1EL4A 1WDCC 2KI4B 1PALA 1DJXA 4GGFC 2EGDA 3K1EA 5PALA 3PFVA 1JFKA 3FS7A 4F7FA 1DF0B 2NCOA 1NPQA 3QRXA 2WCMA 1F71A 2P71A 1YVLA 4U8DA 2BBNA 3BOWA 3IVTA 1DJYA 3CR2A 1CFFA 4C0JA 5DKRA 1QLKA 1TCOB 1IQ3A 1JC2A 1DGVA 2JULA 2BCBA 3NSOA 4PHJA 1DGUA 1PVAA 1QV1A 3B87A 1KCYA 1Z4HA 1QASA 2LMUA 2I18A 2MLEC 2LAPA 3CZ1A 4PE1A 2M1UA 3KO0A 3WXAA 1AVSA 3CR4X 1SRAA 3CZTX 3BXKA 1TN4A 2ZNDA 5TNCA 3CZ2A 2KHNA 2LMVA 1CLLA 1K93D 5EL2A 2FCEA 1K96A 2L50A 3CGAA 5K89A 1KFXS 1CMFA 2O5GA 3PATA 1KSOA 2CBLA 2M1KB 1F70A 3CABA 2O60A 1YUUA 2BL0B 4XJKA 2OPOA 1N2DA 4GAOA 2KFFA 2QPTA 3BUNB 1IGVA 1YUSA 2B1UA 3SIAA 2QEBA 1SK6D 4ORCB 5HLVA 1OZSA 2JXCA 5KSZA 4ZCUA 1CB1A 2WNDA 1DMOA 1B7TZ 2I7AA 2PASA 5DICA 1S6JA 2NZ0A 3WHUB 3O4XA 3SJSA 1NCYA 3QMEA 4JKTA 1XA5A 2LLSA 1SCVA 2WOSA 3OBVA 2BBMA 3B6XA 3I5IB 1B8RA 3FWCA 4YI9A 1J7RA 4QJ5B 3VRQA 4HRHA 1G4YR 3ZWHA 1A03A 1ALVA 3LK0A 1BODA 2AAOA 1TRFA 1F4QA 1OOGA 1UUSA 3SG7A 2ISDA 3SS5A 1QXPA 2VRGA 1QLSA 5AXIA 2IS9A 4DIRA 3RZSA 2KOTA 1AHRA 1KSMA 1OMVA 1VRKA 2WCKA 1CFDA 1MHOA 1DJHA 2P70A 4INWA 2DOQA 3BOWB 2SASA 1GGZA 4WQ3A 4MRYA 5HYDA 1M31A 2EC6C 3CZ0A 1C07A 1F8HA 3I5GB 3R1PA 4ICBA 1UP5A 1XFYO 1YUTA 5I2LA 4OKHA 1OMRA 3OX5A 3AKBA 2F3YA 1YRTB 2GGZA 4I5JA 3E3RA 3SIBA 1NX3A 1MR8A 2LV7A 3JTDC 3O2PA 5DKQA 4R1EA 1ZFSA 1MXEA 1SMGA 3S0EA 4ETOA 1XK4A 3UNWA 1OQPA 2G2BA 1JF2A 1NUBA 5CPVA 3BFHA 3FWBA 5D69A 5I2OA 4M2QA 3D77A 3IQQA 3LK1A 3EKHA 3NGVA 4YI8A 3TUYC 3EVVA 5D3OA 1W7IB 1IKUA 1L2OB 2PQLA 4YGDB 1LS8A 1T14A 2LVVA 1QX5B 1XVJA 1WRZA 4OVNF 1OOJA 3FE6A 1J7QA 3D10A 1CDMA 1A4PA 2LC5A 3DF0B 4OZDA 3GK4X 3NSKA 3D0YA 4YGEB 4F0ZB 4GUKA 1H8BA 1Q80A 1ORGA 3EK8A 4IJ7A 1XFXO 2K0JA 5GQQC 5KU1A 1EG4A 2JOJA 2M9GA 3B7AA 2M0RA 2KI6D 3PLFB 3RLZA 2WCBA 4MVFA 2KYFA 2QEVA 2ZRTA 2LCPA 1B47A 3KHEA 2KNEA 2OS8B 3MSEB 1C3ZA 3A4UB 3CLNA 4OV2A 5FI6A 2LP3A 1DELA 1OW4A 3UO9A 3N7HA 1WLMA 3TS5B 1JSAA 1SR6B 4E68A 2JT8A 2KGRA 3IQOA 2FJUB 1UHHA 4MZKA 3CR5X 3CYZA 2FCDA 1ZMZA 3BYAA 1PVBA 2MLFC 3GK1A 1TWOA 2AMIA 3SS3A 2SCPA 1FI6A 2KQYA 4PE7A 2H61A 3NHIA 1NX2A 1ZACA 4N5XA 1FPWA 4I5NB 2ZFDA 3LCPC 4P2YB 3TZ1A 1M63B 1BF5A 1KK7Z 4FQOA 4I5LB 2KI4C 2BKHB 2KLDA 2P6BB 5G08A 1Y0VH 1B9AA 1M46A 3S0AA 1NCXA 5CSJA 1DJWA 1TNXA 2BECA 3DY9A 1IRJA 4CFRA 3NHTA 2LUXA 4CFQA 1XFUO 1TIZA 3CDNA 2CTNA 2BNXA 1YURA 1RTP1 1NYAA 2KFHA 2WCJA 2L98A 3DXLA 4CPVA 1AP4A 1P28A 1KFUS 4OCIA 1UHKA 4OR9B 2H2KA 5DKNA 3D78A 4A4CA 4DUQA 5I2QA 2HQ8A 2RGIA 2WC6A 2NXQA 1SL7A 1MWNA 3KPXA 2A4JA 1W9ZA 3K21A 1W7JB 2QEHA 1KK8B 3SG4A 2F8PA 1C7VA 1G33A 2BAPA 4QJ3B 3BJHA 1AUIB 1Z2CB 1JWDA 1PRWA 1OOFA 2FOTA 4YGCB 3A8RA 2BL0C 1UWOA 2QDIA 3I5HB 2PMYA 3O78A 2E6WA 4M2OA 2K7DA 5CSFA 1RECA 1JFJA 2L51A 1SPYA 1K8UA 1KK7Y 5FI2A 1WLZA 1IJ5A 4BY4A 1DT7B 1TNWA 1F54A 1PULA 1J7PA 2WC8A 3EVRA 1KWOB 4PHMA 1HQVA 3I5FB 3I5IC 3TDZA 5AANA 2HETA 1IJ6A 1UHJA 4C0LA 4PCWA 1KFXL 1J1EA 2LLUA 1UHIA 2M97A 1A75A 4L9MA 4NDCA 1NIWA 5AFPA 1KQVA 2HPSA 4CLNA 1OE9B 3L47A 1ZUZA 2BKIB 1LA3A 2L5XB 3SG6A 5I94A 4GFTA 1NP8A 1SL9A 2JT3A 2LVKA 1R2UA 1RK9A 1K9UA 3M0WA 3BQ3A 3NSLA 3PM8A 2LHIA 5I8NA 2QACA 3DVEA 4NDDA 5BPJA 2Q4UA 1XFVO 4DS7A 2ZRSA 5HL1A 1QATA 4A4BA 5IBWA 1CDLA 3VGOA 2F33A 2K61A 3DVJA 3I5GC 3ZNIA 4BY5A 1QJTA 2PALA 4C0KA 2KBIA 3VRPA 1CM1A 1QX2A 3S0DA 2JTTA 1V1FA 3O6BA 1B8CA 4ZCVA 1K9KA 2MHHA 1M45A 2H8VA 3DD4A 5ER4X 2BE6A 1OZOA 2WORA 1X02A 1G8IA 3FE8A 4AQJA 3AKAA 1EG3A 1J7OA 2NCPA 4XJKB 1ZOTB 3BUOB 3R72A 1CDNA 4GGFA 2K2AA 2ZN8A 5J3XA 3L4AA 1SL8A 2Y1NA 4USLA 4MLWA 1S3PA 4INXA 2F3ZA 1N0YA 1DJGA 4PE0A 1L2OC 4ORBB 1RJVA 3EKJA 3HX4A 5CSNA 1DJIA 3VRRA 1YTZC 1CFPA 1ODBA 2WCFA 4QJ4B 3LLEA 1DF0A 1IG5A 4I5KA 2CNPA 2TN4A 2KDHA 4ORAB 1JF0A 1XFRA 2JWWA 1FF1A 1QV0A 3VRNA 1IIOA 1IWQA 1EJ3A 2ZKMX 1IH0A 3B88A 5FYXA 1RROA 3BUMB 1YVHA 1YX8A 1U5IA 2L0PA 1AK8A 1EXRA 1MUXA 3S0FA 1SYMA 1LA0A 1A75B 2KAYA 4MRXA 4PDZA 2K2FA 4WRIA 1KQMB 4WQ2A 3VROA 4DCKA 2K60A 1GM0A 2QEOA 5HKZA 2OS8C 2JT0A 1TCFA 1OOIX 4MSPA 2JC2A 4DRWA 2LUCA 3PN7B 3TS5C 3OP0A 2FJYA 3JVTB 1SR6C 1XFZO 2LM5A 3NXAA 4D1EA 2D8NA 2K7OA 1OSAA 3NSIA 2KAVA 5FI7A 1LXFC 3BFAA 3OGNA 1TUZA 1TTXA 4FTGA 3TDUA 1LVCD 2MRDA 4KYNA 1HT9A 1TNQA 1B4CA 2JU0A 3DZTA 1S26D 3ICBA 1J1DA 1K9PA 1XO5A 3WNXB 4NQGA 2LLTA 2LHLA 2L4HA 1EH2A 3BUWB 2F2PA 3KEVA 1YRUB 2COLB 2LVIA 1BU3A 3B86A 4UPGA 3EK7A 1XK4C 3R1OA 1YX7A 1WDCB 3SG5A 1DC1A 1MXLC 1S6IA 4YBHB 4YGBB 2MAZA 1CLMA 4PHKA 1QIVA 2WC5A 3FIAA 3R1VA 4N1FA 1A2XA 4Q04A 4YRUA 1D1OA 2HQWA 5AERA 3TDIA 1B1GA 3O4YA 1RFJA 1PK0D 3D0YB 1CM4A 2PRUA 4PE4A 1FW4A 3OX6A 1QVIZ 1LKJA 2AUCA 1UHNA 2Y1MA 3BFBA 2ERBA 3HCMA 1OOHA 1L7ZA 1U5IB 1MF8B 4GPLB 2LANA 1S5GZ 1NX1A 1K90D 4HREE 1DEKA 1SNLA 1BOCA 1KK8C 1QWVA 2PYQA 3D76A 4PHNA 4JWQA 1UURA 1BR1B 2KGBC 