2IS9A

Structure of yeast dcn-1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
AHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural basis for the function of DCN-1 in protein Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 70
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2is9A01
1YUUA 2JOJA 5K89A 1YX7A 1CFDA 1WY9A 1ZUZA 2KNEA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 2PRUA 4YGBB 4AQJA 5DKNA 2KFFA 1KFUL 5IBWA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 3PATA 4CIDA 1NCZA 4YGAA 2H2KA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4M2QA 1F4QA 1OOJA 5CPVA 5D7FA 1B7TZ 1EXRA 1S36A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 4I5NB 1YUSA 1CDLA 1LA0A 1CM4A 2NXQA 3JVTB 2OS8C 3NSLA 1KK8C 1HQVA 4PE7A 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 4MRXA 2M49B 1R2UA 1XFWO 4PE1A 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 4NQGA 1UUSA 1K93D 4HRGA 1YURA 5JOLA 1LA3A 3CWGA 4MZLA 2M7LA 4ZCVA 1RJVA 1CLLA 2GV5A 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 1IKUA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3HCMA 1KK8B 1TN4A 1CFFA 5TNCA 1YRTB 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 1SCMC 2LP2A 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5HKWA 2O5GA 1AP4A 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3PN7C 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 1CKKA 2LLTA 1MWNA 2VRGA 1C7VA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 4F0ZB 1NX3A 1KSMA 1K8UA 2KAYA 2JNXA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1FF1A 4PHJA 4HRHA 1J1EA 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3BQ3A 4YGCB 3NSIA 2V53A 1OZOA 1CDNA 5JJGA 3PN7B 1CDPA 1NWDA 1WDCC 1ZMZA 3RLZA 2KI4C 2M1KB 1J7QA 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1OMVA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 4GBAA 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 1SRAA 2CBLA 4GNKB 5B8IB 2JTTA 5HLOA 2LV7A 4WRIA 3ZWHA 1OZSA 2WOSA 3DF0A 4GGFA 1OE9B 4MZKA 2L51A 1MUXA 2WCEA 2JU0A 4M2OA 3CGAA 1NX0A 1UHNA 4GGFC 2K7DA 1WDCB 2JT8A 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 4ICBA 2LMVA 1TOPA 2FCDA 1EL4A 5KU1A 1BR1B 1F71A 3CR4X 4ETOA 3I5HB 2LVVA 3VRRA 4XYNA 5G08A 1IG5A 1J1DA 1A4PA 2JT0A 1MXEA 3O2PA 1DJYA 4HSZA 2BBMA 5CSFA 1WRZA 2LLUA 2HPSA 2K7CA 1XFXO 1LXFC 5D69A 3SIBA 4A4BA 4QJ4B 4N1FA 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 4YBHB 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2KHNA 4C0JA 5HLVA 2L5XB 3NXAA 2Y5IA 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 1BODA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1JBAA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 2CXJA 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 3TDIA 2HETA 1R6PA 1W7IB 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 1DTLA 3EK7A 1AK8A 5KSZA 1DGVA 1VRKA 2AMIA 3FWBA 1S6CA 1YVHA 2BCAA 3EK8A 4OKHA 1B7TY 2BE4A 1KFUS 2K7OA 4HREE 1QASA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2ZFDA 1IWQA 1CTRA 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 4PALA 3WHUB 1IQ3A 3OB1B 3C1VA 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 1WRKA 1ZOTB 4JPZB 1JWDA 4CFQA 4YRUA 1KSOA 1UP5A 1AUIB 2CCMA 2ZN8A 1SW8A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 2LCPA 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 1DT7B 1FBVA 2LC5A 1BMOA 2B1UA 3O6BA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 1B47A 3I5FC 2K0JA 3E3RA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2KGBC 2OTGC 1E8AA 2EC6C 2WCFA 4DS7A 1KQMC 2ZKMX 3EKHA 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 4MLWA 4USLA 5I2QA 4OR9B 4DCKA 3GK4X 2Y1MA 1M39A 1QIWA 1WRLA 1SYMA 2H61C 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2KYFA 3K21A 1TNXA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1UHIA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 1M31A 1KQMB 2F3ZA 1C07A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 1L2OB 1SPYA 2I2RE 1SR6B 1RTP1 1B1GA 3BUMB 3PM8A 1B4CA 1QATA 3TUYC 1C7WA 1KWOC 2KI6C 1WLZA 1JSAA 2BL0C 2JT3A 1S5GY 1F4OA 1K9KA 1XVJA 2JQ6A 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 2CTNA 2PALA 1K96A 4FTGA 5AERA 1OMDA 1ODBA 1DJZA 1MF8B 1QJTA 5AANA 1W7JB 3A4UB 5AFPA 1NIWA 1UWOA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 1DJGA 3BUOB 3TS5C 1UHJA 1QXPA 2LMTA 3VROA 2K61A 1K2HA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 