1RWYA

Crystal structure of rat alpha-parvalbumin at 1.05 resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
b'SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN ALPHA
publication title Crystal Structure of Rat Alpha-Parvalbumin at 1.05 Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rwyA00
2TN4A 1MXEA 2WCBA 2EC6C 3I5IB 3OHMB 2LP2A 1QTXA 1UHNA 1K2HA 1A2XA 1WRKA 1MUXA 3K21A 1DJZA 5DKNA 3IF7A 3BUOB 2L51A 5BPJA 2EHBA 2ZN8A 1EG4A 2JOJA 2LANA 1U5IB 2I18A 1IWQA 1EXRA 1OE9B 3O2PA 2K7OA 3JTDB 1ZUZA 1M63B 2ZNEA 3BYAA 4MZLA 4OV2A 1CFDA 4N5XA 1G8IA 1GGZA 1F8HA 1SR6C 3CS1A 2KBMA 5D69A 2WOSA 2M1UA 1AUIB 1HQVA 4BY4A 2OS8B 2CBLA 4MRXA 1JFJA 2MJWB 1B9AA 2KAVA 2LHLA 1C7WA 2DOQA 3EK7A 4OVNF 4CIDA 5B8IB 1KSMA 1M45A 3CR5X 1CDMA 1XVJA 4GAOA 3BUNB 2ZRSA 2KI6D 4QJ3B 4XYNA 2Y1MA 2JWWA 1DGVA 4ETOA 1X02A 2G9BA 1UHHA 1MWNA 4PE0A 2LVJA 2NCPA 1J7PA 5F6TA 4C0LA 3JVTC 4P2YB 1CKKA 1PK0D 4YI8A 2LVKA 3SG5A 1ODBA 1IQ3A 4UPGA 1PSRA 4CFRA 4DIRA 3M0WA 1H4BA 3LK1A 4PHJA 2FCEA 4ORAB 2K7BA 2M49B 1NCZA 4XJKA 3LK0A 3SIAA 1CDPA 1ALWA 1GJYA 2P6BB 3I5IC 1D1OA 1YRTB 2BBMA 1YVLA 5DKRA 1RJVA 5AERA 1PVAA 1Y6WA 4JQ0D 1DGUA 4AOMA 3CTNA 4WQ3A 1FF1A 4IL1A 3SG3A 2LP3A 2ZN9A 2KYFA 2MA2A 2WCEA 3KHEA 1YUTA 1NUBA 1S6CA 2GV5A 3AAKA 1NWDA 3IQOA 1KK7Y 1EL4A 2JNFA 3TDUA 3JTDC 4GGNA 3WNXB 2BKHB 2HF5A 1BT6A 1TN4A 1UHIA 3OX5A 1IGVA 2KYCA 1LVCD 2F3YA 4QJ4B 2M97A 1CFFA 2L0PA 2L2EA 3DF0A 2KOTA 1CLBA 2HETA 3SG7A 1J7QA 2LMUA 2OS8C 2LMTA 5CPVA 5HYDA 3PFVA 3SG4A 4CLNA 1TCOB 2KFGA 1J1DA 2H61A 5HLOA 1MR8A 1G4YR 1J55A 3CLNA 2G2BA 3VROA 1RECA 1YUUA 4NDBA 1QIVA 2CCMA 1EH2A 1KFXS 2F2PA 3VRRA 4HRGA 2F33A 1XFYO 1J1EA 2KFFA 3CR2A 5CSFA 1DT7B 2NZ0A 1K9PA 5D7FA 1RK9A 1OZOA 1A75A 1NIWA 2JTTA 1GQMA 1CTRA 2M29A 1M39A 3SG2A 2O5GA 2BKIB 5K89A 2M0RA 4NDDA 1CLLA 2CNPA 4N1FA 1TNQA 1K90D 1B1GA 1XK4A 1AHRA 3EK4A 3EVRA 1SL8A 3QRXA 2KFHA 2AMIA 2Q4UA 1B8LA 2JTZA 2F2OA 3KEVA 5HKZA 1BODA 1AVSA 1ZACA 2ZFDA 2SASA 3BUMB 3EKJA 1A4PA 3TS5B 1FI6A 2AUCA 2I94A 2VRGA 3PSRA 1TCFA 4QJ5B 1WLZA 3ZNIA 5IBWA 4ZCUA 2JT8A 2KI4B 1K8UA 2KAXA 2PALA 5AANA 4FQOA 2M8UA 3OP0A 1QV1A 1XFXO 4Q04A 2E6WA 2JULA 2PMYA 1PULA 2M9GA 2M1KB 4OR9B 4D1EA 1JFKA 2K0JA 1UHJA 4MSPA 4ICBA 1K94A 1QIWA 3D0YA 5HKYA 1AP4A 2M3WA 1CMGA 3RLZA 4OKHA 3TDIA 1XFUO 1SCVA 4DS7A 4FTGA 1W7JB 1NSHA 2HPSA 2KAYA 1CB1A 2BECA 3CR4X 1YUSA 3WHUB 1C7VA 3DVEA 1BG1A 1QJTA 1BF5A 1PSBA 1MF8B 1S6IA 2Y1NA 3FIAA 3OB2B 1GGWA 3GK2A 2WC8A 2A4JA 2JZIA 3EVUA 1XYDA 1B7TY 2H61C 4I5KA 4R1EA 3TDZA 1B8CA 1NX2A 2K7DA 1F54A 1SNLA 4YGBB 4YBHB 4P5OE 4NQGA 2MRDA 1QVIY 1UHKA 2LUXA 2RGIA 3BOWA 1K95A 3GK1A 3FWCA 3A4UB 1B47A 1K93D 2M7NA 1UURA 2O60A 2COLB 3LL8B 1BR4B 1F71A 1N65A 2NXQA 3LLEA 2ZKMX 4PHNA 1SMGA 2KBIA 1WRLA 4GNKB 3BXKA 1LXFC 2K8MB 3TS5C 1XO5A 1JBAA 1NYAA 1BR1B 1NPQA 1F4QA 1ALVA 1UP5A 2HQWA 1R6PA 1KK8B 1NP8A 2KI4C 1TTXA 1IQ5A 1DJIA 4PDZA 4XJKB 1IJ5A 3DD4A 5DKQA 1SYMA 1Y1AA 1KFUL 1IH0A 3HCMA 1BOCA 1E8AA 2B1UA 3I5GB 1LKJA 2L4HA 2BL0B 3SJSA 1WY9A 1CMFA 3KF9A 5AXIA 1KSOA 2L5XB 3ICBA 3PATA 1MHOA 2AAOA 1K96A 5KTYA 2LVIA 2LVVA 1QVIZ 2E30A 5CSIA 4PHKA 4YGDB 1S1EA 2SCPA 2KGBC 2JC2A 4MLWA 3O4YA 3AKBA 1S26D 1UUSA 4USLA 1NCYA 1CFPA 1RROA 1WDCB 1FPWA 1SKTA 4L9MA 1SRAA 1IJ6A 1KFXL 1QS7A 3MSEB 3OB1B 1DJYA 1YVHA 2JXCA 3F45A 4WQ2A 4CFQA 1BLQA 1JWDA 2BCBA 1DVIA 3GK4X 3DF0B 4MEWA 3VRNA 4YRUA 2LAPA 1PRWA 3DVJA 5CSJA 1FW4A 2M7LA 1N2DA 5AFPA 3WXAA 1ZOTB 1J7OA 3VRPA 1K9UA 1NX0A 3TZ1A 1DF0A 1A29A 1S5GY 2PASA 1W7IB 1OMDA 2L50A 3LCPC 2LLTA 3DVKA 1PVBA 1OSAA 2BE6A 1OZSA 1KK7Z 3BQ3A 4CPVA 2L4IA 5PALA 2KSPA 1YURA 2LV7A 1A75B 4PALA 2PSRA 4MZJA 1KK8C 4MVFA 1SBJA 1BMOA 2MHHA 3GOFA 2MLEC 5I2LA 1AJ4A 4TNCA 1K9KA 2PRUA 1S3PA 4ZCVA 1RTP1 3CGAA 3FWBA 3AKAA 2JNXA 3FS7A 1SL7A 4WRIA 1BU3A 1SPYA 2JU0A 3SIBA 3I5GC 2NLNA 4PE7A 2BL0C 1XFZO 1AJ5A 1ZFSA 4ORCB 4HREE 1Y1UA 4YGEB 5I2OA 1TRFA 3E3RA 4DUQA 3WHTB 1OQPA 3JVTB 3KPXA 1NX3A 3IQQA 1OMRA 3I5HB 5ER4X 4YGAA 1SCMB 1BJFA 3ZWHA 4DCKA 4GPLB 3EK8A 1SK6D 4M2QA 2NCOA 1IG5A 2ZNDA 5JOLA 4GGFA 2KQ6A 1U5IA 3EKHA 1OOJA 1QLKA 4DRWA 1WDCC 1DJGA 1FI5A 4ORBB 2KDHA 2KI6C 1S5GZ 2HQ8A 2Y4QA 3I5FB 1G33A 1V1FA 1L2OB 5KU1A 3NSLA 4I5NB 2BCXA 1CFCA 5ER5A 1QX7A 1S36A 5HLVA 1DJHA 1CDLA 2KQYA 1RFJA 2CXJA 2QACA 2JRFA 2OTGB 3A8RA 3D0YB 4N1GA 1SY9A 4BY5A 2FOTA 1ZMZA 3PLFB 1SW8A 2BBNA 3NSKA 2LNKA 3C1VA 2QPTA 1QXPA 1UWOA 5I8NA 1FBVA 2H2KA 2CTNA 1QV0A 4GBAA 1M31A 1S6JA 1SL9A 1MXLC 1OMVA 2JQ6A 1TNPA 1V1GA 4C0KA 1LINA 1F70A 2L98A 4A4CA 1KWOB 2GGMA 2LLSA 4M2OA 1N0YA 4C0JA 1KQMB 1CNPA 1IKUA 1TOPA 2R2IA 4NDCA 3BUXB 2ZRTA 3BOWB 1Q80A 1R2UA 1J7RA 5FYXA 4OCIA 3TUYB 1XK4C 2WORA 1JF0A 3SG6A 3VGOA 2K2FA 4PHMA 2Y5IA 4E68A 3O78A 4M2PA 2LC5A 2MBXA 1YX8A 4MBEA 2Q91A 1QASA 1QX5B 5AEQA 5GQQC 1DMOA 4I5JA 2OPOA 3I5HC 1SCMC 3BUWB 4JPZB 5J3XA 4PE4A 1B8RA 2V53A 1Y0VH 1JF2A 2IS9A 1PALA 1B7TZ 1YR5A 3PN7B 2LLUA 2K2AA 3I5FC 3O6BA 1JSAA 1L2OC 2FCDA 1TIZA 3CWGA 4MN0A 1MQ1A 1TNWA 1DJWA 1YX7A 1JUOA 2JT0A 1CM1A 4U8DA 2FJUB 1WLMA 2LM5A 2OTGC 1LA3A 2KNEA 3PALA 4GGFC 2JT3A 3AAJA 4I5LB 2MLFC 4PE1A 2EC6B 2F8PA 3HX4A 1Y1XA 2D8NA 4GFTA 2I2RE 1JC2A 2KGRA 4HRHA 3RM1A 2LMVA 2EGDA 1KFUS 1KCYA 2PVBA 1YRUB 3NSIA 4AQJA 4AQIA 5I2QA 2F3ZA 2GGZA 1KQVA 2LCPA 4MZKA 3PM8A 1A03A 1CLMA 1F55A 1XFVO 2K7CA 2BCAA 5G08A 3NXAA 3NSOA 1KWOC 1XA5A 1F4OA 4PCWA 2JPTA 3H4SE 3VRQA 2JXLA 3KO0A 1XFWO 1B4CA 1KQMC 1QX2A 4JWQA 2K61A 2I7AA 1TNXA 5CSNA 1HT9A 1CDNA 1SR6B 2LHIA 1DJXA 1M46A 3TUYC 2BE4A 1C07A 2LE9B 1DF0B 1EJ3A 1LA0A 1IRJA 2KHNA 1YTZC 3CZTX 5JJGA 1QATA 2MAZA 4HSZA 4F0ZB 1L7ZA 3D10A 1CM4A 2WNDA 1RWYA 5KSZA 4MRYA 4GUKA 4A4BA 2CT9A 3DVMA 2ISDA 1DTLA 1AK8A 1EG3A 1WRZA 1NCXA 3PN7C 3EVVA 3OX6A 1NX1A 2LUCA 4YI9A 1H8BA 1QLSA 5HKWA 1VRKA 5TNCA 2WCFA 4YGCB
