2BBMA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbmA02
3O6BA 1SNLA 1RK9A 2F2PA 2Y5IA 4N1FA 4I5KA 2MBXA 3HCMA 2M97A 1QX5B 2Y4QA 2BBNA 3CR5X 2KFGA 3BOWB 1KSOA 1QS7A 1ODBA 2BCBA 2M49B 2R2IA 1XK4A 1NX1A 2L50A 3D0YA 4JPZB 1QV0A 4ETOA 1SCMC 3SG7A 3TS5C 1J7RA 1QIWA 1IWQA 4U8DA 1Y1XA 4PCWA 2KOTA 1XK4C 3BUXB 1QASA 2JNXA 3BUNB 1XFXO 1S26D 2KQ6A 1E8AA 1L2OB 1UHJA 3I5GB 1FW4A 1RWYA 1SKTA 2KYCA 3WHUB 3I5HB 1K8UA 1K96A 4PE0A 2EHBA 2HF5A 2SCPA 2LM5A 1BLQA 2PSRA 2FCEA 2LV7A 1BR1B 1Y1UA 4HRGA 3SIAA 1LA0A 4BY4A 1K93D 2LC5A 2LLSA 2NCPA 3LCPC 3LLEA 4OKHA 4PHMA 2TN4A 4HSZA 3GK2A 2ZNDA 4CPVA 2K7CA 1DJIA 1BR4B 2K2FA 2HETA 1BOCA 1YX8A 1DJHA 4WQ3A 1KFUS 1YVHA 2COLB 1J1DA 3SG5A 2WCEA 2K0JA 4MLWA 2LCPA 4CFQA 4CFRA 5I2OA 2HPSA 5D7FA 1J55A 1SCVA 4OR9B 2O60A 2KNEA 2M7NA 3DF0B 3O78A 2JRFA 1YTZC 3RLZA 1MF8B 2Y1NA 1NCYA 1PSBA 1LKJA 1MXLC 2MJWB 5CSIA 2JXLA 3TUYC 4USLA 1VRKA 3EK4A 1QX7A 2LP2A 1OQPA 1JBAA 1RROA 1L7ZA 3CWGA 1MXEA 5HYDA 1F4QA 4A4BA 3MSEB 3GK1A 2VRGA 2KAYA 1HT9A 3NSKA 3OX5A 3BUWB 4QJ3B 2F2OA 1MUXA 1BODA 2JZIA 1EL4A 2EC6B 5HKYA 1TNPA 1JUOA 3SG3A 3CZTX 2LANA 4HREE 2KAXA 3D0YB 3GOFA 3VGOA 3A4UB 1JSAA 3WHTB 3TZ1A 2KBMA 1SR6C 5K89A 1NCXA 2BE6A 3IQQA 1OOJA 3K21A 2LVJA 1S3PA 2LMTA 3BXKA 4N1GA 5ER4X 2I7AA 4WQ2A 4C0KA 3BQ3A 3EK8A 3NSIA 1YUTA 2KGBC 1R2UA 2JNFA 3I5HC 1DJYA 1ALVA 5BPJA 2EGDA 1Y1AA 4PE4A 4GGFC 1IKUA 3NXAA 2NXQA 5PALA 5CSJA 3SJSA 1MWNA 1JF2A 1MQ1A 3PSRA 4YGDB 1XFYO 2MLFC 4DUQA 1IH0A 4XJKB 5AXIA 1IQ5A 3TDIA 2LLTA 3H4SE 1ALWA 1BF5A 1TNQA 1NWDA 2WOSA 1CM4A 3OX6A 4ZCVA 2CNPA 5DKNA 2I2RE 3M0WA 1CLBA 1QTXA 1B7TY 1A4PA 3TUYB 5G08A 1XFWO 2WCFA 4PHJA 1TNWA 3AKBA 3I5FC 3JVTC 5AEQA 2NZ0A 4NDBA 1WRZA 1B7TZ 1C07A 2H61A 4ORAB 4AOMA 2HQ8A 4PE7A 3KHEA 1UHHA 1RJVA 4ORCB 1OMRA 1EG4A 1DJXA 1AVSA 1XFZO 1Q80A 1IRJA 1TTXA 2H61C 5TNCA 1KK7Y 3VRRA 1PK0D 3CS1A 5AANA 4DS7A 2PMYA 2M1UA 4FTGA 2JULA 1PALA 1CM1A 1Y0VH 2CBLA 2MAZA 2RGIA 1XVJA 5DKQA 2KQYA 2EC6C 4PHKA 2K61A 4M2QA 4YGCB 2PVBA 2MRDA 1IJ5A 1RTP1 3O4YA 1UP5A 4N5XA 1SR6B 2E30A 4ICBA 4I5LB 5I2LA 4QJ4B 1DJZA 1ZACA 1LA3A 2O5GA 3E3RA 1NCZA 1F4OA 5KSZA 2SASA 1NYAA 1HQVA 5HLVA 2K7BA 1EJ3A 5JOLA 3I5IB 1SBJA 2LHIA 4C0JA 4GBAA 4E68A 1B8RA 1D1OA 5B8IB 3EKHA 1B47A 2BBMA 2MA2A 3CR2A 1QLKA 1U5IA 1H4BA 1BG1A 3QRXA 1DJGA 1CNPA 1AJ5A 1XFUO 2JPTA 2Q91A 1DF0A 1GQMA 2Q4UA 2D8NA 2FCDA 1J7PA 1UWOA 4M2OA 3TDZA 5GQQC 1CKKA 2F33A 1K90D 1BMOA 1DTLA 2BCXA 3NSLA 4BY5A 5KU1A 2CTNA 1NSHA 1S6CA 3I5FB 3JVTB 1CFPA 4UPGA 1J7OA 4GPLB 1YUUA 2L51A 3ZWHA 1OMDA 1XA5A 4YRUA 1V1GA 3VRNA 4OCIA 1CTRA 1WLMA 1FI6A 5D69A 1YR5A 2MHHA 1WRLA 3VRQA 3WXAA 1KFXL 1TRFA 3EK7A 2B1UA 2KDHA 2K7DA 2JT3A 2OTGB 3CLNA 4A4CA 1N2DA 1F71A 2KI4C 2HQWA 1UHKA 2KYFA 1SRAA 2LHLA 2AMIA 4PDZA 3FWCA 1CLLA 1BT6A 1WRKA 1KWOC 4NDCA 1EG3A 1TCOB 4MZLA 1W7JB 3EVVA 4P2YB 1KK8B 1LINA 1JWDA 2LVVA 2KI6C 1J1EA 3DVMA 3FIAA 2OS8B 4TNCA 4L9MA 3PM8A 1M45A 3EVUA 2M1KB 2CXJA 1A75A 2LUXA 2KI6D 2LAPA 2K7OA 3GK4X 3I5IC 4R1EA 2M29A 1K2HA 3CGAA 5HLOA 4MRXA 1SL8A 3SG2A 1CDMA 2LMVA 4PE1A 2L5XB 1QXPA 2LMUA 2L2EA 3IF7A 1PRWA 1DJWA 4PALA 2PASA 3LL8B 1YUSA 2JT8A 4MZKA 3LK0A 1G33A 1SYMA 3DVJA 2ZFDA 1ZMZA 1DF0B 2JTTA 1CLMA 2JWWA 4NQGA 1PVAA 2AAOA 1SK6D 4NDDA 3FS7A 5CPVA 1EH2A 1N65A 1NIWA 3PATA 1CMGA 1M63B 1UUSA 2G9BA 1YRTB 3PFVA 1H8BA 4MBEA 3BUOB 4PHNA 2M7LA 1KFXS 1JF0A 1CFCA 2FOTA 1DT7B 1LVCD 2MLEC 3A8RA 3SG6A 4AQIA 3DF0A 1IG5A 2PRUA 1R6PA 4I5JA 1KFUL 1XO5A 2LE9B 5CSNA 3SIBA 2E6WA 4MEWA 1C7WA 1SY9A 1QV1A 2L4HA 2KI4B 4JWQA 3WNXB 1KK7Z 1NPQA 2OTGC 4MZJA 3FWBA 1XFVO 1KWOB 3TDUA 1AJ4A 1NUBA 4DIRA 1ZUZA 1OZSA 1TOPA 3CR4X 1KK8C 4YGAA 2JXCA 3ICBA 2H2KA 2V53A 3JTDC 4MVFA 5IBWA 1CFFA 1YRUB 1CB1A 2OS8C 4IL1A 3OB2B 4D1EA 1KQMC 1PSRA 4WRIA 4C0LA 2I18A 1KQVA 1B4CA 1EXRA 1FI5A 1S1EA 1A75B 2BKIB 3PN7C 1QATA 2QACA 1QJTA 2KFFA 1GGWA 4CIDA 2OPOA 1TCFA 1F54A 1GGZA 2LUCA 1AP4A 1FBVA 3DD4A 1NX3A 4OVNF 1YURA 2KBIA 3KF9A 5HKWA 4YGBB 1GJYA 2WNDA 2BECA 2L0PA 1SL9A 1B8LA 1NX0A 1KSMA 1A03A 1UHNA 2WC8A 1PVBA 3AAJA 2KAVA 1OSAA 2ZN9A 2BE4A 1OZOA 1C7VA 3KEVA 2F8PA 1Y6WA 1XYDA 4HRHA 2Y1MA 3BYAA 4XJKA 5HKZA 1QVIY 1BJFA 2M0RA 4XYNA 5J3XA 1CDNA 1JFJA 3F45A 2IS9A 2BL0B 1WDCB 1W7IB 1B9AA 2M9GA 2M8UA 1OMVA 1YX7A 2GV5A 2WORA 1QVIZ 1NP8A 5AERA 3KO0A 4AQJA 5JJGA 2K8MB 1SL7A 1G8IA 3CTNA 3C1VA 3ZNIA 4GUKA 2ZRTA 1MR8A 1TIZA 1DMOA 2DOQA 4GFTA 1K9PA 1RECA 3AAKA 1CFDA 1F55A 4MN0A 2G2BA 2JOJA 4YGEB 1OE9B 1F8HA 1KCYA 1QLSA 2NCOA 2LVIA 3HX4A 3DVEA 2JQ6A 2LLUA 1SW8A 5I8NA 1LXFC 3BOWA 1M39A 1NX2A 1TNXA 3PLFB 2ZRSA 5I2QA 1S6IA 2BKHB 3JTDB 1S36A 4YBHB 3OHMB 3EKJA 1DVIA 5FYXA 1FF1A 1J7QA 5F6TA 1G4YR 1K9KA 4OV2A 1KQMB 1S5GY 4ORBB 3PALA 3O2PA 1SCMB 3OP0A 5AFPA 3TS5B 1DGUA 1ZFSA 1WLZA 1CMFA 2WCBA 3LK1A 1K94A 1S5GZ 3PN7B 1CDPA 2F3YA 2AUCA 3BUMB 1MHOA 2GGZA 1UHIA 3NSOA 2ZN8A 4GNKB 1U5IB 1B1GA 1JFKA 3EVRA 1QIVA 2ZNEA 4GAOA 5CSFA 2M3WA 4MRYA 2L98A 5ER5A 1AK8A 1JC2A 2QPTA 1BU3A 4Q04A 2CCMA 2CT9A 1L2OC 4GGFA 3OB1B 4YI9A 1SPYA 2A4JA 2KGRA 3I5GC 1CDLA 2LNKA 1ZOTB 2I94A 1K95A 1K9UA 1DGVA 2JU0A 1X02A 2JTZA 3KPXA 2GGMA 1IQ3A 4FQOA 2BCAA 1PULA 2NLNA 3RM1A 2L4IA 2PALA 3AKAA 4I5NB 4CLNA 1IJ6A 2K2AA 4ZCUA 2ZKMX 4P5OE 4DRWA 3D10A 3VROA 4JQ0D 1B8CA 4F0ZB 2JT0A 1AHRA 2KFHA 3VRPA 1F70A 2BL0C 5DKRA 1TN4A 1WDCC 1WY9A 3SG4A 4QJ5B 1M31A 2JC2A 2KSPA 2LP3A 2P6BB 1SMGA 1FPWA 1N0YA 2FJUB 4MSPA 1QX2A 1M46A 2KHNA 1RFJA 2ISDA 4M2PA 2F3ZA 5KTYA 4YI8A 3DVKA 2LVKA 1A29A 1AUIB 3IQOA 4GGNA 1YVLA 4DCKA 1V1FA 1UURA 1IGVA 1A2XA 1S6JA
