2IS9A

Structure of yeast dcn-1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
AHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Defective in cullin neddylation protein 1
publication title Structural basis for the function of DCN-1 in protein Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2is9A01
1FW4A 2JU0A 3WHUB 3GK2A 1TNXA 1J7PA 1SMGA 3OB2B 1K96A 5CSNA 1S6IA 1WRZA 1ZACA 3MSEB 1CM1A 2MJWB 2OTGC 4GPLB 5K89A 2P6BB 1KSMA 4ZCUA 3ZNIA 3OX5A 2M49B 2ZN9A 3NSIA 1PSRA 4PE7A 4JWQA 2K7BA 1OQPA 3FWCA 1SRAA 4MVFA 2M7NA 2BL0B 2JXCA 4E68A 3JVTC 2GGZA 2FCEA 1RK9A 1ALWA 1HQVA 1WDCC 1XFUO 2LVIA 1NWDA 3I5IB 3SIAA 2FJUB 4ICBA 1GJYA 1K93D 1OZOA 3AKAA 4F0ZB 4QJ4B 2B1UA 3NSLA 4NDCA 2TN4A 4XYNA 1CLMA 2LLTA 1A03A 1IGVA 2KQYA 2G9BA 4WQ2A 1AP4A 1M46A 2GGMA 3O4YA 4OVNF 4P2YB 1DGUA 1J7RA 3K21A 1Y1XA 1XK4A 1PVAA 3HCMA 4YGCB 2ISDA 4PE4A 3I5GB 2FOTA 4BY5A 1DVIA 4OKHA 3I5FB 1EG4A 2JRFA 3VRRA 3TS5C 2NZ0A 1CDPA 3DF0B 2ZN8A 3H4SE 1S6CA 1Q80A 1QX2A 2JPTA 4I5LB 5CPVA 3EK8A 3OX6A 1SR6C 5AXIA 5I2QA 2MHHA 2L0PA 3KEVA 4C0LA 1JBAA 1NCZA 4PHKA 1JFJA 1XA5A 3EK7A 3IQOA 2EC6C 1B1GA 2L2EA 1PALA 1SCMB 1KSOA 4NDDA 1KQVA 3BQ3A 1IKUA 1SBJA 2L4IA 2QACA 4CPVA 4DS7A 2KYCA 1MR8A 1JC2A 3BUXB 4CFQA 1SL9A 3TDZA 2EGDA 4BY4A 1DT7B 3PLFB 2LC5A 1SYMA 1LINA 5HYDA 1OOJA 1YX8A 1R6PA 2LCPA 5HLVA 1B9AA 2KBIA 3OP0A 2KFGA 1HT9A 1BU3A 2CXJA 1AUIB 1M63B 1K95A 1DJYA 3AKBA 2QPTA 1GGWA 3D10A 2K7CA 2BCXA 2LVVA 4YI8A 2KAVA 4HREE 4N1GA 2KAYA 2M97A 4GGFA 2LLUA 1YTZC 2HQWA 1TN4A 1TTXA 3EVRA 4NQGA 3CS1A 4DIRA 5DKRA 2PVBA 4ETOA 3TUYC 2PMYA 1S26D 4HRHA 4XJKB 1EH2A 2I18A 4I5JA 1E8AA 1SKTA 4AQJA 1K9KA 2CT9A 1B8CA 1CDLA 1Y6WA 1QTXA 1KK7Z 1XFWO 2BCAA 1DF0B 2H61A 2KNEA 2LAPA 2D8NA 2JWWA 4DCKA 1TNWA 3BUMB 3OHMB 2M1KB 2AMIA 3CTNA 3VRNA 4MLWA 1XK4C 1CLLA 1JF0A 1OMVA 3EK4A 4YGEB 1H8BA 1BJFA 1YRUB 4JQ0D 4MSPA 1B47A 4WRIA 1IJ5A 1A4PA 1A75A 5BPJA 3PN7C 3EVUA 3O78A 2KGRA 5D69A 5AEQA 1QX5B 1J1DA 1NCYA 1KWOC 1PK0D 2K7DA 1MXLC 1QVIZ 2E6WA 2IS9A 1W7IB 2M8UA 3CR5X 4PE1A 1M39A 1RFJA 1TNQA 1AJ5A 2R2IA 4MEWA 1QATA 3VGOA 2L51A 1B7TZ 1FI5A 1QIVA 3CWGA 1ODBA 3WXAA 1WRLA 5GQQC 2OS8B 2JULA 1UP5A 1SL7A 2KHNA 1K2HA 3VRQA 1QV0A 1CM4A 1KQMB 2DOQA 1UWOA 1BG1A 1J7QA 5HKYA 2GV5A 4GUKA 3D0YB 2K2FA 1CTRA 1S5GZ 1G4YR 1XFYO 1KK8C 5JJGA 1WRKA 2JTZA 1M31A 1CFPA 1AJ4A 2KI6C 3FWBA 1F54A 2CBLA 1CMGA 1QS7A 3TDIA 4ZCVA 2Y1MA 1Y0VH 2F8PA 2NCOA 5J3XA 4GGFC 2K8MB 1V1GA 2KFHA 1F4OA 1QIWA 2COLB 1SCVA 3CR2A 4YRUA 2M29A 1ZUZA 2LP2A 2H61C 1K8UA 1PVBA 2KSPA 1SNLA 1XFXO 1BLQA 1XYDA 3FS7A 1TOPA 3DF0A 1JSAA 4OR9B 1SY9A 1YUTA 2MLEC 5B8IB 4PDZA 1UUSA 1WY9A 1MXEA 1CNPA 3I5HB 3JTDC 3F45A 3AAJA 1TCFA 1LA0A 4N1FA 5HKZA 1L2OC 3SG7A 2LV7A 2LVKA 1M45A 1YUUA 2K2AA 2NXQA 2MBXA 1N0YA 1C7VA 4ORAB 5G08A 1KFUS 2M1UA 3BUWB 2LVJA 1NIWA 1KWOB 3PATA 1PRWA 1EL4A 3WNXB 2A4JA 2MRDA 3RLZA 1RECA 2ZKMX 1XO5A 4M2OA 5F6TA 2H2KA 2F2OA 4AQIA 5ER4X 1CB1A 1QV1A 3BOWB 1DJIA 2OTGB 1AHRA 1YURA 4GNKB 3BXKA 4OCIA 3GK4X 3TZ1A 3IF7A 1JF2A 1XFZO 1C7WA 1YUSA 2EHBA 2VRGA 2HPSA 3OB1B 2WNDA 1N65A 4D1EA 2JXLA 3PSRA 1TNPA 3KPXA 1K9PA 4QJ5B 3JVTB 3LLEA 3SJSA 1JWDA 2JNXA 2Q4UA 1WDCB 1XFVO 1YVHA 2JQ6A 1F55A 1U5IA 4QJ3B 1YR5A 2KQ6A 2KAXA 3LCPC 1SW8A 2JT3A 2BL0C 2F3YA 1KCYA 3EVVA 5IBWA 2F3ZA 1MHOA 3QRXA 3M0WA 2Y1NA 3SG2A 4GAOA 1FPWA 1KFXS 1QXPA 3O6BA 5DKQA 2CTNA 2PASA 2WCEA 2MA2A 1OMRA 4CIDA 1DJWA 2NCPA 4TNCA 2O5GA 4PE0A 1DF0A 2L4HA 2SASA 4MZLA 2Y4QA 1EJ3A 4C0JA 5KSZA 2Y5IA 2KI4C 2KYFA 1F4QA 2L98A 5AANA 1CKKA 1QJTA 2HETA 5HKWA 1RROA 2LMVA 3TS5B 1IRJA 1AK8A 3I5GC 1LA3A 1LKJA 3CGAA 1IQ5A 4M2QA 1ZMZA 2WCBA 5AFPA 3BUNB 1SR6B 2BE4A 2LMUA 2KGBC 4CFRA 1B8LA 3I5FC 1KFUL 2WOSA 1J7OA 4IL1A 1BR1B 4R1EA 2EC6B 1ZOTB 2M9GA 2L5XB 4ORBB 1UHIA 3SG6A 1Y1UA 2HF5A 4JPZB 1CFDA 2MAZA 1SL8A 2KDHA 3SG5A 4MZKA 2F33A 4P5OE 4CLNA 1NX0A 5JOLA 1UHJA 1DJXA 1XVJA 2PSRA 1IJ6A 1A75B 2BBNA 3TDUA 1SCMC 2BCBA 4OV2A 2JC2A 4ORCB 5TNCA 1F71A 1S6JA 3ICBA 5I2OA 1OSAA 3DVJA 3SIBA 1LVCD 3DD4A 4PHJA 1RTP1 2F2PA 1LXFC 3O2PA 2I94A 1NX2A 2NLNA 2Q91A 4MRYA 1K9UA 2JOJA 1IWQA 1KFXL 1NX1A 2KOTA 1B8RA 2PALA 3D0YA 2ZFDA 2K0JA 5CSJA 3CZTX 2LNKA 4WQ3A 1TCOB 1NSHA 3DVKA 3PM8A 2CNPA 1UHKA 3WHTB 1BF5A 1DJZA 4U8DA 4N5XA 2ZNEA 1NYAA 5I2LA 3SG4A 2AUCA 3TUYB 1A29A 4M2PA 4YI9A 4AOMA 2LP3A 1CLBA 4USLA 2K7OA 1NX3A 1QLSA 1DJHA 1YRTB 2G2BA 2BKHB 1NPQA 2LUCA 4I5KA 1IG5A 4PCWA 3BYAA 2JNFA 1S1EA 4MZJA 3HX4A 4HRGA 1KK7Y 1MF8B 1X02A 2LE9B 3CLNA 1AVSA 1RWYA 2LMTA 1CFCA 2JTTA 4UPGA 3A8RA 2K61A 3NSKA 2KI4B 5CSIA 1EXRA 1EG3A 1CDMA 1BT6A 4L9MA 2LM5A 5CSFA 1SPYA 5KU1A 1DJGA 1G8IA 4FTGA 5KTYA 2I7AA 1QASA 3EKJA 1DMOA 3VROA 1R2UA 2L50A 3PN7B 1RJVA 2O60A 3CR4X 3PALA 1V1FA 1PULA 2WCFA 1TIZA 3A4UB 1A2XA 3EKHA 1MUXA 1D1OA 1MWNA 1VRKA 1YX7A 2KI6D 3BUOB 4A4BA 1DGVA 1QVIY 2JT0A 1BMOA 2JZIA 2LLSA 5AERA 3KHEA 3ZWHA 1K94A 3BOWA 4C0KA 1F8HA 2BECA 4FQOA 1B7TY 1IQ3A 4I5NB 4MRXA 2KBMA 1CMFA 3NXAA 1GQMA 1UURA 3E3RA 3LK0A 1J1EA 4PHNA 5I8NA 2PRUA 1IH0A 4YGDB 1OZSA 4DRWA 2ZRSA 2AAOA 4Q04A 1YVLA 4PALA 2LHLA 1FI6A 2OS8C 1DTLA 4MN0A 2KFFA 1BODA 2ZNDA 5D7FA 5FYXA 3SG3A 1WLMA 1ALVA 3GK1A 4PHMA 1QX7A 1KQMC 1KK8B 1L7ZA 1FF1A 3LK1A 1CFFA 3I5IC 1S5GY 1UHHA 3GOFA 4GBAA 3FIAA 2E30A 4XJKA 1NP8A 1OMDA 3AAKA 1S36A 3PFVA 2HQ8A 1FBVA 2LUXA 1TRFA 3LL8B 2FCDA 4A4CA 1U5IB 3RM1A 2LHIA 5DKNA 4MBEA 1OE9B 2BKIB 2M7LA 2V53A 2BE6A 4GGNA 1S3PA 3KO0A 5ER5A 1MQ1A 1GGZA 5HLOA 3IQQA 4DUQA 2I2RE 1JFKA 1N2DA 1JUOA 2OPOA 4HSZA 2CCMA 3DVMA 1ZFSA 3NSOA 2RGIA 2MLFC 1K90D 1H4BA 1B4CA 2SCPA 1G33A 2M0RA 3JTDB 3C1VA 2ZRTA 4YGBB 2M3WA 1PSBA 5PALA 1W7JB 2JT8A 1QLKA 1CDNA 1WLZA 2LANA 1C07A 1BOCA 1L2OB 2WORA 3VRPA 1Y1AA 4YGAA 1NCXA 3I5HC 1UHNA 4NDBA 3KF9A 4GFTA 4YBHB 2WC8A 3DVEA 1NUBA 1F70A 1BR4B 2BBMA 1SK6D 1J55A
