2BBMA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA02
2M7LA 2R2IA 1AHRA 2JT3A 4WRIA 4A4CA 1K2HA 1CLMA 2V53A 4XJKA 2PMYA 2ZN8A 1CTRA 1ZMZA 1B4CA 1PULA 2K8MB 1XFWO 2BCAA 3I5FC 1TNWA 3EVRA 1JF2A 1KQVA 1CFCA 2BKHB 1AJ4A 1XFXO 2KGRA 3I5HC 2KI6C 1MXLC 4I5LB 4QJ5B 2HF5A 1XFYO 1WRLA 1XFUO 1B8CA 2F2PA 1W7IB 1TN4A 5DKNA 1RWYA 2JT0A 3SG6A 4GGFC 2EGDA 3SG7A 2NLNA 1GJYA 2LMVA 2BECA 3F45A 2BL0C 1IWQA 4AQJA 1M31A 2Q4UA 5K89A 2CT9A 1J7QA 1TIZA 2F8PA 2D8NA 1J7RA 3AKBA 1F4OA 2ZN9A 3OB1B 5IBWA 1GGWA 5I2LA 2LNKA 3CR4X 1UWOA 4MZLA 2JU0A 1CLLA 2KBMA 2LMUA 2OTGB 4GGFA 1PSRA 2HPSA 3VROA 2KDHA 2HQ8A 1KQMB 1BU3A 4JWQA 4E68A 3PSRA 1EL4A 1ALWA 2KYCA 1WLZA 1B7TY 2DOQA 1CDPA 1QIVA 5HKZA 2KOTA 1S36A 1JF0A 2JPTA 5AXIA 1A03A 1S6JA 2KSPA 3GK4X 3HCMA 4I5NB 2H61A 1DJYA 1FF1A 3FIAA 1CLBA 5TNCA 1RK9A 1S5GZ 3PN7C 3LK1A 2PVBA 4MRYA 1D1OA 1NSHA 4C0LA 3ZNIA 1J1DA 4I5KA 1QATA 1SCMC 1ODBA 5PALA 1BODA 1KK7Y 4OKHA 3PALA 4CIDA 4DUQA 3KHEA 1A29A 1K9PA 1BR4B 1KFUS 2GGMA 1KFXL 1PRWA 3JVTB 2KAVA 4DIRA 1YTZC 2JWWA 2MA2A 1LA0A 1YX7A 2K0JA 2QACA 1CFFA 1K9UA 2I94A 3OX6A 2JTTA 3VRQA 1DTLA 4ORAB 2JQ6A 1KWOC 1PSBA 1PK0D 1OZSA 2OS8C 1WY9A 5KTYA 1K96A 1YURA 1NCZA 3C1VA 3TS5B 1BF5A 3SJSA 3QRXA 2M8UA 1SKTA 1E8AA 3DD4A 1DJWA 2KHNA 4MZKA 1BG1A 2LANA 1TNPA 4OV2A 2KQ6A 3MSEB 4DRWA 3LL8B 5F6TA 1Q80A 1B8RA 5CSNA 1NP8A 1YRUB 1NCXA 3NXAA 3EK4A 2F3ZA 4ETOA 2M3WA 4DS7A 2KYFA 1ZACA 1EG4A 1CMGA 1WDCC 4ZCUA 3PLFB 1MHOA 4WQ2A 1CDNA 4YGCB 3WXAA 2QPTA 2I18A 5AFPA 1YRTB 1C7VA 2JTZA 1NUBA 3CLNA 4QJ3B 2LP3A 1WRZA 5HYDA 1IJ6A 2M97A 1HT9A 1GGZA 2JNFA 5BPJA 1TTXA 2LCPA 1H4BA 2JC2A 3IF7A 1XFVO 1X02A 5CSFA 2WC8A 2WCEA 1ZOTB 4PHMA 1ALVA 4HRHA 1V1GA 1MR8A 3CZTX 3RM1A 3SG3A 4CPVA 2PASA 2EC6C 3PM8A 3I5GB 1XFZO 3VRPA 1UHHA 4L9MA 4PDZA 4IL1A 4NDCA 4MBEA 1UURA 4NDDA 2M9GA 1FI6A 3DVJA 3O2PA 4JPZB 2CTNA 4GAOA 1OSAA 1Y0VH 3FWCA 5G08A 4ZCVA 4WQ3A 1DJZA 2I2RE 4YRUA 4NQGA 1WLMA 4YGAA 1SY9A 1Y1XA 1MWNA 4MSPA 2A4JA 2KAYA 1CDMA 4AOMA 3TDUA 2EHBA 1TOPA 2F2OA 3ICBA 1J1EA 4UPGA 4JQ0D 1OQPA 3D10A 2HETA 1UHNA 1CFPA 1KFXS 2MJWB 3CS1A 4MN0A 4GFTA 1IRJA 2M7NA 4I5JA 1V1FA 2SCPA 3TUYB 1CFDA 2JOJA 1NPQA 2KAXA 1CMFA 2MBXA 1CKKA 2L5XB 3GK2A 3D0YB 2MAZA 3TDZA 1Y1UA 2K7BA 1S3PA 3NSIA 4CLNA 1F71A 1BLQA 1SR6B 1EJ3A 2H61C 4GUKA 2BE4A 2LMTA 5ER4X 1Y1AA 1RTP1 1YUUA 2KQYA 1GQMA 1NX1A 2LLTA 2AMIA 2OTGC 4OR9B 1A75B 3SIBA 4P2YB 1S5GY 1AK8A 1JSAA 4MRXA 4YI9A 2B1UA 1ZFSA 1KQMC 2MRDA 5B8IB 4NDBA 1F8HA 3DVKA 3CWGA 1SPYA 3DF0B 4MEWA 2K2AA 1LKJA 3D0YA 4HRGA 1A2XA 1L7ZA 1LXFC 1SNLA 3IQOA 2ZNDA 5CSJA 1L2OB 3TZ1A 3BXKA 1BT6A 1J7PA 2KBIA 1YVHA 2LE9B 3BUNB 1YR5A 1QLSA 2LP2A 1A75A 5HKWA 3IQQA 1DGUA 2F3YA 4CFRA 2LLSA 3NSOA 4A4BA 2BKIB 3ZWHA 1FI5A 3DF0A 3EVUA 2O5GA 2P6BB 1YVLA 4DCKA 3KO0A 2K7OA 5I2OA 3BYAA 3KEVA 1C07A 2Y1NA 3FWBA 4ORCB 3JVTC 2M49B 1UUSA 1N65A 5FYXA 1B7TZ 4D1EA 1JWDA 1LA3A 1MF8B 2LAPA 5CPVA 4M2PA 3JTDB 2IS9A 1QX7A 1S26D 2FCDA 2MHHA 1CNPA 3TS5C 2LHIA 3BUMB 1QVIY 4N5XA 1NCYA 1MXEA 2CCMA 3M0WA 1F4QA 1R6PA 1KK8B 1XK4A 3EK8A 4U8DA 1IQ3A 1NX0A 1DGVA 5AANA 1SRAA 2CBLA 2I7AA 1N0YA 2SASA 2Y1MA 2CXJA 2G9BA 2L98A 1XO5A 1K90D 3RLZA 1FBVA 1HQVA 1S6IA 2AUCA 3OB2B 4M2QA 5HKYA 2GGZA 1H8BA 2M1KB 1RFJA 4PHNA 1J7OA 5GQQC 1K93D 2VRGA 2Q91A 1OMVA 2L51A 1F54A 3E3RA 1MQ1A 2TN4A 4R1EA 4C0KA 1R2UA 1XVJA 2M0RA 4YGBB 1YX8A 2LUXA 1A4PA 2ZNEA 2KFFA 1KCYA 2G2BA 1DJXA 1B47A 1UHJA 3I5IB 1IH0A 1Y6WA 2KFGA 1K94A 3BUXB 3LLEA 3FS7A 4MZJA 2WORA 2FJUB 5DKRA 5CSIA 3BUOB 2F33A 1QX2A 3I5GC 3SG2A 3GK1A 2LVJA 1JUOA 1M63B 1SL7A 4HSZA 4YGEB 5HLOA 1QV1A 1AUIB 2JRFA 2KI4B 1TNQA 2LV7A 3K21A 1SW8A 4GNKB 2FCEA 2NZ0A 5D7FA 3TDIA 2JXCA 3EVVA 1M39A 1N2DA 2LUCA 2BE6A 1EXRA 4N1FA 4AQIA 2L0PA 1NX2A 1TNXA 3EKHA 1UHKA 3PFVA 2ISDA 5DKQA 1JFJA 2K7DA 3VRNA 2E30A 2BBNA 5AERA 3I5FB 3EK7A 3A8RA 4MLWA 1VRKA 1QASA 1NYAA 1UP5A 3O78A 4GBAA 3I5HB 2PRUA 2AAOA 3SG4A 5JOLA 2OPOA 3TUYC 2O60A 1K95A 3BUWB 1EG3A 1QV0A 1DVIA 4Q04A 2K2FA 2WCBA 3AAKA 3WNXB 1ZUZA 1QXPA 2JNXA 4PALA 1QTXA 3VRRA 1SR6C 5I2QA 3GOFA 1OMRA 2RGIA 4YBHB 1S1EA 3NSKA 1SK6D 1IGVA 3WHTB 1BMOA 2BL0B 1XA5A 1QIWA 2FOTA 1QLKA 1NWDA 5AEQA 4GGNA 2LVIA 3WHUB 1AP4A 5J3XA 5I8NA 2BCBA 4PE1A 1DJGA 1SCVA 2PALA 3CR2A 1IJ5A 3CR5X 1QJTA 1PALA 3OX5A 3SIAA 1CM4A 1U5IB 2LVKA 1SL9A 1L2OC 1PVBA 3LK0A 1QX5B 1NX3A 1SMGA 1J55A 2NCPA 3H4SE 1YUSA 1K8UA 3PATA 1IG5A 4TNCA 2K7CA 1W7JB 1OOJA 2LC5A 1SBJA 1RECA 4F0ZB 1TCFA 3CGAA 4ORBB 2LHLA 2ZKMX 1DJHA 4OCIA 3A4UB 3PN7B 1U5IA 4PE4A 1XK4C 1SCMB 2GV5A 3DVMA 1G33A 1DF0B 1DJIA 3NSLA 4ICBA 4C0JA 2Y4QA 2LVVA 1B9AA 2ZFDA 3AAJA 3AKAA 1S6CA 4BY4A 5KSZA 1C7WA 4XYNA 3VGOA 1B1GA 2MLFC 2BBMA 4PE0A 1DMOA 4USLA 1MUXA 1XYDA 2K61A 3JTDC 1G4YR 2H2KA 3CTNA 4N1GA 1WRKA 2LM5A 1NIWA 1EH2A 2JT8A 1LINA 2L4HA 1FW4A 2ZRTA 3O4YA 1YUTA 3DVEA 4YGDB 1JC2A 4M2OA 1KK7Z 1G8IA 2KI6D 1KK8C 1DT7B 1CB1A 2JULA 1AJ5A 4PE7A 3KF9A 2HQWA 2NXQA 1KWOB 1M46A 1CM1A 1IQ5A 1DF0A 2MLEC 2OS8B 1TRFA 4P5OE 1F55A 2L4IA 2M1UA 3EKJA 1F70A 4QJ4B 1SL8A 5KU1A 1UHIA 4YI8A 3BOWB 1BJFA 5JJGA 1FPWA 1KSMA 2KNEA 1K9KA 1OMDA 1RJVA 1JBAA 1KSOA 3LCPC 4PCWA 4MVFA 2JZIA 1OE9B 2PSRA 1QS7A 1B8LA 1RROA 4BY5A 1M45A 1WDCB 3O6BA 2Y5IA 5HLVA 2WNDA 5D69A 1SYMA 1CDLA 3SG5A 4PHKA 4OVNF 3HX4A 5ER5A 2E6WA 1QVIZ 3I5IC 1BR1B 3BQ3A 2M29A 4CFQA 2JXLA 3BOWA 2KFHA 4GPLB 4XJKB 2LLUA 1LVCD 1BOCA 1IKUA 2L50A 2KGBC 1PVAA 2ZRSA 3OP0A 1AVSA 3OHMB 2CNPA 2WOSA 4PHJA 1KFUL 2L2EA 1JFKA 3KPXA 2KI4C 4HREE 2NCOA 1OZOA 2EC6B 4FTGA 2COLB 4FQOA 2WCFA 2BCXA 1TCOB