chains in the Genus database with same CATH superfamily
2P70A 3O6BA 3OGNA 1SNLA 1RK9A 1Z4HA 2F2PA 2BNXA 2Y5IA 4I5KA 4N1FA 1OW4A 2MBXA 3HCMA 2M97A 1QX5B 2Y4QA 2BBNA 3CR5X 2KFGA 3BOWB 1KSOA 1QS7A 1ODBA 2BCBA 2M49B 2R2IA 1XK4A 1NX1A 2L50A 3D0YA 4JPZB 1QV0A 4ETOA 4IJ7A 1SCMC 3S0GA 3SG7A 3TS5C 1J7RA 1QIWA 1IWQA 4U8DA 1Y1XA 3R1VA 4PCWA 2KOTA 1XK4C 3BUXB 1QASA 1TWOA 2JNXA 3BUNB 1XFXO 2ERBA 1S26D 2KQ6A 1E8AA 1L2OB 1UHJA 2QDIA 3I5GB 3IVTA 1FW4A 1RWYA 1SKTA 2KYCA 3WHUB 3I5HB 1K8UA 1K96A 3R1OA 4PE0A 2EHBA 2HF5A 2SCPA 2LM5A 1BLQA 2PSRA 2PQLA 2FCEA 2LV7A 3UO9A 1BR1B 1Y1UA 4HRGA 3SIAA 1LA0A 4BY4A 1K93D 2LC5A 2LLSA 2NCPA 5D3OA 3LCPC 3LLEA 4OKHA 4PHMA 2TN4A 4HSZA 3GK2A 2ZNDA 4CPVA 2K7CA 1DJIA 3R72A 1BR4B 2K2FA 2HETA 1BOCA 1YX8A 1DJHA 4WQ3A 1KFUS 1YVHA 2COLB 3BFBA 1J1DA 3SG5A 2WCEA 2K0JA 4MLWA 2LCPA 4CFQA 3DYEA 4CFRA 5I2OA 2HPSA 5D7FA 3O4XA 1J55A 1SCVA 4OR9B 2O60A 3NGVA 2KNEA 2M7NA 3DF0B 3EG5B 2JRFA 3O78A 1YTZC 3RLZA 1MF8B 2Y1NA 1NCYA 1PSBA 1LKJA 1MXLC 2MJWB 5CSIA 2JXLA 3TUYC 4USLA 1VRKA 3EK4A 1QX7A 3S0EA 2LP2A 1OQPA 3NHIA 1JBAA 1RROA 1L7ZA 3CWGA 1MXEA 3D76A 5HYDA 2L2CA 1F4QA 4A4BA 3MSEB 3GK1A 2VRGA 2KAYA 1HT9A 3NSKA 3OX5A 3BUWB 4QJ3B 2F2OA 1MUXA 1BODA 2JZIA 1EL4A 2EC6B 5HKYA 1TNPA 1JUOA 3SG3A 3CZTX 2LANA 4HREE 2KAXA 3D0YB 3GOFA 3VGOA 4KYNA 3UNWA 3A4UB 1JSAA 1SSEB 3SS5A 3FE8A 3TZ1A 2KBMA 3WHTB 1SR6C 5K89A 4PT1A 1NCXA 2BE6A 3IQQA 1OOJA 3K21A 2LVJA 1S3PA 2LMTA 3BXKA 4N1GA 5ER4X 2I7AA 4WQ2A 4C0KA 3BQ3A 3EK8A 1DELA 1YUTA 2KGBC 1R2UA 2JNFA 3I5HC 3NSIA 1DJYA 1ALVA 3K1EA 5BPJA 2EGDA 1Y1AA 4PE4A 4GGFC 1IKUA 3NXAA 2NXQA 5PALA 3DY9A 4JD9A 3DZTA 5CSJA 3SJSA 3V2LA 1MWNA 1JF2A 1MQ1A 3PSRA 4YGDB 1XFYO 2MLFC 4DUQA 1IH0A 4XJKB 5AXIA 1IQ5A 2WCMA 3TDIA 2LLTA 3H4SE 1ALWA 1BF5A 1TNQA 1NWDA 2BAPA 2WOSA 1CM4A 3OX6A 4ZCVA 2CNPA 5DKNA 2I2RE 3M0WA 1CLBA 1QTXA 1B7TY 1A4PA 3D77A 3TUYB 5G08A 1XFWO 2WCFA 4PHJA 1TNWA 1C3ZA 3AKBA 3I5FC 3JVTC 5AEQA 2NZ0A 4NDBA 1WRZA 1B7TZ 5FI7A 1C07A 2H61A 4ORAB 4AOMA 2HQ8A 3S0FA 4PE7A 3KHEA 1UHHA 1RJVA 4ORCB 1OMRA 1EG4A 1DJXA 1AVSA 1XFZO 1Q80A 1IRJA 1TTXA 2H61C 2YGUA 1KK7Y 3VRRA 1PK0D 3CS1A 4FQTA 5AANA 4DS7A 2PMYA 2M1UA 4FTGA 2JULA 1PALA 1CM1A 1Y0VH 2CBLA 2MAZA 2RGIA 4INXA 1XVJA 5DKQA 2KQYA 2EC6C 1FF1A 4PHKA 2K61A 4M2QA 4YGCB 2PVBA 3OBVA 2MRDA 1IJ5A 1RTP1 3O4YA 1UP5A 4N5XA 1SR6B 2E30A 4F7FA 4ICBA 4I5LB 5I2LA 4QJ4B 1DJZA 1ZACA 1LA3A 2O5GA 1OOGA 3E3RA 1NCZA 1F4OA 5KSZA 2SASA 1NYAA 1HQVA 5HLVA 2K7BA 1EJ3A 5JOLA 3I5IB 1SBJA 2LHIA 4C0JA 4GBAA 4E68A 1B8RA 1D1OA 5B8IB 3EKHA 1B47A 2BBMA 2MA2A 3CR2A 1DQEA 1QLKA 1U5IA 2L5YA 1H4BA 1BG1A 3CYZA 3QRXA 1DJGA 1CNPA 1AJ5A 1XFUO 2JPTA 2Q91A 1DF0A 1GQMA 2Q4UA 3RZSA 2D8NA 2FCDA 1J7PA 1UWOA 4M2OA 3TDZA 5GQQC 1CKKA 2F33A 5EL2A 1K90D 1BMOA 3Q8IA 1DTLA 2BCXA 3NSLA 4BY5A 1OOFA 5KU1A 2CTNA 1NSHA 1S6CA 3B86A 3I5FB 3JVTB 1CFPA 4UPGA 1Z2CB 1J7OA 4GPLB 1YUUA 2L51A 3ZWHA 1OMDA 1XA5A 4YRUA 1V1GA 3VRNA 4OCIA 1CTRA 2KPHA 5TNCA 1WLMA 1FI6A 1P28A 5D69A 1YR5A 2MHHA 2GTEA 1WRLA 3L4LA 3VRQA 3WXAA 1KFXL 1TRFA 3EK7A 3S0AA 2B1UA 1TUZA 2KDHA 2K7DA 2JT3A 2OTGB 3CLNA 4A4CA 3NHTA 1N2DA 1F71A 2KI4C 2HQWA 1UHKA 2KYFA 1SRAA 2LHLA 2AMIA 4PDZA 3FWCA 1CLLA 1BT6A 1WRKA 1KWOC 4NDCA 1EG3A 1TCOB 4MZLA 1W7JB 3EVVA 2WCLA 4P2YB 1OOIX 3VB1A 1KK8B 1LINA 1JWDA 2KLEA 2LVVA 2KI6C 1J1EA 3DVMA 3FIAA 2OS8B 4TNCA 4L9MA 3PM8A 3DXLA 1M45A 2QEOA 3EVUA 2M1KB 2CXJA 1A75A 2P71A 2LUXA 2KI6D 2LAPA 2K7OA 3CZ2A 3GK4X 3I5IC 4R1EA 2M29A 1K2HA 3CGAA 5HLOA 4MRXA 1SL8A 3SG2A 1CDMA 2LMVA 4PE1A 2L5XB 1QXPA 2LMUA 2L2EA 3IF7A 1PRWA 1DJWA 4PALA 3S0BA 2PASA 3LL8B 1YUSA 2JT8A 4MZKA 3LK0A 1G33A 1SYMA 3DVJA 2ZFDA 1ZMZA 1DF0B 2JTTA 1CLMA 2H8VA 2JWWA 4NQGA 1PVAA 2AAOA 1SK6D 4NDDA 3FS7A 5CPVA 1EH2A 1N65A 1NIWA 3PATA 1CMGA 1M63B 1UUSA 1W9ZA 1YRTB 2G9BA 1DC1A 3PFVA 1H8BA 4MBEA 3D74A 3BUOB 3BFAA 4PHNA 2M7LA 3PM2A 1KFXS 1JF0A 1CFCA 2FOTA 1DT7B 5I94A 1LVCD 2MLEC 3A8RA 3SG6A 4AQIA 2QEBA 3DF0A 1IG5A 2PRUA 1R6PA 4I5JA 1KFUL 1XO5A 2LE9B 5CSNA 3SIBA 2E6WA 4MEWA 1C7WA 1SY9A 3S0DA 1QV1A 2L4HA 2KI4B 4JWQA 5HL1A 3WNXB 1KK7Z 1NPQA 2JPOA 2OTGC 4MZJA 3FWBA 1XFVO 3L4AA 3D75A 1TUJA 1KWOB 3TDUA 1AJ4A 1NUBA 2FJYA 5FI2A 4DIRA 1ZUZA 1IIOA 1OZSA 1TOPA 3CR4X 1KK8C 1GM0A 4YGAA 2JXCA 3ICBA 3SS4A 2H2KA 2V53A 3JTDC 4MVFA 5IBWA 1CFFA 1YRUB 1CB1A 2OS8C 4IL1A 3OB2B 1QWVA 1KQMC 3FE9A 4INWA 4D1EA 1PSRA 4WRIA 3CZ1A 4C0LA 2I18A 1KQVA 1B4CA 1EXRA 2PYQA 3N7HA 1S1EA 1FI5A 1A75B 2BKIB 3PN7C 1QATA 2QACA 1QJTA 2KFFA 1GGWA 4CIDA 2OPOA 1TCFA 1F54A 1GGZA 2LUCA 1AP4A 1FBVA 3DD4A 1NX3A 4OVNF 1YURA 2KBIA 3KF9A 5HKWA 4JKTA 4YGBB 1GJYA 2WC6A 2WNDA 2BECA 2L0PA 1T14A 1SL9A 1B8LA 1NX0A 3L47A 1KSMA 1XFRA 1A03A 1UHNA 2WC8A 1PVBA 3AAJA 2KAVA 1OSAA 2ZN9A 2BE4A 1OZOA 1C7VA 3KEVA 2F8PA 1Y6WA 1XYDA 4HRHA 2Y1MA 3BYAA 4XJKA 5HKZA 3BJHA 1QVIY 1BJFA 2M0RA 4XYNA 5J3XA 1CDNA 1JFJA 3F45A 2IS9A 1DEKA 2BL0B 1WDCB 1W7IB 1B9AA 2M9GA 2M8UA 1OMVA 1YX7A 2GV5A 2WORA 1QVIZ 1NP8A 5AERA 3KO0A 4AQJA 5JJGA 2K8MB 1SL7A 1G8IA 3CTNA 5DICA 3C1VA 3ZNIA 3D78A 4GUKA 2ZRTA 1MR8A 1TIZA 1DMOA 2DOQA 3B6XA 1ORGA 4GFTA 1K9PA 1RECA 3AAKA 2K60A 1CFDA 1F55A 4MN0A 2G2BA 2JOJA 2WC5A 1OE9B 3D73A 4YGEB 1F8HA 1KCYA 1QLSA 5FI6A 2NCOA 2LVIA 3HX4A 3DVEA 2WCKA 2JQ6A 2LLUA 1SW8A 5I8NA 1LXFC 3BOWA 1M39A 1NX2A 1TNXA 3PLFB 2ZRSA 5I2QA 1S6IA 2BKHB 3JTDB 1S36A 4YBHB 1LS8A 