chains in the Genus database with same CATH superfamily
1FW4A 2JU0A 3WHUB 3GK2A 1TNXA 1J7PA 1SMGA 3OB2B 1K96A 5CSNA 1S6IA 1ZACA 1WRZA 2QEHA 3MSEB 3S0AA 1CM1A 4OZDA 1T14A 2MJWB 2OTGC 4GPLB 3DZTA 5K89A 2P6BB 1KSMA 4ZCUA 3ZNIA 3OX5A 2M49B 2ZN9A 3NSIA 1PSRA 4PE7A 4JWQA 2K7BA 1OQPA 3FWCA 1SRAA 4MVFA 3D76A 2M7NA 2BL0B 2JXCA 4E68A 3JVTC 2GGZA 2FCEA 2QEBA 5FI6A 1RK9A 1ALWA 1HQVA 1WDCC 1XFUO 2LVIA 1NWDA 3I5IB 3SIAA 2FJUB 4ICBA 3NHIA 1GJYA 1K93D 1OZOA 3AKAA 4F0ZB 4QJ4B 2B1UA 3NSLA 4NDCA 2TN4A 4XYNA 1CLMA 2LLTA 1A03A 1IGVA 2KQYA 2G9BA 4WQ2A 1AP4A 2QEVA 1M46A 2GGMA 3O4YA 4OVNF 4P2YB 1DGUA 1J7RA 3K21A 3S0BA 3SS4A 1Y1XA 1XK4A 1PVAA 3HCMA 4YGCB 2ISDA 4PE4A 3I5GB 2FOTA 4BY5A 1DVIA 1OOGA 4OKHA 3I5FB 1EG4A 3CZ2A 2JRFA 3VRRA 3SS3A 3BFAA 3TS5C 1DELA 1CDPA 2NZ0A 3DF0B 3RZSA 2ZN8A 3H4SE 1S6CA 1Q80A 1QX2A 2JPTA 4I5LB 5CPVA 3EK8A 3OX6A 1SR6C 5AXIA 5I2QA 2MHHA 2KLDA 2L0PA 3KEVA 4C0LA 1JBAA 1NCZA 4PHKA 1JFJA 1XA5A 3EK7A 3IQOA 4INXA 2EC6C 1B1GA 2L2EA 1PALA 1SCMB 3S0FA 1KSOA 4NDDA 3OBVA 1KQVA 3BQ3A 1IKUA 2L5YA 1SBJA 2L4IA 2QACA 4CPVA 4DS7A 2KYCA 1MR8A 1JC2A 3BUXB 4CFQA 1SL9A 3TDZA 2EGDA 1OOFA 4BY4A 1DT7B 3PLFB 2LC5A 2WC6A 1SYMA 1LINA 1OW4A 3B7AA 1OOJA 5HYDA 1YX8A 1R6PA 2LCPA 5HLVA 1B9AA 2KBIA 2BNXA 3OP0A 2KFGA 1HT9A 1BU3A 2CXJA 1AUIB 1M63B 1K95A 1DJYA 3AKBA 2QPTA 1TUZA 3CZ1A 1GGWA 3DXLA 3D10A 2K7CA 2BCXA 2LVVA 4YI8A 2KAVA 4HREE 4N1GA 2KAYA 2M97A 4GGFA 2LLUA 1YTZC 2HQWA 1TN4A 1TTXA 3EVRA 4NQGA 3CS1A 4DIRA 5DKRA 2PVBA 4ETOA 3TUYC 2PMYA 1S26D 4HRHA 4XJKB 1EH2A 2I18A 4I5JA 1E8AA 1SKTA 4AQJA 3CYZA 1K9KA 2CT9A 1B8CA 1CDLA 1Y6WA 1QTXA 1KK7Z 1XFWO 2BCAA 1DF0B 2H61A 2KNEA 2LAPA 2D8NA 2JWWA 2WCKA 4DCKA 1TNWA 3BUMB 3OHMB 2M1KB 2P70A 2AMIA 3CTNA 3VRNA 4MLWA 3NGVA 1XK4C 1CLLA 1JF0A 1OMVA 1C3ZA 3EK4A 4YGEB 1H8BA 1BJFA 1YRUB 3L47A 4JQ0D 4MSPA 3S0EA 1B47A 4WRIA 4KYNA 1IJ5A 1A4PA 1A75A 5BPJA 3PN7C 3EVUA 3O78A 2KGRA 5D69A 5AEQA 1QX5B 1J1DA 1NCYA 1KWOC 1PK0D 3D74A 3N7HA 1ORGA 2K7DA 1MXLC 4FQTA 1LS8A 1QVIZ 2E6WA 2IS9A 1W7IB 2M8UA 3CR5X 2FJYA 4PE1A 1M39A 1RFJA 1TNQA 1AJ5A 2R2IA 4MEWA 1QATA 3VGOA 2L51A 1B7TZ 1FI5A 1QIVA 2GTEA 1ODBA 3CWGA 3EG5B 3WXAA 1WRLA 5GQQC 2OS8B 2JULA 1UP5A 1SL7A 5EL2A 4F7FA 2KHNA 1K2HA 3VRQA 1QV0A 1CM4A 1KQMB 2DOQA 3PJIA 1UWOA 2JPOA 1BG1A 3NHTA 1J7QA 5HKYA 2GV5A 4GUKA 3D0YB 2WC5A 2K2FA 1CTRA 1S5GZ 1G4YR 1XFYO 1KK8C 5JJGA 1WRKA 2JTZA 1M31A 1CFPA 1AJ4A 1QWVA 2KI6C 3FWBA 2CBLA 1CMGA 1F54A 1QS7A 3TDIA 3TZ1A 4ZCVA 2Y1MA 3CZ0A 3Q8IA 1Y0VH 2F8PA 2NCOA 5J3XA 4GGFC 2K8MB 1DEKA 1V1GA 2KFHA 3D75A 1F4OA 1IIOA 1QIWA 2COLB 1SCVA 3CR2A 1TWOA 4YRUA 2WCLA 2M29A 3BFBA 1ZUZA 2LP2A 2H61C 1K8UA 1PVBA 2KSPA 1SNLA 1XFXO 1BLQA 1XYDA 2KPHA 3FS7A 1TOPA 3D73A 1DC1A 3DF0A 1JSAA 4OR9B 1SY9A 1YUTA 2MLEC 5B8IB 4PDZA 3S0DA 1UUSA 1WY9A 1MXEA 1CNPA 2PYQA 3I5HB 3JTDC 3D78A 3F45A 3AAJA 1TCFA 2L2CA 1LA0A 4N1FA 5HKZA 1L2OC 3SG7A 2LV7A 2LVKA 1M45A 1YUUA 2K2AA 2NXQA 2WCHA 3FE6A 1N0YA 2MBXA 4ORAB 5G08A 1KFUS 2M1UA 3BUWB 1C7VA 2LVJA 1NIWA 1KWOB 1P28A 3PATA 1PRWA 1EL4A 4PT1A 3WNXB 2A4JA 2MRDA 3RLZA 1RECA 2ZKMX 1XO5A 3R1OA 4M2OA 2H2KA 2F2OA 5F6TA 5ER4X 4AQIA 1QV1A 1CB1A 3BOWB 1DJIA 2OTGB 1AHRA 1YURA 1XFRA 3BXKA 4GNKB 3GK4X 4OCIA 3DY9A 2WCJA 1JF2A 3IF7A 1XFZO 1C7WA 1YUSA 3R1PA 2EHBA 2VRGA 2HPSA 3OB1B 2WNDA 3L4AA 1N65A 4D1EA 2JXLA 3PSRA 1TNPA 3KPXA 1K9PA 4QJ5B 3JVTB 3LLEA 3B6XA 3SJSA 1JWDA 2JNXA 2Q4UA 1WDCB 1XFVO 1YVHA 2JQ6A 1F55A 3UNWA 1U5IA 4QJ3B 1YR5A 2KQ6A 2KAXA 2H8VA 3LCPC 1SW8A 2JT3A 2BL0C 2F3YA 1KCYA 3EVVA 5IBWA 2F3ZA 1MHOA 3QRXA 3M0WA 2Y1NA 3SG2A 4GAOA 1FPWA 1KFXS 1QXPA 3O6BA 3DYEA 1Z4HA 2WCMA 5DKQA 2CTNA 2PASA 2WCEA 2MA2A 1OMRA 4CIDA 3BFHA 1DJWA 2NCPA 4TNCA 2O5GA 4PE0A 1DF0A 2L4HA 2SASA 4MZLA 2ERBA 2Y4QA 3S0GA 1EJ3A 4C0JA 5KSZA 2Y5IA 2KI4C 2KYFA 1F4QA 2L98A 5AANA 1CKKA 1QJTA 2HETA 5HKWA 1RROA 2LMVA 3TS5B 1IRJA 1AK8A 3I5GC 1LA3A 1LKJA 3CGAA 1IQ5A 4M2QA 1ZMZA 2WCBA 3SS5A 3BUNB 1SR6B 5AFPA 2BE4A 2LMUA 2KGBC 4CFRA 1B8LA 3D77A 3I5FC 1KFUL 2WOSA 1TUJA 3CDNA 5I94A 1J7OA 4IL1A 1BR1B 4R1EA 2EC6B 1ZOTB 2M9GA 2L5XB 4ORBB 1UHIA 3SG6A 1Y1UA 2HF5A 1GM0A 4JPZB 1CFDA 2MAZA 1SL8A 2KDHA 3SG5A 4MZKA 2F33A 4P5OE 2K60A 4CLNA 1NX0A 5JOLA 1UHJA 1DJXA 1XVJA 2PSRA 1IJ6A 1A75B 2BBNA 3TDUA 1SCMC 2BCBA 4OV2A 2JC2A 4ORCB 5TNCA 1F71A 1S6JA 3ICBA 3B87A 5I2OA 1OSAA 3DVJA 3SIBA 1LVCD 3DD4A 4PHJA 1RTP1 2F2PA 1LXFC 3O2PA 2I94A 1DQEA 1NX2A 2NLNA 2Q91A 4MRYA 1K9UA 2JOJA 1IWQA 1KFXL 1NX1A 2KOTA 1B8RA 2PALA 3D0YA 2ZFDA 2K0JA 2QEOA 1SSEB 2LNKA 3CZTX 1TCOB 4WQ3A 5CSJA 1NSHA 3DVKA 3PM8A 2CNPA 1UHKA 3WHTB 1BF5A 1DJZA 4U8DA 4N5XA 2ZNEA 1NYAA 5I2LA 3SG4A 2AUCA 3OGNA 3TUYB 1A29A 4M2PA 4IJ7A 4YI9A 3CABA 4AOMA 2LP3A 1CLBA 4USLA 2K7OA 1NX3A 1QLSA 1DJHA 1YRTB 2G2BA 1NPQA 2BKHB 2LUCA 4I5KA 1IG5A 4PCWA 3BYAA 2JNFA 1S1EA 4MZJA 3HX4A 4HRGA 1KK7Y 1MF8B 1X02A 2LE9B 2PQLA 1AVSA 1RWYA 2LMTA 3CLNA 2JTTA 3R72A 1CFCA 4UPGA 3A8RA 2K61A 3NSKA 2KI4B 4JD9A 5CSIA 1EXRA 1EG3A 4INWA 1CDMA 1BT6A 3PM2A 4L9MA 5DICA 2LM5A 5CSFA 1SPYA 5KU1A 1DJGA 1G8IA 4FTGA 5KTYA 2I7AA 1QASA 3EKJA 3L4LA 3VROA 1DMOA 1R2UA 5HL1A 2L50A 3PN7B 1RJVA 2O60A 3CR4X 3PALA 1V1FA 1PULA 