2GGMA 2Y4QA 1DVIA 2K7CA 3FE9A 3OB2B 4MZLA 3RM1A 2ZNEA 2OTGB 2BCXA 5CSIA 5HKWA 2JZIA 1CNPA 3I5HC 5AEQA 3EG5B 1GQMA 1S1EA 1XYDA 2KSPA 2EHBA 3GK2A 1KFUL 1R6PA 2LNKA 1QS7A 2OTGC 2K8MB 3CTNA 3F45A 4FQTA 1CFCA 1QX7A 3LL8B 1LINA 1WRLA 1KWOC 2G9BA 3OB1B 1SW8A 1RWYA 2H61C 3I5FC 3DVMA 4JQ0D 2CT9A 2E30A 1BLQA 2KBMA 1JUOA 3AAJA 2KLEA 1N65A 3PM2A 5ER5A 1Y6WA 1JBAA 3DF0A 1GGWA 1SY9A 2JRFA 2JXLA 1GJYA 1SSEB 2LMTA 1TNPA 1E8AA 2ZN9A 1QVIY 4JD9A 2GTEA 2PVBA 4HRGA 1Y1UA 1PSRA 1DQEA 1DTLA 1NCZA 1QTXA 2KAXA 2R2IA 3D74A 2I2RE 2Y5IA 4CIDA 1CLBA 1S5GY 3SG3A 2EC6B 3D75A 1K2HA 2L4IA 3PSRA 1WRKA 1CKKA 3CWGA 1DJZA 2MA2A 2M3WA 5HKYA 1PSBA 2MJWB 2CCMA 3BUXB 5KTYA 3D73A 3JTDB 3L4LA 3CS1A 3Q8IA 1YR5A 2YGUA 2JPTA 4AQIA 1WY9A 2L2CA 1CTRA 2WCHA 1AJ4A 2JPOA 3SS4A 1IQ5A 1S36A 2JNXA 4MEWA 3AAKA 4TNCA 2V53A 4GGNA 1AJ5A 2BE4A 3EK4A 3TUYB 1QIWA 3OHMB 1FI5A 2NLNA 3DYEA 4JPZB 4PT1A 3V2LA 1Y1XA 1B7TY 2BCAA 5HLOA 5JJGA 2JQ6A 3VB1A 2LVJA 4GNKB 5F6TA 1Y1AA 1F55A 3GOFA 1F4OA 4HSZA 2MBXA 2KFGA 2HF5A 3H4SE 1TOPA 2JNFA 2LP2A 2M29A 4M2PA 1M39A 1CMGA 3DVKA 5B8IB 3C1VA 4IL1A 1A29A 1KQMC 2K7BA 4PALA 2GV5A 2KQ6A 3PJIA 2JTZA 4MN0A 2WCLA 5D7FA 1BR4B 2M8UA 1B8LA 1XFWO 2I94A 3KF9A 1SBJA 4MZJA 3PN7C 1CDPA 3JVTC 3PALA 2KPHA 4N1GA 1BG1A 2CXJA 1OMDA 2F2OA 2L5YA 3EVUA 1J55A 1BMOA 1MQ1A 2KI6C 1BT6A 1SCMB 2M7LA 2M7NA 3S0BA 2Q91A 4P5OE 1V1GA 1K95A 1NX0A 1S6CA 2PSRA 2WCEA 4GBAA 4AOMA 3S0GA 1SCMC 1TUJA 2LE9B 4MBEA 4NDBA 1C3YA 1NSHA 1NWDA 2M49B 1FBVA 4XYNA 5JOLA 3SG2A 4YGAA 3WHTB 2L2EA 1K94A 1H4BA 2KYCA 1SKTA 3IF7A
chains in the Genus database with same CATH topology
1ALWA 1BJFA 1C7WA 1EL4A 1WDCC 2KI4B 1PALA 1DJXA 4GGFC 2EGDA 5PALA 3PFVA 1JFKA 3FS7A 1DF0B 2NCOA 1NPQA 3QRXA 1F71A 1YVLA 4U8DA 2BBNA 3BOWA 1DJYA 3CR2A 1CFFA 4C0JA 5DKRA 1QLKA 1TCOB 1IQ3A 1JC2A 1DGVA 2JULA 2BCBA 3NSOA 4PHJA 1DGUA 1PVAA 1QV1A 1KCYA 1QASA 2LMUA 2I18A 2MLEC 2LAPA 4PE1A 2M1UA 3KO0A 3WXAA 1AVSA 3CR4X 1SRAA 3CZTX 3BXKA 1TN4A 2ZNDA 5TNCA 2KHNA 2LMVA 1CLLA 1K93D 2FCEA 1K96A 2L50A 3CGAA 5K89A 1KFXS 1CMFA 2O5GA 3PATA 1KSOA 2CBLA 2M1KB 1F70A 2O60A 1YUUA 2BL0B 4XJKA 2OPOA 1N2DA 4GAOA 2KFFA 2QPTA 3BUNB 1IGVA 1YUSA 2B1UA 3SIAA 5HLVA 1SK6D 4ORCB 1OZSA 2JXCA 5KSZA 4ZCUA 1CB1A 2WNDA 1DMOA 1B7TZ 2I7AA 2PASA 1S6JA 2NZ0A 3WHUB 3SJSA 1NCYA 1XA5A 2LLSA 1SCVA 2WOSA 2BBMA 3I5IB 1B8RA 3FWCA 4YI9A 1J7RA 4QJ5B 3VRQA 4HRHA 1G4YR 3ZWHA 1A03A 1ALVA 3LK0A 1BODA 2AAOA 1TRFA 1F4QA 1UUSA 3SG7A 2ISDA 1QXPA 2VRGA 1QLSA 5AXIA 2IS9A 4DIRA 2KOTA 1AHRA 1KSMA 1OMVA 1VRKA 1CFDA 1MHOA 1DJHA 2DOQA 3BOWB 2SASA 1GGZA 4WQ3A 4MRYA 5HYDA 1M31A 2EC6C 1C07A 1F8HA 3I5GB 4ICBA 1UP5A 1XFYO 1YUTA 5I2LA 4OKHA 1OMRA 3OX5A 3AKBA 2F3YA 1YRTB 2GGZA 4I5JA 3E3RA 3SIBA 1NX3A 1MR8A 2LV7A 3JTDC 3O2PA 5DKQA 4R1EA 1ZFSA 1MXEA 1SMGA 4ETOA 1XK4A 1OQPA 2G2BA 1JF2A 1NUBA 5CPVA 3FWBA 5D69A 5I2OA 4M2QA 3IQQA 3LK1A 3EKHA 4YI8A 3TUYC 3EVVA 1W7IB 1IKUA 1L2OB 4YGDB 2LVVA 1QX5B 1XVJA 1WRZA 4OVNF 1OOJA 1J7QA 3D10A 1CDMA 1A4PA 2LC5A 3DF0B 4F0ZB 3GK4X 3NSKA 3D0YA 4YGEB 1H8BA 4GUKA 1Q80A 3EK8A 1XFXO 2K0JA 5GQQC 5KU1A 1EG4A 2JOJA 2M9GA 2M0RA 2KI6D 3PLFB 3RLZA 2WCBA 4MVFA 2KYFA 2ZRTA 2LCPA 1B47A 3KHEA 2KNEA 2OS8B 3MSEB 3CLNA 3A4UB 4OV2A 2LP3A 1JSAA 3TS5B 1WLMA 1SR6B 4E68A 2JT8A 2KGRA 3IQOA 2FJUB 1UHHA 4MZKA 3CR5X 2FCDA 1ZMZA 3BYAA 1PVBA 2MLFC 3GK1A 2AMIA 2SCPA 1FI6A 2KQYA 4PE7A 2H61A 1NX2A 1ZACA 4N5XA 1FPWA 4I5NB 2ZFDA 3LCPC 4P2YB 3TZ1A 1M63B 1BF5A 1KK7Z 4FQOA 4I5LB 2KI4C 2BKHB 2P6BB 5G08A 1Y0VH 1B9AA 1M46A 1NCXA 5CSJA 1DJWA 1TNXA 2BECA 1IRJA 4CFRA 4CFQA 2LUXA 1XFUO 1TIZA 2CTNA 1YURA 1RTP1 1NYAA 2KFHA 2L98A 4CPVA 1AP4A 1KFUS 4OCIA 1UHKA 4OR9B 2H2KA 5DKNA 4A4CA 4DUQA 5I2QA 2HQ8A 2RGIA 2NXQA 1SL7A 1MWNA 3KPXA 2A4JA 3K21A 1W7JB 1KK8B 3SG4A 2F8PA 1C7VA 1G33A 1JWDA 4QJ3B 1AUIB 1PRWA 2FOTA 4YGCB 3A8RA 2BL0C 1UWOA 3I5HB 2PMYA 3O78A 2E6WA 4M2OA 2K7DA 5CSFA 1RECA 1JFJA 2L51A 1SPYA 1K8UA 1KK7Y 1F54A 1WLZA 1IJ5A 4BY4A 1DT7B 1TNWA 1PULA 1J7PA 2WC8A 3EVRA 1KWOB 4PHMA 1HQVA 3I5FB 3I5IC 3TDZA 5AANA 2HETA 1IJ6A 1UHJA 4C0LA 4PCWA 1KFXL 1J1EA 2LLUA 1UHIA 2M97A 1A75A 4L9MA 4NDCA 1NIWA 5AFPA 1KQVA 2HPSA 4CLNA 1OE9B 3SG6A 1ZUZA 2BKIB 1LA3A 2L5XB 4GFTA 1NP8A 1SL9A 2JT3A 2LVKA 1R2UA 1RK9A 1K9UA 3M0WA 3BQ3A 3NSLA 3PM8A 2LHIA 5I8NA 2QACA 3DVEA 4NDDA 5BPJA 2Q4UA 1XFVO 4DS7A 2ZRSA 1QATA 4A4BA 5IBWA 1CDLA 3VGOA 2F33A 2K61A 3DVJA 3I5GC 3ZNIA 4BY5A 1QJTA 2PALA 4C0KA 2KBIA 3VRPA 1CM1A 1QX2A 2JTTA 1V1FA 3O6BA 1B8CA 4ZCVA 1K9KA 2MHHA 1M45A 3DD4A 5ER4X 2BE6A 1OZOA 2WORA 1X02A 1G8IA 4AQJA 3AKAA 1EG3A 1J7OA 2NCPA 4XJKB 1ZOTB 3BUOB 1CDNA 4GGFA 2K2AA 2ZN8A 5J3XA 1SL8A 2Y1NA 4USLA 4MLWA 1S3PA 2F3ZA 1N0YA 1DJGA 4PE0A 1L2OC 4ORBB 1RJVA 3EKJA 3HX4A 5CSNA 