2IS9A

Structure of yeast dcn-1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
AHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural basis for the function of DCN-1 in protein Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 70
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2is9A01
1SL9A 2MLFC 3O2PA 1HQVA 1ODBA 2ZFDA 4XYNA 1NX3A 3NSLA 1Y1XA 2LP3A 1R6PA 3BUWB 3ZWHA 2MLEC 1J7RA 1HT9A 1M31A 2BE4A 3DVEA 2JRFA 1PALA 1SYMA 1TN4A 2HQ8A 3AAKA 4MVFA 1UHHA 3VROA 1B4CA 1JWDA 2PASA 2FOTA 1OOJA 2LUCA 4CPVA 1YVLA 3D0YB 1AHRA 1QJTA 1BLQA 1LINA 2KFHA 1FBVA 1Y6WA 2LAPA 1SR6C 1XFVO 4C0KA 5HYDA 3ICBA 4OKHA 2AUCA 1N65A 2JQ6A 4M2QA 1LKJA 2JWWA 2WC8A 1TNWA 1NCXA 5CSFA 1A29A 1X02A 2JT0A 2ISDA 2PMYA 1CLBA 2HETA 2Y5IA 1JFJA 1B8LA 2BL0B 2L0PA 4U8DA 2HPSA 5JJGA 4HREE 4HSZA 3CLNA 4GPLB 1OZOA 2EHBA 1QIVA 1OSAA 1SRAA 3BUNB 3DF0A 4BY5A 1RWYA 3OX5A 3VRNA 4MZLA 1WLZA 1BJFA 2FCDA 4D1EA 5KU1A 1K95A 4YGCB 1RTP1 2M8UA 1BF5A 2KAYA 3PLFB 1QVIZ 2K8MB 2LVIA 1WDCC 2KYFA 4ORCB 2L50A 1FW4A 2Y1NA 4YGDB 1ALWA 1S6JA 3QRXA 3BOWA 3I5GC 2G9BA 4WQ3A 3TZ1A 2FJUB 2KI6D 1TNQA 4PHMA 4ZCVA 1OMDA 3FS7A 1CTRA 2DOQA 4DRWA 3D10A 1AJ4A 3I5IC 3WXAA 2OS8B 1DT7B 1MR8A 3RLZA 1K8UA 2MA2A 1TNPA 1YUTA 1SBJA 2BKHB 2LUXA 3F45A 1K96A 1CFDA 1BG1A 3NSIA 1J1DA 1GQMA 4YI9A 2OTGB 4QJ4B 2M0RA 1S1EA 2SCPA 2LNKA 1IG5A 1KK8B 2ZRSA 3DVJA 3JTDB 1QX2A 4GGFC 4GUKA 2NLNA 1G33A 4MBEA 3OP0A 1GJYA 4USLA 1B9AA 4ETOA 1FF1A 1D1OA 3KPXA 1YUSA 3TDUA 3BQ3A 2LCPA 2BCXA 1WRKA 4YBHB 2ZRTA 2F3YA 1NPQA 2L5XB 5BPJA 4MRYA 2Y1MA 1K9UA 2KBMA 2Y4QA 4YI8A 3NSOA 2H61A 2OPOA 3BUMB 2LMUA 2PRUA 3DVKA 1QLKA 1S3PA 1NCZA 1XK4C 5KSZA 1EXRA 1UHNA 1BMOA 2LVVA 1TRFA 1XO5A 1CDPA 1YR5A 2JXCA 2KFFA 3PN7C 4JPZB 5IBWA 1J7QA 1UHKA 1PRWA 5JOLA 1IJ6A 1DGVA 2KQ6A 1XFUO 1S5GZ 5D7FA 3GK2A 5TNCA 4P5OE 3KF9A 4CLNA 2L98A 4PHKA 1JF0A 1NX1A 3WHTB 2BCBA 2CXJA 4OR9B 1S26D 5DKRA 3JVTC 5F6TA 1JC2A 2KAXA 2M9GA 1PSRA 1QVIY 4P2YB 4PE7A 2KOTA 4FQOA 3H4SE 4CFRA 2BE6A 1E8AA 4A4BA 4GFTA 2P6BB 4DIRA 4AOMA 5G08A 2QACA 2LVKA 1Y1AA 1QATA 3BOWB 1DJYA 1WRZA 1JFKA 2WNDA 1CMFA 5CPVA 1J55A 1SKTA 1EG4A 2BBMA 1SCMB 1LA3A 2KI6C 5CSNA 1XFYO 4FTGA 3LLEA 4I5NB 3TS5B 3CGAA 3KO0A 1JBAA 2E30A 1JF2A 1LXFC 2JNXA 2MAZA 1KSOA 1YRTB 1W7JB 4GAOA 1FI5A 1KWOC 1SMGA 1N0YA 2KBIA 3A4UB 1CB1A 2OS8C 2ZNEA 2D8NA 3I5FC 1QS7A 2KYCA 2WCBA 1CKKA 1DVIA 4GGNA 4PCWA 1IRJA 2LV7A 3EK8A 5HLOA 3CS1A 5AFPA 2L2EA 3I5HC 1LA0A 1TNXA 1L2OB 1UWOA 2JPTA 2KI4C 1UHIA 1BU3A 4L9MA 2B1UA 2NZ0A 4PDZA 1BT6A 2JT8A 4PHJA 4WRIA 5I2LA 2K2AA 1OZSA 2LE9B 4N1FA 1NP8A 1C07A 5I2OA 1KQMB 2GGZA 3K21A 1PVBA 5KTYA 1IKUA 2F2OA 3SG6A 1S5GY 2M3WA 1YX7A 3MSEB 3O78A 2M29A 3BUXB 3EVRA 1B8CA 3SG2A 2KFGA 3BUOB 4ICBA 1F54A 2M7NA 1KSMA 2EC6B 1A75A 2Q4UA 3AAJA 3FIAA 5GQQC 1B1GA 3A8RA 2AAOA 1IH0A 3PFVA 1QX5B 2LANA 4ORAB 1SK6D 1NWDA 1CM4A 1NYAA 2VRGA 2BBNA 2F8PA 1DJZA 1GGWA 1OMVA 3CR4X 3GOFA 1IJ5A 3O4YA 2M1KB 3CWGA 2NXQA 2LHIA 1U5IA 3RM1A 4E68A 1NIWA 2L51A 1UHJA 2KHNA 2RGIA 4GGFA 1A4PA 2ZN8A 2IS9A 4PHNA 1CFPA 3SIAA 2LLSA 1F4OA 1OMRA 1BOCA 4M2OA 3EKHA 4CFQA 4C0LA 4MEWA 5B8IB 1F70A 3TDIA 2LM5A 4PALA 2COLB 2LMTA 1KFXS 2QPTA 4ORBB 1Q80A 5HKWA 2BKIB 3SG7A 4A4CA 1MQ1A 1V1FA 3CR2A 5HKYA 3PM8A 1SPYA 2K2FA 2K7OA 1CM1A 1SR6B 2L4IA 1XVJA 1SW8A 1XK4A 1XYDA 3TUYB 1ZUZA 1L7ZA 1QTXA 3OB1B 3D0YA 3NSKA 4DCKA 1UP5A 3EKJA 4N1GA 4DS7A 2G2BA 2HF5A 4N5XA 1BODA 1MF8B 1TCOB 1JSAA 3SIBA 1RROA 1A2XA 1TOPA 2M1UA 1ZOTB 4MSPA 3SJSA 1CMGA 2WOSA 5ER4X 4AQIA 5K89A 3SG4A 1K93D 2KAVA 1JUOA 1M45A 4NDCA 5HKZA 1PSBA 1W7IB 1UUSA 3EVVA 4YGBB 4HRGA 1KFXL 2Q91A 1NX0A 4WQ2A 2KQYA 3DF0B 5HLVA 2M7LA 2BL0C 1H8BA 2JT3A 4PE0A 1CDMA 1IQ5A 1M39A 2CCMA 1YTZC 1WRLA 5AERA 3LL8B 1WDCB 4NDBA 3OB2B 3VRRA 4UPGA 1LVCD 5CSIA 3I5GB 1XFZO 1SCVA 1AK8A 4XJKA 2MJWB 2CNPA 1CFCA 3VRQA 2V53A 1SNLA 3WNXB 3I5IB 1OQPA 1ZFSA 4OCIA 4OVNF 1QASA 1C7WA 2CT9A 1VRKA 2LLUA 4YGEB 1CNPA 1EL4A 1TCFA 2LHLA 5AEQA 1EH2A 1NUBA 1U5IB 1BR4B 1DJGA 2M97A 2M49B 4BY4A 3GK1A 3IQQA 5DKQA 1KQVA 1EJ3A 2K7DA 4PE1A 3DVMA 4MZKA 3SG3A 1SL7A 3O6BA 5AANA 1F71A 1QIWA 2OTGC 5J3XA 1DJXA 2O5GA 2NCPA 1K94A 2GGMA 1AVSA 1QLSA 1WY9A 2JULA 3LK0A 1MXLC 2JTTA 1KK8C 1DF0A 1BR1B 1K2HA 3JTDC 1MWNA 3SG5A 1XFWO 3LCPC 1WLMA 4NDDA 3DD4A 2EGDA 3OX6A 2K7BA 2KNEA 1DTLA 1DJHA 1NCYA 3BXKA 3HCMA 1IWQA 1CDNA 1H4BA 1ZMZA 4I5JA 3PN7B 2ZN9A 3GK4X 1F4QA 1B7TZ 1J7OA 1S36A 1PULA 3TUYC 4QJ3B 2JNFA 4AQJA 3VRPA 2WCEA 1A03A 2O60A 3KHEA 1MXEA 4QJ5B 5CSJA 1DMOA 1M63B 5I8NA 1OE9B 1FPWA 1G8IA 1Y1UA 2BECA 2LLTA 3JVTB 2LMVA 1ZACA 4I5KA 1FI6A 1QV1A 3IQOA 4MZJA 1R2UA 2MHHA 3ZNIA 4CIDA 3AKBA 3M0WA 1B8RA 1XFXO 1YRUB 1K9PA 4MRXA 1QXPA 4GNKB 3PSRA 1J7PA 1KK7Z 4M2PA 1CFFA 1AJ5A 1NSHA 1J1EA 1PVAA 2JZIA 3NXAA 2I7AA 1TTXA 4I5LB 4XJKB 1S6CA 2CBLA 5ER5A 1KFUS 1CDLA 1YURA 2GV5A 1TIZA 1GGZA 3E3RA 1S6IA 2MBXA 3EK7A 1UURA 1K90D 1AP4A 3PATA 1PK0D 5I2QA 2HQWA 1KWOB 1RFJA 2LC5A 4F0ZB 1SCMC 4GBAA 2JTZA 2H2KA 3C1VA 3I5FB 1K9KA 2L4HA 1YX8A 2A4JA 3EK4A 2R2IA 5DKNA 3TS5C 2JXLA 2K61A 1IGVA 4IL1A 1C7VA 3I5HB 2F33A 1QV0A 2K0JA 1SL8A 2KSPA 4JQ0D 1F55A 2JU0A 3PALA 2NCOA 2F2PA 2TN4A 2LVJA 1NX2A 2KI4B 1DJIA 2LP2A 2JC2A 1KFUL 1DGUA 4TNCA 1DF0B 3VGOA 1QX7A 3TDZA 2SASA 4ZCUA 3CTNA 3OHMB 1V1GA 4R1EA 1B7TY 1L2OC 4NQGA 4YRUA 3FWCA 5AXIA 1ALVA 1EG3A 1N2DA 2I2RE 5PALA 4JWQA 2KDHA 4YGAA 3WHUB 2I94A 1YVHA 1XA5A 2ZKMX 1CLMA 3CR5X 2H61C 2CTNA 1CLLA 1RJVA 2WCFA 2MRDA 3KEVA 3BYAA 4HRHA 4MN0A 1M46A 1KQMC 2PSRA 2ZNDA 3FWBA 3EVUA 1B47A 3IF7A 2F3ZA 4OV2A 1MHOA 5D69A 1A75B 1RECA 2AMIA 4Q04A 4C0JA 1MUXA 2K7CA 1KCYA 2FCEA 3CZTX 1IQ3A 1G4YR 1RK9A 1Y0VH 1AUIB 2WORA 2E6WA 2EC6C 1KK7Y 4MLWA 2PALA 1F8HA 4DUQA 5FYXA 3AKAA 3LK1A 2BCAA 3HX4A 4PE4A 1YUUA 2JOJA 2KGRA 1SY9A 2KGBC 2PVBA 2I18A 1DJWA