2WCFA 1TIZA 3A4UB 3BJHA 1A2XA 3EKHA 1MUXA 1D1OA 1MWNA 1VRKA 1YX7A 2KI6D 3BUOB 3VB1A 1DGVA 4A4BA 1QVIY 1W9ZA 1BMOA 2JT0A 2JZIA 2LLSA 5AERA 3KHEA 3ZWHA 1K94A 3BOWA 4C0KA 1F8HA 2BECA 4FQOA 1B7TY 1IQ3A 4I5NB 4MRXA 2KBMA 1CMFA 3NXAA 1GQMA 1UURA 3E3RA 3LK0A 1J1EA 3O4XA 4PHNA 5I8NA 2PRUA 1IH0A 4YGDB 1OZSA 4DRWA 2ZRSA 2AAOA 5D3OA 4Q04A 2P71A 2KLEA 1YVLA 4PALA 2LHLA 1FI6A 2BAPA 2OS8C 1DTLA 3IVTA 4MN0A 2KFFA 1BODA 2ZNDA 5D7FA 5FYXA 3SG3A 1WLMA 1ALVA 3B88A 3GK1A 4PHMA 5FI7A 1QX7A 1KQMC 1KK8B 1L7ZA 3FE9A 1FF1A 3LK1A 1CFFA 1OOHA 3I5IC 1S5GY 1UHHA 3GOFA 4GBAA 3FIAA 2E30A 1Z2CB 4XJKA 1NP8A 1OMDA 3AAKA 1S36A 3PFVA 2HQ8A 1FBVA 4JKTA 2LUXA 1TRFA 3LL8B 2FCDA 4A4CA 1U5IB 3RM1A 2LHIA 5DKNA 4MBEA 1OE9B 2BKIB 2M7LA 2V53A 2BE6A 4GGNA 1S3PA 3KO0A 5ER5A 1MQ1A 3FE8A 1GGZA 3V2LA 5HLOA 3IQQA 4DUQA 2I2RE 1JFKA 1N2DA 1JUOA 2OPOA 4HSZA 3K1EA 2CCMA 3DVMA 3UO9A 1ZFSA 3NSOA 2RGIA 2MLFC 3B86A 1K90D 1H4BA 1B4CA 2SCPA 5FI2A 1G33A 1C3YA 2M0RA 3QMEA 3JTDB 3R1VA 3C1VA 2ZRTA 4YGBB 2M3WA 1PSBA 5PALA 1W7JB 2JT8A 1QLKA 1CDNA 1WLZA 2LANA 1C07A 1BOCA 1L2OB 2WORA 3VRPA 1Y1AA 4YGAA 1NCXA 3I5HC 1UHNA 4NDBA 3KF9A 4GFTA 2YGUA 4YBHB 2WC8A 3DVEA 1NUBA 2QDIA 1OOIX 1F70A 1BR4B 2BBMA 1SK6D 1J55A
chains in the Genus database with same CATH topology
1FW4A 2JU0A 3WHUB 3GK2A 1TNXA 1J7PA 1SMGA 3OB2B 1K96A 5CSNA 1S6IA 1WRZA 1ZACA 3MSEB 1CM1A 2MJWB 2OTGC 4GPLB 5K89A 2P6BB 1KSMA 4ZCUA 3ZNIA 3OX5A 2M49B 2ZN9A 3NSIA 1PSRA 4PE7A 4JWQA 2K7BA 1OQPA 3FWCA 1SRAA 4MVFA 2M7NA 2BL0B 2JXCA 4E68A 3JVTC 2GGZA 2FCEA 1RK9A 1ALWA 1HQVA 1WDCC 1XFUO 2LVIA 1NWDA 3I5IB 3SIAA 2FJUB 4ICBA 1GJYA 1K93D 1OZOA 3AKAA 4F0ZB 4QJ4B 2B1UA 3NSLA 4NDCA 2TN4A 4XYNA 1CLMA 2LLTA 1A03A 1IGVA 2KQYA 2G9BA 4WQ2A 1AP4A 1M46A 2GGMA 3O4YA 4OVNF 4P2YB 1DGUA 1J7RA 3K21A 1Y1XA 1XK4A 1PVAA 3HCMA 4YGCB 2ISDA 4PE4A 3I5GB 2FOTA 4BY5A 1DVIA 4OKHA 3I5FB 1EG4A 2JRFA 3VRRA 3TS5C 2NZ0A 1CDPA 3DF0B 2ZN8A 3H4SE 1S6CA 1Q80A 1QX2A 2JPTA 4I5LB 5CPVA 3EK8A 3OX6A 1SR6C 5AXIA 5I2QA 2MHHA 2L0PA 3KEVA 4C0LA 1JBAA 1NCZA 4PHKA 1JFJA 1XA5A 3EK7A 3IQOA 2EC6C 1B1GA 2L2EA 1PALA 1SCMB 1KSOA 4NDDA 1KQVA 3BQ3A 1IKUA 1SBJA 2L4IA 2QACA 4CPVA 4DS7A 2KYCA 1MR8A 1JC2A 3BUXB 4CFQA 1SL9A 3TDZA 2EGDA 4BY4A 1DT7B 3PLFB 2LC5A 1SYMA 1LINA 5HYDA 1OOJA 1YX8A 1R6PA 2LCPA 5HLVA 1B9AA 2KBIA 3OP0A 2KFGA 1HT9A 1BU3A 2CXJA 1AUIB 1M63B 1K95A 1DJYA 3AKBA 2QPTA 1GGWA 3D10A 2K7CA 2BCXA 2LVVA 4YI8A 2KAVA 4HREE 4N1GA 2KAYA 2M97A 4GGFA 2LLUA 1YTZC 2HQWA 1TN4A 1TTXA 3EVRA 4NQGA 3CS1A 4DIRA 5DKRA 2PVBA 4ETOA 3TUYC 2PMYA 1S26D 4HRHA 4XJKB 1EH2A 2I18A 4I5JA 1E8AA 1SKTA 4AQJA 1K9KA 2CT9A 1B8CA 1CDLA 1Y6WA 1QTXA 1KK7Z 1XFWO 2BCAA 1DF0B 2H61A 2KNEA 2LAPA 2D8NA 2JWWA 4DCKA 1TNWA 3BUMB 3OHMB 2M1KB 2AMIA 3CTNA 3VRNA 4MLWA 1XK4C 1CLLA 1JF0A 1OMVA 3EK4A 4YGEB 1H8BA 1BJFA 1YRUB 4JQ0D 4MSPA 1B47A 4WRIA 1IJ5A 1A4PA 1A75A 5BPJA 3PN7C 3EVUA 3O78A 2KGRA 5D69A 5AEQA 1QX5B 1J1DA 1NCYA 1KWOC 1PK0D 2K7DA 1MXLC 1QVIZ 2E6WA 2IS9A 1W7IB 2M8UA 3CR5X 4PE1A 1M39A 1RFJA 1TNQA 1AJ5A 2R2IA 4MEWA 1QATA 3VGOA 2L51A 1B7TZ 1FI5A 1QIVA 3CWGA 1ODBA 3WXAA 1WRLA 5GQQC 2OS8B 2JULA 1UP5A 1SL7A 2KHNA 1K2HA 3VRQA 1QV0A 1CM4A 1KQMB 2DOQA 1UWOA 1BG1A 1J7QA 5HKYA 2GV5A 4GUKA 3D0YB 2K2FA 1CTRA 1S5GZ 1G4YR 1XFYO 1KK8C 5JJGA 1WRKA 2JTZA 1M31A 1CFPA 1AJ4A 2KI6C 3FWBA 1F54A 2CBLA 1CMGA 1QS7A 3TDIA 4ZCVA 2Y1MA 1Y0VH 2F8PA 2NCOA 5J3XA 4GGFC 2K8MB 1V1GA 2KFHA 1F4OA 1QIWA 2COLB 1SCVA 3CR2A 4YRUA 2M29A 1ZUZA 2LP2A 2H61C 1K8UA 1PVBA 2KSPA 1SNLA 1XFXO 1BLQA 1XYDA 3FS7A 1TOPA 3DF0A 1JSAA 4OR9B 1SY9A 1YUTA 2MLEC 5B8IB 4PDZA 1UUSA 1WY9A 1MXEA 1CNPA 3I5HB 3JTDC 3F45A 3AAJA 1TCFA 1LA0A 4N1FA 5HKZA 1L2OC 3SG7A 2LV7A 2LVKA 1M45A 1YUUA 2K2AA 2NXQA 2MBXA 1N0YA 1C7VA 4ORAB 5G08A 1KFUS 2M1UA 3BUWB 2LVJA 1NIWA 1KWOB 3PATA 1PRWA 1EL4A 3WNXB 2A4JA 2MRDA 3RLZA 1RECA 2ZKMX 1XO5A 4M2OA 5F6TA 2H2KA 2F2OA 4AQIA 5ER4X 1CB1A 1QV1A 3BOWB 1DJIA 2OTGB 1AHRA 1YURA 4GNKB 3BXKA 4OCIA 3GK4X 3TZ1A 3IF7A 1JF2A 1XFZO 1C7WA 1YUSA 2EHBA 2VRGA 2HPSA 3OB1B 2WNDA 1N65A 4D1EA 2JXLA 3PSRA 1TNPA 3KPXA 1K9PA 4QJ5B 3JVTB 3LLEA 3SJSA 1JWDA 2JNXA 2Q4UA 1WDCB 1XFVO 1YVHA 2JQ6A 1F55A 1U5IA 4QJ3B 1YR5A 2KQ6A 2KAXA 3LCPC 1SW8A 2JT3A 2BL0C 2F3YA 1KCYA 3EVVA 5IBWA 2F3ZA 1MHOA 3QRXA 3M0WA 2Y1NA 3SG2A 4GAOA 1FPWA 1KFXS 1QXPA 3O6BA 5DKQA 2CTNA 2PASA 2WCEA 2MA2A 1OMRA 4CIDA 1DJWA 2NCPA 4TNCA 2O5GA 4PE0A 1DF0A 2L4HA 2SASA 4MZLA 2Y4QA 1EJ3A 4C0JA 5KSZA 2Y5IA 2KI4C 2KYFA 1F4QA 2L98A 5AANA 1CKKA 1QJTA 2HETA 5HKWA 1RROA 2LMVA 3TS5B 1IRJA 1AK8A 3I5GC 1LA3A 1LKJA 3CGAA 1IQ5A 4M2QA 1ZMZA 2WCBA 5AFPA 3BUNB 1SR6B 2BE4A 2LMUA 2KGBC 4CFRA 1B8LA 3I5FC 1KFUL 2WOSA 1J7OA 4IL1A 1BR1B 4R1EA 2EC6B 1ZOTB 2M9GA 2L5XB 4ORBB 1UHIA 3SG6A 1Y1UA 2HF5A 4JPZB 1CFDA 2MAZA 1SL8A 2KDHA 3SG5A 4MZKA 2F33A 4P5OE 4CLNA 1NX0A 5JOLA 1UHJA 1DJXA 1XVJA 2PSRA 1IJ6A 1A75B 2BBNA 3TDUA 1SCMC 2BCBA 4OV2A 2JC2A 4ORCB 5TNCA 1F71A 1S6JA 3ICBA 5I2OA 1OSAA 3DVJA 3SIBA 1LVCD 3DD4A 4PHJA 1RTP1 2F2PA 1LXFC 3O2PA 2I94A 1NX2A 2NLNA 2Q91A 4MRYA 1K9UA 2JOJA 1IWQA 1KFXL 1NX1A 2KOTA 1B8RA 2PALA 3D0YA 2ZFDA 2K0JA 5CSJA 3CZTX 2LNKA 4WQ3A 1TCOB 1NSHA 3DVKA 3PM8A 2CNPA 1UHKA 3WHTB 1BF5A 1DJZA 4U8DA 4N5XA 2ZNEA 1NYAA 5I2LA 3SG4A 2AUCA 3TUYB 1A29A 4M2PA 4YI9A 4AOMA 2LP3A 1CLBA 4USLA 2K7OA 1NX3A 1QLSA 1DJHA 1YRTB 2G2BA 2BKHB 1NPQA 2LUCA 4I5KA 1IG5A 4PCWA 3BYAA 2JNFA 1S1EA 4MZJA 3HX4A 4HRGA 1KK7Y 1MF8B 1X02A 2LE9B 3CLNA 1AVSA 1RWYA 2LMTA 1CFCA 2JTTA 