1RWYA

Crystal structure of rat alpha-parvalbumin at 1.05 resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN ALPHA
publication title Crystal Structure of Rat Alpha-Parvalbumin at 1.05 Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rwyA00
3CWGA 1BOCA 1DJXA 1IKUA 1QTXA 4HREE 1DJYA 2IS9A 1YURA 5GQQC 1UUSA 5AERA 1G4YR 1A29A 1CDMA 1CM1A 1SPYA 2G9BA 4CLNA 1BLQA 1B9AA 1NX0A 1UHKA 4OVNF 3TDUA 4PDZA 1KFUS 5KTYA 2OTGB 3PSRA 1VRKA 2WOSA 4PHNA 1NCYA 1IWQA 1F4QA 2RGIA 4HRHA 4PHKA 2B1UA 2BKIB 3VRPA 1CB1A 3GOFA 3VRRA 5AFPA 1BODA 3SG3A 3DD4A 1B8RA 3D0YA 1IG5A 1F55A 1NP8A 1JF2A 2E6WA 1DT7B 2M97A 2MLEC 1UWOA 3BUWB 4YI9A 1LXFC 2JT3A 2KDHA 3ICBA 1WLZA 1XO5A 2LUXA 2R2IA 3HX4A 3A4UB 1K9KA 3IQOA 1IJ5A 5ER5A 3D10A 1B8CA 4CFRA 5DKNA 1NCXA 3MSEB 2BCBA 1YUSA 4BY4A 3LCPC 4YGCB 1U5IA 5I8NA 4DS7A 1S5GY 2LHLA 1EXRA 5IBWA 1A75B 1Y1UA 2KI6C 3BUXB 1XK4A 1CLLA 2LMVA 1FI5A 1CDPA 3CR2A 1JC2A 3ZNIA 1GJYA 2GGMA 1RROA 2H61C 2L0PA 1IQ5A 1EG3A 1FF1A 1M39A 1MXEA 1EL4A 3IF7A 3DVMA 1M31A 3TZ1A 1K9PA 4PE4A 5D7FA 3ZWHA 2BBNA 1IH0A 1CM4A 1Y1XA 2WC8A 1KSOA 1YRTB 2CBLA 4GPLB 1YTZC 1CFCA 2LP2A 5CPVA 1KK8C 1K94A 1MR8A 3OX5A 1FBVA 5CSNA 3NXAA 2LMTA 2WORA 1S5GZ 2KSPA 3FWBA 4I5KA 1W7IB 2Y4QA 1M46A 3WXAA 1SBJA 3KHEA 3JVTC 3TUYC 1OMVA 2NCPA 3I5IB 1B7TY 1GGWA 4M2QA 2JPTA 1S6JA 1RJVA 3AAKA 1CFFA 1EJ3A 2O60A 1KK8B 2K61A 3TS5B 2CT9A 1YR5A 3OX6A 1LA0A 3IQQA 1K2HA 1JSAA 1HQVA 1QV1A 1S3PA 3JTDC 3JVTB 3TUYB 2MAZA 5HKWA 1YX8A 4N1GA 1HT9A 1DJHA 1BR1B 5HLVA 1A4PA 2MJWB 5KU1A 1NCZA 1UHIA 4JQ0D 1IQ3A 4HSZA 1ZOTB 2L2EA 5AANA 2KI4C 2M8UA 1AK8A 1XYDA 1PVBA 1A2XA 4YGAA 1TNQA 1A03A 1B7TZ 3WHUB 3JTDB 3AKBA 4OV2A 2HETA 3NSLA 1W7JB 5CSIA 1YUTA 2L4HA 4PE0A 1YVHA 2LVVA 3FS7A 