3EKJA 1DVIA 3OHMB 5FYXA 1J7QA 5F6TA 1G4YR 1K9KA 4OV2A 3CDNA 1KQMB 1S5GY 4ORBB 3BFHA 3PALA 3O2PA 3R1PA 1SCMB 3OP0A 5AFPA 3TS5B 1DGUA 1ZFSA 1WLZA 1CMFA 2WCBA 3LK1A 1K94A 1S5GZ 3PN7B 1CDPA 2F3YA 2AUCA 3BUMB 1MHOA 2GGZA 1UHIA 3NSOA 2ZN8A 2KLDA 4GNKB 1U5IB 1B1GA 1JFKA 3EVRA 1QIVA 2ZNEA 4GAOA 5CSFA 2M3WA 4MRYA 2L98A 5ER5A 1AK8A 1JC2A 2QPTA 1BU3A 4Q04A 3PJIA 2CCMA 2CT9A 1L2OC 3CZ0A 4GGFA 3OB1B 4YI9A 1SPYA 2A4JA 2KGRA 3I5GC 1CDLA 2LNKA 1ZOTB 2I94A 4OZDA 1K95A 1K9UA 1DGVA 2JU0A 1X02A 2JTZA 3KPXA 2GGMA 1IQ3A 2QEVA 4FQOA 2BCAA 1PULA 2NLNA 2QEHA 3FE6A 3RM1A 2L4IA 2PALA 3AKAA 4I5NB 4CLNA 1C3YA 1IJ6A 2K2AA 4ZCUA 2ZKMX 4P5OE 4DRWA 3D10A 3VROA 2WCJA 3B88A 4JQ0D 2WCHA 1B8CA 3QMEA 2JT0A 1AHRA 2KFHA 3CABA 3VRPA 4F0ZB 2BL0C 5DKRA 1TN4A 1WDCC 1F70A 1WY9A 3SG4A 4QJ5B 1M31A 2JC2A 2KSPA 2LP3A 2P6BB 3B87A 1SMGA 3SS3A 1FPWA 1N0YA 2FJUB 4MSPA 1QX2A 1M46A 1OOHA 2KHNA 1RFJA 2ISDA 4M2PA 2F3ZA 5KTYA 4YI8A 3DVKA 2LVKA 3B7AA 1A29A 1AUIB 3IQOA 4GGNA 1YVLA 4DCKA 1V1FA 1UURA 1IGVA 1A2XA 1S6JA
chains in the Genus database with same CATH topology
3O6BA 1SNLA 1RK9A 2F2PA 2Y5IA 4N1FA 4I5KA 2MBXA 3HCMA 2M97A 1QX5B 2Y4QA 2BBNA 3CR5X 2KFGA 3BOWB 1KSOA 1QS7A 1ODBA 2BCBA 2M49B 2R2IA 1XK4A 1NX1A 2L50A 3D0YA 4JPZB 1QV0A 4ETOA 1SCMC 3SG7A 3TS5C 1J7RA 1QIWA 1IWQA 4U8DA 1Y1XA 4PCWA 2KOTA 1XK4C 3BUXB 1QASA 2JNXA 3BUNB 1XFXO 1S26D 2KQ6A 1E8AA 1L2OB 1UHJA 3I5GB 1FW4A 1RWYA 1SKTA 2KYCA 3WHUB 3I5HB 1K8UA 1K96A 4PE0A 2EHBA 2HF5A 2SCPA 2LM5A 1BLQA 2PSRA 2FCEA 2LV7A 1BR1B 1Y1UA 4HRGA 3SIAA 1LA0A 4BY4A 1K93D 2LC5A 2LLSA 2NCPA 3LCPC 3LLEA 4OKHA 4PHMA 2TN4A 4HSZA 3GK2A 2ZNDA 4CPVA 2K7CA 1DJIA 1BR4B 2K2FA 2HETA 1BOCA 1YX8A 1DJHA 4WQ3A 1KFUS 1YVHA 2COLB 1J1DA 3SG5A 2WCEA 2K0JA 4MLWA 2LCPA 4CFQA 4CFRA 5I2OA 2HPSA 5D7FA 1J55A 1SCVA 4OR9B 2O60A 2KNEA 2M7NA 3DF0B 3O78A 2JRFA 1YTZC 3RLZA 1MF8B 2Y1NA 1NCYA 1PSBA 1LKJA 1MXLC 2MJWB 5CSIA 2JXLA 3TUYC 4USLA 1VRKA 3EK4A 1QX7A 2LP2A 1OQPA 1JBAA 1RROA 1L7ZA 3CWGA 1MXEA 5HYDA 1F4QA 4A4BA 3MSEB 3GK1A 2VRGA 2KAYA 1HT9A 3NSKA 3OX5A 3BUWB 4QJ3B 2F2OA 1MUXA 1BODA 2JZIA 1EL4A 2EC6B 5HKYA 1TNPA 1JUOA 3SG3A 3CZTX 2LANA 4HREE 2KAXA 3D0YB 3GOFA 3VGOA 3A4UB 1JSAA 3WHTB 3TZ1A 2KBMA 1SR6C 5K89A 1NCXA 2BE6A 3IQQA 1OOJA 3K21A 2LVJA 1S3PA 2LMTA 3BXKA 4N1GA 5ER4X 2I7AA 4WQ2A 4C0KA 3BQ3A 3EK8A 3NSIA 1YUTA 2KGBC 1R2UA 2JNFA 3I5HC 1DJYA 1ALVA 5BPJA 2EGDA 1Y1AA 4PE4A 4GGFC 1IKUA 3NXAA 2NXQA 5PALA 5CSJA 3SJSA 1MWNA 1JF2A 1MQ1A 3PSRA 4YGDB 1XFYO 2MLFC 4DUQA 1IH0A 4XJKB 5AXIA 1IQ5A 3TDIA 2LLTA 3H4SE 1ALWA 1BF5A 1TNQA 1NWDA 2WOSA 1CM4A 3OX6A 4ZCVA 2CNPA 5DKNA 2I2RE 3M0WA 1CLBA 1QTXA 1B7TY 1A4PA 3TUYB 5G08A 1XFWO 2WCFA 4PHJA 1TNWA 3AKBA 3I5FC 3JVTC 5AEQA 2NZ0A 4NDBA 1WRZA 1B7TZ 1C07A 2H61A 4ORAB 4AOMA 2HQ8A 4PE7A 3KHEA 1UHHA 1RJVA 4ORCB 1OMRA 1EG4A 1DJXA 1AVSA 1XFZO 1Q80A 1IRJA 1TTXA 2H61C 5TNCA 1KK7Y 3VRRA 1PK0D 3CS1A 5AANA 4DS7A 2PMYA 2M1UA 4FTGA 2JULA 1PALA 1CM1A 1Y0VH 2CBLA 2MAZA 2RGIA 1XVJA 5DKQA 2KQYA 2EC6C 4PHKA 2K61A 4M2QA 4YGCB 2PVBA 2MRDA 1IJ5A 1RTP1 3O4YA 1UP5A 4N5XA 1SR6B 2E30A 4ICBA 4I5LB 5I2LA 4QJ4B 1DJZA 1ZACA 1LA3A 2O5GA 3E3RA 1NCZA 1F4OA 5KSZA 2SASA 1NYAA 1HQVA 5HLVA 2K7BA 1EJ3A 5JOLA 3I5IB 1SBJA 2LHIA 4C0JA 4GBAA 4E68A 1B8RA 1D1OA 5B8IB 3EKHA 1B47A 2BBMA 2MA2A 3CR2A 1QLKA 1U5IA 1H4BA 1BG1A 3QRXA 1DJGA 1CNPA 1AJ5A 1XFUO 2JPTA 2Q91A 1DF0A 1GQMA 2Q4UA 2D8NA 2FCDA 1J7PA 1UWOA 4M2OA 3TDZA 5GQQC 1CKKA 2F33A 1K90D 1BMOA 1DTLA 2BCXA 3NSLA 4BY5A 5KU1A 2CTNA 1NSHA 1S6CA 3I5FB 3JVTB 1CFPA 4UPGA 1J7OA 4GPLB 1YUUA 2L51A 3ZWHA 1OMDA 1XA5A 4YRUA 1V1GA 3VRNA 4OCIA 1CTRA 1WLMA 1FI6A 5D69A 1YR5A 2MHHA 1WRLA 3VRQA 3WXAA 1KFXL 1TRFA 3EK7A 2B1UA 2KDHA 2K7DA 2JT3A 2OTGB 3CLNA 4A4CA 1N2DA 1F71A 2KI4C 2HQWA 1UHKA 2KYFA 1SRAA 2LHLA 2AMIA 4PDZA 3FWCA 1CLLA 1BT6A 1WRKA 1KWOC 4NDCA 1EG3A 1TCOB 4MZLA 1W7JB 3EVVA 4P2YB 1KK8B 1LINA 1JWDA 2LVVA 2KI6C 1J1EA 3DVMA 3FIAA 2OS8B 4TNCA 4L9MA 3PM8A 1M45A 3EVUA 2M1KB 2CXJA 1A75A 2LUXA 2KI6D 2LAPA 2K7OA 3GK4X 3I5IC 4R1EA 2M29A 1K2HA 3CGAA 5HLOA 4MRXA 1SL8A 3SG2A 1CDMA 2LMVA 4PE1A 2L5XB 1QXPA 2LMUA 2L2EA 3IF7A 1PRWA 1DJWA 4PALA 2PASA 3LL8B 1YUSA 2JT8A 4MZKA 3LK0A 1G33A 1SYMA 3DVJA 2ZFDA 1ZMZA 1DF0B 2JTTA 1CLMA 2JWWA 4NQGA 1PVAA 2AAOA 1SK6D 4NDDA 3FS7A 5CPVA 1EH2A 1N65A 1NIWA 3PATA 1CMGA 1M63B 1UUSA 2G9BA 1YRTB 3PFVA 1H8BA 4MBEA 3BUOB 4PHNA 2M7LA 1KFXS 1JF0A 1CFCA 2FOTA 1DT7B 1LVCD 2MLEC 3A8RA 3SG6A 4AQIA 3DF0A 1IG5A 2PRUA 1R6PA 4I5JA 1KFUL 1XO5A 2LE9B 5CSNA 3SIBA 2E6WA 4MEWA 1C7WA 1SY9A 1QV1A 2L4HA 2KI4B 4JWQA 3WNXB 1KK7Z 1NPQA 2OTGC 4MZJA 3FWBA 1XFVO 1KWOB 3TDUA 1AJ4A 1NUBA 4DIRA 1ZUZA 1OZSA 1TOPA 3CR4X 1KK8C 4YGAA 2JXCA 3ICBA 2H2KA 2V53A 3JTDC 4MVFA 5IBWA 1CFFA 1YRUB 1CB1A 2OS8C 4IL1A 3OB2B 4D1EA 1KQMC 1PSRA 4WRIA 4C0LA 2I18A 1KQVA 1B4CA 1EXRA 1FI5A 1S1EA 1A75B 2BKIB 3PN7C 1QATA 2QACA 1QJTA 2KFFA 1GGWA 4CIDA 2OPOA 1TCFA 1F54A 1GGZA 2LUCA 1AP4A 1FBVA 3DD4A 1NX3A 4OVNF 1YURA 2KBIA 3KF9A 5HKWA 4YGBB 1GJYA 2WNDA 2BECA 2L0PA 1SL9A 1B8LA 1NX0A 1KSMA 1A03A 1UHNA 2WC8A 1PVBA 3AAJA 2KAVA 1OSAA 2ZN9A 2BE4A 1OZOA 1C7VA 3KEVA 2F8PA 1Y6WA 1XYDA 4HRHA 2Y1MA 3BYAA 4XJKA 5HKZA 1QVIY 1BJFA 2M0RA 4XYNA 5J3XA 1CDNA 1JFJA 3F45A 2IS9A 2BL0B 1WDCB 1W7IB 1B9AA 2M9GA 2M8UA 1OMVA 1YX7A 2GV5A 2WORA 1QVIZ 1NP8A 5AERA 3KO0A 4AQJA 5JJGA 2K8MB 1SL7A 1G8IA 3CTNA 3C1VA 3ZNIA 4GUKA 2ZRTA 1MR8A 1TIZA 1DMOA 2DOQA 4GFTA 1K9PA 1RECA 3AAKA 1CFDA 