1DJIA 3VRRA 1YTZC 1CFPA 1ODBA 2WCFA 4QJ4B 3LLEA 1DF0A 1IG5A 4I5KA 2CNPA 2TN4A 2KDHA 4ORAB 1JF0A 2JWWA 1FF1A 1QV0A 3VRNA 1IWQA 1EJ3A 2ZKMX 1IH0A 5FYXA 1RROA 3BUMB 1YVHA 1YX8A 1U5IA 2L0PA 1AK8A 1EXRA 1MUXA 1SYMA 1LA0A 1A75B 2KAYA 4MRXA 4PDZA 2K2FA 4WRIA 1KQMB 4WQ2A 3VROA 4DCKA 5HKZA 2OS8C 2JT0A 1TCFA 4MSPA 2JC2A 4DRWA 2LUCA 3PN7B 3TS5C 3OP0A 3JVTB 1SR6C 1XFZO 2LM5A 3NXAA 4D1EA 2D8NA 2K7OA 1OSAA 3NSIA 2KAVA 1LXFC 4FTGA 1TTXA 3TDUA 1LVCD 2MRDA 1HT9A 1TNQA 1B4CA 2JU0A 1S26D 3ICBA 1J1DA 1K9PA 1XO5A 3WNXB 4NQGA 2LLTA 2LHLA 2L4HA 1EH2A 3BUWB 2F2PA 3KEVA 1YRUB 2COLB 2LVIA 1BU3A 4UPGA 3EK7A 1XK4C 1YX7A 1WDCB 3SG5A 1MXLC 1S6IA 4YBHB 4YGBB 2MAZA 1CLMA 4PHKA 1QIVA 4YRUA 3FIAA 4N1FA 1A2XA 4Q04A 1D1OA 2HQWA 5AERA 3TDIA 1B1GA 3O4YA 1RFJA 1PK0D 3D0YB 1CM4A 2PRUA 4PE4A 1FW4A 3OX6A 1QVIZ 1LKJA 2AUCA 1UHNA 2Y1MA 3HCMA 1L7ZA 1U5IB 1MF8B 4GPLB 2LANA 1S5GZ 1NX1A 1K90D 4HREE 1SNLA 1BOCA 1KK8C 4PHNA 4JWQA 1UURA 1BR1B 2KGBC 2GGMA 2Y4QA 1DVIA 2K7CA 3OB2B 4MZLA 3RM1A 2ZNEA 2OTGB 2BCXA 5CSIA 5HKWA 2JZIA 1CNPA 3I5HC 5AEQA 1GQMA 1S1EA 1XYDA 2KSPA 2EHBA 3GK2A 1KFUL 1R6PA 2LNKA 1QS7A 2OTGC 2K8MB 3CTNA 3F45A 1CFCA 1QX7A 3LL8B 1LINA 1WRLA 1KWOC 2G9BA 3OB1B 1SW8A 1RWYA 2H61C 3I5FC 3DVMA 4JQ0D 2CT9A 2E30A 1BLQA 2KBMA 1JUOA 3AAJA 1N65A 5ER5A 1Y6WA 1JBAA 3DF0A 1GGWA 1SY9A 2JRFA 2JXLA 1GJYA 2LMTA 1TNPA 1E8AA 2ZN9A 1QVIY 2PVBA 4HRGA 1Y1UA 1PSRA 1DTLA 1NCZA 1QTXA 2KAXA 2R2IA 2I2RE 2Y5IA 4CIDA 1CLBA 1S5GY 3SG3A 2EC6B 1K2HA 2L4IA 3PSRA 1WRKA 1CKKA 3CWGA 1DJZA 2MA2A 2M3WA 5HKYA 1PSBA 2MJWB 2CCMA 3BUXB 5KTYA 3JTDB 3CS1A 1YR5A 2JPTA 4AQIA 1WY9A 1CTRA 1AJ4A 1IQ5A 1S36A 2JNXA 4MEWA 3AAKA 4TNCA 2V53A 4GGNA 1AJ5A 2BE4A 3EK4A 3TUYB 1QIWA 3OHMB 1FI5A 2NLNA 4JPZB 1Y1XA 1B7TY 2BCAA 5HLOA 5JJGA 2JQ6A 2LVJA 4GNKB 5F6TA 1Y1AA 1F55A 3GOFA 1F4OA 4HSZA 2MBXA 2KFGA 2HF5A 3H4SE 1TOPA 2JNFA 2LP2A 2M29A 4M2PA 1M39A 1CMGA 3DVKA 5B8IB 3C1VA 4IL1A 1A29A 1KQMC 2K7BA 4PALA 2GV5A 2KQ6A 2JTZA 4MN0A 5D7FA 1BR4B 2M8UA 1B8LA 1XFWO 2I94A 3KF9A 1SBJA 4MZJA 3PN7C 1CDPA 3JVTC 3PALA 4N1GA 1BG1A 2CXJA 1OMDA 2F2OA 3EVUA 1J55A 1BMOA 1MQ1A 2KI6C 1BT6A 1SCMB 2M7LA 2M7NA 2Q91A 4P5OE 1V1GA 1K95A 1NX0A 1S6CA 2PSRA 2WCEA 4GBAA 4AOMA 1SCMC 2LE9B 4NDBA 4MBEA 1NSHA 1NWDA 2M49B 1FBVA 4XYNA 5JOLA 3SG2A 4YGAA 3WHTB 2L2EA 1K94A 1H4BA 2KYCA 1SKTA 3IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALW A;  1BJF A;  1C7W A;  1EL4 A;  1WDC C;  2KI4 B;  1PAL A;  1DJX A;  4GGF C;  2EGD A;  5PAL A;  3PFV A;  1JFK A;  3FS7 A;  1DF0 B;  2NCO A;  1NPQ A;  3QRX A;  1F71 A;  1YVL A;  4U8D A;  2BBN A;  3BOW A;  1DJY A;  3CR2 A;  1CFF A;  4C0J A;  5DKR A;  1QLK A;  1TCO B;  1IQ3 A;  1JC2 A;  1DGV A;  2JUL A;  2BCB A;  3NSO A;  4PHJ A;  1DGU A;  1PVA A;  1QV1 A;  1KCY A;  1QAS A;  2LMU A;  2I18 A;  2MLE C;  2LAP A;  4PE1 A;  2M1U A;  3KO0 A;  3WXA A;  1AVS A;  3CR4 X;  1SRA A;  3CZT X;  3BXK A;  1TN4 A;  2ZND A;  5TNC A;  2KHN A;  2LMV A;  1CLL A;  1K93 D;  2FCE A;  1K96 A;  2L50 A;  3CGA A;  5K89 A;  1KFX S;  1CMF A;  2O5G A;  3PAT A;  1KSO A;  2CBL A;  2M1K B;  1F70 A;  2O60 A;  1YUU A;  2BL0 B;  4XJK A;  2OPO A;  1N2D A;  4GAO A;  2KFF A;  2QPT A;  3BUN B;  1IGV A;  1YUS A;  2B1U A;  3SIA A;  5HLV A;  1SK6 D;  4ORC B;  1OZS A;  2JXC A;  5KSZ A;  4ZCU A;  1CB1 A;  2WND A;  1DMO A;  1B7T Z;  2I7A A;  2PAS A;  1S6J A;  2NZ0 A;  3WHU B;  3SJS A;  1NCY A;  1XA5 A;  2LLS A;  1SCV A;  2WOS A;  2BBM A;  3I5I B;  1B8R A;  3FWC A;  4YI9 A;  1J7R A;  4QJ5 B;  3VRQ A;  4HRH A;  1G4Y R;  3ZWH A;  1A03 A;  1ALV A;  3LK0 A;  1BOD A;  2AAO A;  1TRF A;  1F4Q A;  1UUS A;  3SG7 A;  2ISD A;  1QXP A;  2VRG A;  1QLS A;  5AXI A;  2IS9 A;  4DIR A;  2KOT A;  1AHR A;  1KSM A;  1OMV A;  1VRK A;  1CFD A;  1MHO A;  1DJH A;  2DOQ A;  3BOW B;  2SAS A;  1GGZ A;  4WQ3 A;  4MRY A;  5HYD A;  1M31 A;  2EC6 C;  1C07 A;  1F8H A;  3I5G B;  4ICB A;  1UP5 A;  1XFY O;  1YUT A;  5I2L A;  4OKH A;  1OMR A;  3OX5 A;  3AKB A;  2F3Y A;  1YRT B;  2GGZ A;  4I5J A;  3E3R A;  3SIB A;  1NX3 A;  1MR8 A;  2LV7 A;  3JTD C;  3O2P A;  5DKQ A;  4R1E A;  1ZFS A;  1MXE A;  1SMG A;  4ETO A;  1XK4 A;  1OQP A;  2G2B A;  1JF2 A;  1NUB A;  5CPV A;  3FWB A;  5D69 A;  5I2O A;  4M2Q A;  3IQQ A;  3LK1 A;  3EKH A;  4YI8 A;  3TUY C;  3EVV A;  1W7I B;  1IKU A;  1L2O B;  4YGD B;  2LVV A;  1QX5 B;  1XVJ A;  1WRZ A;  4OVN F;  1OOJ A;  1J7Q A;  3D10 A;  1CDM A;  1A4P A;  2LC5 A;  3DF0 B;  4F0Z B;  3GK4 X;  3NSK A;  3D0Y A;  4YGE B;  1H8B A;  4GUK A;  1Q80 A;  3EK8 A;  1XFX O;  2K0J A;  5GQQ C;  5KU1 A;  1EG4 A;  2JOJ A;  2M9G A;  2M0R A;  2KI6 D;  3PLF B;  3RLZ A;  2WCB A;  4MVF A;  2KYF A;  2ZRT A;  2LCP A;  1B47 A;  3KHE