1KWOB 5I8NA 2BL0B 1CLBA 2WORA 4PHKA 2LUXA 3AAKA 1QX5B 5HKYA 1IRJA 2GGMA 3KEVA 1PSBA 1ALWA 4P2YB 1M63B 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 3WNXB 4PDZA 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 2JXLA 1S3PA 1XK4C 1UURA 2HF5A 4YGEB 1NCXA 3NSKA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 1TNQA 4GAOA 5BPJA 1DJXA 1EJ3A 2RGIA 3JTDB 1SKTA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 2L98A 1UHHA 3I5GC 2CNPA 1G8IA 1IGVA 4CFRA 3PLFB 1BOCA 3CR2A 4XJKB 1SL9A 4MN0A 3ICBA 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 3IF7A 2KOTA 1K9UA 2LP3A 1S5GZ 1FI6A 1JF0A 3HX4A 3VRQA 4JQ0D 1GGWA 1XFVO 3BUWB 3H4SE 4GFTA 1JFKA 2K8MB 2K2AA 2JPTA 1LKJA 2IS9A 2G2BA 2L4HA 1CFCA 1NUBA 5I2OA 1K95A 1SNLA 1S26D
chains in the Genus database with same CATH superfamily
1YUUA 2JOJA 5K89A 1YX7A 1CFDA 1WY9A 1ZUZA 2KNEA 3BFHA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 1OOIX 2PRUA 3QMEA 4YGBB 4AQJA 5DKNA 2KFFA 1KFUL 5IBWA 2YGUA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 1C3YA 3PATA 4CIDA 1NCZA 4YGAA 2H2KA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4F7FA 4M2QA 1F4QA 1OOJA 5CPVA 1Z2CB 2WCMA 5D7FA 1B7TZ 1EXRA 1S36A 3D78A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 3CZ2A 4I5NB 1YUSA 1CDLA 2QEOA 1LA0A 1CM4A 2NXQA 3JVTB 2OS8C 3NSLA 1KK8C 1HQVA 4PE7A 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 2KPHA 3Q8IA 4MRXA 2M49B 1R2UA 1XFWO 4KYNA 4PE1A 3RZSA 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 2WC6A 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 3BJHA 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 1DELA 4NQGA 1UUSA 1K93D 3B6XA 4HRGA 1YURA 5JOLA 1LA3A 2PQLA 3CWGA 4MZLA 2M7LA 4ZCVA 1RJVA 1CLLA 2GV5A 2PYQA 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 3D73A 1IKUA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3HCMA 1KK8B 1TN4A 1CFFA 5TNCA 1YRTB 3BFBA 1OOGA 3BFAA 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 1SCMC 2LP2A 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5D3OA 5HKWA 2O5GA 1AP4A 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3B86A 3PN7C 3D76A 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 3S0FA 1CKKA 2LLTA 1MWNA 2ERBA 3S0DA 2VRGA 1C7VA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 5FI7A 4F0ZB 1NX3A 1KSMA 1K8UA 2KAYA 2JNXA 2L5YA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1DC1A 1FF1A 4PHJA 4HRHA 1J1EA 5FI2A 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3CDNA 3BQ3A 4YGCB 3NSIA 2BNXA 1OZOA 2V53A 2QEVA 3PN7B 3VB1A 5JJGA 1CDPA 1CDNA 1NWDA 1WDCC 1ZMZA 3FE6A 2KI4C 2M1KB 3RLZA 2BAPA 3CABA 1J7QA 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1OMVA 3IVTA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 1W9ZA 3B7AA 4GBAA 1C3ZA 4INWA 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 1SRAA 2CBLA 2WCHA 4GNKB 5B8IB 2GTEA 3O4XA 2JTTA 5HLOA 2QEHA 2LV7A 4WRIA 3ZWHA 1OZSA 2KLEA 2WOSA 3DF0A 4GGFA 1OE9B 4MZKA 3R1PA 2L51A 1MUXA 2WCEA 1P28A 1TUJA 2JU0A 3CGAA 4M2OA 1NX0A 1T14A 1UHNA 2WCJA 4GGFC 2K7DA 1WDCB 2JT8A 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 4ICBA 2LMVA 1TOPA 2FCDA 1EL4A 5KU1A 1BR1B 4JD9A 3CR4X 1F71A 4ETOA 3I5HB 2LVVA 3SS3A 4XYNA 5G08A 3VRRA 1ORGA 1IG5A 1J1DA 3V2LA 1GM0A 1A4PA 2JT0A 1MXEA 3O2PA 1DJYA 4HSZA 3B88A 2BBMA 5CSFA 1WRZA 2LLUA 2HPSA 2K7CA 1XFXO 1LXFC 3B87A 5D69A 3SIBA 4A4BA 4QJ4B 4N1FA 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 3CYZA 4YBHB 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2L2CA 2KHNA 3R1OA 4C0JA 4IJ7A 5HLVA 2L5XB 3CZ1A 3NXAA 2Y5IA 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 2WCLA 4JKTA 1BODA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1JBAA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2KLDA 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 2CXJA 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 3TDIA 2HETA 1R6PA 1W7IB 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 3SS5A 1DTLA 3EK7A 1OW4A 1AK8A 5KSZA 3L4LA 1DGVA 1VRKA 2AMIA 3FWBA 1S6CA 1YVHA 5EL2A 2BCAA 3EK8A 4OKHA 1B7TY 2BE4A 1KFUS 2K7OA 4HREE 1QASA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2ZFDA 3FE9A 1IWQA 1CTRA 3D74A 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 3PM2A 4PALA 3WHUB 1IQ3A 3OB1B 3C1VA 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 3NHTA 1WRKA 1ZOTB 4JPZB 1JWDA 4CFQA 4YRUA 1KSOA 1UP5A 3UO9A 1AUIB 2CCMA 2ZN8A 1OOHA 