chains in the Genus database with same CATH superfamily
2TN4A 1MXEA 2WCBA 2EC6C 3I5IB 3OHMB 2LP2A 1QTXA 1DEKA 1UHNA 1K2HA 1A2XA 1WRKA 1MUXA 3K21A 5B8IB 1DJZA 5DKNA 3L4AA 3IF7A 3S0EA 3BUOB 2L51A 5BPJA 2EHBA 3CZ2A 2ZN8A 1EG4A 2JOJA 2WCKA 2LANA 3RZSA 2PQLA 1U5IB 2JPOA 2I18A 1IWQA 1EXRA 1OE9B 3O2PA 2K7OA 3JTDB 1ZUZA 1M63B 2ZNEA 3BYAA 4MZLA 4OV2A 1CFDA 4N5XA 1G8IA 1GGZA 1F8HA 1SR6C 1C3ZA 3FE9A 3CS1A 2KBMA 4OZDA 5D69A 2WOSA 2M1UA 1AUIB 1HQVA 3DY9A 2OS8B 2CBLA 4BY4A 4MRXA 3CDNA 1JFJA 2MJWB 1B9AA 2KAVA 2LHLA 5EL2A 1C7WA 2DOQA 3EG5B 3EK7A 4OVNF 3UO9A 1KSMA 1M45A 3CR5X 4CIDA 1CDMA 1XVJA 4GAOA 3BUNB 1W9ZA 1TUJA 2ZRSA 3S0AA 2KI6D 4QJ3B 4XYNA 2Y1MA 2JWWA 1DGVA 4ETOA 1X02A 2ERBA 2G9BA 1UHHA 1MWNA 4PE0A 2LVJA 2NCPA 1J7PA 3BFHA 5F6TA 3JVTC 4C0LA 4P2YB 1CKKA 1PK0D 4YI8A 2LVKA 3SG5A 1ODBA 1IQ3A 4UPGA 1PSRA 4CFRA 4DIRA 3M0WA 1H4BA 3LK1A 4PHJA 2FCEA 4ORAB 2K7BA 2M49B 1NCZA 5FI6A 4XJKA 2QEHA 3LK0A 3SIAA 1CDPA 3R1PA 1ALWA 1GJYA 2P6BB 3I5IC 1D1OA 1YRTB 2BBMA 1YVLA 5DKRA 1RJVA 5AERA 1PVAA 2WCHA 1Y6WA 4JQ0D 1DGUA 4AOMA 3CTNA 4WQ3A 1FF1A 4IL1A 3SG3A 4F7FA 2LP3A 2ZN9A 2KYFA 3NHIA 2MA2A 2WCEA 3KHEA 1YUTA 1NUBA 1S6CA 2GV5A 1T14A 3AAKA 1NWDA 3IQOA 5FI2A 1KK7Y 1EL4A 2JNFA 3TDUA 3JTDC 4GGNA 3WNXB 2BKHB 2HF5A 1BT6A 1TN4A 1UHIA 3OX5A 1IGVA 2KYCA 1LVCD 2F3YA 4QJ4B 2M97A 1CFFA 2L0PA 2L2EA 3DF0A 2KOTA 1CLBA 2HETA 3SG7A 1J7QA 2LMUA 2OS8C 2LMTA 5CPVA 5HYDA 3PFVA 3SG4A 4CLNA 1TCOB 2KFGA 1J1DA 2H61A 5HLOA 1MR8A 1G4YR 1J55A 3CLNA 2G2BA 3VROA 1RECA 3D74A 1YUUA 4NDBA 1QIVA 2CCMA 1EH2A 1KFXS 2F2PA 3VRRA 3S0FA 4HRGA 2F33A 1XFYO 1J1EA 2KFFA 3CR2A 3DXLA 5CSFA 1DT7B 2NZ0A 1K9PA 5D7FA 1RK9A 1OZOA 1A75A 1NIWA 2JTTA 1GQMA 1CTRA 1LS8A 2M29A 1M39A 3SG2A 2O5GA 2BKIB 5K89A 2M0RA 4NDDA 1CLLA 2CNPA 4N1FA 1TNQA 1K90D 1QWVA 1B1GA 1XK4A 3BFAA 1AHRA 3EK4A 3EVRA 1SL8A 3QRXA 2KFHA 2AMIA 2Q4UA 1B8LA 2JTZA 2F2OA 3KEVA 3D76A 5HKZA 1BODA 1AVSA 1ZACA 2ZFDA 2SASA 3BUMB 3EKJA 1A4PA 3TS5B 1FI6A 1TWOA 2AUCA 2I94A 2VRGA 3PSRA 1TCFA 4QJ5B 3DZTA 1WLZA 3ZNIA 5IBWA 4ZCUA 3OGNA 2JT8A 2KI4B 1K8UA 2KAXA 2PALA 3R1OA 5AANA 4FQOA 2M8UA 3OP0A 1QV1A 1XFXO 4Q04A 2E6WA 2JULA 2PMYA 2WCLA 1PULA 1ORGA 2M1KB 2M9GA 4OR9B 4D1EA 1JFKA 2K0JA 1UHJA 4MSPA 4ICBA 1K94A 1QIWA 3D0YA 5HKYA 1AP4A 2M3WA 1CMGA 3RLZA 4OKHA 3TDIA 1XFUO 1SCVA 4DS7A 4FTGA 1W7JB 3SS5A 1NSHA 2HPSA 2BAPA 2KAYA 1CB1A 2BECA 3CR4X 1YUSA 3S0BA 3WHUB 1C7VA 3DVEA 1BG1A 1QJTA 1BF5A 1PSBA 1MF8B 1S6IA 3K1EA 1XFRA 1OOIX 2Y1NA 3FIAA 3OB2B 5FI7A 3GK2A 1GGWA 2WC8A 2A4JA 3FE8A 2JZIA 3EVUA 1XYDA 1B7TY 2H61C 4I5KA 4R1EA 3TDZA 1B8CA 1NX2A 2K7DA 1F54A 1SNLA 3D77A 4YGBB 4YBHB 4P5OE 4NQGA 2MRDA 1QVIY 1UHKA 2LUXA 2RGIA 3BOWA 1K95A 3GK1A 3FWCA 3A4UB 1B47A 1K93D 2M7NA 1UURA 2O60A 2COLB 1DQEA 3LL8B 1BR4B 1F71A 1N65A 2NXQA 3LLEA 2ZKMX 4PHNA 1SMGA 2KBIA 1WRLA 4GNKB 3BXKA 1LXFC 2K8MB 3TS5C 1XO5A 1JBAA 4INXA 1NYAA 1BR1B 1NPQA 1F4QA 1ALVA 1UP5A 2HQWA 1R6PA 3O4XA 1KK8B 2L2CA 1NP8A 2KI4C 2KLEA 1TTXA 2P71A 1IQ5A 1DJIA 4PDZA 4XJKB 1IJ5A 3DD4A 5DKQA 1SYMA 1Y1AA 1KFUL 1IH0A 3HCMA 1BOCA 1E8AA 2B1UA 3I5GB 1LKJA 2L4HA 2BL0B 3SJSA 1WY9A 2QDIA 1CMFA 3KF9A 5AXIA 1KSOA 2L5XB 3ICBA 3PATA 1MHOA 2AAOA 1K96A 2K60A 5KTYA 2LVIA 2LVVA 1QVIZ 2E30A 5CSIA 4PHKA 4YGDB 1OOGA 1S1EA 2SCPA 2KGBC 2JC2A 4MLWA 3O4YA 3AKBA 1S26D 1UUSA 4USLA 1NCYA 1P28A 1RROA 1WDCB 1CFPA 1FPWA 1SKTA 4L9MA 1SRAA 1IJ6A 1KFXL 1QS7A 3MSEB 3OB1B 1DJYA 1YVHA 2JXCA 3F45A 4WQ2A 4CFQA 1BLQA 1JWDA 2BCBA 1DVIA 3D73A 3DF0B 3GK4X 4MEWA 3VRNA 4YRUA 1C3YA 2LAPA 1OOFA 1PRWA 3DVJA 5CSJA 1FW4A 3Q8IA 2M7LA 1N2DA 2BNXA 5AFPA 3WXAA 1ZOTB 3DYEA 1J7OA 3VRPA 1K9UA 1NX0A 3TZ1A 1DF0A 3B86A 3S0GA 1Z2CB 2H8VA 1A29A 1S5GY 5I94A 2QEOA 3L47A 2PASA 1W7IB 1OMDA 2L50A 3LCPC 2LLTA 1OW4A 1PVBA 3DVKA 1OSAA 2BE6A 1OZSA 1KK7Z 3BQ3A 4CPVA 2L4IA 5PALA 2KSPA 1YURA 2LV7A 1A75B 3VB1A 1IIOA 4PALA 1DC1A 2PSRA 4MZJA 3B87A 1KK8C 4MVFA 1SBJA 2L5YA 1BMOA 2MHHA 3GOFA 2QEVA 2MLEC 5I2LA 1TUZA 1AJ4A 4TNCA 1K9KA 2PRUA 1SSEB 2GTEA 1S3PA 4ZCVA 1OOHA 1RTP1 3CGAA 3FWBA 3AKAA 2JNXA 3FS7A 1SL7A 4WRIA 1BU3A 1SPYA 2JU0A 3SIBA 3I5GC 2NLNA 3BFBA 4PE7A 2BL0C 1XFZO 1AJ5A 1ZFSA 4ORCB 4HREE 1Y1UA 4IJ7A 4YGEB 5I2OA 1TRFA 3E3RA 2FJYA 4DUQA 3WHTB 1OQPA 3JVTB 3KPXA 3N7HA 4PT1A 1NX3A 3IQQA 1OMRA 3I5HB 5ER4X 4YGAA 1SCMB 1BJFA 3ZWHA 4DCKA 3L4LA 4GPLB 3EK8A 1SK6D 4M2QA 2NCOA 1IG5A 2ZNDA 5JOLA 4GGFA 2KQ6A 1U5IA 3EKHA 1OOJA 1QLKA 4DRWA 1WDCC 1DJGA 1FI5A 4ORBB 2KDHA 2KI6C 1S5GZ 2HQ8A 2Y4QA 3I5FB 2WC6A 1G33A 1V1FA 1L2OB 4INWA 5KU1A 3NSLA 4I5NB 2BCXA 1CFCA 5ER5A 1QX7A 1S36A 5HLVA 1DJHA 1CDLA 2KQYA 1RFJA 2CXJA 2QACA 2JRFA 2OTGB 3A8RA 3D0YB 4N1GA 1SY9A 4BY5A 2FOTA 1ZMZA 3PLFB 1SW8A 2BBNA 3NSKA 3CYZA 3UNWA 2LNKA 3B7AA 3QMEA 3C1VA 2QPTA 3V2LA 1QXPA 1UWOA 5I8NA 2WCJA 1FBVA 3PJIA 2H2KA 3CZ0A 3D75A 2CTNA 1QV0A 4GBAA 1M31A 1S6JA 1Z4HA 1SL9A 4KYNA 1MXLC 3BJHA 1OMVA 2JQ6A 1TNPA 1V1GA 4C0KA 1LINA 4JKTA 2L98A 1F70A 4A4CA 1KWOB 2GGMA 2LLSA 4M2OA 1N0YA 4C0JA 1KQMB 1CNPA 1IKUA 1TOPA 2R2IA 4NDCA 3BUXB 2ZRTA 3BOWB 1Q80A 1R2UA 1J7RA 5FYXA 4OCIA 2WC5A 3TUYB 1XK4C 2WORA 1JF0A 3SG6A 3VGOA 2K2FA 4PHMA 2Y5IA 4E68A 3O78A 3SS3A 4M2PA 2LC5A 