A;  2KNE A;  2OS8 B;  3MSE B;  3CLN A;  3A4U B;  4OV2 A;  2LP3 A;  1JSA A;  3TS5 B;  1WLM A;  1SR6 B;  4E68 A;  2JT8 A;  2KGR A;  3IQO A;  2FJU B;  1UHH A;  4MZK A;  3CR5 X;  2FCD A;  1ZMZ A;  3BYA A;  1PVB A;  2MLF C;  3GK1 A;  2AMI A;  2SCP A;  1FI6 A;  2KQY A;  4PE7 A;  2H61 A;  1NX2 A;  1ZAC A;  4N5X A;  1FPW A;  4I5N B;  2ZFD A;  3LCP C;  4P2Y B;  3TZ1 A;  1M63 B;  1BF5 A;  1KK7 Z;  4FQO A;  4I5L B;  2KI4 C;  2BKH B;  2P6B B;  5G08 A;  1Y0V H;  1B9A A;  1M46 A;  1NCX A;  5CSJ A;  1DJW A;  1TNX A;  2BEC A;  1IRJ A;  4CFR A;  4CFQ A;  2LUX A;  1XFU O;  1TIZ A;  2CTN A;  1YUR A;  1RTP 1;  1NYA A;  2KFH A;  2L98 A;  4CPV A;  1AP4 A;  1KFU S;  4OCI A;  1UHK A;  4OR9 B;  2H2K A;  5DKN A;  4A4C A;  4DUQ A;  5I2Q A;  2HQ8 A;  2RGI A;  2NXQ A;  1SL7 A;  1MWN A;  3KPX A;  2A4J A;  3K21 A;  1W7J B;  1KK8 B;  3SG4 A;  2F8P A;  1C7V A;  1G33 A;  1JWD A;  4QJ3 B;  1AUI B;  1PRW A;  2FOT A;  4YGC B;  3A8R A;  2BL0 C;  1UWO A;  3I5H B;  2PMY A;  3O78 A;  2E6W A;  4M2O A;  2K7D A;  5CSF A;  1REC A;  1JFJ A;  2L51 A;  1SPY A;  1K8U A;  1KK7 Y;  1F54 A;  1WLZ A;  1IJ5 A;  4BY4 A;  1DT7 B;  1TNW A;  1PUL A;  1J7P A;  2WC8 A;  3EVR A;  1KWO B;  4PHM A;  1HQV A;  3I5F B;  3I5I C;  3TDZ A;  5AAN A;  2HET A;  1IJ6 A;  1UHJ A;  4C0L A;  4PCW A;  1KFX L;  1J1E A;  2LLU A;  1UHI A;  2M97 A;  1A75 A;  4L9M A;  4NDC A;  1NIW A;  5AFP A;  1KQV A;  2HPS A;  4CLN A;  1OE9 B;  3SG6 A;  1ZUZ A;  2BKI B;  1LA3 A;  2L5X B;  4GFT A;  1NP8 A;  1SL9 A;  2JT3 A;  2LVK A;  1R2U A;  1RK9 A;  1K9U A;  3M0W A;  3BQ3 A;  3NSL A;  3PM8 A;  2LHI A;  5I8N A;  2QAC A;  3DVE A;  4NDD A;  5BPJ A;  2Q4U A;  1XFV O;  4DS7 A;  2ZRS A;  1QAT A;  4A4B A;  5IBW A;  1CDL A;  3VGO A;  2F33 A;  2K61 A;  3DVJ A;  3I5G C;  3ZNI A;  4BY5 A;  1QJT A;  2PAL A;  4C0K A;  2KBI A;  3VRP A;  1CM1 A;  1QX2 A;  2JTT A;  1V1F A;  3O6B A;  1B8C A;  4ZCV A;  1K9K A;  2MHH A;  1M45 A;  3DD4 A;  5ER4 X;  2BE6 A;  1OZO A;  2WOR A;  1X02 A;  1G8I A;  4AQJ A;  3AKA A;  1EG3 A;  1J7O A;  2NCP A;  4XJK B;  1ZOT B;  3BUO B;  1CDN A;  4GGF A;  2K2A A;  2ZN8 A;  5J3X A;  1SL8 A;  2Y1N A;  4USL A;  4MLW A;  1S3P A;  2F3Z A;  1N0Y A;  1DJG A;  4PE0 A;  1L2O C;  4ORB B;  1RJV A;  3EKJ A;  3HX4 A;  5CSN A;  1DJI A;  3VRR A;  1YTZ C;  1CFP A;  1ODB A;  2WCF A;  4QJ4 B;  3LLE A;  1DF0 A;  1IG5 A;  4I5K A;  2CNP A;  2TN4 A;  2KDH A;  4ORA B;  1JF0 A;  2JWW A;  1FF1 A;  1QV0 A;  3VRN A;  1IWQ A;  1EJ3 A;  2ZKM X;  1IH0 A;  5FYX A;  1RRO A;  3BUM B;  1YVH A;  1YX8 A;  1U5I A;  2L0P A;  1AK8 A;  1EXR A;  1MUX A;  1SYM A;  1LA0 A;  1A75 B;  2KAY A;  4MRX A;  4PDZ A;  2K2F A;  4WRI A;  1KQM B;  4WQ2 A;  3VRO A;  4DCK A;  5HKZ A;  2OS8 C;  2JT0 A;  1TCF A;  4MSP A;  2JC2 A;  4DRW A;  2LUC A;  3PN7 B;  3TS5 C;  3OP0 A;  3JVT B;  1SR6 C;  1XFZ O;  2LM5 A;  3NXA A;  4D1E A;  2D8N A;  2K7O A;  1OSA A;  3NSI A;  2KAV A;  1LXF C;  4FTG A;  1TTX A;  3TDU A;  1LVC D;  2MRD A;  1HT9 A;  1TNQ A;  1B4C A;  2JU0 A;  1S26 D;  3ICB A;  1J1D A;  1K9P A;  1XO5 A;  3WNX B;  4NQG A;  2LLT A;  2LHL A;  2L4H A;  1EH2 A;  3BUW B;  2F2P A;  3KEV A;  1YRU B;  2COL B;  2LVI A;  1BU3 A;  4UPG A;  3EK7 A;  1XK4 C;  1YX7 A;  1WDC B;  3SG5 A;  1MXL C;  1S6I A;  4YBH B;  4YGB B;  2MAZ A;  1CLM A;  4PHK A;  1QIV A;  4YRU A;  3FIA A;  4N1F A;  1A2X A;  4Q04 A;  1D1O A;  2HQW A;  5AER A;  3TDI A;  1B1G A;  3O4Y A;  1RFJ A;  1PK0 D;  3D0Y B;  1CM4 A;  2PRU A;  4PE4 A;  1FW4 A;  3OX6 A;  1QVI Z;  1LKJ A;  2AUC A;  1UHN A;  2Y1M A;  3HCM A;  1L7Z A;  1U5I B;  1MF8 B;  4GPL B;  2LAN A;  1S5G Z;  1NX1 A;  1K90 D;  4HRE E;  1SNL A;  1BOC A;  1KK8 C;  4PHN A;  4JWQ A;  1UUR A;  1BR1 B;  2KGB C;  2GGM A;  2Y4Q A;  1DVI A;  2K7C A;  3OB2 B;  4MZL A;  3RM1 A;  2ZNE A;  2OTG B;  2BCX A;  5CSI A;  5HKW A;  2JZI A;  1CNP A;  3I5H C;  5AEQ A;  1GQM A;  1S1E A;  1XYD A;  2KSP A;  2EHB A;  3GK2 A;  1KFU L;  1R6P A;  2LNK A;  1QS7 A;  2OTG C;  2K8M B;  3CTN A;  3F45 A;  1CFC A;  1QX7 A;  3LL8 B;  1LIN A;  1WRL A;  1KWO C;  2G9B A;  3OB1 B;  1SW8 A;  1RWY A;  2H61 C;  3I5F C;  3DVM A;  4JQ0 D;  2CT9 A;  2E30 A;  1BLQ A;  2KBM A;  1JUO A;  3AAJ A;  1N65 A;  5ER5 A;  1Y6W A;  1JBA A;  3DF0 A;  1GGW A;  1SY9 A;  2JRF A;  2JXL A;  1GJY A;  2LMT A;  1TNP A;  1E8A A;  2ZN9 A;  1QVI Y;  2PVB A;  4HRG A;  1Y1U A;  1PSR A;  1DTL A;  1NCZ A;  1QTX A;  2KAX A;  2R2I A;  2I2R E;  2Y5I A;  4CID A;  1CLB A;  1S5G Y;  3SG3 A;  2EC6 B;  1K2H A;  2L4I A;  3PSR A;  1WRK A;  1CKK A;  3CWG A;  1DJZ A;  2MA2 A;  2M3W A;  5HKY A;  1PSB A;  2MJW B;  2CCM A;  3BUX B;  5KTY A;  3JTD B;  3CS1 A;  1YR5 A;  2JPT