1SW8A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 3OGNA 2LCPA 3FE8A 3DXLA 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 3S0EA 1DT7B 1FBVA 3D77A 5DICA 2LC5A 1BMOA 2B1UA 3O6BA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 3K1EA 1B47A 3I5FC 2K0JA 3E3RA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2KGBC 2OTGC 1E8AA 2EC6C 2WCFA 4DS7A 1KQMC 2ZKMX 3EKHA 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 3L4AA 4MLWA 4USLA 5I2QA 4OR9B 4DCKA 3GK4X 2Y1MA 1M39A 1QIWA 1WRLA 1SYMA 2H61C 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2KYFA 3K21A 1TNXA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1LS8A 1UHIA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 1M31A 1KQMB 2F3ZA 1C07A 3CZ0A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 2WC5A 1L2OB 1SPYA 2I2RE 1SR6B 3N7HA 1RTP1 4OZDA 1B1GA 3DZTA 3BUMB 2FJYA 3PM8A 1B4CA 1QATA 1OOFA 3TUYC 1C7WA 1KWOC 2KI6C 1WLZA 3D75A 2BL0C 1JSAA 1XFRA 2JT3A 1S5GY 1F4OA 1K9KA 3R1VA 5HL1A 1XVJA 2JPOA 2JQ6A 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 5I94A 2CTNA 2P71A 1DQEA 1TUZA 2PALA 1K96A 2P70A 4FTGA 5AERA 1OMDA 1ODBA 1DJZA 1MF8B 1QJTA 4FQTA 5AANA 1W7JB 3R72A 3A4UB 2QDIA 3S0BA 5AFPA 1NIWA 1UWOA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 1DJGA 3BUOB 3TS5C 1UHJA 1QXPA 2LMTA 3VROA 2K61A 3DY9A 1K2HA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 3UNWA 1KWOB 5I8NA 2BL0B 1CLBA 2WORA 3NHIA 4PHKA 2LUXA 3AAKA 1QX5B 5HKYA 3S0AA 1IRJA 2GGMA 3KEVA 1PSBA 1ALWA 4P2YB 1M63B 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 3EG5B 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 2H8VA 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 4INXA 3WNXB 1IIOA 4PDZA 1SSEB 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 4PT1A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 2JXLA 1S3PA 1XK4C 1UURA 2HF5A 2QEBA 4YGEB 1NCXA 3NSKA 3S0GA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 1TNQA 3L47A 4GAOA 5BPJA 1DJXA 1EJ3A 2RGIA 3DYEA 3JTDB 1SKTA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 5FI6A 2L98A 1UHHA 3I5GC 2CNPA 1G8IA 1Z4HA 1IGVA 4CFRA 3PLFB 1BOCA 3CR2A 4XJKB 2K60A 1SL9A 4MN0A 3ICBA 3SS4A 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 2WCKA 2KOTA 3IF7A 1K9UA 2LP3A 1S5GZ 3PJIA 1FI6A 1JF0A 3HX4A 3OBVA 3NGVA 4JQ0D 1XFVO 3VRQA 3BUWB 3H4SE 4GFTA 1GGWA 1JFKA 2K8MB 2K2AA 2JPTA 1LKJA 2IS9A 2G2BA 2L4HA 1CFCA 1TWOA 1NUBA 1QWVA 1K95A 1DEKA 5I2OA 1SNLA 1S26D
chains in the Genus database with same CATH topology
1YUUA 2JOJA 5K89A 1YX7A 1CFDA 1WY9A 1ZUZA 2KNEA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 2PRUA 4YGBB 4AQJA 5DKNA 2KFFA 1KFUL 5IBWA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 3PATA 4CIDA 1NCZA 4YGAA 2H2KA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4M2QA 1F4QA 1OOJA 5CPVA 5D7FA 1B7TZ 1EXRA 1S36A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 4I5NB 1YUSA 1CDLA 1LA0A 1CM4A 2NXQA 3JVTB 2OS8C 3NSLA 1KK8C 1HQVA 4PE7A 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 4MRXA 2M49B 1R2UA 1XFWO 4PE1A 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 4NQGA 1UUSA 1K93D 4HRGA 1YURA 5JOLA 1LA3A 3CWGA 4MZLA 2M7LA 4ZCVA 1RJVA 1CLLA 2GV5A 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 1IKUA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3HCMA 1KK8B 1TN4A 1CFFA 5TNCA 1YRTB 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 1SCMC 2LP2A 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5HKWA 2O5GA 1AP4A 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3PN7C 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 1CKKA 2LLTA 1MWNA 2VRGA 1C7VA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 4F0ZB 1NX3A 1KSMA 1K8UA 2KAYA 2JNXA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1FF1A 4PHJA 4HRHA 1J1EA 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3BQ3A 4YGCB 3NSIA 2V53A 1OZOA 1CDNA 5JJGA 3PN7B 1CDPA 1NWDA 1WDCC 1ZMZA 3RLZA 2KI4C 2M1KB 1J7QA 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1OMVA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 4GBAA 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 1SRAA 2CBLA 4GNKB 5B8IB 2JTTA 5HLOA 2LV7A 4WRIA 3ZWHA 1OZSA 2WOSA 3DF0A 4GGFA 1OE9B 4MZKA 2L51A 1MUXA 2WCEA 2JU0A 4M2OA 3CGAA 1NX0A 1UHNA 4GGFC 2K7DA 1WDCB 2JT8A 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 4ICBA 2LMVA 1TOPA 2FCDA 1EL4A 5KU1A 1BR1B 1F71A 3CR4X 4ETOA 3I5HB 2LVVA 3VRRA 4XYNA 