4UPGA 3A8RA 2K61A 3NSKA 2KI4B 5CSIA 1EXRA 1EG3A 1CDMA 1BT6A 4L9MA 2LM5A 5CSFA 1SPYA 5KU1A 1DJGA 1G8IA 4FTGA 5KTYA 2I7AA 1QASA 3EKJA 1DMOA 3VROA 1R2UA 2L50A 3PN7B 1RJVA 2O60A 3CR4X 3PALA 1V1FA 1PULA 2WCFA 1TIZA 3A4UB 1A2XA 3EKHA 1MUXA 1D1OA 1MWNA 1VRKA 1YX7A 2KI6D 3BUOB 4A4BA 1DGVA 1QVIY 2JT0A 1BMOA 2JZIA 2LLSA 5AERA 3KHEA 3ZWHA 1K94A 3BOWA 4C0KA 1F8HA 2BECA 4FQOA 1B7TY 1IQ3A 4I5NB 4MRXA 2KBMA 1CMFA 3NXAA 1GQMA 1UURA 3E3RA 3LK0A 1J1EA 4PHNA 5I8NA 2PRUA 1IH0A 4YGDB 1OZSA 4DRWA 2ZRSA 2AAOA 4Q04A 1YVLA 4PALA 2LHLA 1FI6A 2OS8C 1DTLA 4MN0A 2KFFA 1BODA 2ZNDA 5D7FA 5FYXA 3SG3A 1WLMA 1ALVA 3GK1A 4PHMA 1QX7A 1KQMC 1KK8B 1L7ZA 1FF1A 3LK1A 1CFFA 3I5IC 1S5GY 1UHHA 3GOFA 4GBAA 3FIAA 2E30A 4XJKA 1NP8A 1OMDA 3AAKA 1S36A 3PFVA 2HQ8A 1FBVA 2LUXA 1TRFA 3LL8B 2FCDA 4A4CA 1U5IB 3RM1A 2LHIA 5DKNA 4MBEA 1OE9B 2BKIB 2M7LA 2V53A 2BE6A 4GGNA 1S3PA 3KO0A 5ER5A 1MQ1A 1GGZA 5HLOA 3IQQA 4DUQA 2I2RE 1JFKA 1N2DA 1JUOA 2OPOA 4HSZA 2CCMA 3DVMA 1ZFSA 3NSOA 2RGIA 2MLFC 1K90D 1H4BA 1B4CA 2SCPA 1G33A 2M0RA 3JTDB 3C1VA 2ZRTA 4YGBB 2M3WA 1PSBA 5PALA 1W7JB 2JT8A 1QLKA 1CDNA 1WLZA 2LANA 1C07A 1BOCA 1L2OB 2WORA 3VRPA 1Y1AA 4YGAA 1NCXA 3I5HC 1UHNA 4NDBA 3KF9A 4GFTA 4YBHB 2WC8A 3DVEA 1NUBA 1F70A 1BR4B 2BBMA 1SK6D 1J55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW4 A;  2JU0 A;  3WHU B;  3GK2 A;  1TNX A;  1J7P A;  1SMG A;  3OB2 B;  1K96 A;  5CSN A;  1S6I A;  1WRZ A;  1ZAC A;  3MSE B;  1CM1 A;  2MJW B;  2OTG C;  4GPL B;  5K89 A;  2P6B B;  1KSM A;  4ZCU A;  3ZNI A;  3OX5 A;  2M49 B;  2ZN9 A;  3NSI A;  1PSR A;  4PE7 A;  4JWQ A;  2K7B A;  1OQP A;  3FWC A;  1SRA A;  4MVF A;  2M7N A;  2BL0 B;  2JXC A;  4E68 A;  3JVT C;  2GGZ A;  2FCE A;  1RK9 A;  1ALW A;  1HQV A;  1WDC C;  1XFU O;  2LVI A;  1NWD A;  3I5I B;  3SIA A;  2FJU B;  4ICB A;  1GJY A;  1K93 D;  1OZO A;  3AKA A;  4F0Z B;  4QJ4 B;  2B1U A;  3NSL A;  4NDC A;  2TN4 A;  4XYN A;  1CLM A;  2LLT A;  1A03 A;  1IGV A;  2KQY A;  2G9B A;  4WQ2 A;  1AP4 A;  1M46 A;  2GGM A;  3O4Y A;  4OVN F;  4P2Y B;  1DGU A;  1J7R A;  3K21 A;  1Y1X A;  1XK4 A;  1PVA A;  3HCM A;  4YGC B;  2ISD A;  4PE4 A;  3I5G B;  2FOT A;  4BY5 A;  1DVI A;  4OKH A;  3I5F B;  1EG4 A;  2JRF A;  3VRR A;  3TS5 C;  2NZ0 A;  1CDP A;  3DF0 B;  2ZN8 A;  3H4S E;  1S6C A;  1Q80 A;  1QX2 A;  2JPT A;  4I5L B;  5CPV A;  3EK8 A;  3OX6 A;  1SR6 C;  5AXI A;  5I2Q A;  2MHH A;  2L0P A;  3KEV A;  4C0L A;  1JBA A;  1NCZ A;  4PHK A;  1JFJ A;  1XA5 A;  3EK7 A;  3IQO A;  2EC6 C;  1B1G A;  2L2E A;  1PAL A;  1SCM B;  1KSO A;  4NDD A;  1KQV A;  3BQ3 A;  1IKU A;  1SBJ A;  2L4I A;  2QAC A;  4CPV A;  4DS7 A;  2KYC A;  1MR8 A;  1JC2 A;  3BUX B;  4CFQ A;  1SL9 A;  3TDZ A;  2EGD A;  4BY4 A;  1DT7 B;  3PLF B;  2LC5 A;  1SYM A;  1LIN A;  5HYD A;  1OOJ A;  1YX8 A;  1R6P A;  2LCP A;  5HLV A;  1B9A A;  2KBI A;  3OP0 A;  2KFG A;  1HT9 A;  1BU3 A;  2CXJ A;  1AUI B;  1M63 B;  1K95 A;  1DJY A;  3AKB A;  2QPT A;  1GGW A;  3D10 A;  2K7C A;  2BCX A;  2LVV A;  4YI8 A;  2KAV A;  4HRE E;  4N1G A;  2KAY A;  2M97 A;  4GGF A;  2LLU A;  1YTZ C;  2HQW A;  1TN4 A;  1TTX A;  3EVR A;  4NQG A;  3CS1 A;  4DIR A;  5DKR A;  2PVB A;  4ETO A;  3TUY C;  2PMY A;  1S26 D;  4HRH A;  4XJK B;  1EH2 A;  2I18 A;  4I5J A;  1E8A A;  1SKT A;  4AQJ A;  1K9K A;  2CT9 A;  1B8C A;  1CDL A;  1Y6W A;  1QTX A;  1KK7 Z;  1XFW O;  2BCA A;  1DF0 B;  2H61 A;  2KNE A;  2LAP A;  2D8N A;  2JWW A;  4DCK A;  1TNW A;  3BUM B;  3OHM B;  2M1K B;  2AMI A;  3CTN A;  3VRN A;  4MLW A;  1XK4 C;  1CLL A;  1JF0 A;  1OMV A;  3EK4 A;  4YGE B;  1H8B A;  1BJF A;  1YRU B;  4JQ0 D;  4MSP A;  1B47 A;  4WRI A;  1IJ5 A;  1A4P A;  1A75 A;  5BPJ A;  3PN7 C;  3EVU A;  3O78 A;  2KGR A;  5D69 A;  5AEQ A;  1QX5 B;  1J1D A;  1NCY A;  1KWO C;  1PK0 D;  2K7D A;  1MXL C;  1QVI Z;  2E6W A;  2IS9 A;  1W7I B;  2M8U A;  3CR5 X;  4PE1 A;  1M39 A;  1RFJ A;  1TNQ A;  1AJ5 A;  2R2I A;  4MEW A;  1QAT A;  3VGO A;  2L51 A;  1B7T Z;  1FI5 A;  1QIV A;  3CWG A;  1ODB A;  3WXA A;  1WRL A;  5GQQ C;  2OS8 B;  2JUL A;  1UP5 A;  1SL7 A;  2KHN A;  1K2H A;  3VRQ A;  1QV0 A;  1CM4 A;  1KQM B;  2DOQ A;  1UWO A;  1BG1 A;  1J7Q A;  5HKY A;  2GV5 A;  4GUK A;  3D0Y B;  2K2F A;  1CTR A;  1S5G Z;  1G4Y R;  1XFY O;  1KK8 C;  5JJG A;  1WRK A;  2JTZ A;  1M31 A;  1CFP A;  1AJ4 A;  2KI6 C;  3FWB A;  1F54 A;  2CBL A;  1CMG A;  1QS7 A;  3TDI A;  4ZCV A;  2Y1M A;  1Y0V H;  2F8P A;  2NCO A;  5J3X A;  4GGF C;  2K8M B;  1V1G A;  2KFH A;  1F4O A;  1QIW A;  2COL B;  1SCV A;  3CR2 A;  4YRU A;  2M29 A;  1ZUZ A;  2LP2 A;  2H61 C;  1K8U A;  1PVB A;  2KSP A;  1SNL A;  1XFX O;  1BLQ A;  1XYD A;  3FS7 A;  1TOP A;  3DF0 A;  1JSA A;  4OR9 B;  1SY9 A;  1YUT A;  2MLE C;  5B8I B;  4PDZ A;  1UUS A;  1WY9 A;  1MXE A;  1CNP A;  3I5H B;  3JTD C;  3F45 A;  3AAJ A;  1TCF A;  1LA0 A;  4N1F A;  5HKZ A;  1L2O C;  3SG7 A;  2LV7 A;  2LVK A;  1M45 A;  1YUU A;  2K2A A;  2NXQ A;  2MBX A;  1N0Y A;  1C7V A;  4ORA B;  5G08 A;  1KFU S;  2M1U A;  3BUW B;  2LVJ A;  1NIW A;  1KWO B;  3PAT A;  1PRW A;  1EL4 A;  3WNX B;  2A4J A;  2MRD A;  3RLZ A;  1REC A;  2ZKM X;  1XO5 A;  4M2O A;  5F6T A;  2H2K A;  2F2O A;  4AQI A;  5ER4 X;  1CB1 A;  1QV1 A;  3BOW B;  1DJI A;  2OTG B;  1AHR A;  1YUR A;  4GNK B;  3BXK A;  4OCI A;  3GK4 X;  3TZ1 A;  3IF7 A;  1JF2 A;  1XFZ O;  1C7W A;  1YUS A;  2EHB A;  2VRG A;  2HPS A;  3OB1 B;  2WND A;  1N65 A;  4D1E A;  