chains in the Genus database with same CATH superfamily
1SL9A 2MLFC 3O2PA 1HQVA 1ODBA 2ZFDA 4XYNA 1NX3A 3CYZA 3NSLA 1Y1XA 1DELA 1R6PA 2LP3A 3BUWB 5HL1A 3ZWHA 2MLEC 1J7RA 1HT9A 1M31A 2BE4A 3DVEA 1Z2CB 2JRFA 1PALA 1SYMA 3V2LA 1TN4A 2HQ8A 2KPHA 3AAKA 1UHHA 4MVFA 3IVTA 3VROA 1B4CA 2PASA 5FI6A 1JWDA 2FOTA 1OOJA 2LUCA 4CPVA 1YVLA 3D0YB 1AHRA 1QJTA 3SS5A 1BLQA 1LINA 2KFHA 1FBVA 1Y6WA 2LAPA 1SR6C 1XFVO 4C0KA 5HYDA 3ICBA 4OKHA 2AUCA 1N65A 2JQ6A 4M2QA 1LKJA 2JWWA 2WC8A 1TNWA 1NCXA 5CSFA 1A29A 1X02A 2JT0A 2ISDA 2PMYA 1CLBA 2HETA 1ORGA 5FI7A 2Y5IA 3CABA 1B8LA 1JFJA 2BL0B 2L0PA 4U8DA 3BFAA 2HPSA 5JJGA 4HREE 4HSZA 3CLNA 4GPLB 1OZOA 2EHBA 1QIVA 1OSAA 1SRAA 3BUNB 3DF0A 4BY5A 1RWYA 2YGUA 3OX5A 3VRNA 4F7FA 4MZLA 1WLZA 1BJFA 2FCDA 4D1EA 5KU1A 1K95A 4YGCB 1RTP1 2M8UA 1BF5A 2KAYA 3PLFB 1QVIZ 2K8MB 2LVIA 1WDCC 2KYFA 4ORCB 2L50A 1FW4A 2Y1NA 4YGDB 1ALWA 1S6JA 3QRXA 3BOWA 3I5GC 2G9BA 4WQ3A 3TZ1A 2FJUB 2KI6D 1TNQA 4PHMA 4ZCVA 1OMDA 3FS7A 1CTRA 2DOQA 4DRWA 3D10A 1AJ4A 1T14A 3I5IC 3WXAA 2OS8B 2QEVA 1DT7B 1MR8A 3RLZA 1K8UA 2MA2A 1TNPA 1YUTA 1SBJA 2BKHB 1TUJA 2LUXA 3F45A 1K96A 1CFDA 1BG1A 3NSIA 1J1DA 1GQMA 4YI9A 1P28A 2OTGB 4QJ4B 2M0RA 5I94A 1S1EA 2SCPA 2LNKA 1IG5A 1KK8B 2ZRSA 3DVJA 3JTDB 1QX2A 4GGFC 4GUKA 2NLNA 1G33A 3VB1A 1QWVA 4MBEA 3OP0A 1GJYA 4USLA 1B9AA 4ETOA 1FF1A 1D1OA 3KPXA 1YUSA 1C3ZA 2WCMA 3BQ3A 2LCPA 3TDUA 1GM0A 2BCXA 1WRKA 4YBHB 2ZRTA 2F3YA 1NPQA 2L5XB 5BPJA 4MRYA 2Y1MA 1K9UA 3DZTA 2KBMA 2Y4QA 4YI8A 3NSOA 2H61A 2OPOA 3BUMB 2QEOA 2LMUA 2PRUA 3DVKA 1QLKA 1S3PA 3CDNA 1NCZA 2BAPA 1XK4C 5KSZA 1EXRA 2GTEA 1UHNA 1BMOA 2LVVA 1TRFA 1XO5A 1CDPA 1YR5A 2JXCA 2KFFA 3PN7C 4JPZB 5IBWA 1J7QA 1UHKA 1PRWA 5JOLA 1IJ6A 1DGVA 3CZ1A 2KQ6A 1XFUO 1S5GZ 3D74A 5D7FA 3GK2A 5TNCA 4P5OE 3KF9A 3UO9A 3NHIA 2KLEA 3UNWA 4CLNA 2L98A 4PHKA 3S0AA 1JF0A 1NX1A 3WHTB 2BCBA 2CXJA 4OR9B 1S26D 5DKRA 3JVTC 5F6TA 1JC2A 1Z4HA 2PYQA 1IIOA 2KAXA 2M9GA 1PSRA 1QVIY 4P2YB 4PE7A 2KOTA 4FQOA 2L5YA 3H4SE 4CFRA 2BE6A 1E8AA 3R1VA 4GFTA 4A4BA 2P6BB 4DIRA 5FI2A 4AOMA 2JPOA 5G08A 3D75A 2QACA 3SS4A 2LVKA 1Y1AA 1QATA 3BOWB 1DJYA 1WRZA 1JFKA 2WNDA 1CMFA 5CPVA 1J55A 1C3YA 1SKTA 1EG4A 2BBMA 1SCMB 1LA3A 3PJIA 3R72A 2KI6C 5CSNA 1XFYO 4FTGA 3LLEA 4I5NB 3TS5B 3CGAA 3KO0A 1JBAA 2E30A 1JF2A 1LXFC 2JNXA 2MAZA 1KSOA 1YRTB 1W7JB 4GAOA 1FI5A 1KWOC 1SMGA 1N0YA 2KBIA 3A4UB 1CB1A 1W9ZA 2OS8C 2ZNEA 2D8NA 4FQTA 3I5FC 1QS7A 2KYCA 2WCBA 1DC1A 1DVIA 4GGNA 4PCWA 1CKKA 1IRJA 3L4AA 2LV7A 3EK8A 5HLOA 3DYEA 3CS1A 5AFPA 2L2EA 3I5HC 1LA0A 1TNXA 1L2OB 3NHTA 3DY9A 1UWOA 2JPTA 2KI4C 5DICA 3OGNA 1UHIA 1BU3A 4L9MA 2B1UA 2NZ0A 2P71A 4PDZA 1BT6A 2JT8A 2PQLA 3B87A 4PHJA 4WRIA 5I2LA 2K2AA 1OZSA 2LE9B 4N1FA 1NP8A 2QEHA 1C07A 3FE8A 5I2OA 1KQMB 2GGZA 3K21A 3RZSA 1PVBA 5KTYA 1IKUA 2F2OA 3SG6A 3D73A 1S5GY 5EL2A 2M3WA 1YX7A 3MSEB 3O78A 2M29A 3BUXB 3EVRA 1B8CA 3SG2A 2KFGA 3BUOB 4ICBA 1F54A 2M7NA 1KSMA 2EC6B 1A75A 2Q4UA 3B88A 3AAJA 3D76A 3FIAA 5GQQC 1B1GA 3A8RA 2AAOA 1IH0A 3PFVA 1QX5B 2LANA 4ORAB 1SK6D 1NWDA 1CM4A 1NYAA 2VRGA 3PM2A 2BBNA 2F8PA 1DJZA 3K1EA 1GGWA 1OMVA 3CR4X 3GOFA 1IJ5A 3O4YA 2M1KB 3CWGA 2NXQA 2LHIA 1OW4A 1U5IA 3RM1A 4E68A 1NIWA 2L51A 1UHJA 2KHNA 2RGIA 4GGFA 1A4PA 2ZN8A 2IS9A 1TWOA 4PHNA 1CFPA 3SIAA 2LLSA 1F4OA 1OMRA 1BOCA 4M2OA 3EKHA 4CFQA 4C0LA 4MEWA 3S0EA 5B8IB 1F70A 3TDIA 2LM5A 4PALA 2COLB 2LMTA 1KFXS 2QPTA 4ORBB 1Q80A 5HKWA 2BKIB 3SG7A 4A4CA 1MQ1A 1V1FA 3CR2A 5HKYA 3PM8A 1SPYA 2K2FA 2K7OA 1CM1A 1SR6B 2L4IA 1XVJA 1SW8A 1XK4A 1XYDA 3TUYB 1ZUZA 1L7ZA 1QTXA 3OB1B 3D0YA 3NSKA 4DCKA 1UP5A 3EKJA 4N1GA 4DS7A 2G2BA 2HF5A 4N5XA 4INXA 1BODA 1MF8B 1TCOB 5D3OA 1JSAA 3SIBA 1TUZA 1RROA 1A2XA 1TOPA 2M1UA 1ZOTB 3L47A 4MSPA 3D78A 3SJSA 1CMGA 2WOSA 5ER4X 4AQIA 5K89A 3SG4A 1K93D 2KAVA 3QMEA 1JUOA 1M45A 4NDCA 5HKZA 1PSBA 3FE9A 1W7IB 1UUSA 3EVVA 4YGBB 4HRGA 1KFXL 2Q91A 1NX0A 2H8VA 2KQYA 3DF0B 4WQ2A 5HLVA 2M7LA 2BL0C 1H8BA 2JT3A 4PE0A 1CDMA 1IQ5A 1M39A 2CCMA 1YTZC 1WRLA 5AERA 3LL8B 1WDCB 1SSEB 3OB2B 4NDBA 3VRRA 4UPGA 1LVCD 5CSIA 2QDIA 3I5GB 1XFZO 1SCVA 1AK8A 4PT1A 4XJKA 2MJWB 2CNPA 3CZ0A 1CFCA 3VRQA 2V53A 1SNLA 3WNXB 2L2CA 3I5IB 1OOGA 1OQPA 1ZFSA 3BJHA 4OCIA 4OVNF 1QASA 3B86A 1C7WA 2CT9A 1VRKA 2LLUA 2WC5A 4YGEB 1CNPA 1EL4A 2P70A 1OOFA 1TCFA 2LHLA 5AEQA 1EH2A 1NUBA 4INWA 1U5IB 1BR4B 2KLDA 1DJGA 2M97A 2M49B 3BFHA 4BY4A 3CZ2A 3GK1A 3IQQA 5DKQA 1KQVA 1EJ3A 2K7DA 4PE1A 3DVMA 3DXLA 4MZKA 3SG3A 1SL7A 3O6BA 5AANA 1F71A 1QIWA 2OTGC 5J3XA 1DJXA 2O5GA 2NCPA 1K94A 2GGMA 1AVSA 1QLSA 1WY9A 2JULA 3LK0A 1MXLC 2JTTA 1KK8C 1DF0A 1BR1B 3OBVA 3JTDC 1MWNA 1OOHA 3SG5A 1K2HA 1XFWO 3LCPC 1WLMA 3R1PA 3DD4A 4NDDA 2EGDA 3OX6A 2K7BA 2KNEA 1DTLA 1DJHA 1NCYA 3BXKA 3HCMA 1IWQA 1CDNA 1H4BA 1ZMZA 3S0GA 4I5JA 3PN7B 2ZN9A 3S0DA 3GK4X 1F4QA 3N7HA 1B7TZ 1J7OA 1S36A 1PULA 3TUYC 4QJ3B 2JNFA 4AQJA 3VRPA 2WCEA 2WCJA 2ERBA 1A03A 2O60A 3KHEA 1MXEA 4QJ5B 5CSJA 1DMOA 1M63B 5I8NA 1OE9B 1OOIX 3B6XA 1FPWA 1G8IA 1Y1UA 2BECA 2LLTA 3JVTB 4OZDA 2LMVA 1ZACA 4I5KA 1FI6A 1QV1A 3IQOA 4MZJA 1R2UA 2MHHA 3ZNIA 2QEBA 4CIDA 3AKBA 3M0WA 1B8RA 1XFXO 2WCKA 1YRUB 1K9PA 4MRXA 1QXPA 4GNKB 3PSRA 1J7PA 1KK7Z 4M2PA 3SS3A 