1CFDA 1L7ZA 5CSJA 1R2UA 3CLNA 2CCMA 2F3YA 1NYAA 3I5HB 1TRFA 3DF0A 2L98A 3LK0A 1NPQA 3BQ3A 3FIAA 2LLUA 2WNDA 5AEQA 1C7WA 2M9GA 3RLZA 1OE9B 4ETOA 2LC5A 1CKKA 2JWWA 2I2RE 4WQ2A 3BUMB 4ORBB 3EKHA 1JFJA 1EG4A 1KFXL 2JRFA 5JOLA 1A75A 1NIWA 1QXPA 2CTNA 2KAYA 2OS8C 3VRNA 2I94A 2BL0C 2L5XB 2LUCA 3BYAA 3HCMA 3GK4X 3C1VA 2KBMA 1XVJA 4U8DA 2NXQA 1SL7A 1J1EA 2EGDA 4YBHB 1PVAA 2LANA 3LLEA 4WQ3A 1SYMA 2NCOA 1QASA 4UPGA 1EH2A 3OP0A 1OMRA 2LAPA 2ISDA 2KHNA 2Q91A 1N0YA 1NX2A 5J3XA 2OS8B 3DVJA 2MBXA 1F4OA 2BL0B 1UP5A 1S6IA 4ZCVA 1Y0VH 1TNXA 1UURA 1YX7A 1SW8A 3EK7A 1KWOC 2L50A 2MHHA 3PM8A 1SL9A 4MEWA 1ODBA 4IL1A 3F45A 1LINA 1CTRA 1J7PA 3CGAA 2LMUA 2SASA 2KQ6A 4PCWA 1B1GA 1KK7Y 3VROA 2KAVA 4I5NB 1K95A 3O6BA 2ZN9A 1IGVA 1N65A 1XFXO 5I2OA 1CLBA 1LKJA 1QIWA 2ZFDA 1KWOB 2KQYA 1J7QA 2MLFC 1YUUA 4NQGA 3SG5A 1B4CA 1JWDA 1QX2A 1PSBA 1RTP1 2HQ8A 2KFFA 2LCPA 2M29A 1ZFSA 4YRUA 5F6TA 2HF5A 1PALA 4R1EA 3EVRA 1SCMC 2NZ0A 4L9MA 1K93D 1BR4B 2JQ6A 3O78A 2SCPA 1CDLA 1GQMA 3O2PA 4MRXA 4PE1A 3SG7A 3WNXB 1MF8B 1FI6A 1PULA 2JXCA 3CR4X 4AQJA 1AVSA 1SL8A 2F2OA 4USLA 3OHMB 1YVLA 1TN4A 2ZKMX 1XFUO 2BCXA 4OR9B 3BUOB 1PRWA 3E3RA 1SCMB 2M49B 3GK2A 5PALA 2WCEA 3NSOA 1L2OC 2LLSA 4C0KA 4XJKB 1TNPA 1KSMA 2PMYA 1QS7A 1SK6D 3PALA 1NX3A 3SIAA 1BF5A 1F71A 4AOMA 1OSAA 1FW4A 2MA2A 2K2FA 3NSIA 3OB1B 2WCFA 1V1FA 4YI8A 2L51A 4GUKA 2LHIA 1S1EA 5TNCA 2F2PA 1XK4C 2FOTA 4GGNA 1L2OB 2F3ZA 1OMDA 2LNKA 2M7NA 4MSPA 1WRKA 2NLNA 1TOPA 4YGEB 3LK1A 2FCDA 4GNKB 2M7LA 1XFZO 2Y1MA 2CNPA 2GV5A 4NDCA 1KFXS 4GGFA 1CNPA 4ORCB 1RECA 3I5GC 4MRYA 1KCYA 1BMOA 2JZIA 4AQIA 4GFTA 1DVIA 3QRXA 2JTZA 2L4IA 1B8LA 1ZACA 2LVIA 2PSRA 3PFVA 3PN7C 4OKHA 2JNFA 3CTNA 1ZUZA 4CIDA 1QATA 1DJGA 4MZKA 4ZCUA 4N1FA 