2MBXA 1YX8A 2QEBA 4MBEA 4FQTA 2Q91A 1QASA 1QX5B 5AEQA 3CZ1A 5GQQC 3FE6A 1DMOA 4I5JA 2OPOA 3I5HC 1SCMC 3BUWB 4JPZB 5J3XA 4PE4A 1B8RA 2P70A 2V53A 1Y0VH 1JF2A 2IS9A 1PALA 1B7TZ 1YR5A 3PN7B 2LLUA 2K2AA 2KPHA 3I5FC 3O6BA 1JSAA 1L2OC 2FCDA 1TIZA 3CWGA 3IVTA 4MN0A 1MQ1A 1TNWA 1DJWA 1YX7A 1JUOA 2JT0A 1CM1A 4U8DA 2FJUB 1WLMA 2LM5A 2OTGC 1LA3A 2KNEA 3PALA 3R1VA 4GGFC 2JT3A 3AAJA 4I5LB 2MLFC 4PE1A 3D78A 2EC6B 3S0DA 2F8PA 3HX4A 1Y1XA 2D8NA 3R72A 2I2RE 4GFTA 2KGRA 4HRHA 1JC2A 3NHTA 3RM1A 2LMVA 2EGDA 1KFUS 1KCYA 2PVBA 1YRUB 3NSIA 4AQJA 4AQIA 5I2QA 2F3ZA 2GGZA 1KQVA 2LCPA 4MZKA 3PM8A 1A03A 2KLDA 1CLMA 1F55A 1XFVO 3B88A 2K7CA 2BCAA 5G08A 3NXAA 3PM2A 3NSOA 1KWOC 1XA5A 1F4OA 4PCWA 2JPTA 3H4SE 3VRQA 2JXLA 3KO0A 1XFWO 1B4CA 1KQMC 1QX2A 2PYQA 4JWQA 1DELA 2K61A 2I7AA 1TNXA 5CSNA 1HT9A 1CDNA 1SR6B 2LHIA 5D3OA 1DJXA 1M46A 3TUYC 2BE4A 1C07A 3B6XA 3NGVA 2LE9B 2WCMA 1DF0B 1EJ3A 1LA0A 1IRJA 2KHNA 4JD9A 1YTZC 3CZTX 5JJGA 5DICA 1QATA 1GM0A 2MAZA 4HSZA 4F0ZB 1L7ZA 5HL1A 3D10A 1CM4A 2WNDA 1RWYA 3CABA 5KSZA 4MRYA 3OBVA 4GUKA 4A4BA 2CT9A 3DVMA 2ISDA 1DTLA 1AK8A 1EG3A 1WRZA 1NCXA 3PN7C 3EVVA 3OX6A 1NX1A 2LUCA 4YI9A 3SS4A 1H8BA 1QLSA 2YGUA 5HKWA 1VRKA 5TNCA 2WCFA 4YGCB
chains in the Genus database with same CATH topology
2TN4A 1MXEA 2WCBA 2EC6C 3I5IB 3OHMB 2LP2A 1QTXA 1UHNA 1K2HA 1A2XA 1WRKA 1MUXA 3K21A 1DJZA 5DKNA 3IF7A 3BUOB 2L51A 5BPJA 2EHBA 2ZN8A 1EG4A 2JOJA 2LANA 1U5IB 2I18A 1IWQA 1EXRA 1OE9B 3O2PA 2K7OA 3JTDB 1ZUZA 1M63B 2ZNEA 3BYAA 4MZLA 4OV2A 1CFDA 4N5XA 1G8IA 1GGZA 1F8HA 1SR6C 3CS1A 2KBMA 5D69A 2WOSA 2M1UA 1AUIB 1HQVA 4BY4A 2OS8B 2CBLA 4MRXA 1JFJA 2MJWB 1B9AA 2KAVA 2LHLA 1C7WA 2DOQA 3EK7A 4OVNF 4CIDA 5B8IB 1KSMA 1M45A 3CR5X 1CDMA 1XVJA 4GAOA 3BUNB 2ZRSA 2KI6D 4QJ3B 4XYNA 2Y1MA 2JWWA 1DGVA 4ETOA 1X02A 2G9BA 1UHHA 1MWNA 4PE0A 2LVJA 2NCPA 1J7PA 5F6TA 4C0LA 3JVTC 4P2YB 1CKKA 1PK0D 4YI8A 2LVKA 3SG5A 1ODBA 1IQ3A 4UPGA 1PSRA 4CFRA 4DIRA 3M0WA 1H4BA 3LK1A 4PHJA 2FCEA 4ORAB 2K7BA 2M49B 1NCZA 4XJKA 3LK0A 3SIAA 1CDPA 1ALWA 1GJYA 2P6BB 3I5IC 1D1OA 1YRTB 2BBMA 1YVLA 5DKRA 1RJVA 5AERA 1PVAA 1Y6WA 4JQ0D 1DGUA 4AOMA 3CTNA 4WQ3A 1FF1A 4IL1A 3SG3A 2LP3A 2ZN9A 2KYFA 2MA2A 2WCEA 3KHEA 1YUTA 1NUBA 1S6CA 2GV5A 3AAKA 1NWDA 3IQOA 1KK7Y 1EL4A 2JNFA 3TDUA 3JTDC 4GGNA 3WNXB 2BKHB 2HF5A 1BT6A 1TN4A 1UHIA 3OX5A 1IGVA 2KYCA 1LVCD 2F3YA 4QJ4B 2M97A 1CFFA 2L0PA 2L2EA 3DF0A 2KOTA 1CLBA 2HETA 3SG7A 1J7QA 2LMUA 2OS8C 2LMTA 5CPVA 5HYDA 3PFVA 3SG4A 4CLNA 1TCOB 2KFGA 1J1DA 2H61A 5HLOA 1MR8A 1G4YR 1J55A 3CLNA 2G2BA 3VROA 1RECA 1YUUA 4NDBA 1QIVA 2CCMA 1EH2A 1KFXS 2F2PA 3VRRA 4HRGA 2F33A 1XFYO 1J1EA 2KFFA 3CR2A 5CSFA 1DT7B 2NZ0A 1K9PA 5D7FA 1RK9A 1OZOA 1A75A 1NIWA 2JTTA 1GQMA 1CTRA 2M29A 1M39A 3SG2A 2O5GA 2BKIB 5K89A 2M0RA 4NDDA 1CLLA 2CNPA 4N1FA 1TNQA 1K90D 1B1GA 1XK4A 1AHRA 3EK4A 3EVRA 1SL8A 3QRXA 2KFHA 2AMIA 2Q4UA 1B8LA 2JTZA 2F2OA 3KEVA 5HKZA 1BODA 1AVSA 1ZACA 2ZFDA 2SASA 3BUMB 3EKJA 1A4PA 3TS5B 1FI6A 2AUCA 2I94A 2VRGA 3PSRA 1TCFA 4QJ5B 1WLZA 3ZNIA 5IBWA 4ZCUA 2JT8A 2KI4B 1K8UA 2KAXA 2PALA 5AANA 4FQOA 2M8UA 3OP0A 1QV1A 1XFXO 4Q04A 2E6WA 2JULA 2PMYA 1PULA 2M9GA 2M1KB 4OR9B 4D1EA 1JFKA 2K0JA 1UHJA 4MSPA 4ICBA 1K94A 1QIWA 3D0YA 5HKYA 1AP4A 2M3WA 1CMGA 3RLZA 4OKHA 3TDIA 1XFUO 1SCVA 4DS7A 4FTGA 1W7JB 1NSHA 2HPSA 2KAYA 1CB1A 2BECA 3CR4X 1YUSA 3WHUB 1C7VA 3DVEA 1BG1A 1QJTA 1BF5A 1PSBA 1MF8B 1S6IA 2Y1NA 3FIAA 3OB2B 1GGWA 3GK2A 2WC8A 2A4JA 2JZIA 3EVUA 1XYDA 1B7TY 2H61C 4I5KA 4R1EA 3TDZA 1B8CA 1NX2A 2K7DA 1F54A 1SNLA 4YGBB 4YBHB 4P5OE 4NQGA 2MRDA 1QVIY 1UHKA 2LUXA 2RGIA 3BOWA 1K95A 3GK1A 3FWCA 3A4UB 1B47A 1K93D 2M7NA 1UURA 2O60A 2COLB 3LL8B 1BR4B 1F71A 1N65A 2NXQA 3LLEA 2ZKMX 4PHNA 1SMGA 2KBIA 1WRLA 4GNKB 3BXKA 1LXFC 2K8MB 3TS5C 1XO5A 1JBAA 1NYAA 1BR1B 1NPQA 1F4QA 1ALVA 1UP5A 2HQWA 1R6PA 1KK8B 1NP8A 2KI4C 1TTXA 1IQ5A 1DJIA 4PDZA 4XJKB 1IJ5A 3DD4A 5DKQA 1SYMA 1Y1AA 1KFUL 1IH0A 3HCMA 1BOCA 1E8AA 2B1UA 3I5GB 1LKJA 2L4HA 2BL0B 3SJSA 1WY9A 1CMFA 3KF9A 5AXIA 1KSOA 2L5XB 3ICBA 3PATA 1MHOA 2AAOA 1K96A 5KTYA 2LVIA 2LVVA 1QVIZ 2E30A 5CSIA 4PHKA 4YGDB 1S1EA 2SCPA 2KGBC 2JC2A 4MLWA 3O4YA 3AKBA 1S26D 1UUSA 4USLA 1NCYA 1CFPA 1RROA 1WDCB 1FPWA 1SKTA 4L9MA 1SRAA 1IJ6A 1KFXL 1QS7A 3MSEB 3OB1B 1DJYA 1YVHA 2JXCA 3F45A 4WQ2A 4CFQA 1BLQA 1JWDA 2BCBA 1DVIA 3GK4X 3DF0B 4MEWA 3VRNA 4YRUA 2LAPA 1PRWA 3DVJA 5CSJA 1FW4A 2M7LA 1N2DA 5AFPA 3WXAA 1ZOTB 1J7OA 3VRPA 1K9UA 1NX0A 3TZ1A 1DF0A 1A29A 1S5GY 2PASA 1W7IB 1OMDA 2L50A 3LCPC 2LLTA 3DVKA 1PVBA 1OSAA 2BE6A 1OZSA 1KK7Z 3BQ3A 4CPVA 2L4IA 5PALA 2KSPA 1YURA 2LV7A 1A75B 4PALA 2PSRA 4MZJA 1KK8C 4MVFA 1SBJA 1BMOA 2MHHA 3GOFA 2MLEC 5I2LA 1AJ4A 4TNCA 1K9KA 2PRUA 1S3PA 4ZCVA 1RTP1 3CGAA 3FWBA 3AKAA 2JNXA 3FS7A 1SL7A 4WRIA 1BU3A 1SPYA 2JU0A 3SIBA 3I5GC 2NLNA 4PE7A 2BL0C 1XFZO 1AJ5A 1ZFSA 4ORCB 4HREE 1Y1UA 4YGEB 5I2OA 1TRFA 3E3RA 4DUQA 3WHTB 1OQPA 3JVTB 3KPXA 1NX3A 3IQQA 1OMRA 3I5HB 5ER4X 4YGAA 1SCMB 1BJFA 3ZWHA 4DCKA 4GPLB 3EK8A 1SK6D 4M2QA 2NCOA 1IG5A 2ZNDA 5JOLA 4GGFA 2KQ6A 1U5IA 3EKHA 1OOJA 1QLKA 4DRWA 1WDCC 1DJGA 1FI5A 4ORBB 2KDHA 2KI6C 1S5GZ 2HQ8A 2Y4QA 3I5FB 1G33A 1V1FA 1L2OB 5KU1A 3NSLA 4I5NB 2BCXA 1CFCA 5ER5A 1QX7A 1S36A 5HLVA 1DJHA 1CDLA 2KQYA 1RFJA 2CXJA 2QACA 2JRFA 2OTGB 3A8RA 3D0YB 4N1GA 1SY9A 4BY5A 2FOTA 1ZMZA 3PLFB 1SW8A 2BBNA 3NSKA 2LNKA 3C1VA 2QPTA 1QXPA 1UWOA 5I8NA 1FBVA 2H2KA 2CTNA 1QV0A 4GBAA 1M31A 1S6JA 1SL9A 1MXLC 1OMVA 2JQ6A 1TNPA 1V1GA 4C0KA 1LINA 1F70A 