1CFFA 1AJ5A 1NSHA 1J1EA 1PVAA 2JZIA 3NXAA 2I7AA 1TTXA 4I5LB 4XJKB 1S6CA 2CBLA 5ER5A 1KFUS 3FE6A 1CDLA 1YURA 2GV5A 1TIZA 1GGZA 3E3RA 1S6IA 2MBXA 3EK7A 1UURA 1K90D 3NGVA 1AP4A 3PATA 1PK0D 5I2QA 2HQWA 1KWOB 1RFJA 2LC5A 4F0ZB 3D77A 1SCMC 4GBAA 2JTZA 2H2KA 3C1VA 3I5FB 1K9KA 2L4HA 4JD9A 1YX8A 2A4JA 3EK4A 2R2IA 5DKNA 1XFRA 3TS5C 2JXLA 2K61A 1IGVA 4IL1A 1C7VA 3I5HB 2F33A 1QV0A 1LS8A 1SL8A 2K0JA 2KSPA 2WCHA 2JU0A 4JQ0D 3PALA 2NCOA 1F55A 3Q8IA 2F2PA 2TN4A 2LVJA 3S0FA 3S0BA 1NX2A 2KI4B 1DJIA 2LP2A 2JC2A 1KFUL 1DGUA 4KYNA 1DF0B 2BNXA 2WCLA 4TNCA 3VGOA 1QX7A 3TDZA 2SASA 4ZCUA 3CTNA 3OHMB 1V1GA 4R1EA 1B7TY 1L2OC 3B7AA 4NQGA 4YRUA 3FWCA 5AXIA 1ALVA 1EG3A 1N2DA 2I2RE 2WC6A 5PALA 4JWQA 2KDHA 4YGAA 3WHUB 2I94A 3R1OA 4JKTA 1YVHA 1XA5A 2ZKMX 1CLMA 3CR5X 2H61C 2CTNA 1CLLA 1RJVA 2WCFA 2MRDA 3KEVA 3BYAA 4HRHA 4MN0A 3EG5B 1M46A 1KQMC 2PSRA 2ZNDA 3FWBA 3EVUA 3BFBA 4IJ7A 3L4LA 1B47A 3IF7A 2F3ZA 4OV2A 1MHOA 5D69A 1A75B 1RECA 2AMIA 4Q04A 4C0JA 1DEKA 1MUXA 2K7CA 1KCYA 2FCEA 3CZTX 1IQ3A 1G4YR 1DQEA 1RK9A 1Y0VH 1AUIB 2WORA 2E6WA 2EC6C 1KK7Y 4MLWA 2PALA 1F8HA 3O4XA 4DUQA 2FJYA 5FYXA 3AKAA 3LK1A 2BCAA 3HX4A 4PE4A 1YUUA 2JOJA 2KGRA 1SY9A 2KGBC 2PVBA 2I18A 1DJWA 2K60A
chains in the Genus database with same CATH topology
1SL9A 2MLFC 3O2PA 1HQVA 1ODBA 2ZFDA 4XYNA 1NX3A 3NSLA 1Y1XA 2LP3A 1R6PA 3BUWB 3ZWHA 2MLEC 1J7RA 1HT9A 1M31A 2BE4A 3DVEA 2JRFA 1PALA 1SYMA 1TN4A 2HQ8A 3AAKA 4MVFA 1UHHA 3VROA 1B4CA 1JWDA 2PASA 2FOTA 1OOJA 2LUCA 4CPVA 1YVLA 3D0YB 1AHRA 1QJTA 1BLQA 1LINA 2KFHA 1FBVA 1Y6WA 2LAPA 1SR6C 1XFVO 4C0KA 5HYDA 3ICBA 4OKHA 2AUCA 1N65A 2JQ6A 4M2QA 1LKJA 2JWWA 2WC8A 1TNWA 1NCXA 5CSFA 1A29A 1X02A 2JT0A 2ISDA 2PMYA 1CLBA 2HETA 2Y5IA 1JFJA 1B8LA 2BL0B 2L0PA 4U8DA 2HPSA 5JJGA 4HREE 4HSZA 3CLNA 4GPLB 1OZOA 2EHBA 1QIVA 1OSAA 1SRAA 3BUNB 3DF0A 4BY5A 1RWYA 3OX5A 3VRNA 4MZLA 1WLZA 1BJFA 2FCDA 4D1EA 5KU1A 1K95A 4YGCB 1RTP1 2M8UA 1BF5A 2KAYA 3PLFB 1QVIZ 2K8MB 2LVIA 1WDCC 2KYFA 4ORCB 2L50A 1FW4A 2Y1NA 4YGDB 1ALWA 1S6JA 3QRXA 3BOWA 3I5GC 2G9BA 4WQ3A 3TZ1A 2FJUB 2KI6D 1TNQA 4PHMA 4ZCVA 1OMDA 3FS7A 1CTRA 2DOQA 4DRWA 3D10A 1AJ4A 3I5IC 3WXAA 2OS8B 1DT7B 1MR8A 3RLZA 1K8UA 2MA2A 1TNPA 1YUTA 1SBJA 2BKHB 2LUXA 3F45A 1K96A 1CFDA 1BG1A 3NSIA 1J1DA 1GQMA 4YI9A 2OTGB 4QJ4B 2M0RA 1S1EA 2SCPA 2LNKA 1IG5A 1KK8B 2ZRSA 3DVJA 3JTDB 1QX2A 4GGFC 4GUKA 2NLNA 1G33A 4MBEA 3OP0A 1GJYA 4USLA 1B9AA 4ETOA 1FF1A 1D1OA 3KPXA 1YUSA 3TDUA 3BQ3A 2LCPA 2BCXA 1WRKA 4YBHB 2ZRTA 2F3YA 1NPQA 2L5XB 5BPJA 4MRYA 2Y1MA 1K9UA 2KBMA 2Y4QA 4YI8A 3NSOA 2H61A 2OPOA 3BUMB 2LMUA 2PRUA 3DVKA 1QLKA 1S3PA 1NCZA 1XK4C 5KSZA 1EXRA 1UHNA 1BMOA 2LVVA 1TRFA 1XO5A 1CDPA 1YR5A 2JXCA 2KFFA 3PN7C 4JPZB 5IBWA 1J7QA 1UHKA 1PRWA 5JOLA 1IJ6A 1DGVA 2KQ6A 1XFUO 1S5GZ 5D7FA 3GK2A 5TNCA 4P5OE 3KF9A 4CLNA 2L98A 4PHKA 1JF0A 1NX1A 3WHTB 2BCBA 2CXJA 4OR9B 1S26D 5DKRA 3JVTC 5F6TA 1JC2A 2KAXA 2M9GA 1PSRA 1QVIY 4P2YB 4PE7A 2KOTA 4FQOA 3H4SE 4CFRA 2BE6A 1E8AA 4A4BA 4GFTA 2P6BB 4DIRA 4AOMA 5G08A 2QACA 2LVKA 1Y1AA 1QATA 3BOWB 1DJYA 1WRZA 1JFKA 2WNDA 1CMFA 5CPVA 1J55A 1SKTA 1EG4A 2BBMA 1SCMB 1LA3A 2KI6C 5CSNA 1XFYO 4FTGA 3LLEA 4I5NB 3TS5B 3CGAA 3KO0A 1JBAA 2E30A 1JF2A 1LXFC 2JNXA 2MAZA 1KSOA 1YRTB 1W7JB 4GAOA 1FI5A 1KWOC 1SMGA 1N0YA 2KBIA 3A4UB 1CB1A 2OS8C 2ZNEA 2D8NA 3I5FC 1QS7A 2KYCA 2WCBA 1CKKA 1DVIA 4GGNA 4PCWA 1IRJA 2LV7A 3EK8A 5HLOA 3CS1A 5AFPA 2L2EA 3I5HC 1LA0A 1TNXA 1L2OB 1UWOA 2JPTA 2KI4C 1UHIA 1BU3A 4L9MA 2B1UA 2NZ0A 4PDZA 1BT6A 2JT8A 4PHJA 4WRIA 5I2LA 2K2AA 1OZSA 2LE9B 4N1FA 1NP8A 1C07A 5I2OA 1KQMB 2GGZA 3K21A 1PVBA 5KTYA 1IKUA 2F2OA 3SG6A 1S5GY 2M3WA 1YX7A 3MSEB 3O78A 2M29A 3BUXB 3EVRA 1B8CA 3SG2A 2KFGA 3BUOB 4ICBA 1F54A 2M7NA 1KSMA 2EC6B 1A75A 2Q4UA 3AAJA 3FIAA 5GQQC 1B1GA 3A8RA 2AAOA 1IH0A 3PFVA 1QX5B 2LANA 4ORAB 1SK6D 1NWDA 1CM4A 1NYAA 2VRGA 2BBNA 2F8PA 1DJZA 1GGWA 1OMVA 3CR4X 3GOFA 1IJ5A 3O4YA 2M1KB 3CWGA 2NXQA 2LHIA 1U5IA 3RM1A 4E68A 1NIWA 2L51A 1UHJA 2KHNA 2RGIA 4GGFA 1A4PA 2ZN8A 2IS9A 4PHNA 1CFPA 3SIAA 2LLSA 1F4OA 1OMRA 1BOCA 4M2OA 3EKHA 4CFQA 4C0LA 4MEWA 5B8IB 1F70A 3TDIA 2LM5A 4PALA 2COLB 2LMTA 1KFXS 2QPTA 4ORBB 1Q80A 5HKWA 2BKIB 3SG7A 4A4CA 1MQ1A 1V1FA 3CR2A 5HKYA 3PM8A 1SPYA 2K2FA 2K7OA 1CM1A 1SR6B 2L4IA 1XVJA 1SW8A 1XK4A 1XYDA 3TUYB 1ZUZA 1L7ZA 1QTXA 3OB1B 3D0YA 3NSKA 4DCKA 1UP5A 3EKJA 4N1GA 4DS7A 2G2BA 2HF5A 4N5XA 1BODA 1MF8B 1TCOB 1JSAA 3SIBA 1RROA 1A2XA 1TOPA 2M1UA 1ZOTB 4MSPA 3SJSA 1CMGA 2WOSA 5ER4X 4AQIA 5K89A 3SG4A 1K93D 2KAVA 1JUOA 1M45A 4NDCA 5HKZA 1PSBA 1W7IB 1UUSA 3EVVA 4YGBB 4HRGA 1KFXL 2Q91A 1NX0A 4WQ2A 2KQYA 3DF0B 5HLVA 2M7LA 2BL0C 1H8BA 2JT3A 4PE0A 1CDMA 1IQ5A 1M39A 2CCMA 1YTZC 1WRLA 5AERA 3LL8B 1WDCB 4NDBA 3OB2B 3VRRA 4UPGA 1LVCD 5CSIA 3I5GB 1XFZO 1SCVA 1AK8A 4XJKA 2MJWB 2CNPA 1CFCA 3VRQA 2V53A 1SNLA 3WNXB 3I5IB 1OQPA 1ZFSA 4OCIA 4OVNF 1QASA 1C7WA 2CT9A 1VRKA 2LLUA 4YGEB 1CNPA 1EL4A 1TCFA 2LHLA 5AEQA 1EH2A 1NUBA 1U5IB 1BR4B 1DJGA 2M97A 2M49B 4BY4A 3GK1A 3IQQA 5DKQA 1KQVA 1EJ3A 2K7DA 4PE1A 3DVMA 4MZKA 3SG3A 1SL7A 3O6BA 5AANA 1F71A 1QIWA 2OTGC 5J3XA 1DJXA 2O5GA 2NCPA 1K94A 2GGMA 1AVSA 1QLSA 1WY9A 2JULA 3LK0A 1MXLC 2JTTA 1KK8C 1DF0A 1BR1B 1K2HA 3JTDC 1MWNA 3SG5A 1XFWO 3LCPC 1WLMA 4NDDA 3DD4A 2EGDA 3OX6A 2K7BA 2KNEA 1DTLA 1DJHA 1NCYA 3BXKA 3HCMA 1IWQA 1CDNA 1H4BA 1ZMZA 4I5JA 3PN7B 2ZN9A 3GK4X 1F4QA 1B7TZ 1J7OA 1S36A 1PULA 3TUYC 4QJ3B 2JNFA 4AQJA 3VRPA 2WCEA 1A03A 2O60A 3KHEA 1MXEA 4QJ5B 5CSJA 1DMOA 1M63B 