chains in the Genus database with same CATH superfamily
2M7LA 3UO9A 2R2IA 1AHRA 2JT3A 4WRIA 4A4CA 1K2HA 1CLMA 2V53A 4XJKA 2PMYA 2ZN8A 1CTRA 1ZMZA 1B4CA 1PULA 2K8MB 1XFWO 2BCAA 3BFHA 3SS3A 3I5FC 1TNWA 3EVRA 1JF2A 1KQVA 3NHTA 3PJIA 1CFCA 2BKHB 1AJ4A 1XFXO 2KGRA 3I5HC 2KI6C 1MXLC 4I5LB 4QJ5B 2HF5A 1XFYO 1WRLA 1XFUO 1B8CA 4OZDA 2F2PA 3BJHA 1W7IB 3D75A 1TN4A 2L2CA 3S0BA 5DKNA 1RWYA 2JT0A 1Z4HA 3SG6A 4GGFC 2EGDA 2WCHA 3SG7A 2NLNA 1GJYA 2LMVA 2BECA 3F45A 2BL0C 1IWQA 4AQJA 1M31A 2Q4UA 5K89A 2CT9A 1J7QA 1TIZA 2F8PA 2D8NA 1J7RA 3AKBA 1F4OA 2ZN9A 3OB1B 5IBWA 1GGWA 3FE6A 5I2LA 2LNKA 3CR4X 1UWOA 4MZLA 2JU0A 1CLLA 2KBMA 2LMUA 2OTGB 1DEKA 2PYQA 2QEBA 4GGFA 1C3YA 1PSRA 2HPSA 3VROA 2KDHA 2HQ8A 1KQMB 1BU3A 4JWQA 4E68A 1GM0A 3PSRA 1EL4A 1ALWA 2KYCA 1WLZA 3R72A 1B7TY 2DOQA 1CDPA 1QIVA 5HKZA 2KOTA 1S36A 1JF0A 2JPTA 3RZSA 5AXIA 1DT7B 1A03A 3L4LA 1S6JA 2H8VA 2KSPA 3GK4X 3HCMA 4I5NB 2H61A 1DJYA 1FF1A 3FIAA 1CLBA 5TNCA 1RK9A 1S5GZ 3PN7C 3LK1A 2PVBA 4MRYA 1D1OA 1NSHA 4C0LA 3ZNIA 1J1DA 4I5KA 1QATA 1QWVA 1SCMC 1ODBA 5PALA 1BODA 1KK7Y 4OKHA 3PALA 4CIDA 3SS5A 4DUQA 3KHEA 1A29A 1K9PA 1BR4B 1KFUS 2GGMA 1KFXL 3V2LA 1DC1A 1PRWA 3JVTB 2KAVA 4DIRA 2WCJA 1YTZC 2JWWA 2MA2A 1LA0A 1YX7A 2K0JA 2QACA 1CFFA 1K9UA 2I94A 3OX6A 2JTTA 3VRQA 1DTLA 4ORAB 2JQ6A 5FI2A 2K60A 1KWOC 1PSBA 1PK0D 1OZSA 2OS8C 1WY9A 5KTYA 1K96A 1YURA 1NCZA 3C1VA 3TS5B 1BF5A 3SJSA 3QRXA 2M8UA 1SKTA 3NHIA 1E8AA 3DD4A 3OGNA 1DJWA 2KHNA 4MZKA 1BG1A 2LANA 1TNPA 4OV2A 2KQ6A 3MSEB 4DRWA 3CZ0A 3LL8B 5F6TA 1Q80A 1B8RA 4FQTA 5CSNA 1NP8A 1YRUB 1NCXA 3NXAA 3OBVA 3EK4A 2F3ZA 1ORGA 4ETOA 2M3WA 4DS7A 2KYFA 1ZACA 1EG4A 1CMGA 1WDCC 4ZCUA 3PLFB 1MHOA 4WQ2A 1CDNA 4YGCB 3WXAA 2QPTA 2I18A 5AFPA 1YRTB 1C7VA 2JTZA 3DXLA 1NUBA 3CLNA 2QEHA 4QJ3B 2LP3A 1WRZA 5HYDA 1IJ6A 2M97A 1HT9A 1GGZA 2JNFA 3L47A 5BPJA 1TTXA 2LCPA 1H4BA 2JC2A 3IF7A 1XFVO 4JD9A 1X02A 5CSFA 2WC8A 2WCEA 1ZOTB 4PHMA 1ALVA 3R1OA 3S0AA 4HRHA 1V1GA 1MR8A 3CZTX 3RM1A 3SG3A 4CPVA 1LS8A 2PASA 2EC6C 3PM8A 3I5GB 1XFZO 3VRPA 1UHHA 4L9MA 4PDZA 4IL1A 4NDCA 4MBEA 1UURA 4NDDA 2M9GA 1FI6A 3CYZA 1OOHA 3DVJA 3O2PA 4JPZB 2CTNA 4GAOA 3EG5B 1OSAA 1Y0VH 3FWCA 5D3OA 5G08A 4ZCVA 4WQ3A 1DJZA 2I2RE 1OOGA 4NQGA 4YRUA 1WLMA 3FE8A 4YGAA 1T14A 1SY9A 1Y1XA 1MWNA 4MSPA 2A4JA 2KAYA 1CDMA 5FI6A 3TDUA 2EHBA 4AOMA 1TOPA 2KPHA 2F2OA 2BAPA 1J1EA 3ICBA 3K1EA 4UPGA 4JQ0D 1OQPA 3D10A 2HETA 1UHNA 1CFPA 1KFXS 4IJ7A 2MJWB 3CABA 3CS1A 4GFTA 1IRJA 4MN0A 1IIOA 2M7NA 4I5JA 1V1FA 2SCPA 3TUYB 1CFDA 2JOJA 2L5YA 1NPQA 2KAXA 1CMFA 2MBXA 1CKKA 2L5XB 3GK2A 3D0YB 1OOIX 2MAZA 3TDZA 1Y1UA 2KLEA 3D74A 2K7BA 1S3PA 2BNXA 3NSIA 4CLNA 1F71A 1BLQA 1SR6B 1EJ3A 2H61C 3B86A 4GUKA 1TWOA 2BE4A 2LMTA 5ER4X 1Y1AA 1RTP1 1YUUA 2KQYA 1GQMA 1NX1A 2LLTA 2AMIA 2OTGC 3D77A 1A75B 4OR9B 3SIBA 4P2YB 1S5GY 1AK8A 1JSAA 4MRXA 4YI9A 2B1UA 1ZFSA 1KQMC 2MRDA 5B8IB 4NDBA 1F8HA 3DVKA 3CWGA 1SPYA 3DF0B 4MEWA 2K2AA 1LKJA 3D0YA 4HRGA 1A2XA 1L7ZA 1LXFC 1SNLA 3IQOA 3SS4A 5I94A 2ZNDA 5CSJA 1L2OB 3S0DA 3TZ1A 3BXKA 1BT6A 1J7PA 2KBIA 3CDNA 3DZTA 1YVHA 2LE9B 3BUNB 1YR5A 1QLSA 2LP2A 1A75A 5HKWA 3IQQA 1DGUA 3B6XA 2F3YA 4CFRA 2LLSA 5FI7A 3NSOA 4A4BA 3R1PA 3QMEA 2BKIB 3ZWHA 1FI5A 3DF0A 3EVUA 2O5GA 2P6BB 1YVLA 4DCKA 3KO0A 2K7OA 5I2OA 3BYAA 3KEVA 1C07A 2Y1NA 3FWBA 4ORCB 3JVTC 3BFBA 2M49B 1UUSA 1N65A 2WC5A 3B7AA 5FYXA 1B7TZ 4D1EA 1JWDA 1LA3A 3B87A 1MF8B 2LAPA 5CPVA 4M2PA 3JTDB 2IS9A 1QX7A 1S26D 2FCDA 2MHHA 1CNPA 3TS5C 2LHIA 3BUMB 1QVIY 4N5XA 1NCYA 1MXEA 2CCMA 3M0WA 1F4QA 1R6PA 1KK8B 1XK4A 3EK8A 4U8DA 1IQ3A 1NX0A 1DGVA 3L4AA 1SRAA 5AANA 2CBLA 2I7AA 1N0YA 3S0EA 2SASA 2Y1MA 2CXJA 2G9BA 3D73A 2L98A 1XO5A 1K90D 3RLZA 1FBVA 1HQVA 1Z2CB 1S6IA 2AUCA 3OB2B 4M2QA 5HKYA 2GGZA 1H8BA 2M1KB 1RFJA 2KLDA 4PHNA 1J7OA 5GQQC 1K93D 2VRGA 2Q91A 1OMVA 2L51A 1F54A 3E3RA 1MQ1A 2TN4A 4R1EA 4C0KA 1R2UA 1XVJA 2M0RA 4YGBB 1YX8A 2LUXA 1A4PA 2ZNEA 2KFFA 1C3ZA 2P70A 1KCYA 2G2BA 1DJXA 1B47A 1UHJA 2WCLA 3I5IB 1IH0A 1Y6WA 2KFGA 1K94A 3BUXB 3LLEA 1P28A 3FS7A 5HL1A 4MZJA 3BFAA 2WORA 2FJUB 5DKRA 5CSIA 3IVTA 3BUOB 2F33A 1QX2A 2YGUA 3I5GC 3SG2A 3GK1A 2LVJA 1JUOA 1M63B 1SL7A 4HSZA 4YGEB 5HLOA 1QV1A 3UNWA 1AUIB 2JRFA 2KI4B 1TNQA 2LV7A 3K21A 1SW8A 4GNKB 2PQLA 2FCEA 2NZ0A 5D7FA 3TDIA 2JXCA 3EVVA 1M39A 1N2DA 3S0GA 2LUCA 2BE6A 1EXRA 4N1FA 4AQIA 2L0PA 1NX2A 1TNXA 3EKHA 1UHKA 3PFVA 2ISDA 5DKQA 1JFJA 2K7DA 3VRNA 2E30A 2BBNA 5AERA 3I5FB 2WC6A 3A8RA 3EK7A 1VRKA 4MLWA 3N7HA 2QEVA 2QEOA 1QASA 1NYAA 1UP5A 3O78A 1XFRA 4GBAA 3I5HB 2PRUA 2AAOA 3SG4A 1DQEA 5JOLA 2OPOA 3TUYC 2O60A 1K95A 3BUWB 1EG3A 1QV0A 1DVIA 3R1VA 4Q04A 2K2FA 2WCBA 3AAKA 3WNXB 1ZUZA 1QXPA 2JNXA 4PALA 1QTXA 3VRRA 1CB1A 1SR6C 4JKTA 5I2QA 3GOFA 1OMRA 2RGIA 4YBHB 1S1EA 3NSKA 1SK6D 1IGVA 3WHTB 1BMOA 2BL0B 1XA5A 2WCKA 4INWA 1QIWA 2FOTA 1QLKA 1NWDA 5AEQA 3S0FA 4GGNA 2LVIA 3WHUB 1AP4A 5EL2A 5J3XA 5I8NA 3Q8IA 2BCBA 4PE1A 1DJGA 1SCVA 2PALA 3CR2A 1IJ5A 3CR5X 1QJTA 1PALA 2FJYA 3OX5A 3SIAA 1CM4A 1U5IB 2LVKA 1SL9A 1L2OC 1PVBA 3LK0A 2P71A 1QX5B 1NX3A 1SMGA 1J55A 2NCPA 3H4SE 1YUSA 4F7FA 1TUJA 1K8UA 3PATA 1IG5A 3PM2A 4TNCA 2K7CA 1W7JB 1OOJA 2LC5A 1SBJA 1RECA 4F0ZB 1TCFA 3CGAA 4ORBB 2LHLA 2ZKMX 1DJHA 2ERBA 3A4UB 3DY9A 4OCIA 3PN7B 1U5IA 3CZ2A 4PE4A 1XK4C 1SCMB 2GV5A 3DVMA 1G33A 3VB1A 1DF0B 1DJIA 3NSLA 4ICBA 4C0JA 2Y4QA 2LVVA 1B9AA 1OOFA 2ZFDA 3AAJA 1S6CA 