1F55A 4MN0A 2G2BA 2JOJA 4YGEB 1OE9B 1F8HA 1KCYA 1QLSA 2NCOA 2LVIA 3HX4A 3DVEA 2JQ6A 2LLUA 1SW8A 5I8NA 1LXFC 3BOWA 1M39A 1NX2A 1TNXA 3PLFB 2ZRSA 5I2QA 1S6IA 2BKHB 3JTDB 1S36A 4YBHB 3OHMB 3EKJA 1DVIA 5FYXA 1FF1A 1J7QA 5F6TA 1G4YR 1K9KA 4OV2A 1KQMB 1S5GY 4ORBB 3PALA 3O2PA 1SCMB 3OP0A 5AFPA 3TS5B 1DGUA 1ZFSA 1WLZA 1CMFA 2WCBA 3LK1A 1K94A 1S5GZ 3PN7B 1CDPA 2F3YA 2AUCA 3BUMB 1MHOA 2GGZA 1UHIA 3NSOA 2ZN8A 4GNKB 1U5IB 1B1GA 1JFKA 3EVRA 1QIVA 2ZNEA 4GAOA 5CSFA 2M3WA 4MRYA 2L98A 5ER5A 1AK8A 1JC2A 2QPTA 1BU3A 4Q04A 2CCMA 2CT9A 1L2OC 4GGFA 3OB1B 4YI9A 1SPYA 2A4JA 2KGRA 3I5GC 1CDLA 2LNKA 1ZOTB 2I94A 1K95A 1K9UA 1DGVA 2JU0A 1X02A 2JTZA 3KPXA 2GGMA 1IQ3A 4FQOA 2BCAA 1PULA 2NLNA 3RM1A 2L4IA 2PALA 3AKAA 4I5NB 4CLNA 1IJ6A 2K2AA 4ZCUA 2ZKMX 4P5OE 4DRWA 3D10A 3VROA 4JQ0D 1B8CA 4F0ZB 2JT0A 1AHRA 2KFHA 3VRPA 1F70A 2BL0C 5DKRA 1TN4A 1WDCC 1WY9A 3SG4A 4QJ5B 1M31A 2JC2A 2KSPA 2LP3A 2P6BB 1SMGA 1FPWA 1N0YA 2FJUB 4MSPA 1QX2A 1M46A 2KHNA 1RFJA 2ISDA 4M2PA 2F3ZA 5KTYA 4YI8A 3DVKA 2LVKA 1A29A 1AUIB 3IQOA 4GGNA 1YVLA 4DCKA 1V1FA 1UURA 1IGVA 1A2XA 1S6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O6B A;  1SNL A;  1RK9 A;  2F2P A;  2Y5I A;  4N1F A;  4I5K A;  2MBX A;  3HCM A;  2M97 A;  1QX5 B;  2Y4Q A;  2BBN A;  3CR5 X;  2KFG A;  3BOW B;  1KSO A;  1QS7 A;  1ODB A;  2BCB A;  2M49 B;  2R2I A;  1XK4 A;  1NX1 A;  2L50 A;  3D0Y A;  4JPZ B;  1QV0 A;  4ETO A;  1SCM C;  3SG7 A;  3TS5 C;  1J7R A;  1QIW A;  1IWQ A;  4U8D A;  1Y1X A;  4PCW A;  2KOT A;  1XK4 C;  3BUX B;  1QAS A;  2JNX A;  3BUN B;  1XFX O;  1S26 D;  2KQ6 A;  1E8A A;  1L2O B;  1UHJ A;  3I5G B;  1FW4 A;  1RWY A;  1SKT A;  2KYC A;  3WHU B;  3I5H B;  1K8U A;  1K96 A;  4PE0 A;  2EHB A;  2HF5 A;  2SCP A;  2LM5 A;  1BLQ A;  2PSR A;  2FCE A;  2LV7 A;  1BR1 B;  1Y1U A;  4HRG A;  3SIA A;  1LA0 A;  4BY4 A;  1K93 D;  2LC5 A;  2LLS A;  2NCP A;  3LCP C;  3LLE A;  4OKH A;  4PHM A;  2TN4 A;  4HSZ A;  3GK2 A;  2ZND A;  4CPV A;  2K7C A;  1DJI A;  1BR4 B;  2K2F A;  2HET A;  1BOC A;  1YX8 A;  1DJH A;  4WQ3 A;  1KFU S;  1YVH A;  2COL B;  1J1D A;  3SG5 A;  2WCE A;  2K0J A;  4MLW A;  2LCP A;  4CFQ A;  4CFR A;  5I2O A;  2HPS A;  5D7F A;  1J55 A;  1SCV A;  4OR9 B;  2O60 A;  2KNE A;  2M7N A;  3DF0 B;  3O78 A;  2JRF A;  1YTZ C;  3RLZ A;  1MF8 B;  2Y1N A;  1NCY A;  1PSB A;  1LKJ A;  1MXL C;  2MJW B;  5CSI A;  2JXL A;  3TUY C;  4USL A;  1VRK A;  3EK4 A;  1QX7 A;  2LP2 A;  1OQP A;  1JBA A;  1RRO A;  1L7Z A;  3CWG A;  1MXE A;  5HYD A;  1F4Q A;  4A4B A;  3MSE B;  3GK1 A;  2VRG A;  2KAY A;  1HT9 A;  3NSK A;  3OX5 A;  3BUW B;  4QJ3 B;  2F2O A;  1MUX A;  1BOD A;  2JZI A;  1EL4 A;  2EC6 B;  5HKY A;  1TNP A;  1JUO A;  3SG3 A;  3CZT X;  2LAN A;  4HRE E;  2KAX A;  3D0Y B;  3GOF A;  3VGO A;  3A4U B;  1JSA A;  3WHT B;  3TZ1 A;  2KBM A;  1SR6 C;  5K89 A;  1NCX A;  2BE6 A;  3IQQ A;  1OOJ A;  3K21 A;  2LVJ A;  1S3P A;  2LMT A;  3BXK A;  4N1G A;  5ER4 X;  2I7A A;  4WQ2 A;  4C0K A;  3BQ3 A;  3EK8 A;  3NSI A;  1YUT A;  2KGB C;  1R2U A;  2JNF A;  3I5H C;  1DJY A;  1ALV A;  5BPJ A;  2EGD A;  1Y1A A;  4PE4 A;  4GGF C;  1IKU A;  3NXA A;  2NXQ A;  5PAL A;  5CSJ A;  3SJS A;  1MWN A;  1JF2 A;  1MQ1 A;  3PSR A;  4YGD B;  1XFY O;  2MLF C;  4DUQ A;  1IH0 A;  4XJK B;  5AXI A;  1IQ5 A;  3TDI A;  2LLT A;  3H4S E;  1ALW A;  1BF5 A;  1TNQ A;  1NWD A;  2WOS A;  1CM4 A;  3OX6 A;  4ZCV A;  2CNP A;  5DKN A;  2I2R E;  3M0W A;  1CLB A;  1QTX A;  1B7T Y;  1A4P A;  3TUY B;  5G08 A;  1XFW O;  2WCF A;  4PHJ A;  1TNW A;  3AKB A;  3I5F C;  3JVT C;  5AEQ A;  2NZ0 A;  4NDB A;  1WRZ A;  1B7T Z;  1C07 A;  2H61 A;  4ORA B;  4AOM A;  2HQ8 A;  4PE7 A;  3KHE A;  1UHH A;  1RJV A;  4ORC B;  1OMR A;  1EG4 A;  1DJX A;  1AVS A;  1XFZ O;  1Q80 A;  1IRJ A;  1TTX A;  2H61 C;  5TNC A;  1KK7 Y;  3VRR A;  1PK0 D;  3CS1 A;  5AAN A;  4DS7 A;  2PMY A;  2M1U A;  4FTG A;  2JUL A;  1PAL A;  1CM1 A;  1Y0V H;  2CBL A;  2MAZ A;  2RGI A;  1XVJ A;  5DKQ A;  2KQY A;  2EC6 C;  4PHK A;  2K61 A;  4M2Q A;  4YGC B;  2PVB A;  2MRD A;  1IJ5 A;  1RTP 1;  3O4Y A;  1UP5 A;  4N5X A;  1SR6 B;  2E30 A;  4ICB A;  4I5L B;  5I2L A;  4QJ4 B;  1DJZ A;  1ZAC A;  1LA3 A;  2O5G A;  3E3R A;  1NCZ A;  1F4O A;  5KSZ A;  2SAS A;  1NYA A;  1HQV A;  5HLV A;  2K7B A;  1EJ3 A;  5JOL A;  3I5I B;  1SBJ A;  2LHI A;  4C0J A;  4GBA A;  4E68 A;  1B8R A;  1D1O A;  5B8I B;  3EKH A;  1B47 A;  2BBM A;  2MA2 A;  3CR2 A;  1QLK A;  1U5I A;  1H4B A;  1BG1 A;  3QRX A;  1DJG A;  1CNP A;  1AJ5 A;  1XFU O;  2JPT A;  2Q91 A;  1DF0 A;  1GQM A;  2Q4U A;  2D8N A;  2FCD A;  1J7P A;  1UWO A;  4M2O A;  3TDZ A;  5GQQ C;  1CKK A;  2F33 A;  1K90 D;  1BMO A;  1DTL A;  2BCX A;  3NSL A;  4BY5 A;  5KU1 A;  2CTN A;  1NSH A;  1S6C A;  3I5F B;  3JVT B;  1CFP A;  4UPG A;  1J7O A;  4GPL B;  1YUU A;  2L51 A;  3ZWH A;  1OMD A;  1XA5 A;  4YRU A;  1V1G A;  3VRN A;  4OCI A;  1CTR A;  1WLM A;  1FI6 A;  5D69 A;  1YR5 A;  2MHH A;  1WRL A;  3VRQ A;  3WXA A;  1KFX L;  1TRF A;  3EK7 A;  2B1U A;  2KDH A;  2K7D A;  2JT3 A;  2OTG B;  3CLN A;  4A4C A;  1N2D A;  1F71 A;  2KI4 C;  2HQW A;  1UHK A;  2KYF A;  1SRA A;  2LHL A;  2AMI A;  4PDZ A;  3FWC A;  1CLL A;  1BT6 A;  1WRK A;  1KWO C;  4NDC A;  1EG3 A;  1TCO B;  4MZL A;  1W7J B;  3EVV A;  4P2Y B;  1KK8 B;  1LIN A;  1JWD A;  2LVV A;  2KI6 C;  1J1E A;  3DVM A;  3FIA A;  2OS8 B;  4TNC A;  4L9M A;  