2L98A 4A4CA 1KWOB 2GGMA 2LLSA 4M2OA 1N0YA 4C0JA 1KQMB 1CNPA 1IKUA 1TOPA 2R2IA 4NDCA 3BUXB 2ZRTA 3BOWB 1Q80A 1R2UA 1J7RA 5FYXA 4OCIA 3TUYB 1XK4C 2WORA 1JF0A 3SG6A 3VGOA 2K2FA 4PHMA 2Y5IA 4E68A 3O78A 4M2PA 2LC5A 2MBXA 1YX8A 4MBEA 2Q91A 1QASA 1QX5B 5AEQA 5GQQC 1DMOA 4I5JA 2OPOA 3I5HC 1SCMC 3BUWB 4JPZB 5J3XA 4PE4A 1B8RA 2V53A 1Y0VH 1JF2A 2IS9A 1PALA 1B7TZ 1YR5A 3PN7B 2LLUA 2K2AA 3I5FC 3O6BA 1JSAA 1L2OC 2FCDA 1TIZA 3CWGA 4MN0A 1MQ1A 1TNWA 1DJWA 1YX7A 1JUOA 2JT0A 1CM1A 4U8DA 2FJUB 1WLMA 2LM5A 2OTGC 1LA3A 2KNEA 3PALA 4GGFC 2JT3A 3AAJA 4I5LB 2MLFC 4PE1A 2EC6B 2F8PA 3HX4A 1Y1XA 2D8NA 4GFTA 2I2RE 1JC2A 2KGRA 4HRHA 3RM1A 2LMVA 2EGDA 1KFUS 1KCYA 2PVBA 1YRUB 3NSIA 4AQJA 4AQIA 5I2QA 2F3ZA 2GGZA 1KQVA 2LCPA 4MZKA 3PM8A 1A03A 1CLMA 1F55A 1XFVO 2K7CA 2BCAA 5G08A 3NXAA 3NSOA 1KWOC 1XA5A 1F4OA 4PCWA 2JPTA 3H4SE 3VRQA 2JXLA 3KO0A 1XFWO 1B4CA 1KQMC 1QX2A 4JWQA 2K61A 2I7AA 1TNXA 5CSNA 1HT9A 1CDNA 1SR6B 2LHIA 1DJXA 1M46A 3TUYC 2BE4A 1C07A 2LE9B 1DF0B 1EJ3A 1LA0A 1IRJA 2KHNA 1YTZC 3CZTX 5JJGA 1QATA 2MAZA 4HSZA 4F0ZB 1L7ZA 3D10A 1CM4A 2WNDA 1RWYA 5KSZA 4MRYA 4GUKA 4A4BA 2CT9A 3DVMA 2ISDA 1DTLA 1AK8A 1EG3A 1WRZA 1NCXA 3PN7C 3EVVA 3OX6A 1NX1A 2LUCA 4YI9A 1H8BA 1QLSA 5HKWA 1VRKA 5TNCA 2WCFA 4YGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TN4 A;  1MXE A;  2WCB A;  2EC6 C;  3I5I B;  3OHM B;  2LP2 A;  1QTX A;  1UHN A;  1K2H A;  1A2X A;  1WRK A;  1MUX A;  3K21 A;  1DJZ A;  5DKN A;  3IF7 A;  3BUO B;  2L51 A;  5BPJ A;  2EHB A;  2ZN8 A;  1EG4 A;  2JOJ A;  2LAN A;  1U5I B;  2I18 A;  1IWQ A;  1EXR A;  1OE9 B;  3O2P A;  2K7O A;  3JTD B;  1ZUZ A;  1M63 B;  2ZNE A;  3BYA A;  4MZL A;  4OV2 A;  1CFD A;  4N5X A;  1G8I A;  1GGZ A;  1F8H A;  1SR6 C;  3CS1 A;  2KBM A;  5D69 A;  2WOS A;  2M1U A;  1AUI B;  1HQV A;  4BY4 A;  2OS8 B;  2CBL A;  4MRX A;  1JFJ A;  2MJW B;  1B9A A;  2KAV A;  2LHL A;  1C7W A;  2DOQ A;  3EK7 A;  4OVN F;  4CID A;  5B8I B;  1KSM A;  1M45 A;  3CR5 X;  1CDM A;  1XVJ A;  4GAO A;  3BUN B;  2ZRS A;  2KI6 D;  4QJ3 B;  4XYN A;  2Y1M A;  2JWW A;  1DGV A;  4ETO A;  1X02 A;  2G9B A;  1UHH A;  1MWN A;  4PE0 A;  2LVJ A;  2NCP A;  1J7P A;  5F6T A;  4C0L A;  3JVT C;  4P2Y B;  1CKK A;  1PK0 D;  4YI8 A;  2LVK A;  3SG5 A;  1ODB A;  1IQ3 A;  4UPG A;  1PSR A;  4CFR A;  4DIR A;  3M0W A;  1H4B A;  3LK1 A;  4PHJ A;  2FCE A;  4ORA B;  2K7B A;  2M49 B;  1NCZ A;  4XJK A;  3LK0 A;  3SIA A;  1CDP A;  1ALW A;  1GJY A;  2P6B B;  3I5I C;  1D1O A;  1YRT B;  2BBM A;  1YVL A;  5DKR A;  1RJV A;  5AER A;  1PVA A;  1Y6W A;  4JQ0 D;  1DGU A;  4AOM A;  3CTN A;  4WQ3 A;  1FF1 A;  4IL1 A;  3SG3 A;  2LP3 A;  2ZN9 A;  2KYF A;  2MA2 A;  2WCE A;  3KHE A;  1YUT A;  1NUB A;  1S6C A;  2GV5 A;  3AAK A;  1NWD A;  3IQO A;  1KK7 Y;  1EL4 A;  2JNF A;  3TDU A;  3JTD C;  4GGN A;  3WNX B;  2BKH B;  2HF5 A;  1BT6 A;  1TN4 A;  1UHI A;  3OX5 A;  1IGV A;  2KYC A;  1LVC D;  2F3Y A;  4QJ4 B;  2M97 A;  1CFF A;  2L0P A;  2L2E A;  3DF0 A;  2KOT A;  1CLB A;  2HET A;  3SG7 A;  1J7Q A;  2LMU A;  2OS8 C;  2LMT A;  5CPV A;  5HYD A;  3PFV A;  3SG4 A;  4CLN A;  1TCO B;  2KFG A;  1J1D A;  2H61 A;  5HLO A;  1MR8 A;  1G4Y R;  1J55 A;  3CLN A;  2G2B A;  3VRO A;  1REC A;  1YUU A;  4NDB A;  1QIV A;  2CCM A;  1EH2 A;  1KFX S;  2F2P A;  3VRR A;  4HRG A;  2F33 A;  1XFY O;  1J1E A;  2KFF A;  3CR2 A;  5CSF A;  1DT7 B;  2NZ0 A;  1K9P A;  5D7F A;  1RK9 A;  1OZO A;  1A75 A;  1NIW A;  2JTT A;  1GQM A;  1CTR A;  2M29 A;  1M39 A;  3SG2 A;  2O5G A;  2BKI B;  5K89 A;  2M0R A;  4NDD A;  1CLL A;  2CNP A;  4N1F A;  1TNQ A;  1K90 D;  1B1G A;  1XK4 A;  1AHR A;  3EK4 A;  3EVR A;  1SL8 A;  3QRX A;  2KFH A;  2AMI A;  2Q4U A;  1B8L A;  2JTZ A;  2F2O A;  3KEV A;  5HKZ A;  1BOD A;  1AVS A;  1ZAC A;  2ZFD A;  2SAS A;  3BUM B;  3EKJ A;  1A4P A;  3TS5 B;  1FI6 A;  2AUC A;  2I94 A;  2VRG A;  3PSR A;  1TCF A;  4QJ5 B;  1WLZ A;  3ZNI A;  5IBW A;  4ZCU A;  2JT8 A;  2KI4 B;  1K8U A;  2KAX A;  2PAL A;  5AAN A;  4FQO A;  2M8U A;  3OP0 A;  1QV1 A;  1XFX O;  4Q04 A;  2E6W A;  2JUL A;  2PMY A;  1PUL A;  2M9G A;  2M1K B;  4OR9 B;  4D1E A;  1JFK A;  2K0J A;  1UHJ A;  4MSP A;  4ICB A;  1K94 A;  1QIW A;  3D0Y A;  5HKY A;  1AP4 A;  2M3W A;  1CMG A;  3RLZ A;  4OKH A;  3TDI A;  1XFU O;  1SCV A;  4DS7 A;  4FTG A;  1W7J B;  1NSH A;  2HPS A;  2KAY A;  1CB1 A;  2BEC A;  3CR4 X;  1YUS A;  3WHU B;  1C7V A;  3DVE A;  1BG1 A;  1QJT A;  1BF5 A;  1PSB A;  1MF8 B;  1S6I A;  2Y1N A;  3FIA A;  3OB2 B;  1GGW A;  3GK2 A;  2WC8 A;  2A4J A;  2JZI A;  3EVU A;  1XYD A;  1B7T Y;  2H61 C;  4I5K A;  4R1E A;  3TDZ A;  1B8C A;  1NX2 A;  2K7D A;  1F54 A;  1SNL A;  4YGB B;  4YBH B;  4P5O E;  4NQG A;  2MRD A;  1QVI Y;  1UHK A;  2LUX A;  2RGI A;  3BOW A;  1K95 A;  3GK1 A;  3FWC A;  3A4U B;  1B47 A;  1K93 D;  2M7N A;  1UUR A;  2O60 A;  2COL B;  3LL8 B;  1BR4 B;  1F71 A;  1N65 A;  2NXQ A;  3LLE A;  2ZKM X;  4PHN A;  1SMG A;  2KBI A;  1WRL A;  4GNK B;  3BXK A;  1LXF C;  2K8M B;  3TS5 C;  1XO5 A;  1JBA A;  1NYA A;  1BR1 B;  1NPQ A;  1F4Q A;  1ALV A;  1UP5 A;  2HQW A;  1R6P A;  1KK8 B;  1NP8 A;  2KI4 C;  1TTX A;  1IQ5 A;  1DJI A;  4PDZ A;  4XJK B;  1IJ5 A;  3DD4 A;  5DKQ A;  1SYM A;  1Y1A A;  1KFU L;  1IH0 A;  3HCM A;  1BOC A;  1E8A A;  2B1U A;  3I5G B;  1LKJ A;  2L4H A;  2BL0 B;  3SJS A;  1WY9 A;  1CMF A;  3KF9 A;  5AXI A;  1KSO A;  2L5X B;  3ICB A;  3PAT A;  1MHO A;  2AAO A;  1K96 