3AKAA 3O4XA 4BY4A 1C7WA 5KSZA 4XYNA 3VGOA 1B1GA 2MLFC 2QDIA 2BBMA 4PE0A 1DMOA 4USLA 1MUXA 1XYDA 2K61A 3JTDC 1G4YR 4PT1A 2H2KA 3CTNA 4N1GA 1WRKA 2LM5A 1NIWA 1DELA 1EH2A 2JT8A 1LINA 2L4HA 1SSEB 1FW4A 2ZRTA 3NGVA 1YUTA 3CZ1A 3DVEA 3O4YA 4YGDB 1JC2A 4M2OA 1KK7Z 1G8IA 1W9ZA 1KK8C 2KI6D 3B88A 2JULA 1AJ5A 3FE9A 3KF9A 2HQWA 2NXQA 4PE7A 1KWOB 1M46A 1CM1A 1IQ5A 1DF0A 2MLEC 2OS8B 1TRFA 4P5OE 1F55A 2L4IA 2M1UA 3DYEA 3EKJA 3D76A 1F70A 4QJ4B 1SL8A 5KU1A 1UHIA 4YI8A 3BOWB 1BJFA 5JJGA 1FPWA 1KSMA 2KNEA 3D78A 1K9KA 1OMDA 1RJVA 1JBAA 1KSOA 3LCPC 4PCWA 4MVFA 2JZIA 4KYNA 1OE9B 2PSRA 1QS7A 1B8LA 1RROA 4BY5A 1M45A 1WDCB 3O6BA 2Y5IA 5DICA 5HLVA 2WNDA 5D69A 1SYMA 2WCMA 1CDLA 3SG5A 4PHKA 4OVNF 3HX4A 5ER5A 2E6WA 1QVIZ 3I5IC 1BR1B 3BQ3A 2M29A 4CFQA 2JXLA 3BOWA 2KFHA 4GPLB 4XJKB 2LLUA 1LVCD 1BOCA 2GTEA 1IKUA 2L50A 2KGBC 1PVAA 2ZRSA 3OP0A 1AVSA 3OHMB 2JPOA 2CNPA 2WOSA 4PHJA 4INXA 1KFUL 2L2EA 1JFKA 3KPXA 2KI4C 4HREE 2NCOA 1OZOA 2EC6B 4FTGA 2COLB 4FQOA 1TUZA 1OW4A 2WCFA 2BCXA 1TCOB
chains in the Genus database with same CATH topology
2M7LA 2R2IA 1AHRA 2JT3A 4WRIA 4A4CA 1K2HA 1CLMA 2V53A 4XJKA 2PMYA 2ZN8A 1CTRA 1ZMZA 1B4CA 1PULA 2K8MB 1XFWO 2BCAA 3I5FC 1TNWA 3EVRA 1JF2A 1KQVA 1CFCA 2BKHB 1AJ4A 1XFXO 2KGRA 3I5HC 2KI6C 1MXLC 4I5LB 4QJ5B 2HF5A 1XFYO 1WRLA 1XFUO 1B8CA 2F2PA 1W7IB 1TN4A 5DKNA 1RWYA 2JT0A 3SG6A 4GGFC 2EGDA 3SG7A 2NLNA 1GJYA 2LMVA 2BECA 3F45A 2BL0C 1IWQA 4AQJA 1M31A 2Q4UA 5K89A 2CT9A 1J7QA 1TIZA 2F8PA 2D8NA 1J7RA 3AKBA 1F4OA 2ZN9A 3OB1B 5IBWA 1GGWA 5I2LA 2LNKA 3CR4X 1UWOA 4MZLA 2JU0A 1CLLA 2KBMA 2LMUA 2OTGB 4GGFA 1PSRA 2HPSA 3VROA 2KDHA 2HQ8A 1KQMB 1BU3A 4JWQA 4E68A 3PSRA 1EL4A 1ALWA 2KYCA 1WLZA 1B7TY 2DOQA 1CDPA 1QIVA 5HKZA 2KOTA 1S36A 1JF0A 2JPTA 5AXIA 1A03A 1S6JA 2KSPA 3GK4X 3HCMA 4I5NB 2H61A 1DJYA 1FF1A 3FIAA 1CLBA 5TNCA 1RK9A 1S5GZ 3PN7C 3LK1A 2PVBA 4MRYA 1D1OA 1NSHA 4C0LA 3ZNIA 1J1DA 4I5KA 1QATA 1SCMC 1ODBA 5PALA 1BODA 1KK7Y 4OKHA 3PALA 4CIDA 4DUQA 3KHEA 1A29A 1K9PA 1BR4B 1KFUS 2GGMA 1KFXL 1PRWA 3JVTB 2KAVA 4DIRA 1YTZC 2JWWA 2MA2A 1LA0A 1YX7A 2K0JA 2QACA 1CFFA 1K9UA 2I94A 3OX6A 2JTTA 3VRQA 1DTLA 4ORAB 2JQ6A 1KWOC 1PSBA 1PK0D 1OZSA 2OS8C 1WY9A 5KTYA 1K96A 1YURA 1NCZA 3C1VA 3TS5B 1BF5A 3SJSA 3QRXA 2M8UA 1SKTA 1E8AA 3DD4A 1DJWA 2KHNA 4MZKA 1BG1A 2LANA 1TNPA 4OV2A 2KQ6A 3MSEB 4DRWA 3LL8B 5F6TA 1Q80A 1B8RA 5CSNA 1NP8A 1YRUB 1NCXA 3NXAA 3EK4A 2F3ZA 4ETOA 2M3WA 4DS7A 2KYFA 1ZACA 1EG4A 1CMGA 1WDCC 4ZCUA 3PLFB 1MHOA 4WQ2A 1CDNA 4YGCB 3WXAA 2QPTA 2I18A 5AFPA 1YRTB 1C7VA 2JTZA 1NUBA 3CLNA 4QJ3B 2LP3A 1WRZA 5HYDA 1IJ6A 2M97A 1HT9A 1GGZA 2JNFA 5BPJA 1TTXA 2LCPA 1H4BA 2JC2A 3IF7A 1XFVO 1X02A 5CSFA 2WC8A 2WCEA 1ZOTB 4PHMA 1ALVA 4HRHA 1V1GA 1MR8A 3CZTX 3RM1A 3SG3A 4CPVA 2PASA 2EC6C 3PM8A 3I5GB 1XFZO 3VRPA 1UHHA 4L9MA 4PDZA 4IL1A 4NDCA 4MBEA 1UURA 4NDDA 2M9GA 1FI6A 3DVJA 3O2PA 4JPZB 2CTNA 4GAOA 1OSAA 1Y0VH 3FWCA 5G08A 4ZCVA 4WQ3A 1DJZA 2I2RE 4YRUA 4NQGA 1WLMA 4YGAA 1SY9A 1Y1XA 1MWNA 4MSPA 2A4JA 2KAYA 1CDMA 4AOMA 3TDUA 2EHBA 1TOPA 2F2OA 3ICBA 1J1EA 4UPGA 4JQ0D 1OQPA 3D10A 2HETA 1UHNA 1CFPA 1KFXS 2MJWB 3CS1A 4MN0A 4GFTA 1IRJA 2M7NA 4I5JA 1V1FA 2SCPA 3TUYB 1CFDA 2JOJA 1NPQA 2KAXA 1CMFA 2MBXA 1CKKA 2L5XB 3GK2A 3D0YB 2MAZA 3TDZA 1Y1UA 2K7BA 1S3PA 3NSIA 4CLNA 1F71A 1BLQA 1SR6B 1EJ3A 2H61C 4GUKA 2BE4A 2LMTA 5ER4X 1Y1AA 1RTP1 1YUUA 2KQYA 1GQMA 1NX1A 2LLTA 2AMIA 2OTGC 4OR9B 1A75B 3SIBA 4P2YB 1S5GY 1AK8A 1JSAA 4MRXA 4YI9A 2B1UA 1ZFSA 1KQMC 2MRDA 5B8IB 4NDBA 1F8HA 3DVKA 3CWGA 1SPYA 3DF0B 4MEWA 2K2AA 1LKJA 3D0YA 4HRGA 1A2XA 1L7ZA 1LXFC 1SNLA 3IQOA 2ZNDA 5CSJA 1L2OB 3TZ1A 3BXKA 1BT6A 1J7PA 2KBIA 1YVHA 2LE9B 3BUNB 1YR5A 1QLSA 2LP2A 1A75A 5HKWA 3IQQA 1DGUA 2F3YA 4CFRA 2LLSA 3NSOA 4A4BA 2BKIB 3ZWHA 1FI5A 3DF0A 3EVUA 2O5GA 2P6BB 1YVLA 4DCKA 3KO0A 2K7OA 5I2OA 3BYAA 3KEVA 1C07A 2Y1NA 3FWBA 4ORCB 3JVTC 2M49B 1UUSA 1N65A 5FYXA 1B7TZ 4D1EA 1JWDA 1LA3A 1MF8B 2LAPA 5CPVA 4M2PA 3JTDB 2IS9A 1QX7A 1S26D 2FCDA 2MHHA 1CNPA 3TS5C 2LHIA 3BUMB 1QVIY 4N5XA 1NCYA 1MXEA 2CCMA 3M0WA 1F4QA 1R6PA 1KK8B 1XK4A 3EK8A 4U8DA 1IQ3A 1NX0A 1DGVA 5AANA 1SRAA 2CBLA 2I7AA 1N0YA 2SASA 2Y1MA 2CXJA 2G9BA 2L98A 1XO5A 1K90D 3RLZA 1FBVA 1HQVA 1S6IA 2AUCA 3OB2B 4M2QA 5HKYA 2GGZA 1H8BA 2M1KB 1RFJA 4PHNA 1J7OA 5GQQC 1K93D 2VRGA 2Q91A 1OMVA 2L51A 1F54A 3E3RA 1MQ1A 2TN4A 4R1EA 4C0KA 1R2UA 1XVJA 2M0RA 4YGBB 1YX8A 2LUXA 1A4PA 2ZNEA 2KFFA 1KCYA 2G2BA 1DJXA 1B47A 1UHJA 3I5IB 1IH0A 1Y6WA 2KFGA 1K94A 3BUXB 3LLEA 3FS7A 4MZJA 2WORA 2FJUB 5DKRA 5CSIA 3BUOB 2F33A 1QX2A 3I5GC 3SG2A 3GK1A 2LVJA 1JUOA 1M63B 1SL7A 4HSZA 4YGEB 5HLOA 1QV1A 1AUIB 2JRFA 2KI4B 1TNQA 2LV7A 3K21A 1SW8A 4GNKB 2FCEA 2NZ0A 5D7FA 3TDIA 2JXCA 3EVVA 1M39A 1N2DA 2LUCA 2BE6A 1EXRA 4N1FA 4AQIA 2L0PA 1NX2A 1TNXA 3EKHA 1UHKA 3PFVA 2ISDA 5DKQA 1JFJA 2K7DA 3VRNA 2E30A 2BBNA 5AERA 3I5FB 3EK7A 3A8RA 4MLWA 1VRKA 1QASA 1NYAA 1UP5A 3O78A 4GBAA 3I5HB 2PRUA 2AAOA 3SG4A 5JOLA 2OPOA 3TUYC 2O60A 1K95A 3BUWB 1EG3A 1QV0A 1DVIA 4Q04A 2K2FA 2WCBA 3AAKA 3WNXB 1ZUZA 1QXPA 2JNXA 4PALA 1QTXA 3VRRA 1SR6C 5I2QA 3GOFA 1OMRA 2RGIA 4YBHB 1S1EA 3NSKA 1SK6D 1IGVA 3WHTB 1BMOA 2BL0B 1XA5A 1QIWA 2FOTA 1QLKA 1NWDA 5AEQA 4GGNA 2LVIA 3WHUB 1AP4A 5J3XA 5I8NA 2BCBA 4PE1A 1DJGA 1SCVA 2PALA 3CR2A 1IJ5A 3CR5X 1QJTA 1PALA 3OX5A 3SIAA 1CM4A 1U5IB 2LVKA 1SL9A 1L2OC 1PVBA 3LK0A 1QX5B 1NX3A 1SMGA 1J55A 2NCPA 3H4SE 1YUSA 1K8UA 3PATA 1IG5A 4TNCA 2K7CA 1W7JB 1OOJA 2LC5A 