3PM8 A;  1M45 A;  3EVU A;  2M1K B;  2CXJ A;  1A75 A;  2LUX A;  2KI6 D;  2LAP A;  2K7O A;  3GK4 X;  3I5I C;  4R1E A;  2M29 A;  1K2H A;  3CGA A;  5HLO A;  4MRX A;  1SL8 A;  3SG2 A;  1CDM A;  2LMV A;  4PE1 A;  2L5X B;  1QXP A;  2LMU A;  2L2E A;  3IF7 A;  1PRW A;  1DJW A;  4PAL A;  2PAS A;  3LL8 B;  1YUS A;  2JT8 A;  4MZK A;  3LK0 A;  1G33 A;  1SYM A;  3DVJ A;  2ZFD A;  1ZMZ A;  1DF0 B;  2JTT A;  1CLM A;  2JWW A;  4NQG A;  1PVA A;  2AAO A;  1SK6 D;  4NDD A;  3FS7 A;  5CPV A;  1EH2 A;  1N65 A;  1NIW A;  3PAT A;  1CMG A;  1M63 B;  1UUS A;  2G9B A;  1YRT B;  3PFV A;  1H8B A;  4MBE A;  3BUO B;  4PHN A;  2M7L A;  1KFX S;  1JF0 A;  1CFC A;  2FOT A;  1DT7 B;  1LVC D;  2MLE C;  3A8R A;  3SG6 A;  4AQI A;  3DF0 A;  1IG5 A;  2PRU A;  1R6P A;  4I5J A;  1KFU L;  1XO5 A;  2LE9 B;  5CSN A;  3SIB A;  2E6W A;  4MEW A;  1C7W A;  1SY9 A;  1QV1 A;  2L4H A;  2KI4 B;  4JWQ A;  3WNX B;  1KK7 Z;  1NPQ A;  2OTG C;  4MZJ A;  3FWB A;  1XFV O;  1KWO B;  3TDU A;  1AJ4 A;  1NUB A;  4DIR A;  1ZUZ A;  1OZS A;  1TOP A;  3CR4 X;  1KK8 C;  4YGA A;  2JXC A;  3ICB A;  2H2K A;  2V53 A;  3JTD C;  4MVF A;  5IBW A;  1CFF A;  1YRU B;  1CB1 A;  2OS8 C;  4IL1 A;  3OB2 B;  4D1E A;  1KQM C;  1PSR A;  4WRI A;  4C0L A;  2I18 A;  1KQV A;  1B4C A;  1EXR A;  1FI5 A;  1S1E A;  1A75 B;  2BKI B;  3PN7 C;  1QAT A;  2QAC A;  1QJT A;  2KFF A;  1GGW A;  4CID A;  2OPO A;  1TCF A;  1F54 A;  1GGZ A;  2LUC A;  1AP4 A;  1FBV A;  3DD4 A;  1NX3 A;  4OVN F;  1YUR A;  2KBI A;  3KF9 A;  5HKW A;  4YGB B;  1GJY A;  2WND A;  2BEC A;  2L0P A;  1SL9 A;  1B8L A;  1NX0 A;  1KSM A;  1A03 A;  1UHN A;  2WC8 A;  1PVB A;  3AAJ A;  2KAV A;  1OSA A;  2ZN9 A;  2BE4 A;  1OZO A;  1C7V A;  3KEV A;  2F8P A;  1Y6W A;  1XYD A;  4HRH A;  2Y1M A;  3BYA A;  4XJK A;  5HKZ A;  1QVI Y;  1BJF A;  2M0R A;  4XYN A;  5J3X A;  1CDN A;  1JFJ A;  3F45 A;  2IS9 A;  2BL0 B;  1WDC B;  1W7I B;  1B9A A;  2M9G A;  2M8U A;  1OMV A;  1YX7 A;  2GV5 A;  2WOR A;  1QVI Z;  1NP8 A;  5AER A;  3KO0 A;  4AQJ A;  5JJG A;  2K8M B;  1SL7 A;  1G8I A;  3CTN A;  3C1V A;  3ZNI A;  4GUK A;  2ZRT A;  1MR8 A;  1TIZ A;  1DMO A;  2DOQ A;  4GFT A;  1K9P A;  1REC A;  3AAK A;  1CFD A;  1F55 A;  4MN0 A;  2G2B A;  2JOJ A;  4YGE B;  1OE9 B;  1F8H A;  1KCY A;  1QLS A;  2NCO A;  2LVI A;  3HX4 A;  3DVE A;  2JQ6 A;  2LLU A;  1SW8 A;  5I8N A;  1LXF C;  3BOW A;  1M39 A;  1NX2 A;  1TNX A;  3PLF B;  2ZRS A;  5I2Q A;  1S6I A;  2BKH B;  3JTD B;  1S36 A;  4YBH B;  3OHM B;  3EKJ A;  1DVI A;  5FYX A;  1FF1 A;  1J7Q A;  5F6T A;  1G4Y R;  1K9K A;  4OV2 A;  1KQM B;  1S5G Y;  4ORB B;  3PAL A;  3O2P A;  1SCM B;  3OP0 A;  5AFP A;  3TS5 B;  1DGU A;  1ZFS A;  1WLZ A;  1CMF A;  2WCB A;  3LK1 A;  1K94 A;  1S5G Z;  3PN7 B;  1CDP A;  2F3Y A;  2AUC A;  3BUM B;  1MHO A;  2GGZ A;  1UHI A;  3NSO A;  2ZN8 A;  4GNK B;  1U5I B;  1B1G A;  1JFK A;  3EVR A;  1QIV A;  2ZNE A;  4GAO A;  5CSF A;  2M3W A;  4MRY A;  2L98 A;  5ER5 A;  1AK8 A;  1JC2 A;  2QPT A;  1BU3 A;  4Q04 A;  2CCM A;  2CT9 A;  1L2O C;  4GGF A;  3OB1 B;  4YI9 A;  1SPY A;  2A4J A;  2KGR A;  3I5G C;  1CDL A;  2LNK A;  1ZOT B;  2I94 A;  1K95 A;  1K9U A;  1DGV A;  2JU0 A;  1X02 A;  2JTZ A;  3KPX A;  2GGM A;  1IQ3 A;  4FQO A;  2BCA A;  1PUL A;  2NLN A;  3RM1 A;  2L4I A;  2PAL A;  3AKA A;  4I5N B;  4CLN A;  1IJ6 A;  2K2A A;  4ZCU A;  2ZKM X;  4P5O E;  4DRW A;  3D10 A;  3VRO A;  4JQ0 D;  1B8C A;  4F0Z B;  2JT0 A;  1AHR A;  2KFH A;  3VRP A;  1F70 A;  2BL0 C;  5DKR A;  1TN4 A;  1WDC C;  1WY9 A;  3SG4 A;  4QJ5 B;  1M31 A;  2JC2 A;  2KSP A;  2LP3 A;  2P6B B;  1SMG A;  1FPW A;  1N0Y A;  2FJU B;  4MSP A;  1QX2 A;  1M46 A;  2KHN A;  1RFJ A;  2ISD A;  4M2P A;  2F3Z A;  5KTY A;  4YI8 A;  3DVK A;  2LVK A;  1A29 A;  1AUI B;  3IQO A;  4GGN A;  1YVL A;  4DCK A;  1V1F A;  1UUR A;  1IGV A;  1A2X A;  1S6J A; 
#chains in the Genus database with same CATH topology
 2P70 A;  3O6B A;  3OGN A;  1SNL A;  1RK9 A;  1Z4H A;  2F2P A;  2BNX A;  2Y5I A;  4I5K A;  4N1F A;  1OW4 A;  2MBX A;  3HCM A;  2M97 A;  1QX5 B;  2Y4Q A;  2BBN A;  3CR5 X;  2KFG A;  3BOW B;  1KSO A;  1QS7 A;  1ODB A;  2BCB A;  2M49 B;  2R2I A;  1XK4 A;  1NX1 A;  2L50 A;  3D0Y A;  4JPZ B;  1QV0 A;  4ETO A;  4IJ7 A;  1SCM C;  3S0G A;  3SG7 A;  3TS5 C;  1J7R A;  1QIW A;  1IWQ A;  4U8D A;  1Y1X A;  3R1V A;  4PCW A;  2KOT A;  1XK4 C;  3BUX B;  1QAS A;  1TWO A;  2JNX A;  3BUN B;  1XFX O;  2ERB A;  1S26 D;  2KQ6 A;  1E8A A;  1L2O B;  1UHJ A;  2QDI A;  3I5G B;  3IVT A;  1FW4 A;  1RWY A;  1SKT A;  2KYC A;  3WHU B;  3I5H B;  1K8U A;  1K96 A;  3R1O A;  4PE0 A;  2EHB A;  2HF5 A;  2SCP A;  2LM5 A;  1BLQ A;  2PSR A;  2PQL A;  2FCE A;  2LV7 A;  3UO9 A;  1BR1 B;  1Y1U A;  4HRG A;  3SIA A;  1LA0 A;  4BY4 A;  1K93 D;  2LC5 A;  2LLS A;  2NCP A;  5D3O A;  3LCP C;  3LLE A;  4OKH A;  4PHM A;  2TN4 A;  4HSZ A;  3GK2 A;  2ZND A;  4CPV A;  2K7C A;  1DJI A;  3R72 A;  1BR4 B;  2K2F A;  2HET A;  1BOC A;  1YX8 A;  1DJH A;  4WQ3 A;  1KFU S;  1YVH A;  2COL B;  3BFB A;  1J1D A;  3SG5 A;  2WCE A;  2K0J A;  4MLW A;  2LCP A;  4CFQ A;  3DYE A;  4CFR A;  5I2O A;  2HPS A;  5D7F A;  3O4X A;  1J55 A;  1SCV A;  4OR9 B;  2O60 A;  3NGV A;  2KNE A;  2M7N A;  3DF0 B;  3EG5 B;  2JRF A;  3O78 A;  1YTZ C;  3RLZ A;  1MF8 B;  2Y1N A;  1NCY A;  1PSB A;  1LKJ A;  1MXL C;  2MJW B;  5CSI A;  2JXL A;  3TUY C;  