5I8NA 1OE9B 1FPWA 1G8IA 1Y1UA 2BECA 2LLTA 3JVTB 2LMVA 1ZACA 4I5KA 1FI6A 1QV1A 3IQOA 4MZJA 1R2UA 2MHHA 3ZNIA 4CIDA 3AKBA 3M0WA 1B8RA 1XFXO 1YRUB 1K9PA 4MRXA 1QXPA 4GNKB 3PSRA 1J7PA 1KK7Z 4M2PA 1CFFA 1AJ5A 1NSHA 1J1EA 1PVAA 2JZIA 3NXAA 2I7AA 1TTXA 4I5LB 4XJKB 1S6CA 2CBLA 5ER5A 1KFUS 1CDLA 1YURA 2GV5A 1TIZA 1GGZA 3E3RA 1S6IA 2MBXA 3EK7A 1UURA 1K90D 1AP4A 3PATA 1PK0D 5I2QA 2HQWA 1KWOB 1RFJA 2LC5A 4F0ZB 1SCMC 4GBAA 2JTZA 2H2KA 3C1VA 3I5FB 1K9KA 2L4HA 1YX8A 2A4JA 3EK4A 2R2IA 5DKNA 3TS5C 2JXLA 2K61A 1IGVA 4IL1A 1C7VA 3I5HB 2F33A 1QV0A 2K0JA 1SL8A 2KSPA 4JQ0D 1F55A 2JU0A 3PALA 2NCOA 2F2PA 2TN4A 2LVJA 1NX2A 2KI4B 1DJIA 2LP2A 2JC2A 1KFUL 1DGUA 4TNCA 1DF0B 3VGOA 1QX7A 3TDZA 2SASA 4ZCUA 3CTNA 3OHMB 1V1GA 4R1EA 1B7TY 1L2OC 4NQGA 4YRUA 3FWCA 5AXIA 1ALVA 1EG3A 1N2DA 2I2RE 5PALA 4JWQA 2KDHA 4YGAA 3WHUB 2I94A 1YVHA 1XA5A 2ZKMX 1CLMA 3CR5X 2H61C 2CTNA 1CLLA 1RJVA 2WCFA 2MRDA 3KEVA 3BYAA 4HRHA 4MN0A 1M46A 1KQMC 2PSRA 2ZNDA 3FWBA 3EVUA 1B47A 3IF7A 2F3ZA 4OV2A 1MHOA 5D69A 1A75B 1RECA 2AMIA 4Q04A 4C0JA 1MUXA 2K7CA 1KCYA 2FCEA 3CZTX 1IQ3A 1G4YR 1RK9A 1Y0VH 1AUIB 2WORA 2E6WA 2EC6C 1KK7Y 4MLWA 2PALA 1F8HA 4DUQA 5FYXA 3AKAA 3LK1A 2BCAA 3HX4A 4PE4A 1YUUA 2JOJA 2KGRA 1SY9A 2KGBC 2PVBA 2I18A 1DJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL9 A;  2MLF C;  3O2P A;  1HQV A;  1ODB A;  2ZFD A;  4XYN A;  1NX3 A;  3NSL A;  1Y1X A;  2LP3 A;  1R6P A;  3BUW B;  3ZWH A;  2MLE C;  1J7R A;  1HT9 A;  1M31 A;  2BE4 A;  3DVE A;  2JRF A;  1PAL A;  1SYM A;  1TN4 A;  2HQ8 A;  3AAK A;  4MVF A;  1UHH A;  3VRO A;  1B4C A;  1JWD A;  2PAS A;  2FOT A;  1OOJ A;  2LUC A;  4CPV A;  1YVL A;  3D0Y B;  1AHR A;  1QJT A;  1BLQ A;  1LIN A;  2KFH A;  1FBV A;  1Y6W A;  2LAP A;  1SR6 C;  1XFV O;  4C0K A;  5HYD A;  3ICB A;  4OKH A;  2AUC A;  1N65 A;  2JQ6 A;  4M2Q A;  1LKJ A;  2JWW A;  2WC8 A;  1TNW A;  1NCX A;  5CSF A;  1A29 A;  1X02 A;  2JT0 A;  2ISD A;  2PMY A;  1CLB A;  2HET A;  2Y5I A;  1JFJ A;  1B8L A;  2BL0 B;  2L0P A;  4U8D A;  2HPS A;  5JJG A;  4HRE E;  4HSZ A;  3CLN A;  4GPL B;  1OZO A;  2EHB A;  1QIV A;  1OSA A;  1SRA A;  3BUN B;  3DF0 A;  4BY5 A;  1RWY A;  3OX5 A;  3VRN A;  4MZL A;  1WLZ A;  1BJF A;  2FCD A;  4D1E A;  5KU1 A;  1K95 A;  4YGC B;  1RTP 1;  2M8U A;  1BF5 A;  2KAY A;  3PLF B;  1QVI Z;  2K8M B;  2LVI A;  1WDC C;  2KYF A;  4ORC B;  2L50 A;  1FW4 A;  2Y1N A;  4YGD B;  1ALW A;  1S6J A;  3QRX A;  3BOW A;  3I5G C;  2G9B A;  4WQ3 A;  3TZ1 A;  2FJU B;  2KI6 D;  1TNQ A;  4PHM A;  4ZCV A;  1OMD A;  3FS7 A;  1CTR A;  2DOQ A;  4DRW A;  3D10 A;  1AJ4 A;  3I5I C;  3WXA A;  2OS8 B;  1DT7 B;  1MR8 A;  3RLZ A;  1K8U A;  2MA2 A;  1TNP A;  1YUT A;  1SBJ A;  2BKH B;  2LUX A;  3F45 A;  1K96 A;  1CFD A;  1BG1 A;  3NSI A;  1J1D A;  1GQM A;  4YI9 A;  2OTG B;  4QJ4 B;  2M0R A;  1S1E A;  2SCP A;  2LNK A;  1IG5 A;  1KK8 B;  2ZRS A;  3DVJ A;  3JTD B;  1QX2 A;  4GGF C;  4GUK A;  2NLN A;  1G33 A;  4MBE A;  3OP0 A;  1GJY A;  4USL A;  1B9A A;  4ETO A;  1FF1 A;  1D1O A;  3KPX A;  1YUS A;  3TDU A;  3BQ3 A;  2LCP A;  2BCX A;  1WRK A;  4YBH B;  2ZRT A;  2F3Y A;  1NPQ A;  2L5X B;  5BPJ A;  4MRY A;  2Y1M A;  1K9U A;  2KBM A;  2Y4Q A;  4YI8 A;  3NSO A;  2H61 A;  2OPO A;  3BUM B;  2LMU A;  2PRU A;  3DVK A;  1QLK A;  1S3P A;  1NCZ A;  1XK4 C;  5KSZ A;  1EXR A;  1UHN A;  1BMO A;  2LVV A;  1TRF A;  1XO5 A;  1CDP A;  1YR5 A;  2JXC A;  2KFF A;  3PN7 C;  4JPZ B;  5IBW A;  1J7Q A;  1UHK A;  1PRW A;  5JOL A;  1IJ6 A;  1DGV A;  2KQ6 A;  1XFU O;  1S5G Z;  5D7F A;  3GK2 A;  5TNC A;  4P5O E;  3KF9 A;  4CLN A;  2L98 A;  4PHK A;  1JF0 A;  1NX1 A;  3WHT B;  2BCB A;  2CXJ A;  4OR9 B;  1S26 D;  5DKR A;  3JVT C;  5F6T A;  1JC2 A;  2KAX A;  2M9G A;  1PSR A;  1QVI Y;  4P2Y B;  4PE7 A;  2KOT A;  4FQO A;  3H4S E;  4CFR A;  2BE6 A;  1E8A A;  4A4B A;  4GFT A;  2P6B B;  4DIR A;  4AOM A;  5G08 A;  2QAC A;  2LVK A;  1Y1A A;  1QAT A;  3BOW B;  1DJY A;  1WRZ A;  1JFK A;  2WND A;  1CMF A;  5CPV A;  1J55 A;  1SKT A;  1EG4 A;  2BBM A;  1SCM B;  1LA3 A;  2KI6 C;  5CSN A;  1XFY O;  4FTG A;  3LLE A;  4I5N B;  3TS5 B;  3CGA A;  3KO0 A;  1JBA A;  2E30 A;  1JF2 A;  1LXF C;  2JNX A;  2MAZ A;  1KSO A;  1YRT B;  1W7J B;  4GAO A;  1FI5 A;  1KWO C;  1SMG A;  1N0Y A;  2KBI A;  3A4U B;  1CB1 A;  2OS8 C;  2ZNE A;  2D8N A;  3I5F C;  1QS7 A;  2KYC A;  2WCB A;  1CKK A;  1DVI A;  4GGN A;  4PCW A;  1IRJ A;  2LV7 A;  3EK8 A;  5HLO A;  3CS1 A;  5AFP A;  2L2E A;  3I5H C;  1LA0 A;  1TNX A;  1L2O B;  1UWO A;  2JPT A;  2KI4 C;  1UHI A;  1BU3 A;  4L9M A;  2B1U A;  2NZ0 A;  4PDZ A;  1BT6 A;  2JT8 A;  4PHJ A;  4WRI A;  5I2L A;  2K2A A;  1OZS A;  2LE9 B;  4N1F A;  1NP8 A;  1C07 A;  5I2O A;  1KQM B;  2GGZ A;  3K21 A;  1PVB A;  5KTY A;  1IKU A;  2F2O A;  3SG6 A;  1S5G Y;  2M3W A;  1YX7 A;  3MSE B;  3O78 A;  2M29 A;  3BUX B;  3EVR A;  1B8C A;  3SG2 A;  2KFG A;  3BUO B;  4ICB A;  1F54 A;  2M7N A;  1KSM A;  2EC6 B;  1A75 A;  2Q4U A;  3AAJ A;  3FIA A;  5GQQ C;  1B1G A;  3A8R A;  2AAO A;  1IH0 A;  3PFV A;  1QX5 B;  2LAN A;  4ORA B;  1SK6 D;  1NWD A;  1CM4 A;  1NYA A;  2VRG A;  2BBN A;  2F8P A;  1DJZ A;  1GGW A;  1OMV A;  3CR4 X;  3GOF A;  1IJ5 A;  3O4Y A;  2M1K B;  3CWG A;  2NXQ A;  2LHI A;  1U5I A;  3RM1 A;  4E68 A;  1NIW A;  2L51 A;  1UHJ A;  2KHN A;  2RGI A;  4GGF A;  1A4P A;  2ZN8 A;  2IS9 A;  4PHN A;  1CFP A;  3SIA A;  2LLS A;  1F4O A;  1OMR A;  1BOC