1SBJA 1RECA 4F0ZB 1TCFA 3CGAA 4ORBB 2LHLA 2ZKMX 1DJHA 4OCIA 3A4UB 3PN7B 1U5IA 4PE4A 1XK4C 1SCMB 2GV5A 3DVMA 1G33A 1DF0B 1DJIA 3NSLA 4ICBA 4C0JA 2Y4QA 2LVVA 1B9AA 2ZFDA 3AAJA 3AKAA 1S6CA 4BY4A 5KSZA 1C7WA 4XYNA 3VGOA 1B1GA 2MLFC 2BBMA 4PE0A 1DMOA 4USLA 1MUXA 1XYDA 2K61A 3JTDC 1G4YR 2H2KA 3CTNA 4N1GA 1WRKA 2LM5A 1NIWA 1EH2A 2JT8A 1LINA 2L4HA 1FW4A 2ZRTA 3O4YA 1YUTA 3DVEA 4YGDB 1JC2A 4M2OA 1KK7Z 1G8IA 2KI6D 1KK8C 1DT7B 1CB1A 2JULA 1AJ5A 4PE7A 3KF9A 2HQWA 2NXQA 1KWOB 1M46A 1CM1A 1IQ5A 1DF0A 2MLEC 2OS8B 1TRFA 4P5OE 1F55A 2L4IA 2M1UA 3EKJA 1F70A 4QJ4B 1SL8A 5KU1A 1UHIA 4YI8A 3BOWB 1BJFA 5JJGA 1FPWA 1KSMA 2KNEA 1K9KA 1OMDA 1RJVA 1JBAA 1KSOA 3LCPC 4PCWA 4MVFA 2JZIA 1OE9B 2PSRA 1QS7A 1B8LA 1RROA 4BY5A 1M45A 1WDCB 3O6BA 2Y5IA 5HLVA 2WNDA 5D69A 1SYMA 1CDLA 3SG5A 4PHKA 4OVNF 3HX4A 5ER5A 2E6WA 1QVIZ 3I5IC 1BR1B 3BQ3A 2M29A 4CFQA 2JXLA 3BOWA 2KFHA 4GPLB 4XJKB 2LLUA 1LVCD 1BOCA 1IKUA 2L50A 2KGBC 1PVAA 2ZRSA 3OP0A 1AVSA 3OHMB 2CNPA 2WOSA 4PHJA 1KFUL 2L2EA 1JFKA 3KPXA 2KI4C 4HREE 2NCOA 1OZOA 2EC6B 4FTGA 2COLB 4FQOA 2WCFA 2BCXA 1TCOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7L A;  2R2I A;  1AHR A;  2JT3 A;  4WRI A;  4A4C A;  1K2H A;  1CLM A;  2V53 A;  4XJK A;  2PMY A;  2ZN8 A;  1CTR A;  1ZMZ A;  1B4C A;  1PUL A;  2K8M B;  1XFW O;  2BCA A;  3I5F C;  1TNW A;  3EVR A;  1JF2 A;  1KQV A;  1CFC A;  2BKH B;  1AJ4 A;  1XFX O;  2KGR A;  3I5H C;  2KI6 C;  1MXL C;  4I5L B;  4QJ5 B;  2HF5 A;  1XFY O;  1WRL A;  1XFU O;  1B8C A;  2F2P A;  1W7I B;  1TN4 A;  5DKN A;  1RWY A;  2JT0 A;  3SG6 A;  4GGF C;  2EGD A;  3SG7 A;  2NLN A;  1GJY A;  2LMV A;  2BEC A;  3F45 A;  2BL0 C;  1IWQ A;  4AQJ A;  1M31 A;  2Q4U A;  5K89 A;  2CT9 A;  1J7Q A;  1TIZ A;  2F8P A;  2D8N A;  1J7R A;  3AKB A;  1F4O A;  2ZN9 A;  3OB1 B;  5IBW A;  1GGW A;  5I2L A;  2LNK A;  3CR4 X;  1UWO A;  4MZL A;  2JU0 A;  1CLL A;  2KBM A;  2LMU A;  2OTG B;  4GGF A;  1PSR A;  2HPS A;  3VRO A;  2KDH A;  2HQ8 A;  1KQM B;  1BU3 A;  4JWQ A;  4E68 A;  3PSR A;  1EL4 A;  1ALW A;  2KYC A;  1WLZ A;  1B7T Y;  2DOQ A;  1CDP A;  1QIV A;  5HKZ A;  2KOT A;  1S36 A;  1JF0 A;  2JPT A;  5AXI A;  1A03 A;  1S6J A;  2KSP A;  3GK4 X;  3HCM A;  4I5N B;  2H61 A;  1DJY A;  1FF1 A;  3FIA A;  1CLB A;  5TNC A;  1RK9 A;  1S5G Z;  3PN7 C;  3LK1 A;  2PVB A;  4MRY A;  1D1O A;  1NSH A;  4C0L A;  3ZNI A;  1J1D A;  4I5K A;  1QAT A;  1SCM C;  1ODB A;  5PAL A;  1BOD A;  1KK7 Y;  4OKH A;  3PAL A;  4CID A;  4DUQ A;  3KHE A;  1A29 A;  1K9P A;  1BR4 B;  1KFU S;  2GGM A;  1KFX L;  1PRW A;  3JVT B;  2KAV A;  4DIR A;  1YTZ C;  2JWW A;  2MA2 A;  1LA0 A;  1YX7 A;  2K0J A;  2QAC A;  1CFF A;  1K9U A;  2I94 A;  3OX6 A;  2JTT A;  3VRQ A;  1DTL A;  4ORA B;  2JQ6 A;  1KWO C;  1PSB A;  1PK0 D;  1OZS A;  2OS8 C;  1WY9 A;  5KTY A;  1K96 A;  1YUR A;  1NCZ A;  3C1V A;  3TS5 B;  1BF5 A;  3SJS A;  3QRX A;  2M8U A;  1SKT A;  1E8A A;  3DD4 A;  1DJW A;  2KHN A;  4MZK A;  1BG1 A;  2LAN A;  1TNP A;  4OV2 A;  2KQ6 A;  3MSE B;  4DRW A;  3LL8 B;  5F6T A;  1Q80 A;  1B8R A;  5CSN A;  1NP8 A;  1YRU B;  1NCX A;  3NXA A;  3EK4 A;  2F3Z A;  4ETO A;  2M3W A;  4DS7 A;  2KYF A;  1ZAC A;  1EG4 A;  1CMG A;  1WDC C;  4ZCU A;  3PLF B;  1MHO A;  4WQ2 A;  1CDN A;  4YGC B;  3WXA A;  2QPT A;  2I18 A;  5AFP A;  1YRT B;  1C7V A;  2JTZ A;  1NUB A;  3CLN A;  4QJ3 B;  2LP3 A;  1WRZ A;  5HYD A;  1IJ6 A;  2M97 A;  1HT9 A;  1GGZ A;  2JNF A;  5BPJ A;  1TTX A;  2LCP A;  1H4B A;  2JC2 A;  3IF7 A;  1XFV O;  1X02 A;  5CSF A;  2WC8 A;  2WCE A;  1ZOT B;  4PHM A;  1ALV A;  4HRH A;  1V1G A;  1MR8 A;  3CZT X;  3RM1 A;  3SG3 A;  4CPV A;  2PAS A;  2EC6 C;  3PM8 A;  3I5G B;  1XFZ O;  3VRP A;  1UHH A;  4L9M A;  4PDZ A;  4IL1 A;  4NDC A;  4MBE A;  1UUR A;  4NDD A;  2M9G A;  1FI6 A;  3DVJ A;  3O2P A;  4JPZ B;  2CTN A;  4GAO A;  1OSA A;  1Y0V H;  3FWC A;  5G08 A;  4ZCV A;  4WQ3 A;  1DJZ A;  2I2R E;  4YRU A;  4NQG A;  1WLM A;  4YGA A;  1SY9 A;  1Y1X A;  1MWN A;  4MSP A;  2A4J A;  2KAY A;  1CDM A;  4AOM A;  3TDU A;  2EHB A;  1TOP A;  2F2O A;  3ICB A;  1J1E A;  4UPG A;  4JQ0 D;  1OQP A;  3D10 A;  2HET A;  1UHN A;  1CFP A;  1KFX S;  2MJW B;  3CS1 A;  4MN0 A;  4GFT A;  1IRJ A;  2M7N A;  4I5J A;  1V1F A;  2SCP A;  3TUY B;  1CFD A;  2JOJ A;  1NPQ A;  2KAX A;  1CMF A;  2MBX A;  1CKK A;  2L5X B;  3GK2 A;  3D0Y B;  2MAZ A;  3TDZ A;  1Y1U A;  2K7B A;  1S3P A;  3NSI A;  4CLN A;  1F71 A;  1BLQ A;  1SR6 B;  1EJ3 A;  2H61 C;  4GUK A;  2BE4 A;  2LMT A;  5ER4 X;  1Y1A A;  1RTP 1;  1YUU A;  2KQY A;  1GQM A;  1NX1 A;  2LLT A;  2AMI A;  2OTG C;  4OR9 B;  1A75 B;  3SIB A;  4P2Y B;  1S5G Y;  1AK8 A;  1JSA A;  4MRX A;  4YI9 A;  2B1U A;  1ZFS A;  1KQM C;  2MRD A;  5B8I B;  4NDB A;  1F8H A;  3DVK A;  3CWG A;  1SPY A;  3DF0 B;  4MEW A;  2K2A A;  1LKJ A;  3D0Y A;  4HRG A;  1A2X A;  1L7Z A;  1LXF C;  1SNL A;  3IQO A;  2ZND A;  5CSJ A;  1L2O B;  3TZ1 A;  3BXK A;  1BT6 A;  1J7P A;  2KBI A;  1YVH A;  2LE9 B;  3BUN B;  1YR5 A;  1QLS A;  2LP2 A;  1A75 A;  5HKW A;  3IQQ A;  1DGU A;  2F3Y A;  4CFR A;  2LLS A;  3NSO A;  4A4B A;  2BKI B;  3ZWH A;  1FI5 A;  3DF0 A;  3EVU A;  2O5G A;  2P6B B;  1YVL A;  4DCK A;  3KO0 A;  2K7O A;  5I2O A;  3BYA A;  3KEV A;  1C07 A;  2Y1N A;  3FWB A;  4ORC B;  3JVT C;  2M49 B;  1UUS A;  1N65 A;  5FYX A;  1B7T Z;  4D1E A;  1JWD A;  1LA3 A;  1MF8 B;  2LAP A;  5CPV A;  