2K8MB 4MN0A 4MZLA 4MZJA 2MRDA 5I2LA 1QV0A 2JOJA 3LL8B 1S36A 2KAXA 2KI4B 2KYFA 4JWQA 1MHOA 2GGZA 1DF0B 1J1DA 3EK8A 4QJ5B 3AAJA 3PN7B 1UHJA 1DJZA 1PSRA 3TDZA 4C0LA 1SY9A 1C7VA 4BY5A 1F70A 4GBAA 1TIZA 3KO0A 1N2DA 1D1OA 2KOTA 3DVEA 1H4BA 1MWNA 2ZRTA 4HRGA 4PE7A 4PHMA 3H4SE 4TNCA 2M3WA 4F0ZB 2QPTA 1CLMA 1YRUB 2COLB 2OTGC 4DCKA 1G33A 1J7OA 4N5XA 2M0RA 2EC6C 2O5GA 1RK9A 3KF9A 1BT6A 1QJTA 2M1KB 1S26D 4M2PA 4QJ4B 1DGVA 2JULA 2WCBA 1AHRA 3EVVA 2JC2A 3NSKA 4I5LB 1QVIY 4NDBA 4MVFA 4E68A 1C07A 1CMGA 2DOQA 1CFPA 5HKZA 2QACA 1UHHA 2PASA 2LLTA 1M63B 3PLFB 4CPVA 2TN4A 4ICBA 1SRAA 2ZNEA 3EVUA 2EC6B 5BPJA 1SR6C 2KFGA 1GGZA 3BOWB 1XA5A 2H61A 4NDDA 1WDCC 3VGOA 2K7OA 1JBAA 1DMOA 4YGBB 5AXIA 1WRLA 3CS1A 4XJKA 3SG2A 2AMIA 1DJIA 1WRZA 1TTXA 2D8NA 4ORAB 3AKAA 1CMFA 2KYCA 4C0JA 2G2BA 1K8UA 5ER4X 2BE4A 1SCVA 3FWCA 2M1UA 1AUIB 2PRUA 1S6CA 2K7DA 2ZNDA 1KQVA 1E8AA 1SR6B 2JU0A 2K7BA 1JF0A 1K96A 3A8RA 2JT0A 2LM5A 3DF0B 1SMGA 1QVIZ 1WDCB 3VRQA 2HPSA 2LE9B 1ALWA 1G8IA 2KFHA 4WRIA 2KI6D 1QX5B 1TNWA 1WLMA 2JNXA 2KBIA 4DIRA 3CZTX 1XFVO 2BBMA 1NUBA 1X02A 3BXKA 1ZMZA 2HQWA 3EK4A 2I18A 1DGUA 1V1GA 2K2AA 1NWDA 2LV7A 2I7AA 1RFJA 2BKHB 1KFUL 2Y5IA 1BG1A 2CXJA 2E30A 1QX7A 2BECA 4YGDB 5CSFA 2Y1NA 1KK7Z 1NX1A 1LVCD 3EKJA 3OB2B 1F8HA 1QIVA 1XFWO 3KEVA 4DUQA 5KSZA 2JXLA 5D69A 2LVJA 3WHTB 1MUXA 2EHBA 3TDIA 1ALVA 3M0WA 2AUCA 3I5FC 2OPOA 1MQ1A 1KQMC 3D0YB 4MLWA 2KNEA 5FYXA 5JJGA 2ZRSA 2BE6A 4P2YB 1TCFA 1AJ5A 1SKTA 3I5IC 2PVBA 1J55A 3SG4A 1J7RA 1DF0A 2F8PA 2FCEA 2KGRA 2PALA 2KGBC 1K9UA 1OZSA 5G08A 1UHNA 5HKYA 1JFKA 3TS5C 3SJSA 4PALA 1CDNA 1OOJA 4A4BA 3I5FB 4Q04A 3GK1A 1KQMB 1SNLA 1Q80A 1LA3A 1OZOA 1PK0D 1WY9A 1OQPA 3SG6A 2VRGA 1U5IB 1MXLC 3K21A 3RM1A 2LVKA 1IJ6A 