5G08A 1IG5A 1J1DA 1A4PA 2JT0A 1MXEA 3O2PA 1DJYA 4HSZA 2BBMA 5CSFA 1WRZA 2LLUA 2HPSA 2K7CA 1XFXO 1LXFC 5D69A 3SIBA 4A4BA 4QJ4B 4N1FA 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 4YBHB 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2KHNA 4C0JA 5HLVA 2L5XB 3NXAA 2Y5IA 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 1BODA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1JBAA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 2CXJA 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 3TDIA 2HETA 1R6PA 1W7IB 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 1DTLA 3EK7A 1AK8A 5KSZA 1DGVA 1VRKA 2AMIA 3FWBA 1S6CA 1YVHA 2BCAA 3EK8A 4OKHA 1B7TY 2BE4A 1KFUS 2K7OA 4HREE 1QASA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2ZFDA 1IWQA 1CTRA 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 4PALA 3WHUB 1IQ3A 3OB1B 3C1VA 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 1WRKA 1ZOTB 4JPZB 1JWDA 4CFQA 4YRUA 1KSOA 1UP5A 1AUIB 2CCMA 2ZN8A 1SW8A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 2LCPA 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 1DT7B 1FBVA 2LC5A 1BMOA 2B1UA 3O6BA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 1B47A 3I5FC 2K0JA 3E3RA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2KGBC 2OTGC 1E8AA 2EC6C 2WCFA 4DS7A 1KQMC 2ZKMX 3EKHA 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 4MLWA 4USLA 5I2QA 4OR9B 4DCKA 3GK4X 2Y1MA 1M39A 1QIWA 1WRLA 1SYMA 2H61C 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2KYFA 3K21A 1TNXA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1UHIA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 1M31A 1KQMB 2F3ZA 1C07A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 1L2OB 1SPYA 2I2RE 1SR6B 1RTP1 1B1GA 3BUMB 3PM8A 1B4CA 1QATA 3TUYC 1C7WA 1KWOC 2KI6C 1WLZA 1JSAA 2BL0C 2JT3A 1S5GY 1F4OA 1K9KA 1XVJA 2JQ6A 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 2CTNA 2PALA 1K96A 4FTGA 5AERA 1OMDA 1ODBA 1DJZA 1MF8B 1QJTA 5AANA 1W7JB 3A4UB 5AFPA 1NIWA 1UWOA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 1DJGA 3BUOB 3TS5C 1UHJA 1QXPA 2LMTA 3VROA 2K61A 1K2HA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 1KWOB 5I8NA 2BL0B 1CLBA 2WORA 4PHKA 2LUXA 3AAKA 1QX5B 5HKYA 1IRJA 2GGMA 3KEVA 1PSBA 1ALWA 4P2YB 1M63B 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 3WNXB 4PDZA 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 2JXLA 1S3PA 1XK4C 1UURA 2HF5A 4YGEB 1NCXA 3NSKA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 1TNQA 4GAOA 5BPJA 1DJXA 1EJ3A 2RGIA 3JTDB 1SKTA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 2L98A 1UHHA 3I5GC 2CNPA 1G8IA 1IGVA 4CFRA 3PLFB 1BOCA 3CR2A 4XJKB 1SL9A 4MN0A 3ICBA 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 3IF7A 2KOTA 1K9UA 2LP3A 1S5GZ 1FI6A 1JF0A 3HX4A 3VRQA 4JQ0D 1GGWA 1XFVO 3BUWB 3H4SE 4GFTA 1JFKA 2K8MB 2K2AA 2JPTA 1LKJA 2IS9A 2G2BA 2L4HA 1CFCA 1NUBA 5I2OA 1K95A 1SNLA 1S26D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1CFD A;  1WY9 A;  1ZUZ A;  2KNE A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  2PRU A;  4YGB B;  4AQJ A;  5DKN A;  2KFF A;  1KFU L;  5IBW A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  3PAT A;  4CID A;  1NCZ A;  4YGA A;  2H2K A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  4I5N B;  1YUS A;  1CDL A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2OS8 C;  3NSL A;  1KK8 C;  1HQV A;  4PE7 A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4PE1 A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  4NQG A;  1UUS A;  1K93 D;  4HRG A;  1YUR A;  5JOL A;  1LA3 A;  3CWG A;  4MZL A;  2M7L A;  4ZCV A;  1RJV A;  1CLL A;  2GV5 A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  1IKU A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3HCM A;  1KK8 B;  1TN4 A;  1CFF A;  5TNC A;  1YRT B;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  1SCM C;  2LP2 A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5HKW A;  2O5G A;  1AP4 A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3PN7 C;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  1CKK A;  2LLT A;  1MWN A;  2VRG A;  1C7V A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  4F0Z B;  1NX3 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1FF1 A;  4PHJ A;  4HRH A;  1J1E A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3BQ3 A;  4YGC B;  3NSI A;  2V53 A;  1OZO A;  1CDN A;  5JJG