4M2P A;  3JTD B;  2IS9 A;  1QX7 A;  1S26 D;  2FCD A;  2MHH A;  1CNP A;  3TS5 C;  2LHI A;  3BUM B;  1QVI Y;  4N5X A;  1NCY A;  1MXE A;  2CCM A;  3M0W A;  1F4Q A;  1R6P A;  1KK8 B;  1XK4 A;  3EK8 A;  4U8D A;  1IQ3 A;  1NX0 A;  1DGV A;  5AAN A;  1SRA A;  2CBL A;  2I7A A;  1N0Y A;  2SAS A;  2Y1M A;  2CXJ A;  2G9B A;  2L98 A;  1XO5 A;  1K90 D;  3RLZ A;  1FBV A;  1HQV A;  1S6I A;  2AUC A;  3OB2 B;  4M2Q A;  5HKY A;  2GGZ A;  1H8B A;  2M1K B;  1RFJ A;  4PHN A;  1J7O A;  5GQQ C;  1K93 D;  2VRG A;  2Q91 A;  1OMV A;  2L51 A;  1F54 A;  3E3R A;  1MQ1 A;  2TN4 A;  4R1E A;  4C0K A;  1R2U A;  1XVJ A;  2M0R A;  4YGB B;  1YX8 A;  2LUX A;  1A4P A;  2ZNE A;  2KFF A;  1KCY A;  2G2B A;  1DJX A;  1B47 A;  1UHJ A;  3I5I B;  1IH0 A;  1Y6W A;  2KFG A;  1K94 A;  3BUX B;  3LLE A;  3FS7 A;  4MZJ A;  2WOR A;  2FJU B;  5DKR A;  5CSI A;  3BUO B;  2F33 A;  1QX2 A;  3I5G C;  3SG2 A;  3GK1 A;  2LVJ A;  1JUO A;  1M63 B;  1SL7 A;  4HSZ A;  4YGE B;  5HLO A;  1QV1 A;  1AUI B;  2JRF A;  2KI4 B;  1TNQ A;  2LV7 A;  3K21 A;  1SW8 A;  4GNK B;  2FCE A;  2NZ0 A;  5D7F A;  3TDI A;  2JXC A;  3EVV A;  1M39 A;  1N2D A;  2LUC A;  2BE6 A;  1EXR A;  4N1F A;  4AQI A;  2L0P A;  1NX2 A;  1TNX A;  3EKH A;  1UHK A;  3PFV A;  2ISD A;  5DKQ A;  1JFJ A;  2K7D A;  3VRN A;  2E30 A;  2BBN A;  5AER A;  3I5F B;  3EK7 A;  3A8R A;  4MLW A;  1VRK A;  1QAS A;  1NYA A;  1UP5 A;  3O78 A;  4GBA A;  3I5H B;  2PRU A;  2AAO A;  3SG4 A;  5JOL A;  2OPO A;  3TUY C;  2O60 A;  1K95 A;  3BUW B;  1EG3 A;  1QV0 A;  1DVI A;  4Q04 A;  2K2F A;  2WCB A;  3AAK A;  3WNX B;  1ZUZ A;  1QXP A;  2JNX A;  4PAL A;  1QTX A;  3VRR A;  1SR6 C;  5I2Q A;  3GOF A;  1OMR A;  2RGI A;  4YBH B;  1S1E A;  3NSK A;  1SK6 D;  1IGV A;  3WHT B;  1BMO A;  2BL0 B;  1XA5 A;  1QIW A;  2FOT A;  1QLK A;  1NWD A;  5AEQ A;  4GGN A;  2LVI A;  3WHU B;  1AP4 A;  5J3X A;  5I8N A;  2BCB A;  4PE1 A;  1DJG A;  1SCV A;  2PAL A;  3CR2 A;  1IJ5 A;  3CR5 X;  1QJT A;  1PAL A;  3OX5 A;  3SIA A;  1CM4 A;  1U5I B;  2LVK A;  1SL9 A;  1L2O C;  1PVB A;  3LK0 A;  1QX5 B;  1NX3 A;  1SMG A;  1J55 A;  2NCP A;  3H4S E;  1YUS A;  1K8U A;  3PAT A;  1IG5 A;  4TNC A;  2K7C A;  1W7J B;  1OOJ A;  2LC5 A;  1SBJ A;  1REC A;  4F0Z B;  1TCF A;  3CGA A;  4ORB B;  2LHL A;  2ZKM X;  1DJH A;  4OCI A;  3A4U B;  3PN7 B;  1U5I A;  4PE4 A;  1XK4 C;  1SCM B;  2GV5 A;  3DVM A;  1G33 A;  1DF0 B;  1DJI A;  3NSL A;  4ICB A;  4C0J A;  2Y4Q A;  2LVV A;  1B9A A;  2ZFD A;  3AAJ A;  3AKA A;  1S6C A;  4BY4 A;  5KSZ A;  1C7W A;  4XYN A;  3VGO A;  1B1G A;  2MLF C;  2BBM A;  4PE0 A;  1DMO A;  4USL A;  1MUX A;  1XYD A;  2K61 A;  3JTD C;  1G4Y R;  2H2K A;  3CTN A;  4N1G A;  1WRK A;  2LM5 A;  1NIW A;  1EH2 A;  2JT8 A;  1LIN A;  2L4H A;  1FW4 A;  2ZRT A;  3O4Y A;  1YUT A;  3DVE A;  4YGD B;  1JC2 A;  4M2O A;  1KK7 Z;  1G8I A;  2KI6 D;  1KK8 C;  1DT7 B;  1CB1 A;  2JUL A;  1AJ5 A;  4PE7 A;  3KF9 A;  2HQW A;  2NXQ A;  1KWO B;  1M46 A;  1CM1 A;  1IQ5 A;  1DF0 A;  2MLE C;  2OS8 B;  1TRF A;  4P5O E;  1F55 A;  2L4I A;  2M1U A;  3EKJ A;  1F70 A;  4QJ4 B;  1SL8 A;  5KU1 A;  1UHI A;  4YI8 A;  3BOW B;  1BJF A;  5JJG A;  1FPW A;  1KSM A;  2KNE A;  1K9K A;  1OMD A;  1RJV A;  1JBA A;  1KSO A;  3LCP C;  4PCW A;  4MVF A;  2JZI A;  1OE9 B;  2PSR A;  1QS7 A;  1B8L A;  1RRO A;  4BY5 A;  1M45 A;  1WDC B;  3O6B A;  2Y5I A;  5HLV A;  2WND A;  5D69 A;  1SYM A;  1CDL A;  3SG5 A;  4PHK A;  4OVN F;  3HX4 A;  5ER5 A;  2E6W A;  1QVI Z;  3I5I C;  1BR1 B;  3BQ3 A;  2M29 A;  4CFQ A;  2JXL A;  3BOW A;  2KFH A;  4GPL B;  4XJK B;  2LLU A;  1LVC D;  1BOC A;  1IKU A;  2L50 A;  2KGB C;  1PVA A;  2ZRS A;  3OP0 A;  1AVS A;  3OHM B;  2CNP A;  2WOS A;  4PHJ A;  1KFU L;  2L2E A;  1JFK A;  3KPX A;  2KI4 C;  4HRE E;  2NCO A;  1OZO A;  2EC6 B;  4FTG A;  2COL B;  4FQO A;  2WCF A;  2BCX A;  1TCO B; 
#chains in the Genus database with same CATH topology
 2M7L A;  3UO9 A;  2R2I A;  1AHR A;  2JT3 A;  4WRI A;  4A4C A;  1K2H A;  1CLM A;  2V53 A;  4XJK A;  2PMY A;  2ZN8 A;  1CTR A;  1ZMZ A;  1B4C A;  1PUL A;  2K8M B;  1XFW O;  2BCA A;  3BFH A;  3SS3 A;  3I5F C;  1TNW A;  3EVR A;  1JF2 A;  1KQV A;  3NHT A;  3PJI A;  1CFC A;  2BKH B;  1AJ4 A;  1XFX O;  2KGR A;  3I5H C;  2KI6 C;  1MXL C;  4I5L B;  4QJ5 B;  2HF5 A;  1XFY O;  1WRL A;  1XFU O;  1B8C A;  4OZD A;  2F2P A;  3BJH A;  1W7I B;  3D75 A;  1TN4 A;  2L2C A;  3S0B A;  5DKN A;  1RWY A;  2JT0 A;  1Z4H A;  3SG6 A;  4GGF C;  2EGD A;  2WCH A;  3SG7 A;  2NLN A;  1GJY A;  2LMV A;  2BEC A;  3F45 A;  2BL0 C;  1IWQ A;  4AQJ A;  1M31 A;  2Q4U A;  5K89 A;  2CT9 A;  1J7Q A;  1TIZ A;  2F8P A;  2D8N A;  1J7R A;  3AKB A;  1F4O A;  2ZN9 A;  3OB1 B;  5IBW A;  1GGW A;  3FE6 A;  5I2L A;  2LNK A;  3CR4 X;  1UWO A;  4MZL A;  2JU0 A;  1CLL A;  2KBM A;  2LMU A;  2OTG B;  1DEK A;  2PYQ A;  2QEB A;  4GGF A;  1C3Y A;  1PSR A;  2HPS A;  3VRO A;  2KDH A;  2HQ8 A;  1KQM B;  1BU3 A;  4JWQ A;  4E68 A;  1GM0 A;  3PSR A;  1EL4 A;  1ALW A;  2KYC A;  1WLZ A;  3R72 A;  1B7T Y;  2DOQ A;  1CDP A;  1QIV A;  5HKZ A;  2KOT A;  1S36 A;  1JF0 A;  2JPT A;  3RZS A;  5AXI A;  1DT7 B;  1A03 A;  3L4L A;  1S6J A;  2H8V A;  2KSP A;  3GK4 X;  3HCM A;  4I5N B;  2H61 A;  1DJY A;  1FF1 A;  3FIA A;  1CLB A;  5TNC A;  1RK9 A;  1S5G Z;  3PN7 C;  3LK1 A;  2PVB A;  4MRY A;  1D1O A;  1NSH A;  4C0L A;  3ZNI A;  1J1D A;  4I5K