A;  4AQI A;  1WY9 A;  1CTR A;  1AJ4 A;  1IQ5 A;  1S36 A;  2JNX A;  4MEW A;  3AAK A;  4TNC A;  2V53 A;  4GGN A;  1AJ5 A;  2BE4 A;  3EK4 A;  3TUY B;  1QIW A;  3OHM B;  1FI5 A;  2NLN A;  4JPZ B;  1Y1X A;  1B7T Y;  2BCA A;  5HLO A;  5JJG A;  2JQ6 A;  2LVJ A;  4GNK B;  5F6T A;  1Y1A A;  1F55 A;  3GOF A;  1F4O A;  4HSZ A;  2MBX A;  2KFG A;  2HF5 A;  3H4S E;  1TOP A;  2JNF A;  2LP2 A;  2M29 A;  4M2P A;  1M39 A;  1CMG A;  3DVK A;  5B8I B;  3C1V A;  4IL1 A;  1A29 A;  1KQM C;  2K7B A;  4PAL A;  2GV5 A;  2KQ6 A;  2JTZ A;  4MN0 A;  5D7F A;  1BR4 B;  2M8U A;  1B8L A;  1XFW O;  2I94 A;  3KF9 A;  1SBJ A;  4MZJ A;  3PN7 C;  1CDP A;  3JVT C;  3PAL A;  4N1G A;  1BG1 A;  2CXJ A;  1OMD A;  2F2O A;  3EVU A;  1J55 A;  1BMO A;  1MQ1 A;  2KI6 C;  1BT6 A;  1SCM B;  2M7L A;  2M7N A;  2Q91 A;  4P5O E;  1V1G A;  1K95 A;  1NX0 A;  1S6C A;  2PSR A;  2WCE A;  4GBA A;  4AOM A;  1SCM C;  2LE9 B;  4NDB A;  4MBE A;  1NSH A;  1NWD A;  2M49 B;  1FBV A;  4XYN A;  5JOL A;  3SG2 A;  4YGA A;  3WHT B;  2L2E A;  1K94 A;  1H4B A;  2KYC A;  1SKT A;  3IF7 A; 
#chains in the Genus database with same CATH topology
 1ALW A;  1BJF A;  1C7W A;  1EL4 A;  1WDC C;  2KI4 B;  1PAL A;  1DJX A;  4GGF C;  2EGD A;  3K1E A;  5PAL A;  3PFV A;  1JFK A;  3FS7 A;  4F7F A;  1DF0 B;  2NCO A;  1NPQ A;  3QRX A;  2WCM A;  1F71 A;  2P71 A;  1YVL A;  4U8D A;  2BBN A;  3BOW A;  3IVT A;  1DJY A;  3CR2 A;  1CFF A;  4C0J A;  5DKR A;  1QLK A;  1TCO B;  1IQ3 A;  1JC2 A;  1DGV A;  2JUL A;  2BCB A;  3NSO A;  4PHJ A;  1DGU A;  1PVA A;  1QV1 A;  3B87 A;  1KCY A;  1Z4H A;  1QAS A;  2LMU A;  2I18 A;  2MLE C;  2LAP A;  3CZ1 A;  4PE1 A;  2M1U A;  3KO0 A;  3WXA A;  1AVS A;  3CR4 X;  1SRA A;  3CZT X;  3BXK A;  1TN4 A;  2ZND A;  5TNC A;  3CZ2 A;  2KHN A;  2LMV A;  1CLL A;  1K93 D;  5EL2 A;  2FCE A;  1K96 A;  2L50 A;  3CGA A;  5K89 A;  1KFX S;  1CMF A;  2O5G A;  3PAT A;  1KSO A;  2CBL A;  2M1K B;  1F70 A;  3CAB A;  2O60 A;  1YUU A;  2BL0 B;  4XJK A;  2OPO A;  1N2D A;  4GAO A;  2KFF A;  2QPT A;  3BUN B;  1IGV A;  1YUS A;  2B1U A;  3SIA A;  2QEB A;  1SK6 D;  4ORC B;  5HLV A;  1OZS A;  2JXC A;  5KSZ A;  4ZCU A;  1CB1 A;  2WND A;  1DMO A;  1B7T Z;  2I7A A;  2PAS A;  5DIC A;  1S6J A;  2NZ0 A;  3WHU B;  3O4X A;  3SJS A;  1NCY A;  3QME A;  4JKT A;  1XA5 A;  2LLS A;  1SCV A;  2WOS A;  3OBV A;  2BBM A;  3B6X A;  3I5I B;  1B8R A;  3FWC A;  4YI9 A;  1J7R A;  4QJ5 B;  3VRQ A;  4HRH A;  1G4Y R;  3ZWH A;  1A03 A;  1ALV A;  3LK0 A;  1BOD A;  2AAO A;  1TRF A;  1F4Q A;  1OOG A;  1UUS A;  3SG7 A;  2ISD A;  3SS5 A;  1QXP A;  2VRG A;  1QLS A;  5AXI A;  2IS9 A;  4DIR A;  3RZS A;  2KOT A;  1AHR A;  1KSM A;  1OMV A;  1VRK A;  2WCK A;  1CFD A;  1MHO A;  1DJH A;  2P70 A;  4INW A;  2DOQ A;  3BOW B;  2SAS A;  1GGZ A;  4WQ3 A;  4MRY A;  5HYD A;  1M31 A;  2EC6 C;  3CZ0 A;  1C07 A;  1F8H A;  3I5G B;  3R1P A;  4ICB A;  1UP5 A;  1XFY O;  1YUT A;  5I2L A;  4OKH A;  1OMR A;  3OX5 A;  3AKB A;  2F3Y A;  1YRT B;  2GGZ A;  4I5J A;  3E3R A;  3SIB A;  1NX3 A;  1MR8 A;  2LV7 A;  3JTD C;  3O2P A;  5DKQ A;  4R1E A;  1ZFS A;  1MXE A;  1SMG A;  3S0E A;  4ETO A;  1XK4 A;  3UNW A;  1OQP A;  2G2B A;  1JF2 A;  1NUB A;  5CPV A;  3BFH A;  3FWB A;  5D69 A;  5I2O A;  4M2Q A;  3D77 A;  3IQQ A;  3LK1 A;  3EKH A;  3NGV A;  4YI8 A;  3TUY C;  3EVV A;  5D3O A;  1W7I B;  1IKU A;  1L2O B;  2PQL A;  4YGD B;  1LS8 A;  1T14 A;  2LVV A;  1QX5 B;  1XVJ A;  1WRZ A;  4OVN F;  1OOJ A;  3FE6 A;  1J7Q A;  3D10 A;  1CDM A;  1A4P A;  2LC5 A;  3DF0 B;  4OZD A;  3GK4 X;  3NSK A;  3D0Y A;  4YGE B;  4F0Z B;  4GUK A;  1H8B A;  1Q80 A;  1ORG A;  3EK8 A;  4IJ7 A;  1XFX O;  2K0J A;  5GQQ C;  5KU1 A;  1EG4 A;  2JOJ A;  2M9G A;  3B7A A;  2M0R A;  2KI6 D;  3PLF B;  3RLZ A;  2WCB A;  4MVF A;  2KYF A;  2QEV A;  2ZRT A;  2LCP A;  1B47 A;  3KHE A;  2KNE A;  2OS8 B;  3MSE B;  1C3Z A;  3A4U B;  3CLN A;  4OV2 A;  5FI6 A;  2LP3 A;  1DEL A;  1OW4 A;  3UO9 A;  3N7H A;  1WLM A;  3TS5 B;  1JSA A;  1SR6 B;  4E68 A;  2JT8 A;  2KGR A;  3IQO A;  2FJU B;  1UHH A;  4MZK A;  3CR5 X;  3CYZ A;  2FCD A;  1ZMZ A;  3BYA A;  1PVB A;  2MLF C;  3GK1 A;  1TWO A;  2AMI A;  3SS3 A;  2SCP A;  1FI6 A;  2KQY A;  4PE7 A;  2H61 A;  3NHI A;  1NX2 A;  1ZAC A;  4N5X A;  1FPW A;  4I5N B;  2ZFD A;  3LCP C;  4P2Y B;  3TZ1 A;  1M63 B;  1BF5 A;  1KK7 Z;  4FQO A;  4I5L B;  2KI4 C;  2BKH B;  2KLD A;  2P6B B;  5G08 A;  1Y0V H;  1B9A A;  1M46 A;  3S0A A;  1NCX A;  5CSJ A;  1DJW A;  1TNX A;  2BEC A;  3DY9 A;  1IRJ A;  4CFR A;  3NHT A;  2LUX A;  4CFQ A;  1XFU O;  1TIZ A;  3CDN A;  2CTN A;  2BNX A;  1YUR A;  1RTP 1;  1NYA A;  2KFH A;  2WCJ A;  2L98 A;  3DXL A;  