A;  5KTY A;  2LVI A;  2LVV A;  1QVI Z;  2E30 A;  5CSI A;  4PHK A;  4YGD B;  1S1E A;  2SCP A;  2KGB C;  2JC2 A;  4MLW A;  3O4Y A;  3AKB A;  1S26 D;  1UUS A;  4USL A;  1NCY A;  1CFP A;  1RRO A;  1WDC B;  1FPW A;  1SKT A;  4L9M A;  1SRA A;  1IJ6 A;  1KFX L;  1QS7 A;  3MSE B;  3OB1 B;  1DJY A;  1YVH A;  2JXC A;  3F45 A;  4WQ2 A;  4CFQ A;  1BLQ A;  1JWD A;  2BCB A;  1DVI A;  3GK4 X;  3DF0 B;  4MEW A;  3VRN A;  4YRU A;  2LAP A;  1PRW A;  3DVJ A;  5CSJ A;  1FW4 A;  2M7L A;  1N2D A;  5AFP A;  3WXA A;  1ZOT B;  1J7O A;  3VRP A;  1K9U A;  1NX0 A;  3TZ1 A;  1DF0 A;  1A29 A;  1S5G Y;  2PAS A;  1W7I B;  1OMD A;  2L50 A;  3LCP C;  2LLT A;  3DVK A;  1PVB A;  1OSA A;  2BE6 A;  1OZS A;  1KK7 Z;  3BQ3 A;  4CPV A;  2L4I A;  5PAL A;  2KSP A;  1YUR A;  2LV7 A;  1A75 B;  4PAL A;  2PSR A;  4MZJ A;  1KK8 C;  4MVF A;  1SBJ A;  1BMO A;  2MHH A;  3GOF A;  2MLE C;  5I2L A;  1AJ4 A;  4TNC A;  1K9K A;  2PRU A;  1S3P A;  4ZCV A;  1RTP 1;  3CGA A;  3FWB A;  3AKA A;  2JNX A;  3FS7 A;  1SL7 A;  4WRI A;  1BU3 A;  1SPY A;  2JU0 A;  3SIB A;  3I5G C;  2NLN A;  4PE7 A;  2BL0 C;  1XFZ O;  1AJ5 A;  1ZFS A;  4ORC B;  4HRE E;  1Y1U A;  4YGE B;  5I2O A;  1TRF A;  3E3R A;  4DUQ A;  3WHT B;  1OQP A;  3JVT B;  3KPX A;  1NX3 A;  3IQQ A;  1OMR A;  3I5H B;  5ER4 X;  4YGA A;  1SCM B;  1BJF A;  3ZWH A;  4DCK A;  4GPL B;  3EK8 A;  1SK6 D;  4M2Q A;  2NCO A;  1IG5 A;  2ZND A;  5JOL A;  4GGF A;  2KQ6 A;  1U5I A;  3EKH A;  1OOJ A;  1QLK A;  4DRW A;  1WDC C;  1DJG A;  1FI5 A;  4ORB B;  2KDH A;  2KI6 C;  1S5G Z;  2HQ8 A;  2Y4Q A;  3I5F B;  1G33 A;  1V1F A;  1L2O B;  5KU1 A;  3NSL A;  4I5N B;  2BCX A;  1CFC A;  5ER5 A;  1QX7 A;  1S36 A;  5HLV A;  1DJH A;  1CDL A;  2KQY A;  1RFJ A;  2CXJ A;  2QAC A;  2JRF A;  2OTG B;  3A8R A;  3D0Y B;  4N1G A;  1SY9 A;  4BY5 A;  2FOT A;  1ZMZ A;  3PLF B;  1SW8 A;  2BBN A;  3NSK A;  2LNK A;  3C1V A;  2QPT A;  1QXP A;  1UWO A;  5I8N A;  1FBV A;  2H2K A;  2CTN A;  1QV0 A;  4GBA A;  1M31 A;  1S6J A;  1SL9 A;  1MXL C;  1OMV A;  2JQ6 A;  1TNP A;  1V1G A;  4C0K A;  1LIN A;  1F70 A;  2L98 A;  4A4C A;  1KWO B;  2GGM A;  2LLS A;  4M2O A;  1N0Y A;  4C0J A;  1KQM B;  1CNP A;  1IKU A;  1TOP A;  2R2I A;  4NDC A;  3BUX B;  2ZRT A;  3BOW B;  1Q80 A;  1R2U A;  1J7R A;  5FYX A;  4OCI A;  3TUY B;  1XK4 C;  2WOR A;  1JF0 A;  3SG6 A;  3VGO A;  2K2F A;  4PHM A;  2Y5I A;  4E68 A;  3O78 A;  4M2P A;  2LC5 A;  2MBX A;  1YX8 A;  4MBE A;  2Q91 A;  1QAS A;  1QX5 B;  5AEQ A;  5GQQ C;  1DMO A;  4I5J A;  2OPO A;  3I5H C;  1SCM C;  3BUW B;  4JPZ B;  5J3X A;  4PE4 A;  1B8R A;  2V53 A;  1Y0V H;  1JF2 A;  2IS9 A;  1PAL A;  1B7T Z;  1YR5 A;  3PN7 B;  2LLU A;  2K2A A;  3I5F C;  3O6B A;  1JSA A;  1L2O C;  2FCD A;  1TIZ A;  3CWG A;  4MN0 A;  1MQ1 A;  1TNW A;  1DJW A;  1YX7 A;  1JUO A;  2JT0 A;  1CM1 A;  4U8D A;  2FJU B;  1WLM A;  2LM5 A;  2OTG C;  1LA3 A;  2KNE A;  3PAL A;  4GGF C;  2JT3 A;  3AAJ A;  4I5L B;  2MLF C;  4PE1 A;  2EC6 B;  2F8P A;  3HX4 A;  1Y1X A;  2D8N A;  4GFT A;  2I2R E;  1JC2 A;  2KGR A;  4HRH A;  3RM1 A;  2LMV A;  2EGD A;  1KFU S;  1KCY A;  2PVB A;  1YRU B;  3NSI A;  4AQJ A;  4AQI A;  5I2Q A;  2F3Z A;  2GGZ A;  1KQV A;  2LCP A;  4MZK A;  3PM8 A;  1A03 A;  1CLM A;  1F55 A;  1XFV O;  2K7C A;  2BCA A;  5G08 A;  3NXA A;  3NSO A;  1KWO C;  1XA5 A;  1F4O A;  4PCW A;  2JPT A;  3H4S E;  3VRQ A;  2JXL A;  3KO0 A;  1XFW O;  1B4C A;  1KQM C;  1QX2 A;  4JWQ A;  2K61 A;  2I7A A;  1TNX A;  5CSN A;  1HT9 A;  1CDN A;  1SR6 B;  2LHI A;  1DJX A;  1M46 A;  3TUY C;  2BE4 A;  1C07 A;  2LE9 B;  1DF0 B;  1EJ3 A;  1LA0 A;  1IRJ A;  2KHN A;  1YTZ C;  3CZT X;  5JJG A;  1QAT A;  2MAZ A;  4HSZ A;  4F0Z B;  1L7Z A;  3D10 A;  1CM4 A;  2WND A;  1RWY A;  5KSZ A;  4MRY A;  4GUK A;  4A4B A;  2CT9 A;  3DVM A;  2ISD A;  1DTL A;  1AK8 A;  1EG3 A;  1WRZ A;  1NCX A;  3PN7 C;  3EVV A;  3OX6 A;  1NX1 A;  2LUC A;  4YI9 A;  1H8B A;  1QLS A;  5HKW A;  1VRK A;  5TNC A;  2WCF A;  4YGC B; 
#chains in the Genus database with same CATH topology
 2TN4 A;  1MXE A;  2WCB A;  2EC6 C;  3I5I B;  3OHM B;  2LP2 A;  1QTX A;  1DEK A;  1UHN A;  1K2H A;  1A2X A;  1WRK A;  1MUX A;  3K21 A;  5B8I B;  1DJZ A;  5DKN A;  3L4A A;  3IF7 A;  3S0E A;  3BUO B;  2L51 A;  5BPJ A;  2EHB A;  3CZ2 A;  2ZN8 A;  1EG4 A;  2JOJ A;  2WCK A;  2LAN A;  3RZS A;  2PQL A;  1U5I B;  2JPO A;  2I18 A;  1IWQ A;  1EXR A;  1OE9 B;  3O2P A;  2K7O A;  3JTD B;  1ZUZ A;  1M63 B;  2ZNE A;  3BYA A;  4MZL A;  4OV2 A;  1CFD A;  4N5X A;  1G8I A;  1GGZ A;  1F8H A;  1SR6 C;  1C3Z A;  3FE9 A;  3CS1 A;  2KBM A;  4OZD A;  5D69 A;  2WOS A;  2M1U A;  1AUI B;  1HQV A;  3DY9 A;  2OS8 B;  2CBL A;  4BY4 A;  4MRX A;  3CDN A;  1JFJ A;  2MJW B;  1B9A A;  2KAV A;  2LHL A;  5EL2 A;  1C7W A;  2DOQ A;  3EG5 B;  3EK7 A;  4OVN F;  3UO9 A;  1KSM A;  1M45 A;  3CR5 X;  4CID A;  1CDM A;  1XVJ A;  4GAO A;  3BUN B;  1W9Z A;  1TUJ A;  2ZRS A;  3S0A A;  2KI6 D;  4QJ3 B;  4XYN A;  2Y1M A;  2JWW A;  1DGV A;  4ETO A;  1X02 A;  2ERB A;  2G9B A;  1UHH A;  1MWN A;  4PE0 A;  2LVJ A;  2NCP A;  1J7P A;  3BFH A;  5F6T A;  3JVT C;  4C0L A;  4P2Y B;  1CKK A;  1PK0 D;  4YI8 A;  2LVK A;  3SG5 A;  1ODB A;  1IQ3 A;  4UPG A;  1PSR A;  4CFR A;  4DIR A;  3M0W A;  1H4B A;  3LK1 A;  4PHJ A;  2FCE A;  4ORA B;  2K7B A;  2M49 B;  1NCZ A;  5FI6 A;  4XJK A;  2QEH A;  3LK0 A;  3SIA A;  1CDP A;  3R1P A;  1ALW A;  