A;  1QAT A;  1QWV A;  1SCM C;  1ODB A;  5PAL A;  1BOD A;  1KK7 Y;  4OKH A;  3PAL A;  4CID A;  3SS5 A;  4DUQ A;  3KHE A;  1A29 A;  1K9P A;  1BR4 B;  1KFU S;  2GGM A;  1KFX L;  3V2L A;  1DC1 A;  1PRW A;  3JVT B;  2KAV A;  4DIR A;  2WCJ A;  1YTZ C;  2JWW A;  2MA2 A;  1LA0 A;  1YX7 A;  2K0J A;  2QAC A;  1CFF A;  1K9U A;  2I94 A;  3OX6 A;  2JTT A;  3VRQ A;  1DTL A;  4ORA B;  2JQ6 A;  5FI2 A;  2K60 A;  1KWO C;  1PSB A;  1PK0 D;  1OZS A;  2OS8 C;  1WY9 A;  5KTY A;  1K96 A;  1YUR A;  1NCZ A;  3C1V A;  3TS5 B;  1BF5 A;  3SJS A;  3QRX A;  2M8U A;  1SKT A;  3NHI A;  1E8A A;  3DD4 A;  3OGN A;  1DJW A;  2KHN A;  4MZK A;  1BG1 A;  2LAN A;  1TNP A;  4OV2 A;  2KQ6 A;  3MSE B;  4DRW A;  3CZ0 A;  3LL8 B;  5F6T A;  1Q80 A;  1B8R A;  4FQT A;  5CSN A;  1NP8 A;  1YRU B;  1NCX A;  3NXA A;  3OBV A;  3EK4 A;  2F3Z A;  1ORG A;  4ETO A;  2M3W A;  4DS7 A;  2KYF A;  1ZAC A;  1EG4 A;  1CMG A;  1WDC C;  4ZCU A;  3PLF B;  1MHO A;  4WQ2 A;  1CDN A;  4YGC B;  3WXA A;  2QPT A;  2I18 A;  5AFP A;  1YRT B;  1C7V A;  2JTZ A;  3DXL A;  1NUB A;  3CLN A;  2QEH A;  4QJ3 B;  2LP3 A;  1WRZ A;  5HYD A;  1IJ6 A;  2M97 A;  1HT9 A;  1GGZ A;  2JNF A;  3L47 A;  5BPJ A;  1TTX A;  2LCP A;  1H4B A;  2JC2 A;  3IF7 A;  1XFV O;  4JD9 A;  1X02 A;  5CSF A;  2WC8 A;  2WCE A;  1ZOT B;  4PHM A;  1ALV A;  3R1O A;  3S0A A;  4HRH A;  1V1G A;  1MR8 A;  3CZT X;  3RM1 A;  3SG3 A;  4CPV A;  1LS8 A;  2PAS A;  2EC6 C;  3PM8 A;  3I5G B;  1XFZ O;  3VRP A;  1UHH A;  4L9M A;  4PDZ A;  4IL1 A;  4NDC A;  4MBE A;  1UUR A;  4NDD A;  2M9G A;  1FI6 A;  3CYZ A;  1OOH A;  3DVJ A;  3O2P A;  4JPZ B;  2CTN A;  4GAO A;  3EG5 B;  1OSA A;  1Y0V H;  3FWC A;  5D3O A;  5G08 A;  4ZCV A;  4WQ3 A;  1DJZ A;  2I2R E;  1OOG A;  4NQG A;  4YRU A;  1WLM A;  3FE8 A;  4YGA A;  1T14 A;  1SY9 A;  1Y1X A;  1MWN A;  4MSP A;  2A4J A;  2KAY A;  1CDM A;  5FI6 A;  3TDU A;  2EHB A;  4AOM A;  1TOP A;  2KPH A;  2F2O A;  2BAP A;  1J1E A;  3ICB A;  3K1E A;  4UPG A;  4JQ0 D;  1OQP A;  3D10 A;  2HET A;  1UHN A;  1CFP A;  1KFX S;  4IJ7 A;  2MJW B;  3CAB A;  3CS1 A;  4GFT A;  1IRJ A;  4MN0 A;  1IIO A;  2M7N A;  4I5J A;  1V1F A;  2SCP A;  3TUY B;  1CFD A;  2JOJ A;  2L5Y A;  1NPQ A;  2KAX A;  1CMF A;  2MBX A;  1CKK A;  2L5X B;  3GK2 A;  3D0Y B;  1OOI X;  2MAZ A;  3TDZ A;  1Y1U A;  2KLE A;  3D74 A;  2K7B A;  1S3P A;  2BNX A;  3NSI A;  4CLN A;  1F71 A;  1BLQ A;  1SR6 B;  1EJ3 A;  2H61 C;  3B86 A;  4GUK A;  1TWO A;  2BE4 A;  2LMT A;  5ER4 X;  1Y1A A;  1RTP 1;  1YUU A;  2KQY A;  1GQM A;  1NX1 A;  2LLT A;  2AMI A;  2OTG C;  3D77 A;  1A75 B;  4OR9 B;  3SIB A;  4P2Y B;  1S5G Y;  1AK8 A;  1JSA A;  4MRX A;  4YI9 A;  2B1U A;  1ZFS A;  1KQM C;  2MRD A;  5B8I B;  4NDB A;  1F8H A;  3DVK A;  3CWG A;  1SPY A;  3DF0 B;  4MEW A;  2K2A A;  1LKJ A;  3D0Y A;  4HRG A;  1A2X A;  1L7Z A;  1LXF C;  1SNL A;  3IQO A;  3SS4 A;  5I94 A;  2ZND A;  5CSJ A;  1L2O B;  3S0D A;  3TZ1 A;  3BXK A;  1BT6 A;  1J7P A;  2KBI A;  3CDN A;  3DZT A;  1YVH A;  2LE9 B;  3BUN B;  1YR5 A;  1QLS A;  2LP2 A;  1A75 A;  5HKW A;  3IQQ A;  1DGU A;  3B6X A;  2F3Y A;  4CFR A;  2LLS A;  5FI7 A;  3NSO A;  4A4B A;  3R1P A;  3QME A;  2BKI B;  3ZWH A;  1FI5 A;  3DF0 A;  3EVU A;  2O5G A;  2P6B B;  1YVL A;  4DCK A;  3KO0 A;  2K7O A;  5I2O A;  3BYA A;  3KEV A;  1C07 A;  2Y1N A;  3FWB A;  4ORC B;  3JVT C;  3BFB A;  2M49 B;  1UUS A;  1N65 A;  2WC5 A;  3B7A A;  5FYX A;  1B7T Z;  4D1E A;  1JWD A;  1LA3 A;  3B87 A;  1MF8 B;  2LAP A;  5CPV A;  4M2P A;  3JTD B;  2IS9 A;  1QX7 A;  1S26 D;  2FCD A;  2MHH A;  1CNP A;  3TS5 C;  2LHI A;  3BUM B;  1QVI Y;  4N5X A;  1NCY A;  1MXE A;  2CCM A;  3M0W A;  1F4Q A;  1R6P A;  1KK8 B;  1XK4 A;  3EK8 A;  4U8D A;  1IQ3 A;  1NX0 A;  1DGV A;  3L4A A;  1SRA A;  5AAN A;  2CBL A;  2I7A A;  1N0Y A;  3S0E A;  2SAS A;  2Y1M A;  2CXJ A;  2G9B A;  3D73 A;  2L98 A;  1XO5 A;  1K90 D;  3RLZ A;  1FBV A;  1HQV A;  1Z2C B;  1S6I A;  2AUC A;  3OB2 B;  4M2Q A;  5HKY A;  2GGZ A;  1H8B A;  2M1K B;  1RFJ A;  2KLD A;  4PHN A;  1J7O A;  5GQQ C;  1K93 D;  2VRG A;  2Q91 A;  1OMV A;  2L51 A;  1F54 A;  3E3R A;  1MQ1 A;  2TN4 A;  4R1E A;  4C0K A;  1R2U A;  1XVJ A;  2M0R A;  4YGB B;  1YX8 A;  2LUX A;  1A4P A;  2ZNE A;  2KFF A;  1C3Z A;  2P70 A;  1KCY A;  2G2B A;  1DJX A;  1B47 A;  1UHJ A;  2WCL A;  3I5I B;  1IH0 A;  1Y6W A;  2KFG A;  1K94 A;  3BUX B;  3LLE A;  1P28 A;  3FS7 A;  5HL1 A;  4MZJ A;  3BFA A;  2WOR A;  2FJU B;  5DKR A;  5CSI A;  3IVT A;  3BUO B;  2F33 A;  1QX2 A;  2YGU A;  3I5G C;  3SG2 A;  3GK1 A;  2LVJ A;  1JUO A;  1M63 B;  1SL7 A;  4HSZ A;  4YGE B;  5HLO A;  1QV1 A;  3UNW A;  1AUI B;  2JRF A;  2KI4 B;  1TNQ A;  2LV7 A;  3K21 A;  1SW8 A;  4GNK B;  2PQL A;  2FCE A;  2NZ0 A;  5D7F A;  3TDI A;  2JXC A;  3EVV A;  1M39 A;  1N2D A;  3S0G A;  2LUC A;  2BE6 A;  1EXR A;  4N1F A;  4AQI A;  2L0P A;  1NX2 A;  1TNX A;  3EKH A;  1UHK A;  3PFV A;  2ISD A;  5DKQ A;  1JFJ A;  2K7D A;  3VRN A;  2E30 A;  2BBN A;  5AER A;  3I5F B;  2WC6 A;  3A8R A;  3EK7 A;  1VRK A;  4MLW A;  3N7H A;  2QEV A;  2QEO A;  1QAS A;  1NYA A;  1UP5 A;  3O78 A;  1XFR A;  4GBA A;  3I5H B;  2PRU A;  2AAO A;  3SG4 A;  1DQE A;  5JOL A;  2OPO A;  3TUY C;  2O60 A;  1K95 A;  3BUW B;  1EG3 A;  1QV0 A;  1DVI A;  3R1V A;  4Q04 A;  2K2F A;  2WCB A;  3AAK A;  3WNX B;  1ZUZ A;  1QXP A;  2JNX A;  4PAL A;  1QTX A;  