2Q4UA 2JTTA 4FQOA 3O4YA 3KPXA 3BUNB 1RWYA 2V53A 4D1EA 1R6PA 5B8IB 4DRWA 1Y1AA 1IRJA 1TCOB 2JT8A 2P6BB 4JPZB 1BU3A 5HLOA 1DJWA 3SIBA 1QLKA 4I5JA 1BJFA 2LP3A 5K89A 2H2KA 1B47A 3I5GB 5DKRA 4MBEA 1QLSA 1Y6WA 2F33A 3I5HC 1XFYO 3BOWA 5DKQA 2A4JA 1AP4A 4QJ3B 1FPWA 4M2OA 4CFQA 4FTGA 3DVKA 4P5OE 1M45A 4XYNA 5I2QA 2FJUB 2BCAA 1NSHA 2ZN8A 1K90D 1DTLA 2K7CA 4OCIA 4PHJA 2K0JA 4GAOA 1F54A 1H8BA 1JUOA 2AAOA 3CR5X 4GGFC 5HYDA 1AJ4A 3PATA 4A4CA
chains in the Genus database with same CATH superfamily
3CWGA 1BOCA 1DJXA 1IKUA 1QTXA 2PYQA 4HREE 1DJYA 2IS9A 1YURA 5GQQC 1UUSA 5AERA 1G4YR 3PJIA 3PM2A 1A29A 1CDMA 1CM1A 1SPYA 2G9BA 4CLNA 1BLQA 1B9AA 2GTEA 1NX0A 1UHKA 4OVNF 2P71A 4PDZA 1KFUS 3TDUA 5KTYA 2OTGB 3PSRA 1VRKA 2WOSA 4PHNA 1NCYA 1IWQA 1F4QA 2QEHA 2RGIA 3QMEA 4HRHA 3WNXB 1ORGA 4PHKA 2B1UA 2BKIB 3VRPA 1CB1A 3GOFA 2WCJA 3VRRA 5AFPA 1BODA 3SG3A 3DD4A 1B8RA 3D0YA 1IG5A 1F55A 3R1VA 1NP8A 1JF2A 2E6WA 1DT7B 2M97A 2MLEC 1UWOA 3BUWB 4YI9A 1LXFC 2JT3A 2KDHA 3ICBA 1WLZA 1XO5A 2LUXA 2R2IA 3HX4A 3A4UB 1K9KA 3IQOA 1IJ5A 5ER5A 3D10A 1B8CA 4CFRA 5DKNA 3D74A 1P28A 1NCXA 3MSEB 2BCBA 1TWOA 1YUSA 4BY4A 3LCPC 1GM0A 4YGCB 1U5IA 3SS5A 2K60A 5I8NA 4DS7A 1C3YA 1S5GY 2LHLA 1EXRA 5IBWA 1A75B 1Y1UA 2KI6C 3BUXB 1XK4A 1Z4HA 1CLLA 2LMVA 1FI5A 1CDPA 3CZ2A 3CR2A 1JC2A 3ZNIA 1GJYA 2GGMA 1RROA 2H61C 2L0PA 1IQ5A 3B86A 1EG3A 1FF1A 1M39A 1MXEA 1EL4A 3IF7A 3DVMA 1M31A 5EL2A 3TZ1A 1K9PA 4PE4A 5D7FA 3ZWHA 2BBNA 1IH0A 1CM4A 1Y1XA 2WC8A 1KSOA 1YRTB 2CBLA 4GPLB 1YTZC 1CFCA 2LP2A 5CPVA 1KK8C 1K94A 1TUZA 3DYEA 1MR8A 3OX5A 1FBVA 5CSNA 3NXAA 2LMTA 2WORA 1S5GZ 2KSPA 3FWBA 4I5KA 1W7IB 2Y4QA 1M46A 3WXAA 1SBJA 3KHEA 3JVTC 3TUYC 1OMVA 2NCPA 2QDIA 3I5IB 3IVTA 1B7TY 1GGWA 4M2QA 