4USL A;  1VRK A;  3EK4 A;  1QX7 A;  3S0E A;  2LP2 A;  1OQP A;  3NHI A;  1JBA A;  1RRO A;  1L7Z A;  3CWG A;  1MXE A;  3D76 A;  5HYD A;  2L2C A;  1F4Q A;  4A4B A;  3MSE B;  3GK1 A;  2VRG A;  2KAY A;  1HT9 A;  3NSK A;  3OX5 A;  3BUW B;  4QJ3 B;  2F2O A;  1MUX A;  1BOD A;  2JZI A;  1EL4 A;  2EC6 B;  5HKY A;  1TNP A;  1JUO A;  3SG3 A;  3CZT X;  2LAN A;  4HRE E;  2KAX A;  3D0Y B;  3GOF A;  3VGO A;  4KYN A;  3UNW A;  3A4U B;  1JSA A;  1SSE B;  3SS5 A;  3FE8 A;  3TZ1 A;  2KBM A;  3WHT B;  1SR6 C;  5K89 A;  4PT1 A;  1NCX A;  2BE6 A;  3IQQ A;  1OOJ A;  3K21 A;  2LVJ A;  1S3P A;  2LMT A;  3BXK A;  4N1G A;  5ER4 X;  2I7A A;  4WQ2 A;  4C0K A;  3BQ3 A;  3EK8 A;  1DEL A;  1YUT A;  2KGB C;  1R2U A;  2JNF A;  3I5H C;  3NSI A;  1DJY A;  1ALV A;  3K1E A;  5BPJ A;  2EGD A;  1Y1A A;  4PE4 A;  4GGF C;  1IKU A;  3NXA A;  2NXQ A;  5PAL A;  3DY9 A;  4JD9 A;  3DZT A;  5CSJ A;  3SJS A;  3V2L A;  1MWN A;  1JF2 A;  1MQ1 A;  3PSR A;  4YGD B;  1XFY O;  2MLF C;  4DUQ A;  1IH0 A;  4XJK B;  5AXI A;  1IQ5 A;  2WCM A;  3TDI A;  2LLT A;  3H4S E;  1ALW A;  1BF5 A;  1TNQ A;  1NWD A;  2BAP A;  2WOS A;  1CM4 A;  3OX6 A;  4ZCV A;  2CNP A;  5DKN A;  2I2R E;  3M0W A;  1CLB A;  1QTX A;  1B7T Y;  1A4P A;  3D77 A;  3TUY B;  5G08 A;  1XFW O;  2WCF A;  4PHJ A;  1TNW A;  1C3Z A;  3AKB A;  3I5F C;  3JVT C;  5AEQ A;  2NZ0 A;  4NDB A;  1WRZ A;  1B7T Z;  5FI7 A;  1C07 A;  2H61 A;  4ORA B;  4AOM A;  2HQ8 A;  3S0F A;  4PE7 A;  3KHE A;  1UHH A;  1RJV A;  4ORC B;  1OMR A;  1EG4 A;  1DJX A;  1AVS A;  1XFZ O;  1Q80 A;  1IRJ A;  1TTX A;  2H61 C;  2YGU A;  1KK7 Y;  3VRR A;  1PK0 D;  3CS1 A;  4FQT A;  5AAN A;  4DS7 A;  2PMY A;  2M1U A;  4FTG A;  2JUL A;  1PAL A;  1CM1 A;  1Y0V H;  2CBL A;  2MAZ A;  2RGI A;  4INX A;  1XVJ A;  5DKQ A;  2KQY A;  2EC6 C;  1FF1 A;  4PHK A;  2K61 A;  4M2Q A;  4YGC B;  2PVB A;  3OBV A;  2MRD A;  1IJ5 A;  1RTP 1;  3O4Y A;  1UP5 A;  4N5X A;  1SR6 B;  2E30 A;  4F7F A;  4ICB A;  4I5L B;  5I2L A;  4QJ4 B;  1DJZ A;  1ZAC A;  1LA3 A;  2O5G A;  1OOG A;  3E3R A;  1NCZ A;  1F4O A;  5KSZ A;  2SAS A;  1NYA A;  1HQV A;  5HLV A;  2K7B A;  1EJ3 A;  5JOL A;  3I5I B;  1SBJ A;  2LHI A;  4C0J A;  4GBA A;  4E68 A;  1B8R A;  1D1O A;  5B8I B;  3EKH A;  1B47 A;  2BBM A;  2MA2 A;  3CR2 A;  1DQE A;  1QLK A;  1U5I A;  2L5Y A;  1H4B A;  1BG1 A;  3CYZ A;  3QRX A;  1DJG A;  1CNP A;  1AJ5 A;  1XFU O;  2JPT A;  2Q91 A;  1DF0 A;  1GQM A;  2Q4U A;  3RZS A;  2D8N A;  2FCD A;  1J7P A;  1UWO A;  4M2O A;  3TDZ A;  5GQQ C;  1CKK A;  2F33 A;  5EL2 A;  1K90 D;  1BMO A;  3Q8I A;  1DTL A;  2BCX A;  3NSL A;  4BY5 A;  1OOF A;  5KU1 A;  2CTN A;  1NSH A;  1S6C A;  3B86 A;  3I5F B;  3JVT B;  1CFP A;  4UPG A;  1Z2C B;  1J7O A;  4GPL B;  1YUU A;  2L51 A;  3ZWH A;  1OMD A;  1XA5 A;  4YRU A;  1V1G A;  3VRN A;  4OCI A;  1CTR A;  2KPH A;  5TNC A;  1WLM A;  1FI6 A;  1P28 A;  5D69 A;  1YR5 A;  2MHH A;  2GTE A;  1WRL A;  3L4L A;  3VRQ A;  3WXA A;  1KFX L;  1TRF A;  3EK7 A;  3S0A A;  2B1U A;  1TUZ A;  2KDH A;  2K7D A;  2JT3 A;  2OTG B;  3CLN A;  4A4C A;  3NHT A;  1N2D A;  1F71 A;  2KI4 C;  2HQW A;  1UHK A;  2KYF A;  1SRA A;  2LHL A;  2AMI A;  4PDZ A;  3FWC A;  1CLL A;  1BT6 A;  1WRK A;  1KWO C;  4NDC A;  1EG3 A;  1TCO B;  4MZL A;  1W7J B;  3EVV A;  2WCL A;  4P2Y B;  1OOI X;  3VB1 A;  1KK8 B;  1LIN A;  1JWD A;  2KLE A;  2LVV A;  2KI6 C;  1J1E A;  3DVM A;  3FIA A;  2OS8 B;  4TNC A;  4L9M A;  3PM8 A;  3DXL A;  1M45 A;  2QEO A;  3EVU A;  2M1K B;  2CXJ A;  1A75 A;  2P71 A;  2LUX A;  2KI6 D;  2LAP A;  2K7O A;  3CZ2 A;  3GK4 X;  3I5I C;  4R1E A;  2M29 A;  1K2H A;  3CGA A;  5HLO A;  4MRX A;  1SL8 A;  3SG2 A;  1CDM A;  2LMV A;  4PE1 A;  2L5X B;  1QXP A;  2LMU A;  2L2E A;  3IF7 A;  1PRW A;  1DJW A;  4PAL A;  3S0B A;  2PAS A;  3LL8 B;  1YUS A;  2JT8 A;  4MZK A;  3LK0 A;  1G33 A;  1SYM A;  3DVJ A;  2ZFD A;  1ZMZ A;  1DF0 B;  2JTT A;  1CLM A;  2H8V A;  2JWW A;  4NQG A;  1PVA A;  2AAO A;  1SK6 D;  4NDD A;  3FS7 A;  5CPV A;  1EH2 A;  1N65 A;  1NIW A;  3PAT A;  1CMG A;  1M63 B;  1UUS A;  1W9Z A;  1YRT B;  2G9B A;  1DC1 A;  3PFV A;  1H8B A;  4MBE A;  3D74 A;  3BUO B;  3BFA A;  4PHN A;  2M7L A;  3PM2 A;  1KFX S;  1JF0 A;  1CFC A;  2FOT A;  1DT7 B;  5I94 A;  1LVC D;  2MLE C;  3A8R A;  3SG6 A;  4AQI A;  2QEB A;  3DF0 A;  1IG5 A;  2PRU A;  1R6P A;  4I5J A;  1KFU L;  1XO5 A;  2LE9 B;  5CSN A;  3SIB A;  2E6W A;  4MEW A;  1C7W A;  1SY9 A;  3S0D A;  1QV1 A;  2L4H A;  2KI4 B;  4JWQ A;  5HL1 A;  3WNX B;  1KK7 Z;  1NPQ A;  2JPO A;  2OTG C;  4MZJ A;  3FWB A;  1XFV O;  3L4A A;  3D75 A;  1TUJ A;  1KWO B;  3TDU A;  1AJ4 A;  1NUB A;  2FJY A;  5FI2 A;  4DIR A;  1ZUZ A;  1IIO A;  1OZS A;  1TOP A;  3CR4 X;  1KK8 C;  1GM0 A;  4YGA A;  2JXC A;  3ICB A;  3SS4 A;  2H2K A;  2V53 A;  3JTD C;  4MVF A;  5IBW A;  1CFF A;  1YRU B;  1CB1 A;  2OS8 C;  4IL1 A;  3OB2 B;  1QWV A;  1KQM C;  3FE9 A;  4INW A;  4D1E A;  1PSR A;  4WRI A;  3CZ1 A;  4C0L A;  2I18 A;  1KQV A;  1B4C A;  1EXR A;  2PYQ A;  3N7H A;  1S1E A;  1FI5 A;  1A75 B;  2BKI B;  3PN7 C;  1QAT A;  2QAC A;  1QJT A;  2KFF A;  1GGW A;  4CID A;  2OPO A;  1TCF A;  1F54 A;  1GGZ A;  2LUC A;  1AP4 A;  1FBV A;  3DD4 A;  1NX3 A;  4OVN F;  1YUR A;  2KBI A;  3KF9 A;  5HKW A;  4JKT A;  4YGB B;  1GJY A;  2WC6 A;  2WND A;  2BEC A;  2L0P A;  1T14 A;  1SL9 A;  1B8L A;  1NX0 A;  3L47 