A;  3PN7 B;  1CDP A;  1NWD A;  1WDC C;  1ZMZ A;  3RLZ A;  2KI4 C;  2M1K B;  1J7Q A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1OMV A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  4GBA A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  1SRA A;  2CBL A;  4GNK B;  5B8I B;  2JTT A;  5HLO A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  4MZK A;  2L51 A;  1MUX A;  2WCE A;  2JU0 A;  4M2O A;  3CGA A;  1NX0 A;  1UHN A;  4GGF C;  2K7D A;  1WDC B;  2JT8 A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  4ICB A;  2LMV A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  1BR1 B;  1F71 A;  3CR4 X;  4ETO A;  3I5H B;  2LVV A;  3VRR A;  4XYN A;  5G08 A;  1IG5 A;  1J1D A;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  1DJY A;  4HSZ A;  2BBM A;  5CSF A;  1WRZ A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1LXF C;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4N1F A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  4YBH B;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2KHN A;  4C0J A;  5HLV A;  2L5X B;  3NXA A;  2Y5I A;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  1BOD A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1JBA A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  2CXJ A;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  3TDI A;  2HET A;  1R6P A;  1W7I B;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  1DTL A;  3EK7 A;  1AK8 A;  5KSZ A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  1S6C A;  1YVH A;  2BCA A;  3EK8 A;  4OKH A;  1B7T Y;  2BE4 A;  1KFU S;  2K7O A;  4HRE E;  1QAS A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2ZFD A;  1IWQ A;  1CTR A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  4PAL A;  3WHU B;  1IQ3 A;  3OB1 B;  3C1V A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  1AUI B;  2CCM A;  2ZN8 A;  1SW8 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  2LCP A;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  1DT7 B;  1FBV A;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2KGB C;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  4DS7 A;  1KQM C;  2ZKM X;  3EKH A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  4MLW A;  4USL A;  5I2Q A;  4OR9 B;  4DCK A;  3GK4 X;  2Y1M A;  1M39 A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2KYF A;  3K21 A;  1TNX A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1UHI A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  1L2O B;  1SPY A;  2I2R E;  1SR6 B;  1RTP 1;  1B1G A;  3BUM B;  3PM8 A;  1B4C A;  1QAT A;  3TUY C;  1C7W A;  1KWO C;  2KI6 C;  1WLZ A;  1JSA A;  2BL0 C;  2JT3 A;  1S5G Y;  1F4O A;  1K9K A;  1XVJ A;  2JQ6 A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  2CTN A;  2PAL A;  1K96 A;  4FTG A;  5AER A;  1OMD A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  5AAN A;  1W7J B;  3A4U B;  5AFP A;  1NIW A;  1UWO A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  1DJG A;  3BUO B;  3TS5 C;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  1K2H A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  1KWO B;  5I8N A;  2BL0 B;  1CLB A;  2WOR A;  4PHK A;  2LUX A;  3AAK A;  1QX5 B;  5HKY A;  1IRJ A;  2GGM A;  3KEV A;  1PSB A;  1ALW A;  4P2Y B;  1M63 B;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  3WNX B;  4PDZ A;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  2JXL A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  4YGE B;  1NCX A;  3NSK A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  1TNQ A;  4GAO A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3JTD B;  1SKT A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  2L98 A;  1UHH A;  3I5G C;  2CNP A;  1G8I A;  1IGV A;  4CFR A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  1SL9 A;  4MN0 A;  3ICB A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  3IF7 A;  2KOT A;  1K9U A;  2LP3 A;  1S5G Z;  1FI6 A;  1JF0 A;  3HX4 A;  3VRQ A;  4JQ0 D;  1GGW A;  1XFV O;  3BUW B;  3H4S E;  4GFT A;  1JFK A;  2K8M B;  2K2A A;  2JPT A;  1LKJ A;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  1NUB A;  5I2O A;  1K95 A;  1SNL A;  1S26 D; 
#chains in the Genus database with same CATH topology