2JXL A;  3PSR A;  1TNP A;  3KPX A;  1K9P A;  4QJ5 B;  3JVT B;  3LLE A;  3SJS A;  1JWD A;  2JNX A;  2Q4U A;  1WDC B;  1XFV O;  1YVH A;  2JQ6 A;  1F55 A;  1U5I A;  4QJ3 B;  1YR5 A;  2KQ6 A;  2KAX A;  3LCP C;  1SW8 A;  2JT3 A;  2BL0 C;  2F3Y A;  1KCY A;  3EVV A;  5IBW A;  2F3Z A;  1MHO A;  3QRX A;  3M0W A;  2Y1N A;  3SG2 A;  4GAO A;  1FPW A;  1KFX S;  1QXP A;  3O6B A;  5DKQ A;  2CTN A;  2PAS A;  2WCE A;  2MA2 A;  1OMR A;  4CID A;  1DJW A;  2NCP A;  4TNC A;  2O5G A;  4PE0 A;  1DF0 A;  2L4H A;  2SAS A;  4MZL A;  2Y4Q A;  1EJ3 A;  4C0J A;  5KSZ A;  2Y5I A;  2KI4 C;  2KYF A;  1F4Q A;  2L98 A;  5AAN A;  1CKK A;  1QJT A;  2HET A;  5HKW A;  1RRO A;  2LMV A;  3TS5 B;  1IRJ A;  1AK8 A;  3I5G C;  1LA3 A;  1LKJ A;  3CGA A;  1IQ5 A;  4M2Q A;  1ZMZ A;  2WCB A;  5AFP A;  3BUN B;  1SR6 B;  2BE4 A;  2LMU A;  2KGB C;  4CFR A;  1B8L A;  3I5F C;  1KFU L;  2WOS A;  1J7O A;  4IL1 A;  1BR1 B;  4R1E A;  2EC6 B;  1ZOT B;  2M9G A;  2L5X B;  4ORB B;  1UHI A;  3SG6 A;  1Y1U A;  2HF5 A;  4JPZ B;  1CFD A;  2MAZ A;  1SL8 A;  2KDH A;  3SG5 A;  4MZK A;  2F33 A;  4P5O E;  4CLN A;  1NX0 A;  5JOL A;  1UHJ A;  1DJX A;  1XVJ A;  2PSR A;  1IJ6 A;  1A75 B;  2BBN A;  3TDU A;  1SCM C;  2BCB A;  4OV2 A;  2JC2 A;  4ORC B;  5TNC A;  1F71 A;  1S6J A;  3ICB A;  5I2O A;  1OSA A;  3DVJ A;  3SIB A;  1LVC D;  3DD4 A;  4PHJ A;  1RTP 1;  2F2P A;  1LXF C;  3O2P A;  2I94 A;  1NX2 A;  2NLN A;  2Q91 A;  4MRY A;  1K9U A;  2JOJ A;  1IWQ A;  1KFX L;  1NX1 A;  2KOT A;  1B8R A;  2PAL A;  3D0Y A;  2ZFD A;  2K0J A;  5CSJ A;  3CZT X;  2LNK A;  4WQ3 A;  1TCO B;  1NSH A;  3DVK A;  3PM8 A;  2CNP A;  1UHK A;  3WHT B;  1BF5 A;  1DJZ A;  4U8D A;  4N5X A;  2ZNE A;  1NYA A;  5I2L A;  3SG4 A;  2AUC A;  3TUY B;  1A29 A;  4M2P A;  4YI9 A;  4AOM A;  2LP3 A;  1CLB A;  4USL A;  2K7O A;  1NX3 A;  1QLS A;  1DJH A;  1YRT B;  2G2B A;  2BKH B;  1NPQ A;  2LUC A;  4I5K A;  1IG5 A;  4PCW A;  3BYA A;  2JNF A;  1S1E A;  4MZJ A;  3HX4 A;  4HRG A;  1KK7 Y;  1MF8 B;  1X02 A;  2LE9 B;  3CLN A;  1AVS A;  1RWY A;  2LMT A;  1CFC A;  2JTT A;  4UPG A;  3A8R A;  2K61 A;  3NSK A;  2KI4 B;  5CSI A;  1EXR A;  1EG3 A;  1CDM A;  1BT6 A;  4L9M A;  2LM5 A;  5CSF A;  1SPY A;  5KU1 A;  1DJG A;  1G8I A;  4FTG A;  5KTY A;  2I7A A;  1QAS A;  3EKJ A;  1DMO A;  3VRO A;  1R2U A;  2L50 A;  3PN7 B;  1RJV A;  2O60 A;  3CR4 X;  3PAL A;  1V1F A;  1PUL A;  2WCF A;  1TIZ A;  3A4U B;  1A2X A;  3EKH A;  1MUX A;  1D1O A;  1MWN A;  1VRK A;  1YX7 A;  2KI6 D;  3BUO B;  4A4B A;  1DGV A;  1QVI Y;  2JT0 A;  1BMO A;  2JZI A;  2LLS A;  5AER A;  3KHE A;  3ZWH A;  1K94 A;  3BOW A;  4C0K A;  1F8H A;  2BEC A;  4FQO A;  1B7T Y;  1IQ3 A;  4I5N B;  4MRX A;  2KBM A;  1CMF A;  3NXA A;  1GQM A;  1UUR A;  3E3R A;  3LK0 A;  1J1E A;  4PHN A;  5I8N A;  2PRU A;  1IH0 A;  4YGD B;  1OZS A;  4DRW A;  2ZRS A;  2AAO A;  4Q04 A;  1YVL A;  4PAL A;  2LHL A;  1FI6 A;  2OS8 C;  1DTL A;  4MN0 A;  2KFF A;  1BOD A;  2ZND A;  5D7F A;  5FYX A;  3SG3 A;  1WLM A;  1ALV A;  3GK1 A;  4PHM A;  1QX7 A;  1KQM C;  1KK8 B;  1L7Z A;  1FF1 A;  3LK1 A;  1CFF A;  3I5I C;  1S5G Y;  1UHH A;  3GOF A;  4GBA A;  3FIA A;  2E30 A;  4XJK A;  1NP8 A;  1OMD A;  3AAK A;  1S36 A;  3PFV A;  2HQ8 A;  1FBV A;  2LUX A;  1TRF A;  3LL8 B;  2FCD A;  4A4C A;  1U5I B;  3RM1 A;  2LHI A;  5DKN A;  4MBE A;  1OE9 B;  2BKI B;  2M7L A;  2V53 A;  2BE6 A;  4GGN A;  1S3P A;  3KO0 A;  5ER5 A;  1MQ1 A;  1GGZ A;  5HLO A;  3IQQ A;  4DUQ A;  2I2R E;  1JFK A;  1N2D A;  1JUO A;  2OPO A;  4HSZ A;  2CCM A;  3DVM A;  1ZFS A;  3NSO A;  2RGI A;  2MLF C;  1K90 D;  1H4B A;  1B4C A;  2SCP A;  1G33 A;  2M0R A;  3JTD B;  3C1V A;  2ZRT A;  4YGB B;  2M3W A;  1PSB A;  5PAL A;  1W7J B;  2JT8 A;  1QLK A;  1CDN A;  1WLZ A;  2LAN A;  1C07 A;  1BOC A;  1L2O B;  2WOR A;  3VRP A;  1Y1A A;  4YGA A;  1NCX A;  3I5H C;  1UHN A;  4NDB A;  3KF9 A;  4GFT A;  4YBH B;  2WC8 A;  3DVE A;  1NUB A;  1F70 A;  1BR4 B;  2BBM A;  1SK6 D;  1J55 A; 
#chains in the Genus database with same CATH topology
 1FW4 A;  2JU0 A;  3WHU B;  3GK2 A;  1TNX A;  1J7P A;  1SMG A;  3OB2 B;  1K96 A;  5CSN A;  1S6I A;  1ZAC A;  1WRZ A;  2QEH A;  3MSE B;  3S0A A;  1CM1 A;  4OZD A;  1T14 A;  2MJW B;  2OTG C;  4GPL B;  3DZT A;  5K89 A;  2P6B B;  1KSM A;  4ZCU A;  3ZNI A;  3OX5 A;  2M49 B;  2ZN9 A;  3NSI A;  1PSR A;  4PE7 A;  4JWQ A;  2K7B A;  1OQP A;  3FWC A;  1SRA A;  4MVF A;  3D76 A;  2M7N A;  2BL0 B;  2JXC A;  4E68 A;  3JVT C;  2GGZ A;  2FCE A;  2QEB A;  5FI6 A;  1RK9 A;  1ALW A;  1HQV A;  1WDC C;  1XFU O;  2LVI A;  1NWD A;  3I5I B;  3SIA A;  2FJU B;  4ICB A;  3NHI A;  1GJY A;  1K93 D;  1OZO A;  3AKA A;  4F0Z B;  4QJ4 B;  2B1U A;  3NSL A;  4NDC A;  2TN4 A;  4XYN A;  1CLM A;  2LLT A;  1A03 A;  1IGV A;  2KQY A;  2G9B A;  4WQ2 A;  1AP4 A;  2QEV A;  1M46 A;  2GGM A;  3O4Y A;  4OVN F;  4P2Y B;  1DGU A;  1J7R A;  3K21 A;  3S0B A;  3SS4 A;  1Y1X A;  1XK4 A;  1PVA A;  3HCM A;  4YGC B;  2ISD A;  4PE4 A;  3I5G B;  2FOT A;  4BY5 A;  1DVI A;  1OOG A;  4OKH A;  3I5F B;  1EG4 A;  3CZ2 A;  2JRF A;  3VRR A;  3SS3 A;  3BFA A;  3TS5 C;  1DEL A;  1CDP A;  2NZ0 A;  3DF0 B;  3RZS A;  2ZN8 A;  3H4S E;  1S6C A;  1Q80 A;  1QX2 A;  2JPT A;  4I5L B;  5CPV A;  3EK8 A;  3OX6 A;  1SR6 C;  5AXI A;  5I2Q A;  2MHH A;  2KLD A;  2L0P A;  3KEV A;  4C0L A;  1JBA A;  1NCZ A;  4PHK A;  1JFJ A;  1XA5 A;  3EK7 A;  3IQO A;  