4CPV A;  1AP4 A;  1P28 A;  1KFU S;  4OCI A;  1UHK A;  4OR9 B;  2H2K A;  5DKN A;  3D78 A;  4A4C A;  4DUQ A;  5I2Q A;  2HQ8 A;  2RGI A;  2WC6 A;  2NXQ A;  1SL7 A;  1MWN A;  3KPX A;  2A4J A;  1W9Z A;  3K21 A;  1W7J B;  2QEH A;  1KK8 B;  3SG4 A;  2F8P A;  1C7V A;  1G33 A;  2BAP A;  4QJ3 B;  3BJH A;  1AUI B;  1Z2C B;  1JWD A;  1PRW A;  1OOF A;  2FOT A;  4YGC B;  3A8R A;  2BL0 C;  1UWO A;  2QDI A;  3I5H B;  2PMY A;  3O78 A;  2E6W A;  4M2O A;  2K7D A;  5CSF A;  1REC A;  1JFJ A;  2L51 A;  1SPY A;  1K8U A;  1KK7 Y;  5FI2 A;  1WLZ A;  1IJ5 A;  4BY4 A;  1DT7 B;  1TNW A;  1F54 A;  1PUL A;  1J7P A;  2WC8 A;  3EVR A;  1KWO B;  4PHM A;  1HQV A;  3I5F B;  3I5I C;  3TDZ A;  5AAN A;  2HET A;  1IJ6 A;  1UHJ A;  4C0L A;  4PCW A;  1KFX L;  1J1E A;  2LLU A;  1UHI A;  2M97 A;  1A75 A;  4L9M A;  4NDC A;  1NIW A;  5AFP A;  1KQV A;  2HPS A;  4CLN A;  1OE9 B;  3L47 A;  1ZUZ A;  2BKI B;  1LA3 A;  2L5X B;  3SG6 A;  5I94 A;  4GFT A;  1NP8 A;  1SL9 A;  2JT3 A;  2LVK A;  1R2U A;  1RK9 A;  1K9U A;  3M0W A;  3BQ3 A;  3NSL A;  3PM8 A;  2LHI A;  5I8N A;  2QAC A;  3DVE A;  4NDD A;  5BPJ A;  2Q4U A;  1XFV O;  4DS7 A;  2ZRS A;  5HL1 A;  1QAT A;  4A4B A;  5IBW A;  1CDL A;  3VGO A;  2F33 A;  2K61 A;  3DVJ A;  3I5G C;  3ZNI A;  4BY5 A;  1QJT A;  2PAL A;  4C0K A;  2KBI A;  3VRP A;  1CM1 A;  1QX2 A;  3S0D A;  2JTT A;  1V1F A;  3O6B A;  1B8C A;  4ZCV A;  1K9K A;  2MHH A;  1M45 A;  2H8V A;  3DD4 A;  5ER4 X;  2BE6 A;  1OZO A;  2WOR A;  1X02 A;  1G8I A;  3FE8 A;  4AQJ A;  3AKA A;  1EG3 A;  1J7O A;  2NCP A;  4XJK B;  1ZOT B;  3BUO B;  3R72 A;  1CDN A;  4GGF A;  2K2A A;  2ZN8 A;  5J3X A;  3L4A A;  1SL8 A;  2Y1N A;  4USL A;  4MLW A;  1S3P A;  4INX A;  2F3Z A;  1N0Y A;  1DJG A;  4PE0 A;  1L2O C;  4ORB B;  1RJV A;  3EKJ A;  3HX4 A;  5CSN A;  1DJI A;  3VRR A;  1YTZ C;  1CFP A;  1ODB A;  2WCF A;  4QJ4 B;  3LLE A;  1DF0 A;  1IG5 A;  4I5K A;  2CNP A;  2TN4 A;  2KDH A;  4ORA B;  1JF0 A;  1XFR A;  2JWW A;  1FF1 A;  1QV0 A;  3VRN A;  1IIO A;  1IWQ A;  1EJ3 A;  2ZKM X;  1IH0 A;  3B88 A;  5FYX A;  1RRO A;  3BUM B;  1YVH A;  1YX8 A;  1U5I A;  2L0P A;  1AK8 A;  1EXR A;  1MUX A;  3S0F A;  1SYM A;  1LA0 A;  1A75 B;  2KAY A;  4MRX A;  4PDZ A;  2K2F A;  4WRI A;  1KQM B;  4WQ2 A;  3VRO A;  4DCK A;  2K60 A;  1GM0 A;  2QEO A;  5HKZ A;  2OS8 C;  2JT0 A;  1TCF A;  1OOI X;  4MSP A;  2JC2 A;  4DRW A;  2LUC A;  3PN7 B;  3TS5 C;  3OP0 A;  2FJY A;  3JVT B;  1SR6 C;  1XFZ O;  2LM5 A;  3NXA A;  4D1E A;  2D8N A;  2K7O A;  1OSA A;  3NSI A;  2KAV A;  5FI7 A;  1LXF C;  3BFA A;  3OGN A;  1TUZ A;  1TTX A;  4FTG A;  3TDU A;  1LVC D;  2MRD A;  4KYN A;  1HT9 A;  1TNQ A;  1B4C A;  2JU0 A;  3DZT A;  1S26 D;  3ICB A;  1J1D A;  1K9P A;  1XO5 A;  3WNX B;  4NQG A;  2LLT A;  2LHL A;  2L4H A;  1EH2 A;  3BUW B;  2F2P A;  3KEV A;  1YRU B;  2COL B;  2LVI A;  1BU3 A;  3B86 A;  4UPG A;  3EK7 A;  1XK4 C;  3R1O A;  1YX7 A;  1WDC B;  3SG5 A;  1DC1 A;  1MXL C;  1S6I A;  4YBH B;  4YGB B;  2MAZ A;  1CLM A;  4PHK A;  1QIV A;  2WC5 A;  3FIA A;  3R1V A;  4N1F A;  1A2X A;  4Q04 A;  4YRU A;  1D1O A;  2HQW A;  5AER A;  3TDI A;  1B1G A;  3O4Y A;  1RFJ A;  1PK0 D;  3D0Y B;  1CM4 A;  2PRU A;  4PE4 A;  1FW4 A;  3OX6 A;  1QVI Z;  1LKJ A;  2AUC A;  1UHN A;  2Y1M A;  3BFB A;  2ERB A;  3HCM A;  1OOH A;  1L7Z A;  1U5I B;  1MF8 B;  4GPL B;  2LAN A;  1S5G Z;  1NX1 A;  1K90 D;  4HRE E;  1DEK A;  1SNL A;  1BOC A;  1KK8 C;  1QWV A;  2PYQ A;  3D76 A;  4PHN A;  4JWQ A;  1UUR A;  1BR1 B;  2KGB C;  2GGM A;  2Y4Q A;  1DVI A;  2K7C A;  3FE9 A;  3OB2 B;  4MZL A;  3RM1 A;  2ZNE A;  2OTG B;  2BCX A;  5CSI A;  5HKW A;  2JZI A;  1CNP A;  3I5H C;  5AEQ A;  3EG5 B;  1GQM A;  1S1E A;  1XYD A;  2KSP A;  2EHB A;  3GK2 A;  1KFU L;  1R6P A;  2LNK A;  1QS7 A;  2OTG C;  2K8M B;  3CTN A;  3F45 A;  4FQT A;  1CFC A;  1QX7 A;  3LL8 B;  1LIN A;  1WRL A;  1KWO C;  2G9B A;  3OB1 B;  1SW8 A;  1RWY A;  2H61 C;  3I5F C;  3DVM A;  4JQ0 D;  2CT9 A;  2E30 A;  1BLQ A;  2KBM A;  1JUO A;  3AAJ A;  2KLE A;  1N65 A;  3PM2 A;  5ER5 A;  1Y6W A;  1JBA A;  3DF0 A;  1GGW A;  1SY9 A;  2JRF A;  2JXL A;  1GJY A;  1SSE B;  2LMT A;  1TNP A;  1E8A A;  2ZN9 A;  1QVI Y;  4JD9 A;  2GTE A;  2PVB A;  4HRG A;  1Y1U A;  1PSR A;  1DQE A;  1DTL A;  1NCZ A;  1QTX A;  2KAX A;  2R2I A;  3D74 A;  2I2R E;  2Y5I A;  4CID A;  1CLB A;  1S5G Y;  3SG3 A;  2EC6 B;  3D75 A;  1K2H A;  2L4I A;  3PSR A;  1WRK A;  1CKK A;  3CWG A;  1DJZ A;  2MA2 A;  2M3W A;  5HKY A;  1PSB A;  2MJW B;  2CCM A;  3BUX B;  5KTY A;  3D73 A;  3JTD B;  3L4L A;  3CS1 A;  3Q8I A;  1YR5 A;  2YGU A;  2JPT A;  4AQI A;  1WY9 A;  2L2C A;  1CTR A;  2WCH A;  1AJ4 A;  2JPO A;  