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1CFD A;  1WY9 A;  1ZUZ A;  2KNE A;  3BFH A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  1OOI X;  2PRU A;  3QME A;  4YGB B;  4AQJ A;  5DKN A;  2KFF A;  1KFU L;  5IBW A;  2YGU A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  1C3Y A;  3PAT A;  4CID A;  1NCZ A;  4YGA A;  2H2K A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4F7F A;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  1Z2C B;  2WCM A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3D78 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  3CZ2 A;  4I5N B;  1YUS A;  1CDL A;  2QEO A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2OS8 C;  3NSL A;  1KK8 C;  1HQV A;  4PE7 A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  2KPH A;  3Q8I A;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4KYN A;  4PE1 A;  3RZS A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  2WC6 A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  3BJH A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  1DEL A;  4NQG A;  1UUS A;  1K93 D;  3B6X A;  4HRG A;  1YUR A;  5JOL A;  1LA3 A;  2PQL A;  3CWG A;  4MZL A;  2M7L A;  4ZCV A;  1RJV A;  1CLL A;  2GV5 A;  2PYQ A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  3D73 A;  1IKU A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3HCM A;  1KK8 B;  1TN4 A;  1CFF A;  5TNC A;  1YRT B;  3BFB A;  1OOG A;  3BFA A;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  1SCM C;  2LP2 A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5D3O A;  5HKW A;  2O5G A;  1AP4 A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3B86 A;  3PN7 C;  3D76 A;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  3S0F A;  1CKK A;  2LLT A;  1MWN A;  2ERB A;  3S0D A;  2VRG A;  1C7V A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  5FI7 A;  4F0Z B;  1NX3 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2L5Y A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1DC1 A;  1FF1 A;  4PHJ A;  4HRH A;  1J1E A;  5FI2 A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3CDN A;  3BQ3 A;  4YGC B;  3NSI A;  2BNX A;  1OZO A;  2V53 A;  2QEV A;  3PN7 B;  3VB1 A;  5JJG A;  1CDP A;  1CDN A;  1NWD A;  1WDC C;  1ZMZ A;  3FE6 A;  2KI4 C;  2M1K B;  3RLZ A;  2BAP A;  3CAB A;  1J7Q A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1OMV A;  3IVT A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  1W9Z A;  3B7A A;  4GBA A;  1C3Z A;  4INW A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  1SRA A;  2CBL A;  2WCH A;  4GNK B;  5B8I B;  2GTE A;  3O4X A;  2JTT A;  5HLO A;  2QEH A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2KLE A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  4MZK A;  3R1P A;  2L51 A;  1MUX A;  2WCE A;  1P28 A;  1TUJ A;  2JU0 A;  3CGA A;  4M2O A;  1NX0 A;  1T14 A;  1UHN A;  2WCJ A;  4GGF C;  2K7D A;  1WDC B;  2JT8 A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  4ICB A;  2LMV A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  1BR1 B;  4JD9 A;  3CR4 X;  1F71 A;  4ETO A;  3I5H B;  2LVV A;  3SS3 A;  4XYN A;  5G08 A;  3VRR A;  1ORG A;  1IG5 A;  1J1D A;  3V2L A;  1GM0 A;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  1DJY A;  4HSZ A;  3B88 A;  2BBM A;  5CSF A;  1WRZ A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1LXF C;  3B87 A;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4N1F A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  3CYZ A;  4YBH B;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2L2C A;  2KHN A;  3R1O A;  4C0J A;  4IJ7 A;  5HLV A;  2L5X B;  3CZ1 A;  3NXA A;  2Y5I A;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  2WCL A;  4JKT A;  1BOD A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1JBA A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2KLD A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  2CXJ A;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  3TDI A;  2HET A;  1R6P A;  1W7I B;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  3SS5 A;  1DTL A;  3EK7 A;  1OW4 A;  1AK8 A;  5KSZ A;  3L4L A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  1S6C A;  1YVH A;  5EL2 A;  2BCA A;  3EK8 A;  4OKH A;  1B7T Y;  2BE4 A;  1KFU S;  2K7O A;  4HRE E;  1QAS A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2ZFD A;  3FE9 A;  1IWQ A;  1CTR A;  3D74 A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  3PM2 A;  4PAL A;  3WHU B;  1IQ3 A;  3OB1 B;  3C1V A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  3NHT A;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  3UO9 A;  1AUI B;  