4INX A;  2EC6 C;  1B1G A;  2L2E A;  1PAL A;  1SCM B;  3S0F A;  1KSO A;  4NDD A;  3OBV A;  1KQV A;  3BQ3 A;  1IKU A;  2L5Y A;  1SBJ A;  2L4I A;  2QAC A;  4CPV A;  4DS7 A;  2KYC A;  1MR8 A;  1JC2 A;  3BUX B;  4CFQ A;  1SL9 A;  3TDZ A;  2EGD A;  1OOF A;  4BY4 A;  1DT7 B;  3PLF B;  2LC5 A;  2WC6 A;  1SYM A;  1LIN A;  1OW4 A;  3B7A A;  1OOJ A;  5HYD A;  1YX8 A;  1R6P A;  2LCP A;  5HLV A;  1B9A A;  2KBI A;  2BNX A;  3OP0 A;  2KFG A;  1HT9 A;  1BU3 A;  2CXJ A;  1AUI B;  1M63 B;  1K95 A;  1DJY A;  3AKB A;  2QPT A;  1TUZ A;  3CZ1 A;  1GGW A;  3DXL A;  3D10 A;  2K7C A;  2BCX A;  2LVV A;  4YI8 A;  2KAV A;  4HRE E;  4N1G A;  2KAY A;  2M97 A;  4GGF A;  2LLU A;  1YTZ C;  2HQW A;  1TN4 A;  1TTX A;  3EVR A;  4NQG A;  3CS1 A;  4DIR A;  5DKR A;  2PVB A;  4ETO A;  3TUY C;  2PMY A;  1S26 D;  4HRH A;  4XJK B;  1EH2 A;  2I18 A;  4I5J A;  1E8A A;  1SKT A;  4AQJ A;  3CYZ A;  1K9K A;  2CT9 A;  1B8C A;  1CDL A;  1Y6W A;  1QTX A;  1KK7 Z;  1XFW O;  2BCA A;  1DF0 B;  2H61 A;  2KNE A;  2LAP A;  2D8N A;  2JWW A;  2WCK A;  4DCK A;  1TNW A;  3BUM B;  3OHM B;  2M1K B;  2P70 A;  2AMI A;  3CTN A;  3VRN A;  4MLW A;  3NGV A;  1XK4 C;  1CLL A;  1JF0 A;  1OMV A;  1C3Z A;  3EK4 A;  4YGE B;  1H8B A;  1BJF A;  1YRU B;  3L47 A;  4JQ0 D;  4MSP A;  3S0E A;  1B47 A;  4WRI A;  4KYN A;  1IJ5 A;  1A4P A;  1A75 A;  5BPJ A;  3PN7 C;  3EVU A;  3O78 A;  2KGR A;  5D69 A;  5AEQ A;  1QX5 B;  1J1D A;  1NCY A;  1KWO C;  1PK0 D;  3D74 A;  3N7H A;  1ORG A;  2K7D A;  1MXL C;  4FQT A;  1LS8 A;  1QVI Z;  2E6W A;  2IS9 A;  1W7I B;  2M8U A;  3CR5 X;  2FJY A;  4PE1 A;  1M39 A;  1RFJ A;  1TNQ A;  1AJ5 A;  2R2I A;  4MEW A;  1QAT A;  3VGO A;  2L51 A;  1B7T Z;  1FI5 A;  1QIV A;  2GTE A;  1ODB A;  3CWG A;  3EG5 B;  3WXA A;  1WRL A;  5GQQ C;  2OS8 B;  2JUL A;  1UP5 A;  1SL7 A;  5EL2 A;  4F7F A;  2KHN A;  1K2H A;  3VRQ A;  1QV0 A;  1CM4 A;  1KQM B;  2DOQ A;  3PJI A;  1UWO A;  2JPO A;  1BG1 A;  3NHT A;  1J7Q A;  5HKY A;  2GV5 A;  4GUK A;  3D0Y B;  2WC5 A;  2K2F A;  1CTR A;  1S5G Z;  1G4Y R;  1XFY O;  1KK8 C;  5JJG A;  1WRK A;  2JTZ A;  1M31 A;  1CFP A;  1AJ4 A;  1QWV A;  2KI6 C;  3FWB A;  2CBL A;  1CMG A;  1F54 A;  1QS7 A;  3TDI A;  3TZ1 A;  4ZCV A;  2Y1M A;  3CZ0 A;  3Q8I A;  1Y0V H;  2F8P A;  2NCO A;  5J3X A;  4GGF C;  2K8M B;  1DEK A;  1V1G A;  2KFH A;  3D75 A;  1F4O A;  1IIO A;  1QIW A;  2COL B;  1SCV A;  3CR2 A;  1TWO A;  4YRU A;  2WCL A;  2M29 A;  3BFB A;  1ZUZ A;  2LP2 A;  2H61 C;  1K8U A;  1PVB A;  2KSP A;  1SNL A;  1XFX O;  1BLQ A;  1XYD A;  2KPH A;  3FS7 A;  1TOP A;  3D73 A;  1DC1 A;  3DF0 A;  1JSA A;  4OR9 B;  1SY9 A;  1YUT A;  2MLE C;  5B8I B;  4PDZ A;  3S0D A;  1UUS A;  1WY9 A;  1MXE A;  1CNP A;  2PYQ A;  3I5H B;  3JTD C;  3D78 A;  3F45 A;  3AAJ A;  1TCF A;  2L2C A;  1LA0 A;  4N1F A;  5HKZ A;  1L2O C;  3SG7 A;  2LV7 A;  2LVK A;  1M45 A;  1YUU A;  2K2A A;  2NXQ A;  2WCH A;  3FE6 A;  1N0Y A;  2MBX A;  4ORA B;  5G08 A;  1KFU S;  2M1U A;  3BUW B;  1C7V A;  2LVJ A;  1NIW A;  1KWO B;  1P28 A;  3PAT A;  1PRW A;  1EL4 A;  4PT1 A;  3WNX B;  2A4J A;  2MRD A;  3RLZ A;  1REC A;  2ZKM X;  1XO5 A;  3R1O A;  4M2O A;  2H2K A;  2F2O A;  5F6T A;  5ER4 X;  4AQI A;  1QV1 A;  1CB1 A;  3BOW B;  1DJI A;  2OTG B;  1AHR A;  1YUR A;  1XFR A;  3BXK A;  4GNK B;  3GK4 X;  4OCI A;  3DY9 A;  2WCJ A;  1JF2 A;  3IF7 A;  1XFZ O;  1C7W A;  1YUS A;  3R1P A;  2EHB A;  2VRG A;  2HPS A;  3OB1 B;  2WND A;  3L4A A;  1N65 A;  4D1E A;  2JXL A;  3PSR A;  1TNP A;  3KPX A;  1K9P A;  4QJ5 B;  3JVT B;  3LLE A;  3B6X A;  3SJS A;  1JWD A;  2JNX A;  2Q4U A;  1WDC B;  1XFV O;  1YVH A;  2JQ6 A;  1F55 A;  3UNW A;  1U5I A;  4QJ3 B;  1YR5 A;  2KQ6 A;  2KAX A;  2H8V A;  3LCP C;  1SW8 A;  2JT3 A;  2BL0 C;  2F3Y A;  1KCY A;  3EVV A;  5IBW A;  2F3Z A;  1MHO A;  3QRX A;  3M0W A;  2Y1N A;  3SG2 A;  4GAO A;  1FPW A;  1KFX S;  1QXP A;  3O6B A;  3DYE A;  1Z4H A;  2WCM A;  5DKQ A;  2CTN A;  2PAS A;  2WCE A;  2MA2 A;  1OMR A;  4CID A;  3BFH A;  1DJW A;  2NCP A;  4TNC A;  2O5G A;  4PE0 A;  1DF0 A;  2L4H A;  2SAS A;  4MZL A;  2ERB A;  2Y4Q A;  3S0G A;  1EJ3 A;  4C0J A;  5KSZ A;  2Y5I A;  2KI4 C;  2KYF A;  1F4Q A;  2L98 A;  5AAN A;  1CKK A;  1QJT A;  2HET A;  5HKW A;  1RRO A;  2LMV A;  3TS5 B;  1IRJ A;  1AK8 A;  3I5G C;  1LA3 A;  1LKJ A;  3CGA A;  1IQ5 A;  4M2Q A;  1ZMZ A;  2WCB A;  3SS5 A;  3BUN B;  1SR6 B;  5AFP A;  2BE4 A;  2LMU A;  2KGB C;  4CFR A;  1B8L A;  3D77 A;  3I5F C;  1KFU L;  2WOS A;  1TUJ A;  3CDN A;  5I94 A;  1J7O A;  4IL1 A;  1BR1 B;  4R1E A;  2EC6 B;  1ZOT B;  2M9G A;  2L5X B;  4ORB B;  1UHI A;  3SG6 A;  1Y1U A;  2HF5 A;  1GM0 A;  4JPZ B;  1CFD A;  2MAZ A;  1SL8 A;  2KDH A;  3SG5 A;  4MZK A;  2F33 A;  4P5O E;  2K60 A;  4CLN A;  1NX0 A;  5JOL A;  1UHJ A;  1DJX A;  1XVJ A;  2PSR A;  1IJ6 A;  1A75 B;  2BBN A;  3TDU A;  1SCM C;  2BCB A;  4OV2 A;  2JC2 A;  4ORC B;  5TNC A;  1F71 A;  1S6J A;  3ICB A;  3B87 A;  5I2O A;  1OSA A;  3DVJ A;  3SIB A;  1LVC D;  3DD4 A;  4PHJ A;  1RTP 1;  2F2P A;  1LXF C;  3O2P A;  2I94 A;  1DQE A;  1NX2 A;  2NLN A;  2Q91 A;  4MRY A;  1K9U A;  2JOJ A;  1IWQ A;  1KFX L;  1NX1 A;  2KOT A;  1B8R A;  2PAL A;  3D0Y A;  2ZFD A;  2K0J A;  2QEO A;  1SSE B;  2LNK A;  3CZT X;  1TCO B;  4WQ3 A;  5CSJ A;  1NSH A;  3DVK A;  3PM8 A;  2CNP A;  1UHK A;  3WHT B;  1BF5 A;  1DJZ A;  4U8D A;  4N5X A;  2ZNE A;  1NYA A;  5I2L A;  