A;  1KSM A;  1XFR A;  1A03 A;  1UHN A;  2WC8 A;  1PVB A;  3AAJ A;  2KAV A;  1OSA A;  2ZN9 A;  2BE4 A;  1OZO A;  1C7V A;  3KEV A;  2F8P A;  1Y6W A;  1XYD A;  4HRH A;  2Y1M A;  3BYA A;  4XJK A;  5HKZ A;  3BJH A;  1QVI Y;  1BJF A;  2M0R A;  4XYN A;  5J3X A;  1CDN A;  1JFJ A;  3F45 A;  2IS9 A;  1DEK A;  2BL0 B;  1WDC B;  1W7I B;  1B9A A;  2M9G A;  2M8U A;  1OMV A;  1YX7 A;  2GV5 A;  2WOR A;  1QVI Z;  1NP8 A;  5AER A;  3KO0 A;  4AQJ A;  5JJG A;  2K8M B;  1SL7 A;  1G8I A;  3CTN A;  5DIC A;  3C1V A;  3ZNI A;  3D78 A;  4GUK A;  2ZRT A;  1MR8 A;  1TIZ A;  1DMO A;  2DOQ A;  3B6X A;  1ORG A;  4GFT A;  1K9P A;  1REC A;  3AAK A;  2K60 A;  1CFD A;  1F55 A;  4MN0 A;  2G2B A;  2JOJ A;  2WC5 A;  1OE9 B;  3D73 A;  4YGE B;  1F8H A;  1KCY A;  1QLS A;  5FI6 A;  2NCO A;  2LVI A;  3HX4 A;  3DVE A;  2WCK A;  2JQ6 A;  2LLU A;  1SW8 A;  5I8N A;  1LXF C;  3BOW A;  1M39 A;  1NX2 A;  1TNX A;  3PLF B;  2ZRS A;  5I2Q A;  1S6I A;  2BKH B;  3JTD B;  1S36 A;  4YBH B;  1LS8 A;  3EKJ A;  1DVI A;  3OHM B;  5FYX A;  1J7Q A;  5F6T A;  1G4Y R;  1K9K A;  4OV2 A;  3CDN A;  1KQM B;  1S5G Y;  4ORB B;  3BFH A;  3PAL A;  3O2P A;  3R1P A;  1SCM B;  3OP0 A;  5AFP A;  3TS5 B;  1DGU A;  1ZFS A;  1WLZ A;  1CMF A;  2WCB A;  3LK1 A;  1K94 A;  1S5G Z;  3PN7 B;  1CDP A;  2F3Y A;  2AUC A;  3BUM B;  1MHO A;  2GGZ A;  1UHI A;  3NSO A;  2ZN8 A;  2KLD A;  4GNK B;  1U5I B;  1B1G A;  1JFK A;  3EVR A;  1QIV A;  2ZNE A;  4GAO A;  5CSF A;  2M3W A;  4MRY A;  2L98 A;  5ER5 A;  1AK8 A;  1JC2 A;  2QPT A;  1BU3 A;  4Q04 A;  3PJI A;  2CCM A;  2CT9 A;  1L2O C;  3CZ0 A;  4GGF A;  3OB1 B;  4YI9 A;  1SPY A;  2A4J A;  2KGR A;  3I5G C;  1CDL A;  2LNK A;  1ZOT B;  2I94 A;  4OZD A;  1K95 A;  1K9U A;  1DGV A;  2JU0 A;  1X02 A;  2JTZ A;  3KPX A;  2GGM A;  1IQ3 A;  2QEV A;  4FQO A;  2BCA A;  1PUL A;  2NLN A;  2QEH A;  3FE6 A;  3RM1 A;  2L4I A;  2PAL A;  3AKA A;  4I5N B;  4CLN A;  1C3Y A;  1IJ6 A;  2K2A A;  4ZCU A;  2ZKM X;  4P5O E;  4DRW A;  3D10 A;  3VRO A;  2WCJ A;  3B88 A;  4JQ0 D;  2WCH A;  1B8C A;  3QME A;  2JT0 A;  1AHR A;  2KFH A;  3CAB A;  3VRP A;  4F0Z B;  2BL0 C;  5DKR A;  1TN4 A;  1WDC C;  1F70 A;  1WY9 A;  3SG4 A;  4QJ5 B;  1M31 A;  2JC2 A;  2KSP A;  2LP3 A;  2P6B B;  3B87 A;  1SMG A;  3SS3 A;  1FPW A;  1N0Y A;  2FJU B;  4MSP A;  1QX2 A;  1M46 A;  1OOH A;  2KHN A;  1RFJ A;  2ISD A;  4M2P A;  2F3Z A;  5KTY A;  4YI8 A;  3DVK A;  2LVK A;  3B7A A;  1A29 A;  1AUI B;  3IQO A;  4GGN A;  1YVL A;  4DCK A;  1V1F A;  1UUR A;  1IGV A;  1A2X A;  1S6J A; 
#chains in the Genus database with same CATH homology
 3O6B A;  1SNL A;  1RK9 A;  2F2P A;  2Y5I A;  4N1F A;  4I5K A;  2MBX A;  3HCM A;  2M97 A;  1QX5 B;  2Y4Q A;  2BBN A;  3CR5 X;  2KFG A;  3BOW B;  1KSO A;  1QS7 A;  1ODB A;  2BCB A;  2M49 B;  2R2I A;  1XK4 A;  1NX1 A;  2L50 A;  3D0Y A;  4JPZ B;  1QV0 A;  4ETO A;  1SCM C;  3SG7 A;  3TS5 C;  1J7R A;  1QIW A;  1IWQ A;  4U8D A;  1Y1X A;  4PCW A;  2KOT A;  1XK4 C;  3BUX B;  1QAS A;  2JNX A;  3BUN B;  1XFX O;  1S26 D;  2KQ6 A;  1E8A A;  1L2O B;  1UHJ A;  3I5G B;  1FW4 A;  1RWY A;  1SKT A;  2KYC A;  3WHU B;  3I5H B;  1K8U A;  1K96 A;  4PE0 A;  2EHB A;  2HF5 A;  2SCP A;  2LM5 A;  1BLQ A;  2PSR A;  2FCE A;  2LV7 A;  1BR1 B;  1Y1U A;  4HRG A;  3SIA A;  1LA0 A;  4BY4 A;  1K93 D;  2LC5 A;  2LLS A;  2NCP A;  3LCP C;  3LLE A;  4OKH A;  4PHM A;  2TN4 A;  4HSZ A;  3GK2 A;  2ZND A;  4CPV A;  2K7C A;  1DJI A;  1BR4 B;  2K2F A;  2HET A;  1BOC A;  1YX8 A;  1DJH A;  4WQ3 A;  1KFU S;  1YVH A;  2COL B;  1J1D A;  3SG5 A;  2WCE A;  2K0J A;  4MLW A;  2LCP A;  4CFQ A;  4CFR A;  5I2O A;  2HPS A;  5D7F A;  1J55 A;  1SCV A;  4OR9 B;  2O60 A;  2KNE A;  2M7N A;  3DF0 B;  3O78 A;  2JRF A;  1YTZ C;  3RLZ A;  1MF8 B;  2Y1N A;  1NCY A;  1PSB A;  1LKJ A;  1MXL C;  2MJW B;  5CSI A;  2JXL A;  3TUY C;  4USL A;  1VRK A;  3EK4 A;  1QX7 A;  2LP2 A;  1OQP A;  1JBA A;  1RRO A;  1L7Z A;  3CWG A;  1MXE A;  5HYD A;  1F4Q A;  4A4B A;  3MSE B;  3GK1 A;  2VRG A;  2KAY A;  1HT9 A;  3NSK A;  3OX5 A;  3BUW B;  4QJ3 B;  2F2O A;  1MUX A;  1BOD A;  2JZI A;  1EL4 A;  2EC6 B;  5HKY A;  1TNP A;  1JUO A;  3SG3 A;  3CZT X;  2LAN A;  4HRE E;  2KAX A;  3D0Y B;  3GOF A;  3VGO A;  3A4U B;  1JSA A;  3WHT B;  3TZ1 A;  2KBM A;  1SR6 C;  5K89 A;  1NCX A;  2BE6 A;  3IQQ A;  1OOJ A;  3K21 A;  2LVJ A;  1S3P A;  2LMT A;  3BXK A;  4N1G A;  5ER4 X;  2I7A A;  4WQ2 A;  4C0K A;  3BQ3 A;  3EK8 A;  3NSI A;  1YUT A;  2KGB C;  1R2U A;  2JNF A;  3I5H C;  1DJY A;  1ALV A;  5BPJ A;  2EGD A;  1Y1A A;  4PE4 A;  4GGF C;  1IKU A;  3NXA A;  2NXQ A;  5PAL A;  5CSJ A;  3SJS A;  1MWN A;  1JF2 A;  1MQ1 A;  3PSR A;  4YGD B;  1XFY O;  2MLF C;  4DUQ A;  1IH0 A;  4XJK B;  5AXI A;  1IQ5 A;  3TDI A;  2LLT A;  3H4S E;  1ALW A;  1BF5 A;  1TNQ A;  1NWD A;  2WOS A;  1CM4 A;  3OX6 A;  4ZCV A;  2CNP A;  5DKN A;  2I2R E;  3M0W A;  1CLB A;  1QTX A;  1B7T Y;  1A4P A;  3TUY B;  5G08 A;  1XFW O;  2WCF A;  4PHJ A;  1TNW A;  3AKB A;  3I5F C;  3JVT C;  5AEQ A;  2NZ0 A;  4NDB A;  1WRZ A;  1B7T Z;  1C07 A;  2H61 A;  4ORA B;  4AOM A;  2HQ8 A;  4PE7 A;  3KHE A;  1UHH A;  1RJV A;  4ORC B;  1OMR A;  1EG4 A;  1DJX A;  1AVS A;  1XFZ O;  1Q80 A;  1IRJ A;  1TTX A;  2H61 C;  5TNC A;  1KK7 Y;  3VRR A;  1PK0 D;  3CS1 A;  5AAN A;  4DS7 A;  2PMY A;  2M1U A;  4FTG A;  2JUL A;  1PAL A;  1CM1 A;  