2CCM A;  2ZN8 A;  1OOH A;  1SW8 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  3OGN A;  2LCP A;  3FE8 A;  3DXL A;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  3S0E A;  1DT7 B;  1FBV A;  3D77 A;  5DIC A;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  3K1E A;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2KGB C;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  4DS7 A;  1KQM C;  2ZKM X;  3EKH A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  3L4A A;  4MLW A;  4USL A;  5I2Q A;  4OR9 B;  4DCK A;  3GK4 X;  2Y1M A;  1M39 A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2KYF A;  3K21 A;  1TNX A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1LS8 A;  1UHI A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  3CZ0 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  2WC5 A;  1L2O B;  1SPY A;  2I2R E;  1SR6 B;  3N7H A;  1RTP 1;  4OZD A;  1B1G A;  3DZT A;  3BUM B;  2FJY A;  3PM8 A;  1B4C A;  1QAT A;  1OOF A;  3TUY C;  1C7W A;  1KWO C;  2KI6 C;  1WLZ A;  3D75 A;  2BL0 C;  1JSA A;  1XFR A;  2JT3 A;  1S5G Y;  1F4O A;  1K9K A;  3R1V A;  5HL1 A;  1XVJ A;  2JPO A;  2JQ6 A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  5I94 A;  2CTN A;  2P71 A;  1DQE A;  1TUZ A;  2PAL A;  1K96 A;  2P70 A;  4FTG A;  5AER A;  1OMD A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  4FQT A;  5AAN A;  1W7J B;  3R72 A;  3A4U B;  2QDI A;  3S0B A;  5AFP A;  1NIW A;  1UWO A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  1DJG A;  3BUO B;  3TS5 C;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  3DY9 A;  1K2H A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  3UNW A;  1KWO B;  5I8N A;  2BL0 B;  1CLB A;  2WOR A;  3NHI A;  4PHK A;  2LUX A;  3AAK A;  1QX5 B;  5HKY A;  3S0A A;  1IRJ A;  2GGM A;  3KEV A;  1PSB A;  1ALW A;  4P2Y B;  1M63 B;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  3EG5 B;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  2H8V A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  4INX A;  3WNX B;  1IIO A;  4PDZ A;  1SSE B;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  4PT1 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  2JXL A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  2QEB A;  4YGE B;  1NCX A;  3NSK A;  3S0G A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  1TNQ A;  3L47 A;  4GAO A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3DYE A;  3JTD B;  1SKT A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  5FI6 A;  2L98 A;  1UHH A;  3I5G C;  2CNP A;  1G8I A;  1Z4H A;  1IGV A;  4CFR A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  2K60 A;  1SL9 A;  4MN0 A;  3ICB A;  3SS4 A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  2WCK A;  2KOT A;  3IF7 A;  1K9U A;  2LP3 A;  1S5G Z;  3PJI A;  1FI6 A;  1JF0 A;  3HX4 A;  3OBV A;  3NGV A;  4JQ0 D;  1XFV O;  3VRQ A;  3BUW B;  3H4S E;  4GFT A;  1GGW A;  1JFK A;  2K8M B;  2K2A A;  2JPT A;  1LKJ A;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  1TWO A;  1NUB A;  1QWV A;  1K95 A;  1DEK A;  5I2O A;  1SNL A;  1S26 D; 
#chains in the Genus database with same CATH homology
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1CFD A;  1WY9 A;  1ZUZ A;  2KNE A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  2PRU A;  4YGB B;  4AQJ A;  5DKN A;  2KFF A;  1KFU L;  5IBW A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  3PAT A;  4CID A;  1NCZ A;  4YGA A;  2H2K A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  4I5N B;  1YUS A;  1CDL A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2OS8 C;  3NSL A;  1KK8 C;  1HQV A;  4PE7 A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4PE1 A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  4NQG A;  1UUS A;  1K93 D;  4HRG A;  1YUR A;  5JOL A;  1LA3 A;  3CWG A;  4MZL A;  2M7L A;  4ZCV A;  1RJV A;  1CLL A;  2GV5 A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  1IKU A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3HCM A;  1KK8 B;  1TN4 A;  1CFF A;  5TNC A;  1YRT B;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  1SCM C;  2LP2 A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5HKW A;  2O5G A;  1AP4 A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3PN7 C;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  1CKK A;  2LLT A;  1MWN A;  2VRG A;  1C7V A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  4F0Z B;  1NX3 