A;  4M2O A;  3EKH A;  4CFQ A;  4C0L A;  4MEW A;  5B8I B;  1F70 A;  3TDI A;  2LM5 A;  4PAL A;  2COL B;  2LMT A;  1KFX S;  2QPT A;  4ORB B;  1Q80 A;  5HKW A;  2BKI B;  3SG7 A;  4A4C A;  1MQ1 A;  1V1F A;  3CR2 A;  5HKY A;  3PM8 A;  1SPY A;  2K2F A;  2K7O A;  1CM1 A;  1SR6 B;  2L4I A;  1XVJ A;  1SW8 A;  1XK4 A;  1XYD A;  3TUY B;  1ZUZ A;  1L7Z A;  1QTX A;  3OB1 B;  3D0Y A;  3NSK A;  4DCK A;  1UP5 A;  3EKJ A;  4N1G A;  4DS7 A;  2G2B A;  2HF5 A;  4N5X A;  1BOD A;  1MF8 B;  1TCO B;  1JSA A;  3SIB A;  1RRO A;  1A2X A;  1TOP A;  2M1U A;  1ZOT B;  4MSP A;  3SJS A;  1CMG A;  2WOS A;  5ER4 X;  4AQI A;  5K89 A;  3SG4 A;  1K93 D;  2KAV A;  1JUO A;  1M45 A;  4NDC A;  5HKZ A;  1PSB A;  1W7I B;  1UUS A;  3EVV A;  4YGB B;  4HRG A;  1KFX L;  2Q91 A;  1NX0 A;  4WQ2 A;  2KQY A;  3DF0 B;  5HLV A;  2M7L A;  2BL0 C;  1H8B A;  2JT3 A;  4PE0 A;  1CDM A;  1IQ5 A;  1M39 A;  2CCM A;  1YTZ C;  1WRL A;  5AER A;  3LL8 B;  1WDC B;  4NDB A;  3OB2 B;  3VRR A;  4UPG A;  1LVC D;  5CSI A;  3I5G B;  1XFZ O;  1SCV A;  1AK8 A;  4XJK A;  2MJW B;  2CNP A;  1CFC A;  3VRQ A;  2V53 A;  1SNL A;  3WNX B;  3I5I B;  1OQP A;  1ZFS A;  4OCI A;  4OVN F;  1QAS A;  1C7W A;  2CT9 A;  1VRK A;  2LLU A;  4YGE B;  1CNP A;  1EL4 A;  1TCF A;  2LHL A;  5AEQ A;  1EH2 A;  1NUB A;  1U5I B;  1BR4 B;  1DJG A;  2M97 A;  2M49 B;  4BY4 A;  3GK1 A;  3IQQ A;  5DKQ A;  1KQV A;  1EJ3 A;  2K7D A;  4PE1 A;  3DVM A;  4MZK A;  3SG3 A;  1SL7 A;  3O6B A;  5AAN A;  1F71 A;  1QIW A;  2OTG C;  5J3X A;  1DJX A;  2O5G A;  2NCP A;  1K94 A;  2GGM A;  1AVS A;  1QLS A;  1WY9 A;  2JUL A;  3LK0 A;  1MXL C;  2JTT A;  1KK8 C;  1DF0 A;  1BR1 B;  1K2H A;  3JTD C;  1MWN A;  3SG5 A;  1XFW O;  3LCP C;  1WLM A;  4NDD A;  3DD4 A;  2EGD A;  3OX6 A;  2K7B A;  2KNE A;  1DTL A;  1DJH A;  1NCY A;  3BXK A;  3HCM A;  1IWQ A;  1CDN A;  1H4B A;  1ZMZ A;  4I5J A;  3PN7 B;  2ZN9 A;  3GK4 X;  1F4Q A;  1B7T Z;  1J7O A;  1S36 A;  1PUL A;  3TUY C;  4QJ3 B;  2JNF A;  4AQJ A;  3VRP A;  2WCE A;  1A03 A;  2O60 A;  3KHE A;  1MXE A;  4QJ5 B;  5CSJ A;  1DMO A;  1M63 B;  5I8N A;  1OE9 B;  1FPW A;  1G8I A;  1Y1U A;  2BEC A;  2LLT A;  3JVT B;  2LMV A;  1ZAC A;  4I5K A;  1FI6 A;  1QV1 A;  3IQO A;  4MZJ A;  1R2U A;  2MHH A;  3ZNI A;  4CID A;  3AKB A;  3M0W A;  1B8R A;  1XFX O;  1YRU B;  1K9P A;  4MRX A;  1QXP A;  4GNK B;  3PSR A;  1J7P A;  1KK7 Z;  4M2P A;  1CFF A;  1AJ5 A;  1NSH A;  1J1E A;  1PVA A;  2JZI A;  3NXA A;  2I7A A;  1TTX A;  4I5L B;  4XJK B;  1S6C A;  2CBL A;  5ER5 A;  1KFU S;  1CDL A;  1YUR A;  2GV5 A;  1TIZ A;  1GGZ A;  3E3R A;  1S6I A;  2MBX A;  3EK7 A;  1UUR A;  1K90 D;  1AP4 A;  3PAT A;  1PK0 D;  5I2Q A;  2HQW A;  1KWO B;  1RFJ A;  2LC5 A;  4F0Z B;  1SCM C;  4GBA A;  2JTZ A;  2H2K A;  3C1V A;  3I5F B;  1K9K A;  2L4H A;  1YX8 A;  2A4J A;  3EK4 A;  2R2I A;  5DKN A;  3TS5 C;  2JXL A;  2K61 A;  1IGV A;  4IL1 A;  1C7V A;  3I5H B;  2F33 A;  1QV0 A;  2K0J A;  1SL8 A;  2KSP A;  4JQ0 D;  1F55 A;  2JU0 A;  3PAL A;  2NCO A;  2F2P A;  2TN4 A;  2LVJ A;  1NX2 A;  2KI4 B;  1DJI A;  2LP2 A;  2JC2 A;  1KFU L;  1DGU A;  4TNC A;  1DF0 B;  3VGO A;  1QX7 A;  3TDZ A;  2SAS A;  4ZCU A;  3CTN A;  3OHM B;  1V1G A;  4R1E A;  1B7T Y;  1L2O C;  4NQG A;  4YRU A;  3FWC A;  5AXI A;  1ALV A;  1EG3 A;  1N2D A;  2I2R E;  5PAL A;  4JWQ A;  2KDH A;  4YGA A;  3WHU B;  2I94 A;  1YVH A;  1XA5 A;  2ZKM X;  1CLM A;  3CR5 X;  2H61 C;  2CTN A;  1CLL A;  1RJV A;  2WCF A;  2MRD A;  3KEV A;  3BYA A;  4HRH A;  4MN0 A;  1M46 A;  1KQM C;  2PSR A;  2ZND A;  3FWB A;  3EVU A;  1B47 A;  3IF7 A;  2F3Z A;  4OV2 A;  1MHO A;  5D69 A;  1A75 B;  1REC A;  2AMI A;  4Q04 A;  4C0J A;  1MUX A;  2K7C A;  1KCY A;  2FCE A;  3CZT X;  1IQ3 A;  1G4Y R;  1RK9 A;  1Y0V H;  1AUI B;  2WOR A;  2E6W A;  2EC6 C;  1KK7 Y;  4MLW A;  2PAL A;  1F8H A;  4DUQ A;  5FYX A;  3AKA A;  3LK1 A;  2BCA A;  3HX4 A;  4PE4 A;  1YUU A;  2JOJ A;  2KGR A;  1SY9 A;  2KGB C;  2PVB A;  2I18 A;  1DJW A; 
#chains in the Genus database with same CATH topology
 1SL9 A;  2MLF C;  3O2P A;  1HQV A;  1ODB A;  2ZFD A;  4XYN A;  1NX3 A;  3CYZ A;  3NSL A;  1Y1X A;  1DEL A;  1R6P A;  2LP3 A;  3BUW B;  5HL1 A;  3ZWH A;  2MLE C;  1J7R A;  1HT9 A;  1M31 A;  2BE4 A;  3DVE A;  1Z2C B;  2JRF A;  1PAL A;  1SYM A;  3V2L A;  1TN4 A;  2HQ8 A;  2KPH A;  3AAK A;  1UHH A;  4MVF A;  3IVT A;  3VRO A;  1B4C A;  2PAS A;  5FI6 A;  1JWD A;  2FOT A;  1OOJ A;  2LUC A;  4CPV A;  1YVL A;  3D0Y B;  1AHR A;  1QJT A;  3SS5 A;  1BLQ A;  1LIN A;  2KFH A;  1FBV A;  1Y6W A;  2LAP A;  1SR6 C;  1XFV O;  4C0K A;  5HYD A;  3ICB A;  4OKH A;  2AUC A;  1N65 A;  2JQ6 A;  4M2Q A;  1LKJ A;  2JWW A;  2WC8 A;  1TNW A;  1NCX A;  5CSF A;  1A29 A;  1X02 A;  2JT0 A;  2ISD A;  2PMY A;  1CLB A;  2HET A;  1ORG A;  5FI7 A;  2Y5I A;  3CAB A;  1B8L A;  1JFJ A;  2BL0 B;  2L0P A;  4U8D A;  3BFA A;  2HPS A;  5JJG A;  4HRE E;  4HSZ A;  3CLN A;  4GPL B;  1OZO A;  2EHB A;  1QIV A;  1OSA A;  1SRA A;  3BUN B;  3DF0 A;  4BY5 A;  1RWY A;  2YGU A;  3OX5 A;  3VRN A;  4F7F A;  4MZL A;  1WLZ A;  1BJF A;  2FCD A;  4D1E A;  5KU1 A;  1K95 A;  4YGC B;  1RTP 1;  2M8U A;  1BF5 A;  2KAY A;  3PLF B;  1QVI Z;  2K8M B;  2LVI A;  1WDC C;  2KYF A;  4ORC B;  2L50 A;  1FW4 A;  2Y1N A;  4YGD B;  1ALW A;  1S6J A;  3QRX A;  3BOW A;  3I5G C;  2G9B A;  4WQ3 A;  3TZ1 A;  2FJU B;  2KI6 D;  1TNQ A;  4PHM A;  4ZCV A;  