1GJY A;  2P6B B;  3I5I C;  1D1O A;  1YRT B;  2BBM A;  1YVL A;  5DKR A;  1RJV A;  5AER A;  1PVA A;  2WCH A;  1Y6W A;  4JQ0 D;  1DGU A;  4AOM A;  3CTN A;  4WQ3 A;  1FF1 A;  4IL1 A;  3SG3 A;  4F7F A;  2LP3 A;  2ZN9 A;  2KYF A;  3NHI A;  2MA2 A;  2WCE A;  3KHE A;  1YUT A;  1NUB A;  1S6C A;  2GV5 A;  1T14 A;  3AAK A;  1NWD A;  3IQO A;  5FI2 A;  1KK7 Y;  1EL4 A;  2JNF A;  3TDU A;  3JTD C;  4GGN A;  3WNX B;  2BKH B;  2HF5 A;  1BT6 A;  1TN4 A;  1UHI A;  3OX5 A;  1IGV A;  2KYC A;  1LVC D;  2F3Y A;  4QJ4 B;  2M97 A;  1CFF A;  2L0P A;  2L2E A;  3DF0 A;  2KOT A;  1CLB A;  2HET A;  3SG7 A;  1J7Q A;  2LMU A;  2OS8 C;  2LMT A;  5CPV A;  5HYD A;  3PFV A;  3SG4 A;  4CLN A;  1TCO B;  2KFG A;  1J1D A;  2H61 A;  5HLO A;  1MR8 A;  1G4Y R;  1J55 A;  3CLN A;  2G2B A;  3VRO A;  1REC A;  3D74 A;  1YUU A;  4NDB A;  1QIV A;  2CCM A;  1EH2 A;  1KFX S;  2F2P A;  3VRR A;  3S0F A;  4HRG A;  2F33 A;  1XFY O;  1J1E A;  2KFF A;  3CR2 A;  3DXL A;  5CSF A;  1DT7 B;  2NZ0 A;  1K9P A;  5D7F A;  1RK9 A;  1OZO A;  1A75 A;  1NIW A;  2JTT A;  1GQM A;  1CTR A;  1LS8 A;  2M29 A;  1M39 A;  3SG2 A;  2O5G A;  2BKI B;  5K89 A;  2M0R A;  4NDD A;  1CLL A;  2CNP A;  4N1F A;  1TNQ A;  1K90 D;  1QWV A;  1B1G A;  1XK4 A;  3BFA A;  1AHR A;  3EK4 A;  3EVR A;  1SL8 A;  3QRX A;  2KFH A;  2AMI A;  2Q4U A;  1B8L A;  2JTZ A;  2F2O A;  3KEV A;  3D76 A;  5HKZ A;  1BOD A;  1AVS A;  1ZAC A;  2ZFD A;  2SAS A;  3BUM B;  3EKJ A;  1A4P A;  3TS5 B;  1FI6 A;  1TWO A;  2AUC A;  2I94 A;  2VRG A;  3PSR A;  1TCF A;  4QJ5 B;  3DZT A;  1WLZ A;  3ZNI A;  5IBW A;  4ZCU A;  3OGN A;  2JT8 A;  2KI4 B;  1K8U A;  2KAX A;  2PAL A;  3R1O A;  5AAN A;  4FQO A;  2M8U A;  3OP0 A;  1QV1 A;  1XFX O;  4Q04 A;  2E6W A;  2JUL A;  2PMY A;  2WCL A;  1PUL A;  1ORG A;  2M1K B;  2M9G A;  4OR9 B;  4D1E A;  1JFK A;  2K0J A;  1UHJ A;  4MSP A;  4ICB A;  1K94 A;  1QIW A;  3D0Y A;  5HKY A;  1AP4 A;  2M3W A;  1CMG A;  3RLZ A;  4OKH A;  3TDI A;  1XFU O;  1SCV A;  4DS7 A;  4FTG A;  1W7J B;  3SS5 A;  1NSH A;  2HPS A;  2BAP A;  2KAY A;  1CB1 A;  2BEC A;  3CR4 X;  1YUS A;  3S0B A;  3WHU B;  1C7V A;  3DVE A;  1BG1 A;  1QJT A;  1BF5 A;  1PSB A;  1MF8 B;  1S6I A;  3K1E A;  1XFR A;  1OOI X;  2Y1N A;  3FIA A;  3OB2 B;  5FI7 A;  3GK2 A;  1GGW A;  2WC8 A;  2A4J A;  3FE8 A;  2JZI A;  3EVU A;  1XYD A;  1B7T Y;  2H61 C;  4I5K A;  4R1E A;  3TDZ A;  1B8C A;  1NX2 A;  2K7D A;  1F54 A;  1SNL A;  3D77 A;  4YGB B;  4YBH B;  4P5O E;  4NQG A;  2MRD A;  1QVI Y;  1UHK A;  2LUX A;  2RGI A;  3BOW A;  1K95 A;  3GK1 A;  3FWC A;  3A4U B;  1B47 A;  1K93 D;  2M7N A;  1UUR A;  2O60 A;  2COL B;  1DQE A;  3LL8 B;  1BR4 B;  1F71 A;  1N65 A;  2NXQ A;  3LLE A;  2ZKM X;  4PHN A;  1SMG A;  2KBI A;  1WRL A;  4GNK B;  3BXK A;  1LXF C;  2K8M B;  3TS5 C;  1XO5 A;  1JBA A;  4INX A;  1NYA A;  1BR1 B;  1NPQ A;  1F4Q A;  1ALV A;  1UP5 A;  2HQW A;  1R6P A;  3O4X A;  1KK8 B;  2L2C A;  1NP8 A;  2KI4 C;  2KLE A;  1TTX A;  2P71 A;  1IQ5 A;  1DJI A;  4PDZ A;  4XJK B;  1IJ5 A;  3DD4 A;  5DKQ A;  1SYM A;  1Y1A A;  1KFU L;  1IH0 A;  3HCM A;  1BOC A;  1E8A A;  2B1U A;  3I5G B;  1LKJ A;  2L4H A;  2BL0 B;  3SJS A;  1WY9 A;  2QDI A;  1CMF A;  3KF9 A;  5AXI A;  1KSO A;  2L5X B;  3ICB A;  3PAT A;  1MHO A;  2AAO A;  1K96 A;  2K60 A;  5KTY A;  2LVI A;  2LVV A;  1QVI Z;  2E30 A;  5CSI A;  4PHK A;  4YGD B;  1OOG A;  1S1E A;  2SCP A;  2KGB C;  2JC2 A;  4MLW A;  3O4Y A;  3AKB A;  1S26 D;  1UUS A;  4USL A;  1NCY A;  1P28 A;  1RRO A;  1WDC B;  1CFP A;  1FPW A;  1SKT A;  4L9M A;  1SRA A;  1IJ6 A;  1KFX L;  1QS7 A;  3MSE B;  3OB1 B;  1DJY A;  1YVH A;  2JXC A;  3F45 A;  4WQ2 A;  4CFQ A;  1BLQ A;  1JWD A;  2BCB A;  1DVI A;  3D73 A;  3DF0 B;  3GK4 X;  4MEW A;  3VRN A;  4YRU A;  1C3Y A;  2LAP A;  1OOF A;  1PRW A;  3DVJ A;  5CSJ A;  1FW4 A;  3Q8I A;  2M7L A;  1N2D A;  2BNX A;  5AFP A;  3WXA A;  1ZOT B;  3DYE A;  1J7O A;  3VRP A;  1K9U A;  1NX0 A;  3TZ1 A;  1DF0 A;  3B86 A;  3S0G A;  1Z2C B;  2H8V A;  1A29 A;  1S5G Y;  5I94 A;  2QEO A;  3L47 A;  2PAS A;  1W7I B;  1OMD A;  2L50 A;  3LCP C;  2LLT A;  1OW4 A;  1PVB A;  3DVK A;  1OSA A;  2BE6 A;  1OZS A;  1KK7 Z;  3BQ3 A;  4CPV A;  2L4I A;  5PAL A;  2KSP A;  1YUR A;  2LV7 A;  1A75 B;  3VB1 A;  1IIO A;  4PAL A;  1DC1 A;  2PSR A;  4MZJ A;  3B87 A;  1KK8 C;  4MVF A;  1SBJ A;  2L5Y A;  1BMO A;  2MHH A;  3GOF A;  2QEV A;  2MLE C;  5I2L A;  1TUZ A;  1AJ4 A;  4TNC A;  1K9K A;  2PRU A;  1SSE B;  2GTE A;  1S3P A;  4ZCV A;  1OOH A;  1RTP 1;  3CGA A;  3FWB A;  3AKA A;  2JNX A;  3FS7 A;  1SL7 A;  4WRI A;  1BU3 A;  1SPY A;  2JU0 A;  3SIB A;  3I5G C;  2NLN A;  3BFB A;  4PE7 A;  2BL0 C;  1XFZ O;  1AJ5 A;  1ZFS A;  4ORC B;  4HRE E;  1Y1U A;  4IJ7 A;  4YGE B;  5I2O A;  1TRF A;  3E3R A;  2FJY A;  4DUQ A;  3WHT B;  1OQP A;  3JVT B;  3KPX A;  3N7H A;  4PT1 A;  1NX3 A;  3IQQ A;  1OMR A;  3I5H B;  5ER4 X;  4YGA A;  1SCM B;  1BJF A;  3ZWH A;  4DCK A;  3L4L A;  4GPL B;  3EK8 A;  1SK6 D;  4M2Q A;  2NCO A;  1IG5 A;  2ZND A;  5JOL A;  4GGF A;  2KQ6 A;  1U5I A;  3EKH A;  1OOJ A;  1QLK A;  4DRW A;  1WDC C;  1DJG A;  1FI5 A;  4ORB B;  2KDH A;  2KI6 C;  1S5G Z;  2HQ8 A;  2Y4Q A;  3I5F B;  2WC6 A;  1G33 A;  1V1F A;  1L2O B;  4INW A;  5KU1 A;  3NSL A;  4I5N B;  2BCX A;  1CFC A;  5ER5 A;  1QX7 A;  1S36 A;  5HLV A;  1DJH A;  1CDL A;  2KQY A;  1RFJ A;  2CXJ A;  2QAC A;  2JRF A;  2OTG B;  