3VRR A;  1CB1 A;  1SR6 C;  4JKT A;  5I2Q A;  3GOF A;  1OMR A;  2RGI A;  4YBH B;  1S1E A;  3NSK A;  1SK6 D;  1IGV A;  3WHT B;  1BMO A;  2BL0 B;  1XA5 A;  2WCK A;  4INW A;  1QIW A;  2FOT A;  1QLK A;  1NWD A;  5AEQ A;  3S0F A;  4GGN A;  2LVI A;  3WHU B;  1AP4 A;  5EL2 A;  5J3X A;  5I8N A;  3Q8I A;  2BCB A;  4PE1 A;  1DJG A;  1SCV A;  2PAL A;  3CR2 A;  1IJ5 A;  3CR5 X;  1QJT A;  1PAL A;  2FJY A;  3OX5 A;  3SIA A;  1CM4 A;  1U5I B;  2LVK A;  1SL9 A;  1L2O C;  1PVB A;  3LK0 A;  2P71 A;  1QX5 B;  1NX3 A;  1SMG A;  1J55 A;  2NCP A;  3H4S E;  1YUS A;  4F7F A;  1TUJ A;  1K8U A;  3PAT A;  1IG5 A;  3PM2 A;  4TNC A;  2K7C A;  1W7J B;  1OOJ A;  2LC5 A;  1SBJ A;  1REC A;  4F0Z B;  1TCF A;  3CGA A;  4ORB B;  2LHL A;  2ZKM X;  1DJH A;  2ERB A;  3A4U B;  3DY9 A;  4OCI A;  3PN7 B;  1U5I A;  3CZ2 A;  4PE4 A;  1XK4 C;  1SCM B;  2GV5 A;  3DVM A;  1G33 A;  3VB1 A;  1DF0 B;  1DJI A;  3NSL A;  4ICB A;  4C0J A;  2Y4Q A;  2LVV A;  1B9A A;  1OOF A;  2ZFD A;  3AAJ A;  1S6C A;  3AKA A;  3O4X A;  4BY4 A;  1C7W A;  5KSZ A;  4XYN A;  3VGO A;  1B1G A;  2MLF C;  2QDI A;  2BBM A;  4PE0 A;  1DMO A;  4USL A;  1MUX A;  1XYD A;  2K61 A;  3JTD C;  1G4Y R;  4PT1 A;  2H2K A;  3CTN A;  4N1G A;  1WRK A;  2LM5 A;  1NIW A;  1DEL A;  1EH2 A;  2JT8 A;  1LIN A;  2L4H A;  1SSE B;  1FW4 A;  2ZRT A;  3NGV A;  1YUT A;  3CZ1 A;  3DVE A;  3O4Y A;  4YGD B;  1JC2 A;  4M2O A;  1KK7 Z;  1G8I A;  1W9Z A;  1KK8 C;  2KI6 D;  3B88 A;  2JUL A;  1AJ5 A;  3FE9 A;  3KF9 A;  2HQW A;  2NXQ A;  4PE7 A;  1KWO B;  1M46 A;  1CM1 A;  1IQ5 A;  1DF0 A;  2MLE C;  2OS8 B;  1TRF A;  4P5O E;  1F55 A;  2L4I A;  2M1U A;  3DYE A;  3EKJ A;  3D76 A;  1F70 A;  4QJ4 B;  1SL8 A;  5KU1 A;  1UHI A;  4YI8 A;  3BOW B;  1BJF A;  5JJG A;  1FPW A;  1KSM A;  2KNE A;  3D78 A;  1K9K A;  1OMD A;  1RJV A;  1JBA A;  1KSO A;  3LCP C;  4PCW A;  4MVF A;  2JZI A;  4KYN A;  1OE9 B;  2PSR A;  1QS7 A;  1B8L A;  1RRO A;  4BY5 A;  1M45 A;  1WDC B;  3O6B A;  2Y5I A;  5DIC A;  5HLV A;  2WND A;  5D69 A;  1SYM A;  2WCM A;  1CDL A;  3SG5 A;  4PHK A;  4OVN F;  3HX4 A;  5ER5 A;  2E6W A;  1QVI Z;  3I5I C;  1BR1 B;  3BQ3 A;  2M29 A;  4CFQ A;  2JXL A;  3BOW A;  2KFH A;  4GPL B;  4XJK B;  2LLU A;  1LVC D;  1BOC A;  2GTE A;  1IKU A;  2L50 A;  2KGB C;  1PVA A;  2ZRS A;  3OP0 A;  1AVS A;  3OHM B;  2JPO A;  2CNP A;  2WOS A;  4PHJ A;  4INX A;  1KFU L;  2L2E A;  1JFK A;  3KPX A;  2KI4 C;  4HRE E;  2NCO A;  1OZO A;  2EC6 B;  4FTG A;  2COL B;  4FQO A;  1TUZ A;  1OW4 A;  2WCF A;  2BCX A;  1TCO B; 
#chains in the Genus database with same CATH homology
 2M7L A;  2R2I A;  1AHR A;  2JT3 A;  4WRI A;  4A4C A;  1K2H A;  1CLM A;  2V53 A;  4XJK A;  2PMY A;  2ZN8 A;  1CTR A;  1ZMZ A;  1B4C A;  1PUL A;  2K8M B;  1XFW O;  2BCA A;  3I5F C;  1TNW A;  3EVR A;  1JF2 A;  1KQV A;  1CFC A;  2BKH B;  1AJ4 A;  1XFX O;  2KGR A;  3I5H C;  2KI6 C;  1MXL C;  4I5L B;  4QJ5 B;  2HF5 A;  1XFY O;  1WRL A;  1XFU O;  1B8C A;  2F2P A;  1W7I B;  1TN4 A;  5DKN A;  1RWY A;  2JT0 A;  3SG6 A;  4GGF C;  2EGD A;  3SG7 A;  2NLN A;  1GJY A;  2LMV A;  2BEC A;  3F45 A;  2BL0 C;  1IWQ A;  4AQJ A;  1M31 A;  2Q4U A;  5K89 A;  2CT9 A;  1J7Q A;  1TIZ A;  2F8P A;  2D8N A;  1J7R A;  3AKB A;  1F4O A;  2ZN9 A;  3OB1 B;  5IBW A;  1GGW A;  5I2L A;  2LNK A;  3CR4 X;  1UWO A;  4MZL A;  2JU0 A;  1CLL A;  2KBM A;  2LMU A;  2OTG B;  4GGF A;  1PSR A;  2HPS A;  3VRO A;  2KDH A;  2HQ8 A;  1KQM B;  1BU3 A;  4JWQ A;  4E68 A;  3PSR A;  1EL4 A;  1ALW A;  2KYC A;  1WLZ A;  1B7T Y;  2DOQ A;  1CDP A;  1QIV A;  5HKZ A;  2KOT A;  1S36 A;  1JF0 A;  2JPT A;  5AXI A;  1A03 A;  1S6J A;  2KSP A;  3GK4 X;  3HCM A;  4I5N B;  2H61 A;  1DJY A;  1FF1 A;  3FIA A;  1CLB A;  5TNC A;  1RK9 A;  1S5G Z;  3PN7 C;  3LK1 A;  2PVB A;  4MRY A;  1D1O A;  1NSH A;  4C0L A;  3ZNI A;  1J1D A;  4I5K A;  1QAT A;  1SCM C;  1ODB A;  5PAL A;  1BOD A;  1KK7 Y;  4OKH A;  3PAL A;  4CID A;  4DUQ A;  3KHE A;  1A29 A;  1K9P A;  1BR4 B;  1KFU S;  2GGM A;  1KFX L;  1PRW A;  3JVT B;  2KAV A;  4DIR A;  1YTZ C;  2JWW A;  2MA2 A;  1LA0 A;  1YX7 A;  2K0J A;  2QAC A;  1CFF A;  1K9U A;  2I94 A;  3OX6 A;  2JTT A;  3VRQ A;  1DTL A;  4ORA B;  2JQ6 A;  1KWO C;  1PSB A;  1PK0 D;  1OZS A;  2OS8 C;  1WY9 A;  5KTY A;  1K96 A;  1YUR A;  1NCZ A;  3C1V A;  3TS5 B;  1BF5 A;  3SJS A;  3QRX A;  2M8U A;  1SKT A;  1E8A A;  3DD4 A;  1DJW A;  2KHN A;  4MZK A;  1BG1 A;  2LAN A;  1TNP A;  4OV2 A;  2KQ6 A;  3MSE B;  4DRW A;  3LL8 B;  5F6T A;  1Q80 A;  1B8R A;  5CSN A;  1NP8 A;  1YRU B;  1NCX A;  3NXA A;  3EK4 A;  2F3Z A;  4ETO A;  2M3W A;  4DS7 A;  2KYF A;  1ZAC A;  1EG4 A;  1CMG A;  1WDC C;  4ZCU A;  3PLF B;  1MHO A;  4WQ2 A;  1CDN A;  4YGC B;  3WXA A;  2QPT A;  2I18 A;  5AFP A;  1YRT B;  1C7V A;  2JTZ A;  1NUB A;  3CLN A;  4QJ3 B;  2LP3 A;  1WRZ A;  5HYD A;  1IJ6 A;  2M97 A;  1HT9 A;  1GGZ A;  2JNF A;  5BPJ A;  1TTX A;  2LCP A;  1H4B A;  2JC2 A;  3IF7 A;  1XFV O;  1X02 A;  5CSF A;  2WC8 A;  2WCE A;  1ZOT B;  4PHM A;  1ALV A;  4HRH A;  1V1G A;  1MR8 A;  3CZT X;  3RM1 A;  3SG3 A;  4CPV A;  2PAS A;  2EC6 C;  3PM8 A;  3I5G B;  1XFZ O;  3VRP A;  1UHH A;  4L9M A;  4PDZ A;  4IL1 A;  4NDC A;  4MBE A;  1UUR A;  4NDD A;  2M9G A;  1FI6 A;  3DVJ A;  3O2P A;  4JPZ B;  2CTN A;  4GAO A;  1OSA A;  1Y0V H;  3FWC A;  5G08 A;  4ZCV A;  4WQ3 A;  1DJZ A;  2I2R E;  