3SG4 A;  2AUC A;  3OGN A;  3TUY B;  1A29 A;  4M2P A;  4IJ7 A;  4YI9 A;  3CAB A;  4AOM A;  2LP3 A;  1CLB A;  4USL A;  2K7O A;  1NX3 A;  1QLS A;  1DJH A;  1YRT B;  2G2B A;  1NPQ A;  2BKH B;  2LUC A;  4I5K A;  1IG5 A;  4PCW A;  3BYA A;  2JNF A;  1S1E A;  4MZJ A;  3HX4 A;  4HRG A;  1KK7 Y;  1MF8 B;  1X02 A;  2LE9 B;  2PQL A;  1AVS A;  1RWY A;  2LMT A;  3CLN A;  2JTT A;  3R72 A;  1CFC A;  4UPG A;  3A8R A;  2K61 A;  3NSK A;  2KI4 B;  4JD9 A;  5CSI A;  1EXR A;  1EG3 A;  4INW A;  1CDM A;  1BT6 A;  3PM2 A;  4L9M A;  5DIC A;  2LM5 A;  5CSF A;  1SPY A;  5KU1 A;  1DJG A;  1G8I A;  4FTG A;  5KTY A;  2I7A A;  1QAS A;  3EKJ A;  3L4L A;  3VRO A;  1DMO A;  1R2U A;  5HL1 A;  2L50 A;  3PN7 B;  1RJV A;  2O60 A;  3CR4 X;  3PAL A;  1V1F A;  1PUL A;  2WCF A;  1TIZ A;  3A4U B;  3BJH A;  1A2X A;  3EKH A;  1MUX A;  1D1O A;  1MWN A;  1VRK A;  1YX7 A;  2KI6 D;  3BUO B;  3VB1 A;  1DGV A;  4A4B A;  1QVI Y;  1W9Z A;  1BMO A;  2JT0 A;  2JZI A;  2LLS A;  5AER A;  3KHE A;  3ZWH A;  1K94 A;  3BOW A;  4C0K A;  1F8H A;  2BEC A;  4FQO A;  1B7T Y;  1IQ3 A;  4I5N B;  4MRX A;  2KBM A;  1CMF A;  3NXA A;  1GQM A;  1UUR A;  3E3R A;  3LK0 A;  1J1E A;  3O4X A;  4PHN A;  5I8N A;  2PRU A;  1IH0 A;  4YGD B;  1OZS A;  4DRW A;  2ZRS A;  2AAO A;  5D3O A;  4Q04 A;  2P71 A;  2KLE A;  1YVL A;  4PAL A;  2LHL A;  1FI6 A;  2BAP A;  2OS8 C;  1DTL A;  3IVT A;  4MN0 A;  2KFF A;  1BOD A;  2ZND A;  5D7F A;  5FYX A;  3SG3 A;  1WLM A;  1ALV A;  3B88 A;  3GK1 A;  4PHM A;  5FI7 A;  1QX7 A;  1KQM C;  1KK8 B;  1L7Z A;  3FE9 A;  1FF1 A;  3LK1 A;  1CFF A;  1OOH A;  3I5I C;  1S5G Y;  1UHH A;  3GOF A;  4GBA A;  3FIA A;  2E30 A;  1Z2C B;  4XJK A;  1NP8 A;  1OMD A;  3AAK A;  1S36 A;  3PFV A;  2HQ8 A;  1FBV A;  4JKT A;  2LUX A;  1TRF A;  3LL8 B;  2FCD A;  4A4C A;  1U5I B;  3RM1 A;  2LHI A;  5DKN A;  4MBE A;  1OE9 B;  2BKI B;  2M7L A;  2V53 A;  2BE6 A;  4GGN A;  1S3P A;  3KO0 A;  5ER5 A;  1MQ1 A;  3FE8 A;  1GGZ A;  3V2L A;  5HLO A;  3IQQ A;  4DUQ A;  2I2R E;  1JFK A;  1N2D A;  1JUO A;  2OPO A;  4HSZ A;  3K1E A;  2CCM A;  3DVM A;  3UO9 A;  1ZFS A;  3NSO A;  2RGI A;  2MLF C;  3B86 A;  1K90 D;  1H4B A;  1B4C A;  2SCP A;  5FI2 A;  1G33 A;  1C3Y A;  2M0R A;  3QME A;  3JTD B;  3R1V A;  3C1V A;  2ZRT A;  4YGB B;  2M3W A;  1PSB A;  5PAL A;  1W7J B;  2JT8 A;  1QLK A;  1CDN A;  1WLZ A;  2LAN A;  1C07 A;  1BOC A;  1L2O B;  2WOR A;  3VRP A;  1Y1A A;  4YGA A;  1NCX A;  3I5H C;  1UHN A;  4NDB A;  3KF9 A;  4GFT A;  2YGU A;  4YBH B;  2WC8 A;  3DVE A;  1NUB A;  2QDI A;  1OOI X;  1F70 A;  1BR4 B;  2BBM A;  1SK6 D;  1J55 A; 
#chains in the Genus database with same CATH homology
 1FW4 A;  2JU0 A;  3WHU B;  3GK2 A;  1TNX A;  1J7P A;  1SMG A;  3OB2 B;  1K96 A;  5CSN A;  1S6I A;  1WRZ A;  1ZAC A;  3MSE B;  1CM1 A;  2MJW B;  2OTG C;  4GPL B;  5K89 A;  2P6B B;  1KSM A;  4ZCU A;  3ZNI A;  3OX5 A;  2M49 B;  2ZN9 A;  3NSI A;  1PSR A;  4PE7 A;  4JWQ A;  2K7B A;  1OQP A;  3FWC A;  1SRA A;  4MVF A;  2M7N A;  2BL0 B;  2JXC A;  4E68 A;  3JVT C;  2GGZ A;  2FCE A;  1RK9 A;  1ALW A;  1HQV A;  1WDC C;  1XFU O;  2LVI A;  1NWD A;  3I5I B;  3SIA A;  2FJU B;  4ICB A;  1GJY A;  1K93 D;  1OZO A;  3AKA A;  4F0Z B;  4QJ4 B;  2B1U A;  3NSL A;  4NDC A;  2TN4 A;  4XYN A;  1CLM A;  2LLT A;  1A03 A;  1IGV A;  2KQY A;  2G9B A;  4WQ2 A;  1AP4 A;  1M46 A;  2GGM A;  3O4Y A;  4OVN F;  4P2Y B;  1DGU A;  1J7R A;  3K21 A;  1Y1X A;  1XK4 A;  1PVA A;  3HCM A;  4YGC B;  2ISD A;  4PE4 A;  3I5G B;  2FOT A;  4BY5 A;  1DVI A;  4OKH A;  3I5F B;  1EG4 A;  2JRF A;  3VRR A;  3TS5 C;  2NZ0 A;  1CDP A;  3DF0 B;  2ZN8 A;  3H4S E;  1S6C A;  1Q80 A;  1QX2 A;  2JPT A;  4I5L B;  5CPV A;  3EK8 A;  3OX6 A;  1SR6 C;  5AXI A;  5I2Q A;  2MHH A;  2L0P A;  3KEV A;  4C0L A;  1JBA A;  1NCZ A;  4PHK A;  1JFJ A;  1XA5 A;  3EK7 A;  3IQO A;  2EC6 C;  1B1G A;  2L2E A;  1PAL A;  1SCM B;  1KSO A;  4NDD A;  1KQV A;  3BQ3 A;  1IKU A;  1SBJ A;  2L4I A;  2QAC A;  4CPV A;  4DS7 A;  2KYC A;  1MR8 A;  1JC2 A;  3BUX B;  4CFQ A;  1SL9 A;  3TDZ A;  2EGD A;  4BY4 A;  1DT7 B;  3PLF B;  2LC5 A;  1SYM A;  1LIN A;  5HYD A;  1OOJ A;  1YX8 A;  1R6P A;  2LCP A;  5HLV A;  1B9A A;  2KBI A;  3OP0 A;  2KFG A;  1HT9 A;  1BU3 A;  2CXJ A;  1AUI B;  1M63 B;  1K95 A;  1DJY A;  3AKB A;  2QPT A;  1GGW A;  3D10 A;  2K7C A;  2BCX A;  2LVV A;  4YI8 A;  2KAV A;  4HRE E;  4N1G A;  2KAY A;  2M97 A;  4GGF A;  2LLU A;  1YTZ C;  2HQW A;  1TN4 A;  1TTX A;  3EVR A;  4NQG A;  3CS1 A;  4DIR A;  5DKR A;  2PVB A;  4ETO A;  3TUY C;  2PMY A;  1S26 D;  4HRH A;  4XJK B;  1EH2 A;  2I18 A;  4I5J A;  1E8A A;  1SKT A;  4AQJ A;  1K9K A;  2CT9 A;  1B8C A;  1CDL A;  1Y6W A;  1QTX A;  1KK7 Z;  1XFW O;  2BCA A;  1DF0 B;  2H61 A;  2KNE A;  2LAP A;  2D8N A;  2JWW A;  4DCK A;  1TNW A;  3BUM B;  3OHM B;  2M1K B;  2AMI A;  3CTN A;  3VRN A;  4MLW A;  1XK4 C;  1CLL A;  1JF0 A;  1OMV A;  3EK4 A;  4YGE B;  1H8B A;  1BJF A;  1YRU B;  4JQ0 D;  4MSP A;  1B47 A;  4WRI A;  1IJ5 A;  1A4P A;  1A75 A;  5BPJ A;  3PN7 C;  3EVU A;  3O78 A;  2KGR A;  5D69 A;  5AEQ A;  1QX5 B;  1J1D A;  1NCY A;  1KWO C;  1PK0 D;  2K7D A;  1MXL C;  1QVI Z;  2E6W A;  2IS9 A;  1W7I B;  2M8U A;  3CR5 X;  4PE1 A;  1M39 A;  1RFJ A;  1TNQ A;  1AJ5 A;  2R2I A;  4MEW A;  1QAT A;  3VGO A;  2L51 A;  1B7T Z;  1FI5 A;  1QIV A;  3CWG A;  1ODB A;  3WXA A;  1WRL A;  5GQQ C;  2OS8 B;  2JUL