3A8R A;  3D0Y B;  4N1G A;  1SY9 A;  4BY5 A;  2FOT A;  1ZMZ A;  3PLF B;  1SW8 A;  2BBN A;  3NSK A;  3CYZ A;  3UNW A;  2LNK A;  3B7A A;  3QME A;  3C1V A;  2QPT A;  3V2L A;  1QXP A;  1UWO A;  5I8N A;  2WCJ A;  1FBV A;  3PJI A;  2H2K A;  3CZ0 A;  3D75 A;  2CTN A;  1QV0 A;  4GBA A;  1M31 A;  1S6J A;  1Z4H A;  1SL9 A;  4KYN A;  1MXL C;  3BJH A;  1OMV A;  2JQ6 A;  1TNP A;  1V1G A;  4C0K A;  1LIN A;  4JKT A;  2L98 A;  1F70 A;  4A4C A;  1KWO B;  2GGM A;  2LLS A;  4M2O A;  1N0Y A;  4C0J A;  1KQM B;  1CNP A;  1IKU A;  1TOP A;  2R2I A;  4NDC A;  3BUX B;  2ZRT A;  3BOW B;  1Q80 A;  1R2U A;  1J7R A;  5FYX A;  4OCI A;  2WC5 A;  3TUY B;  1XK4 C;  2WOR A;  1JF0 A;  3SG6 A;  3VGO A;  2K2F A;  4PHM A;  2Y5I A;  4E68 A;  3O78 A;  3SS3 A;  4M2P A;  2LC5 A;  2MBX A;  1YX8 A;  2QEB A;  4MBE A;  4FQT A;  2Q91 A;  1QAS A;  1QX5 B;  5AEQ A;  3CZ1 A;  5GQQ C;  3FE6 A;  1DMO A;  4I5J A;  2OPO A;  3I5H C;  1SCM C;  3BUW B;  4JPZ B;  5J3X A;  4PE4 A;  1B8R A;  2P70 A;  2V53 A;  1Y0V H;  1JF2 A;  2IS9 A;  1PAL A;  1B7T Z;  1YR5 A;  3PN7 B;  2LLU A;  2K2A A;  2KPH A;  3I5F C;  3O6B A;  1JSA A;  1L2O C;  2FCD A;  1TIZ A;  3CWG A;  3IVT A;  4MN0 A;  1MQ1 A;  1TNW A;  1DJW A;  1YX7 A;  1JUO A;  2JT0 A;  1CM1 A;  4U8D A;  2FJU B;  1WLM A;  2LM5 A;  2OTG C;  1LA3 A;  2KNE A;  3PAL A;  3R1V A;  4GGF C;  2JT3 A;  3AAJ A;  4I5L B;  2MLF C;  4PE1 A;  3D78 A;  2EC6 B;  3S0D A;  2F8P A;  3HX4 A;  1Y1X A;  2D8N A;  3R72 A;  2I2R E;  4GFT A;  2KGR A;  4HRH A;  1JC2 A;  3NHT A;  3RM1 A;  2LMV A;  2EGD A;  1KFU S;  1KCY A;  2PVB A;  1YRU B;  3NSI A;  4AQJ A;  4AQI A;  5I2Q A;  2F3Z A;  2GGZ A;  1KQV A;  2LCP A;  4MZK A;  3PM8 A;  1A03 A;  2KLD A;  1CLM A;  1F55 A;  1XFV O;  3B88 A;  2K7C A;  2BCA A;  5G08 A;  3NXA A;  3PM2 A;  3NSO A;  1KWO C;  1XA5 A;  1F4O A;  4PCW A;  2JPT A;  3H4S E;  3VRQ A;  2JXL A;  3KO0 A;  1XFW O;  1B4C A;  1KQM C;  1QX2 A;  2PYQ A;  4JWQ A;  1DEL A;  2K61 A;  2I7A A;  1TNX A;  5CSN A;  1HT9 A;  1CDN A;  1SR6 B;  2LHI A;  5D3O A;  1DJX A;  1M46 A;  3TUY C;  2BE4 A;  1C07 A;  3B6X A;  3NGV A;  2LE9 B;  2WCM A;  1DF0 B;  1EJ3 A;  1LA0 A;  1IRJ A;  2KHN A;  4JD9 A;  1YTZ C;  3CZT X;  5JJG A;  5DIC A;  1QAT A;  1GM0 A;  2MAZ A;  4HSZ A;  4F0Z B;  1L7Z A;  5HL1 A;  3D10 A;  1CM4 A;  2WND A;  1RWY A;  3CAB A;  5KSZ A;  4MRY A;  3OBV A;  4GUK A;  4A4B A;  2CT9 A;  3DVM A;  2ISD A;  1DTL A;  1AK8 A;  1EG3 A;  1WRZ A;  1NCX A;  3PN7 C;  3EVV A;  3OX6 A;  1NX1 A;  2LUC A;  4YI9 A;  3SS4 A;  1H8B A;  1QLS A;  2YGU A;  5HKW A;  1VRK A;  5TNC A;  2WCF A;  4YGC B; 
#chains in the Genus database with same CATH homology
 2TN4 A;  1MXE A;  2WCB A;  2EC6 C;  3I5I B;  3OHM B;  2LP2 A;  1QTX A;  1UHN A;  1K2H A;  1A2X A;  1WRK A;  1MUX A;  3K21 A;  1DJZ A;  5DKN A;  3IF7 A;  3BUO B;  2L51 A;  5BPJ A;  2EHB A;  2ZN8 A;  1EG4 A;  2JOJ A;  2LAN A;  1U5I B;  2I18 A;  1IWQ A;  1EXR A;  1OE9 B;  3O2P A;  2K7O A;  3JTD B;  1ZUZ A;  1M63 B;  2ZNE A;  3BYA A;  4MZL A;  4OV2 A;  1CFD A;  4N5X A;  1G8I A;  1GGZ A;  1F8H A;  1SR6 C;  3CS1 A;  2KBM A;  5D69 A;  2WOS A;  2M1U A;  1AUI B;  1HQV A;  4BY4 A;  2OS8 B;  2CBL A;  4MRX A;  1JFJ A;  2MJW B;  1B9A A;  2KAV A;  2LHL A;  1C7W A;  2DOQ A;  3EK7 A;  4OVN F;  4CID A;  5B8I B;  1KSM A;  1M45 A;  3CR5 X;  1CDM A;  1XVJ A;  4GAO A;  3BUN B;  2ZRS A;  2KI6 D;  4QJ3 B;  4XYN A;  2Y1M A;  2JWW A;  1DGV A;  4ETO A;  1X02 A;  2G9B A;  1UHH A;  1MWN A;  4PE0 A;  2LVJ A;  2NCP A;  1J7P A;  5F6T A;  4C0L A;  3JVT C;  4P2Y B;  1CKK A;  1PK0 D;  4YI8 A;  2LVK A;  3SG5 A;  1ODB A;  1IQ3 A;  4UPG A;  1PSR A;  4CFR A;  4DIR A;  3M0W A;  1H4B A;  3LK1 A;  4PHJ A;  2FCE A;  4ORA B;  2K7B A;  2M49 B;  1NCZ A;  4XJK A;  3LK0 A;  3SIA A;  1CDP A;  1ALW A;  1GJY A;  2P6B B;  3I5I C;  1D1O A;  1YRT B;  2BBM A;  1YVL A;  5DKR A;  1RJV A;  5AER A;  1PVA A;  1Y6W A;  4JQ0 D;  1DGU A;  4AOM A;  3CTN A;  4WQ3 A;  1FF1 A;  4IL1 A;  3SG3 A;  2LP3 A;  2ZN9 A;  2KYF A;  2MA2 A;  2WCE A;  3KHE A;  1YUT A;  1NUB A;  1S6C A;  2GV5 A;  3AAK A;  1NWD A;  3IQO A;  1KK7 Y;  1EL4 A;  2JNF A;  3TDU A;  3JTD C;  4GGN A;  3WNX B;  2BKH B;  2HF5 A;  1BT6 A;  1TN4 A;  1UHI A;  3OX5 A;  1IGV A;  2KYC A;  1LVC D;  2F3Y A;  4QJ4 B;  2M97 A;  1CFF A;  2L0P A;  2L2E A;  3DF0 A;  2KOT A;  1CLB A;  2HET A;  3SG7 A;  1J7Q A;  2LMU A;  2OS8 C;  2LMT A;  5CPV A;  5HYD A;  3PFV A;  3SG4 A;  4CLN A;  1TCO B;  2KFG A;  1J1D A;  2H61 A;  5HLO A;  1MR8 A;  1G4Y R;  1J55 A;  3CLN A;  2G2B A;  3VRO A;  1REC A;  1YUU A;  4NDB A;  1QIV A;  2CCM A;  1EH2 A;  1KFX S;  2F2P A;  3VRR A;  4HRG A;  2F33 A;  1XFY O;  1J1E A;  2KFF A;  3CR2 A;  5CSF A;  1DT7 B;  2NZ0 A;  1K9P A;  5D7F A;  1RK9 A;  1OZO A;  1A75 A;  1NIW A;  2JTT A;  1GQM A;  1CTR A;  2M29 A;  1M39 A;  3SG2 A;  2O5G A;  2BKI B;  5K89 A;  2M0R A;  4NDD A;  1CLL A;  2CNP A;  4N1F A;  1TNQ A;  1K90 D;  1B1G A;  1XK4 A;  1AHR A;  3EK4 A;  3EVR A;  1SL8 A;  3QRX A;  2KFH A;  2AMI A;  2Q4U A;  1B8L A;  2JTZ A;  2F2O A;  3KEV A;  5HKZ A;  1BOD A;  1AVS A;  1ZAC A;  2ZFD A;  2SAS A;  3BUM B;  3EKJ A;  1A4P A;  3TS5 B;  1FI6 A;  2AUC A;  2I94 A;  2VRG A;  3PSR A;  1TCF A;  4QJ5 B;  1WLZ A;  3ZNI A;  5IBW A;  4ZCU A;  2JT8 A;  2KI4 B;  1K8U A;  2KAX A;  2PAL A;  5AAN A;  4FQO A;  2M8U A;  3OP0 A;  1QV1 A;  1XFX O;  4Q04 A;  2E6W