1Y0V H;  2CBL A;  2MAZ A;  2RGI A;  1XVJ A;  5DKQ A;  2KQY A;  2EC6 C;  4PHK A;  2K61 A;  4M2Q A;  4YGC B;  2PVB A;  2MRD A;  1IJ5 A;  1RTP 1;  3O4Y A;  1UP5 A;  4N5X A;  1SR6 B;  2E30 A;  4ICB A;  4I5L B;  5I2L A;  4QJ4 B;  1DJZ A;  1ZAC A;  1LA3 A;  2O5G A;  3E3R A;  1NCZ A;  1F4O A;  5KSZ A;  2SAS A;  1NYA A;  1HQV A;  5HLV A;  2K7B A;  1EJ3 A;  5JOL A;  3I5I B;  1SBJ A;  2LHI A;  4C0J A;  4GBA A;  4E68 A;  1B8R A;  1D1O A;  5B8I B;  3EKH A;  1B47 A;  2BBM A;  2MA2 A;  3CR2 A;  1QLK A;  1U5I A;  1H4B A;  1BG1 A;  3QRX A;  1DJG A;  1CNP A;  1AJ5 A;  1XFU O;  2JPT A;  2Q91 A;  1DF0 A;  1GQM A;  2Q4U A;  2D8N A;  2FCD A;  1J7P A;  1UWO A;  4M2O A;  3TDZ A;  5GQQ C;  1CKK A;  2F33 A;  1K90 D;  1BMO A;  1DTL A;  2BCX A;  3NSL A;  4BY5 A;  5KU1 A;  2CTN A;  1NSH A;  1S6C A;  3I5F B;  3JVT B;  1CFP A;  4UPG A;  1J7O A;  4GPL B;  1YUU A;  2L51 A;  3ZWH A;  1OMD A;  1XA5 A;  4YRU A;  1V1G A;  3VRN A;  4OCI A;  1CTR A;  1WLM A;  1FI6 A;  5D69 A;  1YR5 A;  2MHH A;  1WRL A;  3VRQ A;  3WXA A;  1KFX L;  1TRF A;  3EK7 A;  2B1U A;  2KDH A;  2K7D A;  2JT3 A;  2OTG B;  3CLN A;  4A4C A;  1N2D A;  1F71 A;  2KI4 C;  2HQW A;  1UHK A;  2KYF A;  1SRA A;  2LHL A;  2AMI A;  4PDZ A;  3FWC A;  1CLL A;  1BT6 A;  1WRK A;  1KWO C;  4NDC A;  1EG3 A;  1TCO B;  4MZL A;  1W7J B;  3EVV A;  4P2Y B;  1KK8 B;  1LIN A;  1JWD A;  2LVV A;  2KI6 C;  1J1E A;  3DVM A;  3FIA A;  2OS8 B;  4TNC A;  4L9M A;  3PM8 A;  1M45 A;  3EVU A;  2M1K B;  2CXJ A;  1A75 A;  2LUX A;  2KI6 D;  2LAP A;  2K7O A;  3GK4 X;  3I5I C;  4R1E A;  2M29 A;  1K2H A;  3CGA A;  5HLO A;  4MRX A;  1SL8 A;  3SG2 A;  1CDM A;  2LMV A;  4PE1 A;  2L5X B;  1QXP A;  2LMU A;  2L2E A;  3IF7 A;  1PRW A;  1DJW A;  4PAL A;  2PAS A;  3LL8 B;  1YUS A;  2JT8 A;  4MZK A;  3LK0 A;  1G33 A;  1SYM A;  3DVJ A;  2ZFD A;  1ZMZ A;  1DF0 B;  2JTT A;  1CLM A;  2JWW A;  4NQG A;  1PVA A;  2AAO A;  1SK6 D;  4NDD A;  3FS7 A;  5CPV A;  1EH2 A;  1N65 A;  1NIW A;  3PAT A;  1CMG A;  1M63 B;  1UUS A;  2G9B A;  1YRT B;  3PFV A;  1H8B A;  4MBE A;  3BUO B;  4PHN A;  2M7L A;  1KFX S;  1JF0 A;  1CFC A;  2FOT A;  1DT7 B;  1LVC D;  2MLE C;  3A8R A;  3SG6 A;  4AQI A;  3DF0 A;  1IG5 A;  2PRU A;  1R6P A;  4I5J A;  1KFU L;  1XO5 A;  2LE9 B;  5CSN A;  3SIB A;  2E6W A;  4MEW A;  1C7W A;  1SY9 A;  1QV1 A;  2L4H A;  2KI4 B;  4JWQ A;  3WNX B;  1KK7 Z;  1NPQ A;  2OTG C;  4MZJ A;  3FWB A;  1XFV O;  1KWO B;  3TDU A;  1AJ4 A;  1NUB A;  4DIR A;  1ZUZ A;  1OZS A;  1TOP A;  3CR4 X;  1KK8 C;  4YGA A;  2JXC A;  3ICB A;  2H2K A;  2V53 A;  3JTD C;  4MVF A;  5IBW A;  1CFF A;  1YRU B;  1CB1 A;  2OS8 C;  4IL1 A;  3OB2 B;  4D1E A;  1KQM C;  1PSR A;  4WRI A;  4C0L A;  2I18 A;  1KQV A;  1B4C A;  1EXR A;  1FI5 A;  1S1E A;  1A75 B;  2BKI B;  3PN7 C;  1QAT A;  2QAC A;  1QJT A;  2KFF A;  1GGW A;  4CID A;  2OPO A;  1TCF A;  1F54 A;  1GGZ A;  2LUC A;  1AP4 A;  1FBV A;  3DD4 A;  1NX3 A;  4OVN F;  1YUR A;  2KBI A;  3KF9 A;  5HKW A;  4YGB B;  1GJY A;  2WND A;  2BEC A;  2L0P A;  1SL9 A;  1B8L A;  1NX0 A;  1KSM A;  1A03 A;  1UHN A;  2WC8 A;  1PVB A;  3AAJ A;  2KAV A;  1OSA A;  2ZN9 A;  2BE4 A;  1OZO A;  1C7V A;  3KEV A;  2F8P A;  1Y6W A;  1XYD A;  4HRH A;  2Y1M A;  3BYA A;  4XJK A;  5HKZ A;  1QVI Y;  1BJF A;  2M0R A;  4XYN A;  5J3X A;  1CDN A;  1JFJ A;  3F45 A;  2IS9 A;  2BL0 B;  1WDC B;  1W7I B;  1B9A A;  2M9G A;  2M8U A;  1OMV A;  1YX7 A;  2GV5 A;  2WOR A;  1QVI Z;  1NP8 A;  5AER A;  3KO0 A;  4AQJ A;  5JJG A;  2K8M B;  1SL7 A;  1G8I A;  3CTN A;  3C1V A;  3ZNI A;  4GUK A;  2ZRT A;  1MR8 A;  1TIZ A;  1DMO A;  2DOQ A;  4GFT A;  1K9P A;  1REC A;  3AAK A;  1CFD A;  1F55 A;  4MN0 A;  2G2B A;  2JOJ A;  4YGE B;  1OE9 B;  1F8H A;  1KCY A;  1QLS A;  2NCO A;  2LVI A;  3HX4 A;  3DVE A;  2JQ6 A;  2LLU A;  1SW8 A;  5I8N A;  1LXF C;  3BOW A;  1M39 A;  1NX2 A;  1TNX A;  3PLF B;  2ZRS A;  5I2Q A;  1S6I A;  2BKH B;  3JTD B;  1S36 A;  4YBH B;  3OHM B;  3EKJ A;  1DVI A;  5FYX A;  1FF1 A;  1J7Q A;  5F6T A;  1G4Y R;  1K9K A;  4OV2 A;  1KQM B;  1S5G Y;  4ORB B;  3PAL A;  3O2P A;  1SCM B;  3OP0 A;  5AFP A;  3TS5 B;  1DGU A;  1ZFS A;  1WLZ A;  1CMF A;  2WCB A;  3LK1 A;  1K94 A;  1S5G Z;  3PN7 B;  1CDP A;  2F3Y A;  2AUC A;  3BUM B;  1MHO A;  2GGZ A;  1UHI A;  3NSO A;  2ZN8 A;  4GNK B;  1U5I B;  1B1G A;  1JFK A;  3EVR A;  1QIV A;  2ZNE A;  4GAO A;  5CSF A;  2M3W A;  4MRY A;  2L98 A;  5ER5 A;  1AK8 A;  1JC2 A;  2QPT A;  1BU3 A;  4Q04 A;  2CCM A;  2CT9 A;  1L2O C;  4GGF A;  3OB1 B;  4YI9 A;  1SPY A;  2A4J A;  2KGR A;  3I5G C;  1CDL A;  2LNK A;  1ZOT B;  2I94 A;  1K95 A;  1K9U A;  1DGV A;  2JU0 A;  1X02 A;  2JTZ A;  3KPX A;  2GGM A;  1IQ3 A;  4FQO A;  2BCA A;  1PUL A;  2NLN A;  3RM1 A;  2L4I A;  2PAL A;  3AKA A;  4I5N B;  4CLN A;  1IJ6 A;  2K2A A;  4ZCU A;  2ZKM X;  4P5O E;  4DRW A;  3D10 A;  3VRO A;  4JQ0 D;  1B8C A;  4F0Z B;  2JT0 A;  1AHR A;  2KFH A;  3VRP A;  1F70 A;  2BL0 C;  5DKR A;  1TN4 A;  1WDC C;  1WY9 A;  3SG4 A;  4QJ5 B;  1M31 A;  2JC2 A;  2KSP A;  2LP3 A;  2P6B B;  1SMG A;  1FPW A;  1N0Y A;  2FJU B;  4MSP A;  1QX2 A;  1M46 A;  2KHN A;  1RFJ A;  2ISD A;  4M2P A;  2F3Z A;  5KTY A;  4YI8 A;  3DVK A;  2LVK A;  1A29 A;  1AUI B;  3IQO A;  4GGN A;  1YVL A;  4DCK A;  1V1F A;  1UUR A;  1IGV A;  1A2X A;  1S6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...