3SS4 A;  1IQ5 A;  1S36 A;  2JNX A;  4MEW A;  3AAK A;  4TNC A;  2V53 A;  4GGN A;  1AJ5 A;  2BE4 A;  3EK4 A;  3TUY B;  1QIW A;  3OHM B;  1FI5 A;  2NLN A;  3DYE A;  4JPZ B;  4PT1 A;  3V2L A;  1Y1X A;  1B7T Y;  2BCA A;  5HLO A;  5JJG A;  2JQ6 A;  3VB1 A;  2LVJ A;  4GNK B;  5F6T A;  1Y1A A;  1F55 A;  3GOF A;  1F4O A;  4HSZ A;  2MBX A;  2KFG A;  2HF5 A;  3H4S E;  1TOP A;  2JNF A;  2LP2 A;  2M29 A;  4M2P A;  1M39 A;  1CMG A;  3DVK A;  5B8I B;  3C1V A;  4IL1 A;  1A29 A;  1KQM C;  2K7B A;  4PAL A;  2GV5 A;  2KQ6 A;  3PJI A;  2JTZ A;  4MN0 A;  2WCL A;  5D7F A;  1BR4 B;  2M8U A;  1B8L A;  1XFW O;  2I94 A;  3KF9 A;  1SBJ A;  4MZJ A;  3PN7 C;  1CDP A;  3JVT C;  3PAL A;  2KPH A;  4N1G A;  1BG1 A;  2CXJ A;  1OMD A;  2F2O A;  2L5Y A;  3EVU A;  1J55 A;  1BMO A;  1MQ1 A;  2KI6 C;  1BT6 A;  1SCM B;  2M7L A;  2M7N A;  3S0B A;  2Q91 A;  4P5O E;  1V1G A;  1K95 A;  1NX0 A;  1S6C A;  2PSR A;  2WCE A;  4GBA A;  4AOM A;  3S0G A;  1SCM C;  1TUJ A;  2LE9 B;  4MBE A;  4NDB A;  1C3Y A;  1NSH A;  1NWD A;  2M49 B;  1FBV A;  4XYN A;  5JOL A;  3SG2 A;  4YGA A;  3WHT B;  2L2E A;  1K94 A;  1H4B A;  2KYC A;  1SKT A;  3IF7 A; 
#chains in the Genus database with same CATH homology
 1ALW A;  1BJF A;  1C7W A;  1EL4 A;  1WDC C;  2KI4 B;  1PAL A;  1DJX A;  4GGF C;  2EGD A;  5PAL A;  3PFV A;  1JFK A;  3FS7 A;  1DF0 B;  2NCO A;  1NPQ A;  3QRX A;  1F71 A;  1YVL A;  4U8D A;  2BBN A;  3BOW A;  1DJY A;  3CR2 A;  1CFF A;  4C0J A;  5DKR A;  1QLK A;  1TCO B;  1IQ3 A;  1JC2 A;  1DGV A;  2JUL A;  2BCB A;  3NSO A;  4PHJ A;  1DGU A;  1PVA A;  1QV1 A;  1KCY A;  1QAS A;  2LMU A;  2I18 A;  2MLE C;  2LAP A;  4PE1 A;  2M1U A;  3KO0 A;  3WXA A;  1AVS A;  3CR4 X;  1SRA A;  3CZT X;  3BXK A;  1TN4 A;  2ZND A;  5TNC A;  2KHN A;  2LMV A;  1CLL A;  1K93 D;  2FCE A;  1K96 A;  2L50 A;  3CGA A;  5K89 A;  1KFX S;  1CMF A;  2O5G A;  3PAT A;  1KSO A;  2CBL A;  2M1K B;  1F70 A;  2O60 A;  1YUU A;  2BL0 B;  4XJK A;  2OPO A;  1N2D A;  4GAO A;  2KFF A;  2QPT A;  3BUN B;  1IGV A;  1YUS A;  2B1U A;  3SIA A;  5HLV A;  1SK6 D;  4ORC B;  1OZS A;  2JXC A;  5KSZ A;  4ZCU A;  1CB1 A;  2WND A;  1DMO A;  1B7T Z;  2I7A A;  2PAS A;  1S6J A;  2NZ0 A;  3WHU B;  3SJS A;  1NCY A;  1XA5 A;  2LLS A;  1SCV A;  2WOS A;  2BBM A;  3I5I B;  1B8R A;  3FWC A;  4YI9 A;  1J7R A;  4QJ5 B;  3VRQ A;  4HRH A;  1G4Y R;  3ZWH A;  1A03 A;  1ALV A;  3LK0 A;  1BOD A;  2AAO A;  1TRF A;  1F4Q A;  1UUS A;  3SG7 A;  2ISD A;  1QXP A;  2VRG A;  1QLS A;  5AXI A;  2IS9 A;  4DIR A;  2KOT A;  1AHR A;  1KSM A;  1OMV A;  1VRK A;  1CFD A;  1MHO A;  1DJH A;  2DOQ A;  3BOW B;  2SAS A;  1GGZ A;  4WQ3 A;  4MRY A;  5HYD A;  1M31 A;  2EC6 C;  1C07 A;  1F8H A;  3I5G B;  4ICB A;  1UP5 A;  1XFY O;  1YUT A;  5I2L A;  4OKH A;  1OMR A;  3OX5 A;  3AKB A;  2F3Y A;  1YRT B;  2GGZ A;  4I5J A;  3E3R A;  3SIB A;  1NX3 A;  1MR8 A;  2LV7 A;  3JTD C;  3O2P A;  5DKQ A;  4R1E A;  1ZFS A;  1MXE A;  1SMG A;  4ETO A;  1XK4 A;  1OQP A;  2G2B A;  1JF2 A;  1NUB A;  5CPV A;  3FWB A;  5D69 A;  5I2O A;  4M2Q A;  3IQQ A;  3LK1 A;  3EKH A;  4YI8 A;  3TUY C;  3EVV A;  1W7I B;  1IKU A;  1L2O B;  4YGD B;  2LVV A;  1QX5 B;  1XVJ A;  1WRZ A;  4OVN F;  1OOJ A;  1J7Q A;  3D10 A;  1CDM A;  1A4P A;  2LC5 A;  3DF0 B;  4F0Z B;  3GK4 X;  3NSK A;  3D0Y A;  4YGE B;  1H8B A;  4GUK A;  1Q80 A;  3EK8 A;  1XFX O;  2K0J A;  5GQQ C;  5KU1 A;  1EG4 A;  2JOJ A;  2M9G A;  2M0R A;  2KI6 D;  3PLF B;  3RLZ A;  2WCB A;  4MVF A;  2KYF A;  2ZRT A;  2LCP A;  1B47 A;  3KHE A;  2KNE A;  2OS8 B;  3MSE B;  3CLN A;  3A4U B;  4OV2 A;  2LP3 A;  1JSA A;  3TS5 B;  1WLM A;  1SR6 B;  4E68 A;  2JT8 A;  2KGR A;  3IQO A;  2FJU B;  1UHH A;  4MZK A;  3CR5 X;  2FCD A;  1ZMZ A;  3BYA A;  1PVB A;  2MLF C;  3GK1 A;  2AMI A;  2SCP A;  1FI6 A;  2KQY A;  4PE7 A;  2H61 A;  1NX2 A;  1ZAC A;  4N5X A;  1FPW A;  4I5N B;  2ZFD A;  3LCP C;  4P2Y B;  3TZ1 A;  1M63 B;  1BF5 A;  1KK7 Z;  4FQO A;  4I5L B;  2KI4 C;  2BKH B;  2P6B B;  5G08 A;  1Y0V H;  1B9A A;  1M46 A;  1NCX A;  5CSJ A;  1DJW A;  1TNX A;  2BEC A;  1IRJ A;  4CFR A;  4CFQ A;  2LUX A;  1XFU O;  1TIZ A;  2CTN A;  1YUR A;  1RTP 1;  1NYA A;  2KFH A;  2L98 A;  4CPV A;  1AP4 A;  1KFU S;  4OCI A;  1UHK A;  4OR9 B;  2H2K A;  5DKN A;  4A4C A;  4DUQ A;  5I2Q A;  2HQ8 A;  2RGI A;  2NXQ A;  1SL7 A;  1MWN A;  3KPX A;  2A4J A;  3K21 A;  1W7J B;  1KK8 B;  3SG4 A;  2F8P A;  1C7V A;  1G33 A;  1JWD A;  4QJ3 B;  1AUI B;  1PRW A;  2FOT A;  4YGC B;  3A8R A;  2BL0 C;  1UWO A;  3I5H B;  2PMY A;  3O78 A;  2E6W A;  4M2O A;  2K7D A;  5CSF A;  1REC A;  1JFJ A;  2L51 A;  1SPY A;  1K8U A;  1KK7 Y;  1F54 A;  1WLZ A;  1IJ5 A;  4BY4 