A;  2JUL A;  2PMY A;  1PUL A;  2M9G A;  2M1K B;  4OR9 B;  4D1E A;  1JFK A;  2K0J A;  1UHJ A;  4MSP A;  4ICB A;  1K94 A;  1QIW A;  3D0Y A;  5HKY A;  1AP4 A;  2M3W A;  1CMG A;  3RLZ A;  4OKH A;  3TDI A;  1XFU O;  1SCV A;  4DS7 A;  4FTG A;  1W7J B;  1NSH A;  2HPS A;  2KAY A;  1CB1 A;  2BEC A;  3CR4 X;  1YUS A;  3WHU B;  1C7V A;  3DVE A;  1BG1 A;  1QJT A;  1BF5 A;  1PSB A;  1MF8 B;  1S6I A;  2Y1N A;  3FIA A;  3OB2 B;  1GGW A;  3GK2 A;  2WC8 A;  2A4J A;  2JZI A;  3EVU A;  1XYD A;  1B7T Y;  2H61 C;  4I5K A;  4R1E A;  3TDZ A;  1B8C A;  1NX2 A;  2K7D A;  1F54 A;  1SNL A;  4YGB B;  4YBH B;  4P5O E;  4NQG A;  2MRD A;  1QVI Y;  1UHK A;  2LUX A;  2RGI A;  3BOW A;  1K95 A;  3GK1 A;  3FWC A;  3A4U B;  1B47 A;  1K93 D;  2M7N A;  1UUR A;  2O60 A;  2COL B;  3LL8 B;  1BR4 B;  1F71 A;  1N65 A;  2NXQ A;  3LLE A;  2ZKM X;  4PHN A;  1SMG A;  2KBI A;  1WRL A;  4GNK B;  3BXK A;  1LXF C;  2K8M B;  3TS5 C;  1XO5 A;  1JBA A;  1NYA A;  1BR1 B;  1NPQ A;  1F4Q A;  1ALV A;  1UP5 A;  2HQW A;  1R6P A;  1KK8 B;  1NP8 A;  2KI4 C;  1TTX A;  1IQ5 A;  1DJI A;  4PDZ A;  4XJK B;  1IJ5 A;  3DD4 A;  5DKQ A;  1SYM A;  1Y1A A;  1KFU L;  1IH0 A;  3HCM A;  1BOC A;  1E8A A;  2B1U A;  3I5G B;  1LKJ A;  2L4H A;  2BL0 B;  3SJS A;  1WY9 A;  1CMF A;  3KF9 A;  5AXI A;  1KSO A;  2L5X B;  3ICB A;  3PAT A;  1MHO A;  2AAO A;  1K96 A;  5KTY A;  2LVI A;  2LVV A;  1QVI Z;  2E30 A;  5CSI A;  4PHK A;  4YGD B;  1S1E A;  2SCP A;  2KGB C;  2JC2 A;  4MLW A;  3O4Y A;  3AKB A;  1S26 D;  1UUS A;  4USL A;  1NCY A;  1CFP A;  1RRO A;  1WDC B;  1FPW A;  1SKT A;  4L9M A;  1SRA A;  1IJ6 A;  1KFX L;  1QS7 A;  3MSE B;  3OB1 B;  1DJY A;  1YVH A;  2JXC A;  3F45 A;  4WQ2 A;  4CFQ A;  1BLQ A;  1JWD A;  2BCB A;  1DVI A;  3GK4 X;  3DF0 B;  4MEW A;  3VRN A;  4YRU A;  2LAP A;  1PRW A;  3DVJ A;  5CSJ A;  1FW4 A;  2M7L A;  1N2D A;  5AFP A;  3WXA A;  1ZOT B;  1J7O A;  3VRP A;  1K9U A;  1NX0 A;  3TZ1 A;  1DF0 A;  1A29 A;  1S5G Y;  2PAS A;  1W7I B;  1OMD A;  2L50 A;  3LCP C;  2LLT A;  3DVK A;  1PVB A;  1OSA A;  2BE6 A;  1OZS A;  1KK7 Z;  3BQ3 A;  4CPV A;  2L4I A;  5PAL A;  2KSP A;  1YUR A;  2LV7 A;  1A75 B;  4PAL A;  2PSR A;  4MZJ A;  1KK8 C;  4MVF A;  1SBJ A;  1BMO A;  2MHH A;  3GOF A;  2MLE C;  5I2L A;  1AJ4 A;  4TNC A;  1K9K A;  2PRU A;  1S3P A;  4ZCV A;  1RTP 1;  3CGA A;  3FWB A;  3AKA A;  2JNX A;  3FS7 A;  1SL7 A;  4WRI A;  1BU3 A;  1SPY A;  2JU0 A;  3SIB A;  3I5G C;  2NLN A;  4PE7 A;  2BL0 C;  1XFZ O;  1AJ5 A;  1ZFS A;  4ORC B;  4HRE E;  1Y1U A;  4YGE B;  5I2O A;  1TRF A;  3E3R A;  4DUQ A;  3WHT B;  1OQP A;  3JVT B;  3KPX A;  1NX3 A;  3IQQ A;  1OMR A;  3I5H B;  5ER4 X;  4YGA A;  1SCM B;  1BJF A;  3ZWH A;  4DCK A;  4GPL B;  3EK8 A;  1SK6 D;  4M2Q A;  2NCO A;  1IG5 A;  2ZND A;  5JOL A;  4GGF A;  2KQ6 A;  1U5I A;  3EKH A;  1OOJ A;  1QLK A;  4DRW A;  1WDC C;  1DJG A;  1FI5 A;  4ORB B;  2KDH A;  2KI6 C;  1S5G Z;  2HQ8 A;  2Y4Q A;  3I5F B;  1G33 A;  1V1F A;  1L2O B;  5KU1 A;  3NSL A;  4I5N B;  2BCX A;  1CFC A;  5ER5 A;  1QX7 A;  1S36 A;  5HLV A;  1DJH A;  1CDL A;  2KQY A;  1RFJ A;  2CXJ A;  2QAC A;  2JRF A;  2OTG B;  3A8R A;  3D0Y B;  4N1G A;  1SY9 A;  4BY5 A;  2FOT A;  1ZMZ A;  3PLF B;  1SW8 A;  2BBN A;  3NSK A;  2LNK A;  3C1V A;  2QPT A;  1QXP A;  1UWO A;  5I8N A;  1FBV A;  2H2K A;  2CTN A;  1QV0 A;  4GBA A;  1M31 A;  1S6J A;  1SL9 A;  1MXL C;  1OMV A;  2JQ6 A;  1TNP A;  1V1G A;  4C0K A;  1LIN A;  1F70 A;  2L98 A;  4A4C A;  1KWO B;  2GGM A;  2LLS A;  4M2O A;  1N0Y A;  4C0J A;  1KQM B;  1CNP A;  1IKU A;  1TOP A;  2R2I A;  4NDC A;  3BUX B;  2ZRT A;  3BOW B;  1Q80 A;  1R2U A;  1J7R A;  5FYX A;  4OCI A;  3TUY B;  1XK4 C;  2WOR A;  1JF0 A;  3SG6 A;  3VGO A;  2K2F A;  4PHM A;  2Y5I A;  4E68 A;  3O78 A;  4M2P A;  2LC5 A;  2MBX A;  1YX8 A;  4MBE A;  2Q91 A;  1QAS A;  1QX5 B;  5AEQ A;  5GQQ C;  1DMO A;  4I5J A;  2OPO A;  3I5H C;  1SCM C;  3BUW B;  4JPZ B;  5J3X A;  4PE4 A;  1B8R A;  2V53 A;  1Y0V H;  1JF2 A;  2IS9 A;  1PAL A;  1B7T Z;  1YR5 A;  3PN7 B;  2LLU A;  2K2A A;  3I5F C;  3O6B A;  1JSA A;  1L2O C;  2FCD A;  1TIZ A;  3CWG A;  4MN0 A;  1MQ1 A;  1TNW A;  1DJW A;  1YX7 A;  1JUO A;  2JT0 A;  1CM1 A;  4U8D A;  2FJU B;  1WLM A;  2LM5 A;  2OTG C;  1LA3 A;  2KNE A;  3PAL A;  4GGF C;  2JT3 A;  3AAJ A;  4I5L B;  2MLF C;  4PE1 A;  2EC6 B;  2F8P A;  3HX4 A;  1Y1X A;  2D8N A;  4GFT A;  2I2R E;  1JC2 A;  2KGR A;  4HRH A;  3RM1 A;  2LMV A;  2EGD A;  1KFU S;  1KCY A;  2PVB A;  1YRU B;  3NSI A;  4AQJ A;  4AQI A;  5I2Q A;  2F3Z A;  2GGZ A;  1KQV A;  2LCP A;  4MZK A;  3PM8 A;  1A03 A;  1CLM A;  1F55 A;  1XFV O;  2K7C A;  2BCA A;  5G08 A;  3NXA A;  3NSO A;  1KWO C;  1XA5 A;  1F4O A;  4PCW A;  2JPT A;  3H4S E;  3VRQ A;  2JXL A;  3KO0 A;  1XFW O;  1B4C A;  1KQM C;  1QX2 A;  4JWQ A;  2K61 A;  2I7A A;  1TNX A;  5CSN A;  1HT9 A;  1CDN A;  1SR6 B;  2LHI A;  1DJX A;  1M46 A;  3TUY C;  2BE4 A;  1C07 A;  2LE9 B;  1DF0 B;  1EJ3 A;  1LA0 A;  1IRJ A;  2KHN A;  1YTZ C;  3CZT X;  5JJG A;  1QAT A;  2MAZ A;  4HSZ A;  4F0Z B;  1L7Z A;  3D10 A;  1CM4 A;  2WND A;  1RWY A;  5KSZ A;  4MRY A;  4GUK A;  4A4B A;  2CT9 A;  3DVM A;  2ISD A;  1DTL A;  1AK8 A;  1EG3 A;  1WRZ A;  1NCX A;  3PN7 C;  3EVV A;  3OX6 A;  1NX1 A;  2LUC A;  4YI9 A;  1H8B A;  1QLS A;  5HKW A;  1VRK A;  5TNC A;  2WCF A;  4YGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...