2JPTA 1S6JA 1RJVA 3AAKA 3B6XA 1CFFA 1EJ3A 2O60A 1KK8B 2K61A 3FE8A 3TS5B 2CT9A 2YGUA 1YR5A 3OX6A 1LA0A 3IQQA 1K2HA 1JSAA 3FE6A 1HQVA 1OOGA 1QV1A 1S3PA 2WCLA 3JTDC 3JVTB 2MAZA 5HKWA 1YX8A 3TUYB 4N1GA 1HT9A 1DJHA 1BR1B 5HLVA 3S0AA 1A4PA 2MJWB 5KU1A 1NCZA 1UHIA 3L4LA 4JQ0D 1IQ3A 3D76A 4INWA 3B7AA 1ZOTB 4HSZA 2L2EA 5AANA 2KI4C 2M8UA 2WCHA 1AK8A 1XYDA 1PVBA 1A2XA 4YGAA 3VB1A 1TNQA 1A03A 1B7TZ 3WHUB 3JTDB 3AKBA 4OV2A 2HETA 3NSLA 1W7JB 5CSIA 1YUTA 2L4HA 4PE0A 1YVHA 2LVVA 3FS7A 1CFDA 1L7ZA 1Z2CB 5CSJA 1R2UA 3CLNA 2CCMA 2F3YA 1NYAA 3I5HB 1TRFA 3DF0A 2L98A 3LK0A 1OOFA 1NPQA 3BJHA 3BQ3A 3FIAA 2LLUA 2WNDA 3UNWA 5AEQA 1C7WA 2BNXA 2M9GA 1OE9B 3RLZA 4ETOA 2LC5A 1OOHA 1CKKA 2JWWA 2I2RE 3CABA 4WQ2A 3BUMB 4ORBB 3EKHA 2QEOA 1JFJA 1EG4A 3D73A 3R72A 1KFXL 2JRFA 5JOLA 1A75A 1NIWA 1QXPA 2CTNA 2KAYA 2OS8C 3R1OA 2I94A 3VRNA 2BL0C 2L5XB 3N7HA 2WCMA 2LUCA 3BYAA 3HCMA 3GK4X 1QWVA 3C1VA 2KBMA 1XVJA 3L47A 4U8DA 2NXQA 1SL7A 1J1EA 2EGDA 1OOIX 4YBHB 1PVAA 2LANA 3LLEA 4WQ3A 1SYMA 3R1PA 2NCOA 1QASA 4UPGA 1EH2A 3OP0A 1OMRA 2LAPA 2ISDA 2KHNA 3S0GA 2Q91A 1N0YA 1NX2A 2KLDA 5J3XA 2OS8B 3DVJA 2MBXA 1F4OA 2BL0B 1UP5A 1S6IA 4ZCVA 1Y0VH 1TNXA 1UURA 1YX7A 1SW8A 3EK7A 3S0FA 2WC6A 3CDNA 1KWOC 2L50A 2MHHA 3PM8A 1SL9A 4MEWA 1ODBA 2KLEA 4IL1A 3F45A 1LINA 1CTRA 1J7PA 3CGAA 3OBVA 2LMUA 2SASA 2KQ6A 4PCWA 1B1GA 1KK7Y 3VROA 2KAVA 4I5NB 1K95A 3O6BA 2ZN9A 3V2LA 1IGVA 1N65A 1XFXO 3NGVA 5FI7A 5I2OA 1CLBA 1LKJA 1QIWA 2QEVA 2ZFDA 1KWOB 2KQYA 3B87A 2MLFC 1YUUA 4NQGA 3SG5A 1B4CA 1J7QA 1JWDA 1QX2A 1PSBA 1RTP1 2HQ8A 2KFFA 2LCPA 2M29A 1ZFSA 4YRUA 2H8VA 1DC1A 5F6TA 2HF5A 1PALA 4R1EA 3EVRA 1SCMC 2NZ0A 4L9MA 1K93D 1BR4B 2JQ6A 3O78A 2SCPA 1CDLA 1GQMA 3O2PA 4MRXA 2QEBA 4PE1A 1TUJA 