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1FF1 A;  4PHJ A;  4HRH A;  1J1E A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3BQ3 A;  4YGC B;  3NSI A;  2V53 A;  1OZO A;  1CDN A;  5JJG A;  3PN7 B;  1CDP A;  1NWD A;  1WDC C;  1ZMZ A;  3RLZ A;  2KI4 C;  2M1K B;  1J7Q A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1OMV A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  4GBA A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  1SRA A;  2CBL A;  4GNK B;  5B8I B;  2JTT A;  5HLO A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  4MZK A;  2L51 A;  1MUX A;  2WCE A;  2JU0 A;  4M2O A;  3CGA A;  1NX0 A;  1UHN A;  4GGF C;  2K7D A;  1WDC B;  2JT8 A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  4ICB A;  2LMV A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  1BR1 B;  1F71 A;  3CR4 X;  4ETO A;  3I5H B;  2LVV A;  3VRR A;  4XYN A;  5G08 A;  1IG5 A;  1J1D A;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  1DJY A;  4HSZ A;  2BBM A;  5CSF A;  1WRZ A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1LXF C;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4N1F A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  4YBH B;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2KHN A;  4C0J A;  5HLV A;  2L5X B;  3NXA A;  2Y5I A;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  1BOD A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1JBA A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  2CXJ A;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  3TDI A;  2HET A;  1R6P A;  1W7I B;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  1DTL A;  3EK7 A;  1AK8 A;  5KSZ A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  1S6C A;  1YVH A;  2BCA A;  3EK8 A;  4OKH A;  1B7T Y;  2BE4 A;  1KFU S;  2K7O A;  4HRE E;  1QAS A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2ZFD A;  1IWQ A;  1CTR A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  4PAL A;  3WHU B;  1IQ3 A;  3OB1 B;  3C1V A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  1AUI B;  2CCM A;  2ZN8 A;  1SW8 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  2LCP A;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  1DT7 B;  1FBV A;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2KGB C;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  4DS7 A;  1KQM C;  2ZKM X;  3EKH A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  4MLW A;  4USL A;  5I2Q A;  4OR9 B;  4DCK A;  3GK4 X;  2Y1M A;  1M39 A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2KYF A;  3K21 A;  1TNX A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1UHI A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  1L2O B;  1SPY A;  2I2R E;  1SR6 B;  1RTP 1;  1B1G A;  3BUM B;  3PM8 A;  1B4C A;  1QAT A;  3TUY C;  1C7W A;  1KWO C;  2KI6 C;  1WLZ A;  1JSA A;  2BL0 C;  2JT3 A;  1S5G Y;  1F4O A;  1K9K A;  1XVJ A;  2JQ6 A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  2CTN A;  2PAL A;  1K96 A;  4FTG A;  5AER A;  1OMD A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  5AAN A;  1W7J B;  3A4U B;  5AFP A;  1NIW A;  1UWO A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  1DJG A;  3BUO B;  3TS5 C;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  1K2H A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  1KWO B;  5I8N A;  2BL0 B;  1CLB A;  2WOR A;  4PHK A;  2LUX A;  3AAK A;  1QX5 B;  5HKY A;  1IRJ A;  2GGM A;  3KEV A;  1PSB A;  1ALW A;  4P2Y B;  1M63 B;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  3WNX B;  4PDZ A;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  2JXL A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  4YGE B;  1NCX A;  3NSK A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  1TNQ A;  4GAO A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3JTD B;  1SKT A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  2L98 A;  1UHH A;  3I5G C;  2CNP A;  1G8I A;  1IGV A;  4CFR A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  1SL9 A;  4MN0 A;  3ICB A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  3IF7 A;  2KOT A;  1K9U A;  2LP3 A;  1S5G Z;  1FI6 A;  1JF0 A;  3HX4 A;  3VRQ A;  4JQ0 D;  1GGW A;  1XFV O;  3BUW B;  3H4S E;  4GFT A;  1JFK A;  2K8M B;  2K2A A;  2JPT A;  1LKJ A;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  1NUB A;  5I2O A;  1K95 A;  1SNL A;  1S26 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...