1OMD A;  3FS7 A;  1CTR A;  2DOQ A;  4DRW A;  3D10 A;  1AJ4 A;  1T14 A;  3I5I C;  3WXA A;  2OS8 B;  2QEV A;  1DT7 B;  1MR8 A;  3RLZ A;  1K8U A;  2MA2 A;  1TNP A;  1YUT A;  1SBJ A;  2BKH B;  1TUJ A;  2LUX A;  3F45 A;  1K96 A;  1CFD A;  1BG1 A;  3NSI A;  1J1D A;  1GQM A;  4YI9 A;  1P28 A;  2OTG B;  4QJ4 B;  2M0R A;  5I94 A;  1S1E A;  2SCP A;  2LNK A;  1IG5 A;  1KK8 B;  2ZRS A;  3DVJ A;  3JTD B;  1QX2 A;  4GGF C;  4GUK A;  2NLN A;  1G33 A;  3VB1 A;  1QWV A;  4MBE A;  3OP0 A;  1GJY A;  4USL A;  1B9A A;  4ETO A;  1FF1 A;  1D1O A;  3KPX A;  1YUS A;  1C3Z A;  2WCM A;  3BQ3 A;  2LCP A;  3TDU A;  1GM0 A;  2BCX A;  1WRK A;  4YBH B;  2ZRT A;  2F3Y A;  1NPQ A;  2L5X B;  5BPJ A;  4MRY A;  2Y1M A;  1K9U A;  3DZT A;  2KBM A;  2Y4Q A;  4YI8 A;  3NSO A;  2H61 A;  2OPO A;  3BUM B;  2QEO A;  2LMU A;  2PRU A;  3DVK A;  1QLK A;  1S3P A;  3CDN A;  1NCZ A;  2BAP A;  1XK4 C;  5KSZ A;  1EXR A;  2GTE A;  1UHN A;  1BMO A;  2LVV A;  1TRF A;  1XO5 A;  1CDP A;  1YR5 A;  2JXC A;  2KFF A;  3PN7 C;  4JPZ B;  5IBW A;  1J7Q A;  1UHK A;  1PRW A;  5JOL A;  1IJ6 A;  1DGV A;  3CZ1 A;  2KQ6 A;  1XFU O;  1S5G Z;  3D74 A;  5D7F A;  3GK2 A;  5TNC A;  4P5O E;  3KF9 A;  3UO9 A;  3NHI A;  2KLE A;  3UNW A;  4CLN A;  2L98 A;  4PHK A;  3S0A A;  1JF0 A;  1NX1 A;  3WHT B;  2BCB A;  2CXJ A;  4OR9 B;  1S26 D;  5DKR A;  3JVT C;  5F6T A;  1JC2 A;  1Z4H A;  2PYQ A;  1IIO A;  2KAX A;  2M9G A;  1PSR A;  1QVI Y;  4P2Y B;  4PE7 A;  2KOT A;  4FQO A;  2L5Y A;  3H4S E;  4CFR A;  2BE6 A;  1E8A A;  3R1V A;  4GFT A;  4A4B A;  2P6B B;  4DIR A;  5FI2 A;  4AOM A;  2JPO A;  5G08 A;  3D75 A;  2QAC A;  3SS4 A;  2LVK A;  1Y1A A;  1QAT A;  3BOW B;  1DJY A;  1WRZ A;  1JFK A;  2WND A;  1CMF A;  5CPV A;  1J55 A;  1C3Y A;  1SKT A;  1EG4 A;  2BBM A;  1SCM B;  1LA3 A;  3PJI A;  3R72 A;  2KI6 C;  5CSN A;  1XFY O;  4FTG A;  3LLE A;  4I5N B;  3TS5 B;  3CGA A;  3KO0 A;  1JBA A;  2E30 A;  1JF2 A;  1LXF C;  2JNX A;  2MAZ A;  1KSO A;  1YRT B;  1W7J B;  4GAO A;  1FI5 A;  1KWO C;  1SMG A;  1N0Y A;  2KBI A;  3A4U B;  1CB1 A;  1W9Z A;  2OS8 C;  2ZNE A;  2D8N A;  4FQT A;  3I5F C;  1QS7 A;  2KYC A;  2WCB A;  1DC1 A;  1DVI A;  4GGN A;  4PCW A;  1CKK A;  1IRJ A;  3L4A A;  2LV7 A;  3EK8 A;  5HLO A;  3DYE A;  3CS1 A;  5AFP A;  2L2E A;  3I5H C;  1LA0 A;  1TNX A;  1L2O B;  3NHT A;  3DY9 A;  1UWO A;  2JPT A;  2KI4 C;  5DIC A;  3OGN A;  1UHI A;  1BU3 A;  4L9M A;  2B1U A;  2NZ0 A;  2P71 A;  4PDZ A;  1BT6 A;  2JT8 A;  2PQL A;  3B87 A;  4PHJ A;  4WRI A;  5I2L A;  2K2A A;  1OZS A;  2LE9 B;  4N1F A;  1NP8 A;  2QEH A;  1C07 A;  3FE8 A;  5I2O A;  1KQM B;  2GGZ A;  3K21 A;  3RZS A;  1PVB A;  5KTY A;  1IKU A;  2F2O A;  3SG6 A;  3D73 A;  1S5G Y;  5EL2 A;  2M3W A;  1YX7 A;  3MSE B;  3O78 A;  2M29 A;  3BUX B;  3EVR A;  1B8C A;  3SG2 A;  2KFG A;  3BUO B;  4ICB A;  1F54 A;  2M7N A;  1KSM A;  2EC6 B;  1A75 A;  2Q4U A;  3B88 A;  3AAJ A;  3D76 A;  3FIA A;  5GQQ C;  1B1G A;  3A8R A;  2AAO A;  1IH0 A;  3PFV A;  1QX5 B;  2LAN A;  4ORA B;  1SK6 D;  1NWD A;  1CM4 A;  1NYA A;  2VRG A;  3PM2 A;  2BBN A;  2F8P A;  1DJZ A;  3K1E A;  1GGW A;  1OMV A;  3CR4 X;  3GOF A;  1IJ5 A;  3O4Y A;  2M1K B;  3CWG A;  2NXQ A;  2LHI A;  1OW4 A;  1U5I A;  3RM1 A;  4E68 A;  1NIW A;  2L51 A;  1UHJ A;  2KHN A;  2RGI A;  4GGF A;  1A4P A;  2ZN8 A;  2IS9 A;  1TWO A;  4PHN A;  1CFP A;  3SIA A;  2LLS A;  1F4O A;  1OMR A;  1BOC A;  4M2O A;  3EKH A;  4CFQ A;  4C0L A;  4MEW A;  3S0E A;  5B8I B;  1F70 A;  3TDI A;  2LM5 A;  4PAL A;  2COL B;  2LMT A;  1KFX S;  2QPT A;  4ORB B;  1Q80 A;  5HKW A;  2BKI B;  3SG7 A;  4A4C A;  1MQ1 A;  1V1F A;  3CR2 A;  5HKY A;  3PM8 A;  1SPY A;  2K2F A;  2K7O A;  1CM1 A;  1SR6 B;  2L4I A;  1XVJ A;  1SW8 A;  1XK4 A;  1XYD A;  3TUY B;  1ZUZ A;  1L7Z A;  1QTX A;  3OB1 B;  3D0Y A;  3NSK A;  4DCK A;  1UP5 A;  3EKJ A;  4N1G A;  4DS7 A;  2G2B A;  2HF5 A;  4N5X A;  4INX A;  1BOD A;  1MF8 B;  1TCO B;  5D3O A;  1JSA A;  3SIB A;  1TUZ A;  1RRO A;  1A2X A;  1TOP A;  2M1U A;  1ZOT B;  3L47 A;  4MSP A;  3D78 A;  3SJS A;  1CMG A;  2WOS A;  5ER4 X;  4AQI A;  5K89 A;  3SG4 A;  1K93 D;  2KAV A;  3QME A;  1JUO A;  1M45 A;  4NDC A;  5HKZ A;  1PSB A;  3FE9 A;  1W7I B;  1UUS A;  3EVV A;  4YGB B;  4HRG A;  1KFX L;  2Q91 A;  1NX0 A;  2H8V A;  2KQY A;  3DF0 B;  4WQ2 A;  5HLV A;  2M7L A;  2BL0 C;  1H8B A;  2JT3 A;  4PE0 A;  1CDM A;  1IQ5 A;  1M39 A;  2CCM A;  1YTZ C;  1WRL A;  5AER A;  3LL8 B;  1WDC B;  1SSE B;  3OB2 B;  4NDB A;  3VRR A;  4UPG A;  1LVC D;  5CSI A;  2QDI A;  3I5G B;  1XFZ O;  1SCV A;  1AK8 A;  4PT1 A;  4XJK A;  2MJW B;  2CNP A;  3CZ0 A;  1CFC A;  3VRQ A;  2V53 A;  1SNL A;  3WNX B;  2L2C A;  3I5I B;  1OOG A;  1OQP A;  1ZFS A;  3BJH A;  4OCI A;  4OVN F;  1QAS A;  3B86 A;  1C7W A;  2CT9 A;  1VRK A;  2LLU A;  2WC5 A;  4YGE B;  1CNP A;  1EL4 A;  2P70 A;  1OOF A;  1TCF A;  2LHL A;  5AEQ A;  1EH2 A;  1NUB A;  4INW A;  1U5I B;  1BR4 B;  2KLD A;  1DJG A;  2M97 A;  2M49 B;  3BFH A;  4BY4 A;  3CZ2 A;  3GK1 A;  3IQQ A;  5DKQ A;  1KQV A;  1EJ3 A;  2K7D A;  4PE1 A;  3DVM A;  3DXL A;  4MZK A;  3SG3 A;  1SL7 A;  3O6B A;  5AAN A;  1F71 A;  1QIW A;  2OTG C;  5J3X A;  1DJX A;  2O5G A;  2NCP A;  1K94 A;  2GGM A;  1AVS A;  1QLS A;  1WY9 A;  2JUL A;  3LK0 A;  1MXL C;  2JTT A;  1KK8 C;  1DF0 A;  1BR1 B;  3OBV A;  3JTD C;  1MWN A;  1OOH A;  3SG5 A;  1K2H A;  1XFW O;  3LCP C;  