A;  1UP5 A;  1SL7 A;  2KHN A;  1K2H A;  3VRQ A;  1QV0 A;  1CM4 A;  1KQM B;  2DOQ A;  1UWO A;  1BG1 A;  1J7Q A;  5HKY A;  2GV5 A;  4GUK A;  3D0Y B;  2K2F A;  1CTR A;  1S5G Z;  1G4Y R;  1XFY O;  1KK8 C;  5JJG A;  1WRK A;  2JTZ A;  1M31 A;  1CFP A;  1AJ4 A;  2KI6 C;  3FWB A;  1F54 A;  2CBL A;  1CMG A;  1QS7 A;  3TDI A;  4ZCV A;  2Y1M A;  1Y0V H;  2F8P A;  2NCO A;  5J3X A;  4GGF C;  2K8M B;  1V1G A;  2KFH A;  1F4O A;  1QIW A;  2COL B;  1SCV A;  3CR2 A;  4YRU A;  2M29 A;  1ZUZ A;  2LP2 A;  2H61 C;  1K8U A;  1PVB A;  2KSP A;  1SNL A;  1XFX O;  1BLQ A;  1XYD A;  3FS7 A;  1TOP A;  3DF0 A;  1JSA A;  4OR9 B;  1SY9 A;  1YUT A;  2MLE C;  5B8I B;  4PDZ A;  1UUS A;  1WY9 A;  1MXE A;  1CNP A;  3I5H B;  3JTD C;  3F45 A;  3AAJ A;  1TCF A;  1LA0 A;  4N1F A;  5HKZ A;  1L2O C;  3SG7 A;  2LV7 A;  2LVK A;  1M45 A;  1YUU A;  2K2A A;  2NXQ A;  2MBX A;  1N0Y A;  1C7V A;  4ORA B;  5G08 A;  1KFU S;  2M1U A;  3BUW B;  2LVJ A;  1NIW A;  1KWO B;  3PAT A;  1PRW A;  1EL4 A;  3WNX B;  2A4J A;  2MRD A;  3RLZ A;  1REC A;  2ZKM X;  1XO5 A;  4M2O A;  5F6T A;  2H2K A;  2F2O A;  4AQI A;  5ER4 X;  1CB1 A;  1QV1 A;  3BOW B;  1DJI A;  2OTG B;  1AHR A;  1YUR A;  4GNK B;  3BXK A;  4OCI A;  3GK4 X;  3TZ1 A;  3IF7 A;  1JF2 A;  1XFZ O;  1C7W A;  1YUS A;  2EHB A;  2VRG A;  2HPS A;  3OB1 B;  2WND A;  1N65 A;  4D1E A;  2JXL A;  3PSR A;  1TNP A;  3KPX A;  1K9P A;  4QJ5 B;  3JVT B;  3LLE A;  3SJS A;  1JWD A;  2JNX A;  2Q4U A;  1WDC B;  1XFV O;  1YVH A;  2JQ6 A;  1F55 A;  1U5I A;  4QJ3 B;  1YR5 A;  2KQ6 A;  2KAX A;  3LCP C;  1SW8 A;  2JT3 A;  2BL0 C;  2F3Y A;  1KCY A;  3EVV A;  5IBW A;  2F3Z A;  1MHO A;  3QRX A;  3M0W A;  2Y1N A;  3SG2 A;  4GAO A;  1FPW A;  1KFX S;  1QXP A;  3O6B A;  5DKQ A;  2CTN A;  2PAS A;  2WCE A;  2MA2 A;  1OMR A;  4CID A;  1DJW A;  2NCP A;  4TNC A;  2O5G A;  4PE0 A;  1DF0 A;  2L4H A;  2SAS A;  4MZL A;  2Y4Q A;  1EJ3 A;  4C0J A;  5KSZ A;  2Y5I A;  2KI4 C;  2KYF A;  1F4Q A;  2L98 A;  5AAN A;  1CKK A;  1QJT A;  2HET A;  5HKW A;  1RRO A;  2LMV A;  3TS5 B;  1IRJ A;  1AK8 A;  3I5G C;  1LA3 A;  1LKJ A;  3CGA A;  1IQ5 A;  4M2Q A;  1ZMZ A;  2WCB A;  5AFP A;  3BUN B;  1SR6 B;  2BE4 A;  2LMU A;  2KGB C;  4CFR A;  1B8L A;  3I5F C;  1KFU L;  2WOS A;  1J7O A;  4IL1 A;  1BR1 B;  4R1E A;  2EC6 B;  1ZOT B;  2M9G A;  2L5X B;  4ORB B;  1UHI A;  3SG6 A;  1Y1U A;  2HF5 A;  4JPZ B;  1CFD A;  2MAZ A;  1SL8 A;  2KDH A;  3SG5 A;  4MZK A;  2F33 A;  4P5O E;  4CLN A;  1NX0 A;  5JOL A;  1UHJ A;  1DJX A;  1XVJ A;  2PSR A;  1IJ6 A;  1A75 B;  2BBN A;  3TDU A;  1SCM C;  2BCB A;  4OV2 A;  2JC2 A;  4ORC B;  5TNC A;  1F71 A;  1S6J A;  3ICB A;  5I2O A;  1OSA A;  3DVJ A;  3SIB A;  1LVC D;  3DD4 A;  4PHJ A;  1RTP 1;  2F2P A;  1LXF C;  3O2P A;  2I94 A;  1NX2 A;  2NLN A;  2Q91 A;  4MRY A;  1K9U A;  2JOJ A;  1IWQ A;  1KFX L;  1NX1 A;  2KOT A;  1B8R A;  2PAL A;  3D0Y A;  2ZFD A;  2K0J A;  5CSJ A;  3CZT X;  2LNK A;  4WQ3 A;  1TCO B;  1NSH A;  3DVK A;  3PM8 A;  2CNP A;  1UHK A;  3WHT B;  1BF5 A;  1DJZ A;  4U8D A;  4N5X A;  2ZNE A;  1NYA A;  5I2L A;  3SG4 A;  2AUC A;  3TUY B;  1A29 A;  4M2P A;  4YI9 A;  4AOM A;  2LP3 A;  1CLB A;  4USL A;  2K7O A;  1NX3 A;  1QLS A;  1DJH A;  1YRT B;  2G2B A;  2BKH B;  1NPQ A;  2LUC A;  4I5K A;  1IG5 A;  4PCW A;  3BYA A;  2JNF A;  1S1E A;  4MZJ A;  3HX4 A;  4HRG A;  1KK7 Y;  1MF8 B;  1X02 A;  2LE9 B;  3CLN A;  1AVS A;  1RWY A;  2LMT A;  1CFC A;  2JTT A;  4UPG A;  3A8R A;  2K61 A;  3NSK A;  2KI4 B;  5CSI A;  1EXR A;  1EG3 A;  1CDM A;  1BT6 A;  4L9M A;  2LM5 A;  5CSF A;  1SPY A;  5KU1 A;  1DJG A;  1G8I A;  4FTG A;  5KTY A;  2I7A A;  1QAS A;  3EKJ A;  1DMO A;  3VRO A;  1R2U A;  2L50 A;  3PN7 B;  1RJV A;  2O60 A;  3CR4 X;  3PAL A;  1V1F A;  1PUL A;  2WCF A;  1TIZ A;  3A4U B;  1A2X A;  3EKH A;  1MUX A;  1D1O A;  1MWN A;  1VRK A;  1YX7 A;  2KI6 D;  3BUO B;  4A4B A;  1DGV A;  1QVI Y;  2JT0 A;  1BMO A;  2JZI A;  2LLS A;  5AER A;  3KHE A;  3ZWH A;  1K94 A;  3BOW A;  4C0K A;  1F8H A;  2BEC A;  4FQO A;  1B7T Y;  1IQ3 A;  4I5N B;  4MRX A;  2KBM A;  1CMF A;  3NXA A;  1GQM A;  1UUR A;  3E3R A;  3LK0 A;  1J1E A;  4PHN A;  5I8N A;  2PRU A;  1IH0 A;  4YGD B;  1OZS A;  4DRW A;  2ZRS A;  2AAO A;  4Q04 A;  1YVL A;  4PAL A;  2LHL A;  1FI6 A;  2OS8 C;  1DTL A;  4MN0 A;  2KFF A;  1BOD A;  2ZND A;  5D7F A;  5FYX A;  3SG3 A;  1WLM A;  1ALV A;  3GK1 A;  4PHM A;  1QX7 A;  1KQM C;  1KK8 B;  1L7Z A;  1FF1 A;  3LK1 A;  1CFF A;  3I5I C;  1S5G Y;  1UHH A;  3GOF A;  4GBA A;  3FIA A;  2E30 A;  4XJK A;  1NP8 A;  1OMD A;  3AAK A;  1S36 A;  3PFV A;  2HQ8 A;  1FBV A;  2LUX A;  1TRF A;  3LL8 B;  2FCD A;  4A4C A;  1U5I B;  3RM1 A;  2LHI A;  5DKN A;  4MBE A;  1OE9 B;  2BKI B;  2M7L A;  2V53 A;  2BE6 A;  4GGN A;  1S3P A;  3KO0 A;  5ER5 A;  1MQ1 A;  1GGZ A;  5HLO A;  3IQQ A;  4DUQ A;  2I2R E;  1JFK A;  1N2D A;  1JUO A;  2OPO A;  4HSZ A;  2CCM A;  3DVM A;  1ZFS A;  3NSO A;  2RGI A;  2MLF C;  1K90 D;  1H4B A;  1B4C A;  2SCP A;  1G33 A;  2M0R A;  3JTD B;  3C1V A;  2ZRT A;  4YGB B;  2M3W A;  1PSB A;  5PAL A;  1W7J B;  2JT8 A;  1QLK A;  1CDN A;  1WLZ A;  2LAN A;  1C07 A;  1BOC A;  1L2O B;  2WOR A;  3VRP A;  1Y1A A;  4YGA A;  1NCX A;  3I5H C;  1UHN A;  4NDB A;  3KF9 A;  4GFT A;  4YBH B;  2WC8 A;  3DVE A;  1NUB A;  1F70 A;  1BR4 B;  2BBM A;  1SK6 D;  1J55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...