4YRU A;  4NQG A;  1WLM A;  4YGA A;  1SY9 A;  1Y1X A;  1MWN A;  4MSP A;  2A4J A;  2KAY A;  1CDM A;  4AOM A;  3TDU A;  2EHB A;  1TOP A;  2F2O A;  3ICB A;  1J1E A;  4UPG A;  4JQ0 D;  1OQP A;  3D10 A;  2HET A;  1UHN A;  1CFP A;  1KFX S;  2MJW B;  3CS1 A;  4MN0 A;  4GFT A;  1IRJ A;  2M7N A;  4I5J A;  1V1F A;  2SCP A;  3TUY B;  1CFD A;  2JOJ A;  1NPQ A;  2KAX A;  1CMF A;  2MBX A;  1CKK A;  2L5X B;  3GK2 A;  3D0Y B;  2MAZ A;  3TDZ A;  1Y1U A;  2K7B A;  1S3P A;  3NSI A;  4CLN A;  1F71 A;  1BLQ A;  1SR6 B;  1EJ3 A;  2H61 C;  4GUK A;  2BE4 A;  2LMT A;  5ER4 X;  1Y1A A;  1RTP 1;  1YUU A;  2KQY A;  1GQM A;  1NX1 A;  2LLT A;  2AMI A;  2OTG C;  4OR9 B;  1A75 B;  3SIB A;  4P2Y B;  1S5G Y;  1AK8 A;  1JSA A;  4MRX A;  4YI9 A;  2B1U A;  1ZFS A;  1KQM C;  2MRD A;  5B8I B;  4NDB A;  1F8H A;  3DVK A;  3CWG A;  1SPY A;  3DF0 B;  4MEW A;  2K2A A;  1LKJ A;  3D0Y A;  4HRG A;  1A2X A;  1L7Z A;  1LXF C;  1SNL A;  3IQO A;  2ZND A;  5CSJ A;  1L2O B;  3TZ1 A;  3BXK A;  1BT6 A;  1J7P A;  2KBI A;  1YVH A;  2LE9 B;  3BUN B;  1YR5 A;  1QLS A;  2LP2 A;  1A75 A;  5HKW A;  3IQQ A;  1DGU A;  2F3Y A;  4CFR A;  2LLS A;  3NSO A;  4A4B A;  2BKI B;  3ZWH A;  1FI5 A;  3DF0 A;  3EVU A;  2O5G A;  2P6B B;  1YVL A;  4DCK A;  3KO0 A;  2K7O A;  5I2O A;  3BYA A;  3KEV A;  1C07 A;  2Y1N A;  3FWB A;  4ORC B;  3JVT C;  2M49 B;  1UUS A;  1N65 A;  5FYX A;  1B7T Z;  4D1E A;  1JWD A;  1LA3 A;  1MF8 B;  2LAP A;  5CPV A;  4M2P A;  3JTD B;  2IS9 A;  1QX7 A;  1S26 D;  2FCD A;  2MHH A;  1CNP A;  3TS5 C;  2LHI A;  3BUM B;  1QVI Y;  4N5X A;  1NCY A;  1MXE A;  2CCM A;  3M0W A;  1F4Q A;  1R6P A;  1KK8 B;  1XK4 A;  3EK8 A;  4U8D A;  1IQ3 A;  1NX0 A;  1DGV A;  5AAN A;  1SRA A;  2CBL A;  2I7A A;  1N0Y A;  2SAS A;  2Y1M A;  2CXJ A;  2G9B A;  2L98 A;  1XO5 A;  1K90 D;  3RLZ A;  1FBV A;  1HQV A;  1S6I A;  2AUC A;  3OB2 B;  4M2Q A;  5HKY A;  2GGZ A;  1H8B A;  2M1K B;  1RFJ A;  4PHN A;  1J7O A;  5GQQ C;  1K93 D;  2VRG A;  2Q91 A;  1OMV A;  2L51 A;  1F54 A;  3E3R A;  1MQ1 A;  2TN4 A;  4R1E A;  4C0K A;  1R2U A;  1XVJ A;  2M0R A;  4YGB B;  1YX8 A;  2LUX A;  1A4P A;  2ZNE A;  2KFF A;  1KCY A;  2G2B A;  1DJX A;  1B47 A;  1UHJ A;  3I5I B;  1IH0 A;  1Y6W A;  2KFG A;  1K94 A;  3BUX B;  3LLE A;  3FS7 A;  4MZJ A;  2WOR A;  2FJU B;  5DKR A;  5CSI A;  3BUO B;  2F33 A;  1QX2 A;  3I5G C;  3SG2 A;  3GK1 A;  2LVJ A;  1JUO A;  1M63 B;  1SL7 A;  4HSZ A;  4YGE B;  5HLO A;  1QV1 A;  1AUI B;  2JRF A;  2KI4 B;  1TNQ A;  2LV7 A;  3K21 A;  1SW8 A;  4GNK B;  2FCE A;  2NZ0 A;  5D7F A;  3TDI A;  2JXC A;  3EVV A;  1M39 A;  1N2D A;  2LUC A;  2BE6 A;  1EXR A;  4N1F A;  4AQI A;  2L0P A;  1NX2 A;  1TNX A;  3EKH A;  1UHK A;  3PFV A;  2ISD A;  5DKQ A;  1JFJ A;  2K7D A;  3VRN A;  2E30 A;  2BBN A;  5AER A;  3I5F B;  3EK7 A;  3A8R A;  4MLW A;  1VRK A;  1QAS A;  1NYA A;  1UP5 A;  3O78 A;  4GBA A;  3I5H B;  2PRU A;  2AAO A;  3SG4 A;  5JOL A;  2OPO A;  3TUY C;  2O60 A;  1K95 A;  3BUW B;  1EG3 A;  1QV0 A;  1DVI A;  4Q04 A;  2K2F A;  2WCB A;  3AAK A;  3WNX B;  1ZUZ A;  1QXP A;  2JNX A;  4PAL A;  1QTX A;  3VRR A;  1SR6 C;  5I2Q A;  3GOF A;  1OMR A;  2RGI A;  4YBH B;  1S1E A;  3NSK A;  1SK6 D;  1IGV A;  3WHT B;  1BMO A;  2BL0 B;  1XA5 A;  1QIW A;  2FOT A;  1QLK A;  1NWD A;  5AEQ A;  4GGN A;  2LVI A;  3WHU B;  1AP4 A;  5J3X A;  5I8N A;  2BCB A;  4PE1 A;  1DJG A;  1SCV A;  2PAL A;  3CR2 A;  1IJ5 A;  3CR5 X;  1QJT A;  1PAL A;  3OX5 A;  3SIA A;  1CM4 A;  1U5I B;  2LVK A;  1SL9 A;  1L2O C;  1PVB A;  3LK0 A;  1QX5 B;  1NX3 A;  1SMG A;  1J55 A;  2NCP A;  3H4S E;  1YUS A;  1K8U A;  3PAT A;  1IG5 A;  4TNC A;  2K7C A;  1W7J B;  1OOJ A;  2LC5 A;  1SBJ A;  1REC A;  4F0Z B;  1TCF A;  3CGA A;  4ORB B;  2LHL A;  2ZKM X;  1DJH A;  4OCI A;  3A4U B;  3PN7 B;  1U5I A;  4PE4 A;  1XK4 C;  1SCM B;  2GV5 A;  3DVM A;  1G33 A;  1DF0 B;  1DJI A;  3NSL A;  4ICB A;  4C0J A;  2Y4Q A;  2LVV A;  1B9A A;  2ZFD A;  3AAJ A;  3AKA A;  1S6C A;  4BY4 A;  5KSZ A;  1C7W A;  4XYN A;  3VGO A;  1B1G A;  2MLF C;  2BBM A;  4PE0 A;  1DMO A;  4USL A;  1MUX A;  1XYD A;  2K61 A;  3JTD C;  1G4Y R;  2H2K A;  3CTN A;  4N1G A;  1WRK A;  2LM5 A;  1NIW A;  1EH2 A;  2JT8 A;  1LIN A;  2L4H A;  1FW4 A;  2ZRT A;  3O4Y A;  1YUT A;  3DVE A;  4YGD B;  1JC2 A;  4M2O A;  1KK7 Z;  1G8I A;  2KI6 D;  1KK8 C;  1DT7 B;  1CB1 A;  2JUL A;  1AJ5 A;  4PE7 A;  3KF9 A;  2HQW A;  2NXQ A;  1KWO B;  1M46 A;  1CM1 A;  1IQ5 A;  1DF0 A;  2MLE C;  2OS8 B;  1TRF A;  4P5O E;  1F55 A;  2L4I A;  2M1U A;  3EKJ A;  1F70 A;  4QJ4 B;  1SL8 A;  5KU1 A;  1UHI A;  4YI8 A;  3BOW B;  1BJF A;  5JJG A;  1FPW A;  1KSM A;  2KNE A;  1K9K A;  1OMD A;  1RJV A;  1JBA A;  1KSO A;  3LCP C;  4PCW A;  4MVF A;  2JZI A;  1OE9 B;  2PSR A;  1QS7 A;  1B8L A;  1RRO A;  4BY5 A;  1M45 A;  1WDC B;  3O6B A;  2Y5I A;  5HLV A;  2WND A;  5D69 A;  1SYM A;  1CDL A;  3SG5 A;  4PHK A;  4OVN F;  3HX4 A;  5ER5 A;  2E6W A;  1QVI Z;  3I5I C;  1BR1 B;  3BQ3 A;  2M29 A;  4CFQ A;  2JXL A;  3BOW A;  2KFH A;  4GPL B;  4XJK B;  2LLU A;  1LVC D;  1BOC A;  1IKU A;  2L50 A;  2KGB C;  1PVA A;  2ZRS A;  3OP0 A;  1AVS A;  3OHM B;  2CNP A;  2WOS A;  4PHJ A;  1KFU L;  2L2E A;  1JFK A;  3KPX A;  2KI4 C;  4HRE E;  2NCO A;  1OZO A;  2EC6 B;  4FTG A;  2COL B;  4FQO A;  2WCF A;  2BCX A;  1TCO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...