1WLM A;  3R1P A;  3DD4 A;  4NDD A;  2EGD A;  3OX6 A;  2K7B A;  2KNE A;  1DTL A;  1DJH A;  1NCY A;  3BXK A;  3HCM A;  1IWQ A;  1CDN A;  1H4B A;  1ZMZ A;  3S0G A;  4I5J A;  3PN7 B;  2ZN9 A;  3S0D A;  3GK4 X;  1F4Q A;  3N7H A;  1B7T Z;  1J7O A;  1S36 A;  1PUL A;  3TUY C;  4QJ3 B;  2JNF A;  4AQJ A;  3VRP A;  2WCE A;  2WCJ A;  2ERB A;  1A03 A;  2O60 A;  3KHE A;  1MXE A;  4QJ5 B;  5CSJ A;  1DMO A;  1M63 B;  5I8N A;  1OE9 B;  1OOI X;  3B6X A;  1FPW A;  1G8I A;  1Y1U A;  2BEC A;  2LLT A;  3JVT B;  4OZD A;  2LMV A;  1ZAC A;  4I5K A;  1FI6 A;  1QV1 A;  3IQO A;  4MZJ A;  1R2U A;  2MHH A;  3ZNI A;  2QEB A;  4CID A;  3AKB A;  3M0W A;  1B8R A;  1XFX O;  2WCK A;  1YRU B;  1K9P A;  4MRX A;  1QXP A;  4GNK B;  3PSR A;  1J7P A;  1KK7 Z;  4M2P A;  3SS3 A;  1CFF A;  1AJ5 A;  1NSH A;  1J1E A;  1PVA A;  2JZI A;  3NXA A;  2I7A A;  1TTX A;  4I5L B;  4XJK B;  1S6C A;  2CBL A;  5ER5 A;  1KFU S;  3FE6 A;  1CDL A;  1YUR A;  2GV5 A;  1TIZ A;  1GGZ A;  3E3R A;  1S6I A;  2MBX A;  3EK7 A;  1UUR A;  1K90 D;  3NGV A;  1AP4 A;  3PAT A;  1PK0 D;  5I2Q A;  2HQW A;  1KWO B;  1RFJ A;  2LC5 A;  4F0Z B;  3D77 A;  1SCM C;  4GBA A;  2JTZ A;  2H2K A;  3C1V A;  3I5F B;  1K9K A;  2L4H A;  4JD9 A;  1YX8 A;  2A4J A;  3EK4 A;  2R2I A;  5DKN A;  1XFR A;  3TS5 C;  2JXL A;  2K61 A;  1IGV A;  4IL1 A;  1C7V A;  3I5H B;  2F33 A;  1QV0 A;  1LS8 A;  1SL8 A;  2K0J A;  2KSP A;  2WCH A;  2JU0 A;  4JQ0 D;  3PAL A;  2NCO A;  1F55 A;  3Q8I A;  2F2P A;  2TN4 A;  2LVJ A;  3S0F A;  3S0B A;  1NX2 A;  2KI4 B;  1DJI A;  2LP2 A;  2JC2 A;  1KFU L;  1DGU A;  4KYN A;  1DF0 B;  2BNX A;  2WCL A;  4TNC A;  3VGO A;  1QX7 A;  3TDZ A;  2SAS A;  4ZCU A;  3CTN A;  3OHM B;  1V1G A;  4R1E A;  1B7T Y;  1L2O C;  3B7A A;  4NQG A;  4YRU A;  3FWC A;  5AXI A;  1ALV A;  1EG3 A;  1N2D A;  2I2R E;  2WC6 A;  5PAL A;  4JWQ A;  2KDH A;  4YGA A;  3WHU B;  2I94 A;  3R1O A;  4JKT A;  1YVH A;  1XA5 A;  2ZKM X;  1CLM A;  3CR5 X;  2H61 C;  2CTN A;  1CLL A;  1RJV A;  2WCF A;  2MRD A;  3KEV A;  3BYA A;  4HRH A;  4MN0 A;  3EG5 B;  1M46 A;  1KQM C;  2PSR A;  2ZND A;  3FWB A;  3EVU A;  3BFB A;  4IJ7 A;  3L4L A;  1B47 A;  3IF7 A;  2F3Z A;  4OV2 A;  1MHO A;  5D69 A;  1A75 B;  1REC A;  2AMI A;  4Q04 A;  4C0J A;  1DEK A;  1MUX A;  2K7C A;  1KCY A;  2FCE A;  3CZT X;  1IQ3 A;  1G4Y R;  1DQE A;  1RK9 A;  1Y0V H;  1AUI B;  2WOR A;  2E6W A;  2EC6 C;  1KK7 Y;  4MLW A;  2PAL A;  1F8H A;  3O4X A;  4DUQ A;  2FJY A;  5FYX A;  3AKA A;  3LK1 A;  2BCA A;  3HX4 A;  4PE4 A;  1YUU A;  2JOJ A;  2KGR A;  1SY9 A;  2KGB C;  2PVB A;  2I18 A;  1DJW A;  2K60 A; 
#chains in the Genus database with same CATH homology
 1SL9 A;  2MLF C;  3O2P A;  1HQV A;  1ODB A;  2ZFD A;  4XYN A;  1NX3 A;  3NSL A;  1Y1X A;  2LP3 A;  1R6P A;  3BUW B;  3ZWH A;  2MLE C;  1J7R A;  1HT9 A;  1M31 A;  2BE4 A;  3DVE A;  2JRF A;  1PAL A;  1SYM A;  1TN4 A;  2HQ8 A;  3AAK A;  4MVF A;  1UHH A;  3VRO A;  1B4C A;  1JWD A;  2PAS A;  2FOT A;  1OOJ A;  2LUC A;  4CPV A;  1YVL A;  3D0Y B;  1AHR A;  1QJT A;  1BLQ A;  1LIN A;  2KFH A;  1FBV A;  1Y6W A;  2LAP A;  1SR6 C;  1XFV O;  4C0K A;  5HYD A;  3ICB A;  4OKH A;  2AUC A;  1N65 A;  2JQ6 A;  4M2Q A;  1LKJ A;  2JWW A;  2WC8 A;  1TNW A;  1NCX A;  5CSF A;  1A29 A;  1X02 A;  2JT0 A;  2ISD A;  2PMY A;  1CLB A;  2HET A;  2Y5I A;  1JFJ A;  1B8L A;  2BL0 B;  2L0P A;  4U8D A;  2HPS A;  5JJG A;  4HRE E;  4HSZ A;  3CLN A;  4GPL B;  1OZO A;  2EHB A;  1QIV A;  1OSA A;  1SRA A;  3BUN B;  3DF0 A;  4BY5 A;  1RWY A;  3OX5 A;  3VRN A;  4MZL A;  1WLZ A;  1BJF A;  2FCD A;  4D1E A;  5KU1 A;  1K95 A;  4YGC B;  1RTP 1;  2M8U A;  1BF5 A;  2KAY A;  3PLF B;  1QVI Z;  2K8M B;  2LVI A;  1WDC C;  2KYF A;  4ORC B;  2L50 A;  1FW4 A;  2Y1N A;  4YGD B;  1ALW A;  1S6J A;  3QRX A;  3BOW A;  3I5G C;  2G9B A;  4WQ3 A;  3TZ1 A;  2FJU B;  2KI6 D;  1TNQ A;  4PHM A;  4ZCV A;  1OMD A;  3FS7 A;  1CTR A;  2DOQ A;  4DRW A;  3D10 A;  1AJ4 A;  3I5I C;  3WXA A;  2OS8 B;  1DT7 B;  1MR8 A;  3RLZ A;  1K8U A;  2MA2 A;  1TNP A;  1YUT A;  1SBJ A;  2BKH B;  2LUX A;  3F45 A;  1K96 A;  1CFD A;  1BG1 A;  3NSI A;  1J1D A;  1GQM A;  4YI9 A;  2OTG B;  4QJ4 B;  2M0R A;  1S1E A;  2SCP A;  2LNK A;  1IG5 A;  1KK8 B;  2ZRS A;  3DVJ A;  3JTD B;  1QX2 A;  4GGF C;  4GUK A;  2NLN A;  1G33 A;  4MBE A;  3OP0 A;  1GJY A;  4USL A;  1B9A A;  4ETO A;  1FF1 A;  1D1O A;  3KPX A;  1YUS A;  3TDU A;  3BQ3 A;  2LCP A;  2BCX A;  1WRK A;  4YBH B;  2ZRT A;  2F3Y A;  1NPQ A;  2L5X B;  5BPJ A;  4MRY A;  2Y1M A;  1K9U A;  2KBM A;  2Y4Q A;  4YI8 A;  3NSO A;  2H61 A;  2OPO A;  3BUM B;  2LMU A;  2PRU A;  3DVK A;  1QLK A;  1S3P A;  1NCZ A;  1XK4 C;  5KSZ A;  1EXR A;  1UHN A;  1BMO A;  2LVV A;  1TRF A;  1XO5 A;  1CDP A;  1YR5 A;  2JXC A;  2KFF A;  3PN7 C;  4JPZ B;  5IBW A;  1J7Q A;  1UHK A;  1PRW A;  5JOL A;  1IJ6 A;  1DGV A;  2KQ6 A;  1XFU O;  1S5G Z;  5D7F A;  3GK2 A;  5TNC A;  4P5O E;  3KF9 A;  4CLN A;  2L98 A;  4PHK A;  1JF0 A;  1NX1 A;  3WHT B;  2BCB A;  2CXJ A;  4OR9 B;  1S26 D;  5DKR A;  3JVT C;  5F6T A;  1JC2 A;  2KAX A;  2M9G A;  1PSR A;  1QVI Y;  4P2Y B;  4PE7 A;  2KOT A;  4FQO A;  3H4S E;  4CFR A;  2BE6 A;  1E8A A;  4A4B A;  4GFT A;  2P6B B;  4DIR A;  4AOM A;  5G08 A;  2QAC A;  2LVK A;  1Y1A A;  1QAT A;  3BOW B;  1DJY A;  1WRZ A;  1JFK A;  2WND A;  1CMF A;  5CPV A;  1J55 A;  1SKT A;  1EG4 A;  2BBM A;  1SCM B;  1LA3 