A;  1DT7 B;  1TNW A;  1PUL A;  1J7P A;  2WC8 A;  3EVR A;  1KWO B;  4PHM A;  1HQV A;  3I5F B;  3I5I C;  3TDZ A;  5AAN A;  2HET A;  1IJ6 A;  1UHJ A;  4C0L A;  4PCW A;  1KFX L;  1J1E A;  2LLU A;  1UHI A;  2M97 A;  1A75 A;  4L9M A;  4NDC A;  1NIW A;  5AFP A;  1KQV A;  2HPS A;  4CLN A;  1OE9 B;  3SG6 A;  1ZUZ A;  2BKI B;  1LA3 A;  2L5X B;  4GFT A;  1NP8 A;  1SL9 A;  2JT3 A;  2LVK A;  1R2U A;  1RK9 A;  1K9U A;  3M0W A;  3BQ3 A;  3NSL A;  3PM8 A;  2LHI A;  5I8N A;  2QAC A;  3DVE A;  4NDD A;  5BPJ A;  2Q4U A;  1XFV O;  4DS7 A;  2ZRS A;  1QAT A;  4A4B A;  5IBW A;  1CDL A;  3VGO A;  2F33 A;  2K61 A;  3DVJ A;  3I5G C;  3ZNI A;  4BY5 A;  1QJT A;  2PAL A;  4C0K A;  2KBI A;  3VRP A;  1CM1 A;  1QX2 A;  2JTT A;  1V1F A;  3O6B A;  1B8C A;  4ZCV A;  1K9K A;  2MHH A;  1M45 A;  3DD4 A;  5ER4 X;  2BE6 A;  1OZO A;  2WOR A;  1X02 A;  1G8I A;  4AQJ A;  3AKA A;  1EG3 A;  1J7O A;  2NCP A;  4XJK B;  1ZOT B;  3BUO B;  1CDN A;  4GGF A;  2K2A A;  2ZN8 A;  5J3X A;  1SL8 A;  2Y1N A;  4USL A;  4MLW A;  1S3P A;  2F3Z A;  1N0Y A;  1DJG A;  4PE0 A;  1L2O C;  4ORB B;  1RJV A;  3EKJ A;  3HX4 A;  5CSN A;  1DJI A;  3VRR A;  1YTZ C;  1CFP A;  1ODB A;  2WCF A;  4QJ4 B;  3LLE A;  1DF0 A;  1IG5 A;  4I5K A;  2CNP A;  2TN4 A;  2KDH A;  4ORA B;  1JF0 A;  2JWW A;  1FF1 A;  1QV0 A;  3VRN A;  1IWQ A;  1EJ3 A;  2ZKM X;  1IH0 A;  5FYX A;  1RRO A;  3BUM B;  1YVH A;  1YX8 A;  1U5I A;  2L0P A;  1AK8 A;  1EXR A;  1MUX A;  1SYM A;  1LA0 A;  1A75 B;  2KAY A;  4MRX A;  4PDZ A;  2K2F A;  4WRI A;  1KQM B;  4WQ2 A;  3VRO A;  4DCK A;  5HKZ A;  2OS8 C;  2JT0 A;  1TCF A;  4MSP A;  2JC2 A;  4DRW A;  2LUC A;  3PN7 B;  3TS5 C;  3OP0 A;  3JVT B;  1SR6 C;  1XFZ O;  2LM5 A;  3NXA A;  4D1E A;  2D8N A;  2K7O A;  1OSA A;  3NSI A;  2KAV A;  1LXF C;  4FTG A;  1TTX A;  3TDU A;  1LVC D;  2MRD A;  1HT9 A;  1TNQ A;  1B4C A;  2JU0 A;  1S26 D;  3ICB A;  1J1D A;  1K9P A;  1XO5 A;  3WNX B;  4NQG A;  2LLT A;  2LHL A;  2L4H A;  1EH2 A;  3BUW B;  2F2P A;  3KEV A;  1YRU B;  2COL B;  2LVI A;  1BU3 A;  4UPG A;  3EK7 A;  1XK4 C;  1YX7 A;  1WDC B;  3SG5 A;  1MXL C;  1S6I A;  4YBH B;  4YGB B;  2MAZ A;  1CLM A;  4PHK A;  1QIV A;  4YRU A;  3FIA A;  4N1F A;  1A2X A;  4Q04 A;  1D1O A;  2HQW A;  5AER A;  3TDI A;  1B1G A;  3O4Y A;  1RFJ A;  1PK0 D;  3D0Y B;  1CM4 A;  2PRU A;  4PE4 A;  1FW4 A;  3OX6 A;  1QVI Z;  1LKJ A;  2AUC A;  1UHN A;  2Y1M A;  3HCM A;  1L7Z A;  1U5I B;  1MF8 B;  4GPL B;  2LAN A;  1S5G Z;  1NX1 A;  1K90 D;  4HRE E;  1SNL A;  1BOC A;  1KK8 C;  4PHN A;  4JWQ A;  1UUR A;  1BR1 B;  2KGB C;  2GGM A;  2Y4Q A;  1DVI A;  2K7C A;  3OB2 B;  4MZL A;  3RM1 A;  2ZNE A;  2OTG B;  2BCX A;  5CSI A;  5HKW A;  2JZI A;  1CNP A;  3I5H C;  5AEQ A;  1GQM A;  1S1E A;  1XYD A;  2KSP A;  2EHB A;  3GK2 A;  1KFU L;  1R6P A;  2LNK A;  1QS7 A;  2OTG C;  2K8M B;  3CTN A;  3F45 A;  1CFC A;  1QX7 A;  3LL8 B;  1LIN A;  1WRL A;  1KWO C;  2G9B A;  3OB1 B;  1SW8 A;  1RWY A;  2H61 C;  3I5F C;  3DVM A;  4JQ0 D;  2CT9 A;  2E30 A;  1BLQ A;  2KBM A;  1JUO A;  3AAJ A;  1N65 A;  5ER5 A;  1Y6W A;  1JBA A;  3DF0 A;  1GGW A;  1SY9 A;  2JRF A;  2JXL A;  1GJY A;  2LMT A;  1TNP A;  1E8A A;  2ZN9 A;  1QVI Y;  2PVB A;  4HRG A;  1Y1U A;  1PSR A;  1DTL A;  1NCZ A;  1QTX A;  2KAX A;  2R2I A;  2I2R E;  2Y5I A;  4CID A;  1CLB A;  1S5G Y;  3SG3 A;  2EC6 B;  1K2H A;  2L4I A;  3PSR A;  1WRK A;  1CKK A;  3CWG A;  1DJZ A;  2MA2 A;  2M3W A;  5HKY A;  1PSB A;  2MJW B;  2CCM A;  3BUX B;  5KTY A;  3JTD B;  3CS1 A;  1YR5 A;  2JPT A;  4AQI A;  1WY9 A;  1CTR A;  1AJ4 A;  1IQ5 A;  1S36 A;  2JNX A;  4MEW A;  3AAK A;  4TNC A;  2V53 A;  4GGN A;  1AJ5 A;  2BE4 A;  3EK4 A;  3TUY B;  1QIW A;  3OHM B;  1FI5 A;  2NLN A;  4JPZ B;  1Y1X A;  1B7T Y;  2BCA A;  5HLO A;  5JJG A;  2JQ6 A;  2LVJ A;  4GNK B;  5F6T A;  1Y1A A;  1F55 A;  3GOF A;  1F4O A;  4HSZ A;  2MBX A;  2KFG A;  2HF5 A;  3H4S E;  1TOP A;  2JNF A;  2LP2 A;  2M29 A;  4M2P A;  1M39 A;  1CMG A;  3DVK A;  5B8I B;  3C1V A;  4IL1 A;  1A29 A;  1KQM C;  2K7B A;  4PAL A;  2GV5 A;  2KQ6 A;  2JTZ A;  4MN0 A;  5D7F A;  1BR4 B;  2M8U A;  1B8L A;  1XFW O;  2I94 A;  3KF9 A;  1SBJ A;  4MZJ A;  3PN7 C;  1CDP A;  3JVT C;  3PAL A;  4N1G A;  1BG1 A;  2CXJ A;  1OMD A;  2F2O A;  3EVU A;  1J55 A;  1BMO A;  1MQ1 A;  2KI6 C;  1BT6 A;  1SCM B;  2M7L A;  2M7N A;  2Q91 A;  4P5O E;  1V1G A;  1K95 A;  1NX0 A;  1S6C A;  2PSR A;  2WCE A;  4GBA A;  4AOM A;  1SCM C;  2LE9 B;  4NDB A;  4MBE A;  1NSH A;  1NWD A;  2M49 B;  1FBV A;  4XYN A;  5JOL A;  3SG2 A;  4YGA A;  3WHT B;  2L2E A;  1K94 A;  1H4B A;  2KYC A;  1SKT A;  3IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...