A;  2KI6 C;  5CSN A;  1XFY O;  4FTG A;  3LLE A;  4I5N B;  3TS5 B;  3CGA A;  3KO0 A;  1JBA A;  2E30 A;  1JF2 A;  1LXF C;  2JNX A;  2MAZ A;  1KSO A;  1YRT B;  1W7J B;  4GAO A;  1FI5 A;  1KWO C;  1SMG A;  1N0Y A;  2KBI A;  3A4U B;  1CB1 A;  2OS8 C;  2ZNE A;  2D8N A;  3I5F C;  1QS7 A;  2KYC A;  2WCB A;  1CKK A;  1DVI A;  4GGN A;  4PCW A;  1IRJ A;  2LV7 A;  3EK8 A;  5HLO A;  3CS1 A;  5AFP A;  2L2E A;  3I5H C;  1LA0 A;  1TNX A;  1L2O B;  1UWO A;  2JPT A;  2KI4 C;  1UHI A;  1BU3 A;  4L9M A;  2B1U A;  2NZ0 A;  4PDZ A;  1BT6 A;  2JT8 A;  4PHJ A;  4WRI A;  5I2L A;  2K2A A;  1OZS A;  2LE9 B;  4N1F A;  1NP8 A;  1C07 A;  5I2O A;  1KQM B;  2GGZ A;  3K21 A;  1PVB A;  5KTY A;  1IKU A;  2F2O A;  3SG6 A;  1S5G Y;  2M3W A;  1YX7 A;  3MSE B;  3O78 A;  2M29 A;  3BUX B;  3EVR A;  1B8C A;  3SG2 A;  2KFG A;  3BUO B;  4ICB A;  1F54 A;  2M7N A;  1KSM A;  2EC6 B;  1A75 A;  2Q4U A;  3AAJ A;  3FIA A;  5GQQ C;  1B1G A;  3A8R A;  2AAO A;  1IH0 A;  3PFV A;  1QX5 B;  2LAN A;  4ORA B;  1SK6 D;  1NWD A;  1CM4 A;  1NYA A;  2VRG A;  2BBN A;  2F8P A;  1DJZ A;  1GGW A;  1OMV A;  3CR4 X;  3GOF A;  1IJ5 A;  3O4Y A;  2M1K B;  3CWG A;  2NXQ A;  2LHI A;  1U5I A;  3RM1 A;  4E68 A;  1NIW A;  2L51 A;  1UHJ A;  2KHN A;  2RGI A;  4GGF A;  1A4P A;  2ZN8 A;  2IS9 A;  4PHN A;  1CFP A;  3SIA A;  2LLS A;  1F4O A;  1OMR A;  1BOC A;  4M2O A;  3EKH A;  4CFQ A;  4C0L A;  4MEW A;  5B8I B;  1F70 A;  3TDI A;  2LM5 A;  4PAL A;  2COL B;  2LMT A;  1KFX S;  2QPT A;  4ORB B;  1Q80 A;  5HKW A;  2BKI B;  3SG7 A;  4A4C A;  1MQ1 A;  1V1F A;  3CR2 A;  5HKY A;  3PM8 A;  1SPY A;  2K2F A;  2K7O A;  1CM1 A;  1SR6 B;  2L4I A;  1XVJ A;  1SW8 A;  1XK4 A;  1XYD A;  3TUY B;  1ZUZ A;  1L7Z A;  1QTX A;  3OB1 B;  3D0Y A;  3NSK A;  4DCK A;  1UP5 A;  3EKJ A;  4N1G A;  4DS7 A;  2G2B A;  2HF5 A;  4N5X A;  1BOD A;  1MF8 B;  1TCO B;  1JSA A;  3SIB A;  1RRO A;  1A2X A;  1TOP A;  2M1U A;  1ZOT B;  4MSP A;  3SJS A;  1CMG A;  2WOS A;  5ER4 X;  4AQI A;  5K89 A;  3SG4 A;  1K93 D;  2KAV A;  1JUO A;  1M45 A;  4NDC A;  5HKZ A;  1PSB A;  1W7I B;  1UUS A;  3EVV A;  4YGB B;  4HRG A;  1KFX L;  2Q91 A;  1NX0 A;  4WQ2 A;  2KQY A;  3DF0 B;  5HLV A;  2M7L A;  2BL0 C;  1H8B A;  2JT3 A;  4PE0 A;  1CDM A;  1IQ5 A;  1M39 A;  2CCM A;  1YTZ C;  1WRL A;  5AER A;  3LL8 B;  1WDC B;  4NDB A;  3OB2 B;  3VRR A;  4UPG A;  1LVC D;  5CSI A;  3I5G B;  1XFZ O;  1SCV A;  1AK8 A;  4XJK A;  2MJW B;  2CNP A;  1CFC A;  3VRQ A;  2V53 A;  1SNL A;  3WNX B;  3I5I B;  1OQP A;  1ZFS A;  4OCI A;  4OVN F;  1QAS A;  1C7W A;  2CT9 A;  1VRK A;  2LLU A;  4YGE B;  1CNP A;  1EL4 A;  1TCF A;  2LHL A;  5AEQ A;  1EH2 A;  1NUB A;  1U5I B;  1BR4 B;  1DJG A;  2M97 A;  2M49 B;  4BY4 A;  3GK1 A;  3IQQ A;  5DKQ A;  1KQV A;  1EJ3 A;  2K7D A;  4PE1 A;  3DVM A;  4MZK A;  3SG3 A;  1SL7 A;  3O6B A;  5AAN A;  1F71 A;  1QIW A;  2OTG C;  5J3X A;  1DJX A;  2O5G A;  2NCP A;  1K94 A;  2GGM A;  1AVS A;  1QLS A;  1WY9 A;  2JUL A;  3LK0 A;  1MXL C;  2JTT A;  1KK8 C;  1DF0 A;  1BR1 B;  1K2H A;  3JTD C;  1MWN A;  3SG5 A;  1XFW O;  3LCP C;  1WLM A;  4NDD A;  3DD4 A;  2EGD A;  3OX6 A;  2K7B A;  2KNE A;  1DTL A;  1DJH A;  1NCY A;  3BXK A;  3HCM A;  1IWQ A;  1CDN A;  1H4B A;  1ZMZ A;  4I5J A;  3PN7 B;  2ZN9 A;  3GK4 X;  1F4Q A;  1B7T Z;  1J7O A;  1S36 A;  1PUL A;  3TUY C;  4QJ3 B;  2JNF A;  4AQJ A;  3VRP A;  2WCE A;  1A03 A;  2O60 A;  3KHE A;  1MXE A;  4QJ5 B;  5CSJ A;  1DMO A;  1M63 B;  5I8N A;  1OE9 B;  1FPW A;  1G8I A;  1Y1U A;  2BEC A;  2LLT A;  3JVT B;  2LMV A;  1ZAC A;  4I5K A;  1FI6 A;  1QV1 A;  3IQO A;  4MZJ A;  1R2U A;  2MHH A;  3ZNI A;  4CID A;  3AKB A;  3M0W A;  1B8R A;  1XFX O;  1YRU B;  1K9P A;  4MRX A;  1QXP A;  4GNK B;  3PSR A;  1J7P A;  1KK7 Z;  4M2P A;  1CFF A;  1AJ5 A;  1NSH A;  1J1E A;  1PVA A;  2JZI A;  3NXA A;  2I7A A;  1TTX A;  4I5L B;  4XJK B;  1S6C A;  2CBL A;  5ER5 A;  1KFU S;  1CDL A;  1YUR A;  2GV5 A;  1TIZ A;  1GGZ A;  3E3R A;  1S6I A;  2MBX A;  3EK7 A;  1UUR A;  1K90 D;  1AP4 A;  3PAT A;  1PK0 D;  5I2Q A;  2HQW A;  1KWO B;  1RFJ A;  2LC5 A;  4F0Z B;  1SCM C;  4GBA A;  2JTZ A;  2H2K A;  3C1V A;  3I5F B;  1K9K A;  2L4H A;  1YX8 A;  2A4J A;  3EK4 A;  2R2I A;  5DKN A;  3TS5 C;  2JXL A;  2K61 A;  1IGV A;  4IL1 A;  1C7V A;  3I5H B;  2F33 A;  1QV0 A;  2K0J A;  1SL8 A;  2KSP A;  4JQ0 D;  1F55 A;  2JU0 A;  3PAL A;  2NCO A;  2F2P A;  2TN4 A;  2LVJ A;  1NX2 A;  2KI4 B;  1DJI A;  2LP2 A;  2JC2 A;  1KFU L;  1DGU A;  4TNC A;  1DF0 B;  3VGO A;  1QX7 A;  3TDZ A;  2SAS A;  4ZCU A;  3CTN A;  3OHM B;  1V1G A;  4R1E A;  1B7T Y;  1L2O C;  4NQG A;  4YRU A;  3FWC A;  5AXI A;  1ALV A;  1EG3 A;  1N2D A;  2I2R E;  5PAL A;  4JWQ A;  2KDH A;  4YGA A;  3WHU B;  2I94 A;  1YVH A;  1XA5 A;  2ZKM X;  1CLM A;  3CR5 X;  2H61 C;  2CTN A;  1CLL A;  1RJV A;  2WCF A;  2MRD A;  3KEV A;  3BYA A;  4HRH A;  4MN0 A;  1M46 A;  1KQM C;  2PSR A;  2ZND A;  3FWB A;  3EVU A;  1B47 A;  3IF7 A;  2F3Z A;  4OV2 A;  1MHO A;  5D69 A;  1A75 B;  1REC A;  2AMI A;  4Q04 A;  4C0J A;  1MUX A;  2K7C A;  1KCY A;  2FCE A;  3CZT X;  1IQ3 A;  1G4Y R;  1RK9 A;  1Y0V H;  1AUI B;  2WOR A;  2E6W A;  2EC6 C;  1KK7 Y;  4MLW A;  2PAL A;  1F8H A;  4DUQ A;  5FYX A;  3AKA A;  3LK1 A;  2BCA A;  3HX4 A;  4PE4 A;  1YUU A;  2JOJ A;  2KGR A;  1SY9 A;  2KGB C;  2PVB A;  2I18 A;  1DJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...