1MF8B 3SG7A 1FI6A 1PULA 2JXCA 3CR4X 4AQJA 1AVSA 1SL8A 4OZDA 2F2OA 4USLA 3OHMB 1YVLA 1TN4A 2ZKMX 1W9ZA 1XFUO 2BAPA 4F7FA 2BCXA 4OR9B 3BUOB 1PRWA 3E3RA 1SCMB 2M49B 3GK2A 5PALA 2WCEA 3NSOA 1L2OC 2LLSA 2P70A 4C0KA 4XJKB 1TNPA 5DICA 1KSMA 2PMYA 1QS7A 1SK6D 3L4AA 1NX3A 3PALA 3SIAA 1BF5A 4AOMA 1OSAA 1F71A 1FW4A 2MA2A 5HL1A 2K2FA 3NSIA 3OB1B 2WCFA 1V1FA 1XFRA 2L51A 4YI8A 4GUKA 1DELA 2LHIA 1S1EA 5TNCA 3BFHA 2F2PA 1XK4C 2FOTA 4GGNA 1L2OB 2F3ZA 1OMDA 2LNKA 2M7NA 4MSPA 1WRKA 2NLNA 1TOPA 4YGEB 3LK1A 2FCDA 4GNKB 3DXLA 1XFZO 2Y1MA 2M7LA 2CNPA 2GV5A 4NDCA 3D78A 1KFXS 4GGFA 1CNPA 4ORCB 1RECA 3FE9A 3I5GC 4MRYA 1KCYA 1BMOA 2JZIA 4AQIA 4GFTA 1DVIA 3QRXA 2JTZA 2L4IA 1B8LA 1ZACA 2LVIA 2PSRA 3PFVA 2L2CA 3PN7C 4OKHA 2JNFA 3CTNA 1ZUZA 4CIDA 1QATA 1DJGA 4MZKA 4ZCUA 4N1FA 1DEKA 2K8MB 4MN0A 4MZLA 4MZJA 2ERBA 2MRDA 5I2LA 1QV0A 2JOJA 3LL8B 1S36A 2KAXA 2KI4B 2KYFA 4JWQA 1MHOA 2GGZA 3OGNA 1DF0B 1J1DA 3EK8A 4QJ5B 3AAJA 3PN7B 1UHJA 1DJZA 1LS8A 1PSRA 3TDZA 4C0LA 1SY9A 1C7VA 2FJYA 4BY5A 1F70A 4GBAA 1TIZA 3KO0A 1N2DA 1D1OA 2KOTA 3D75A 3DVEA 1MWNA 1H4BA 2ZRTA 4HRGA 4PE7A 4PHMA 1T14A 3H4SE 4TNCA 2M3WA 4F0ZB 2QPTA 1CLMA 1YRUB 2COLB 2OTGC 3CYZA 4FQTA 4DCKA 1G33A 1J7OA 4N5XA 1C3ZA 2M0RA 2EC6C 2O5GA 1RK9A 3KF9A 1BT6A 1QJTA 2M1KB 1S26D 4M2PA 3SS4A 4QJ4B 1DGVA 2JULA 2WCBA 1AHRA 3EVVA 1SSEB 2JC2A 3NSKA 4I5LB 1QVIY 4NDBA 4MVFA 4E68A 1C07A 1CMGA 2DOQA 1CFPA 5HKZA 2QACA 1UHHA 2PASA 2LLTA 1M63B 3PLFB 3UO9A 3D77A 4CPVA 2TN4A 3CZ1A 4ICBA 1SRAA 2ZNEA 3EVUA 2EC6B 5BPJA 1SR6C 2KFGA 1GGZA 3DY9A 3BOWB 1XA5A 2H61A 4NDDA 1WDCC 5D3OA 3VGOA 4IJ7A 2K7OA 1JBAA 1DMOA 4YGBB 5AXIA 3O4XA 1WRLA 3CS1A 4XJKA 3SG2A 2AMIA 1DJIA 1WRZA 1TTXA 2D8NA 4ORAB 3AKAA 4KYNA 1CMFA 2KYCA 4C0JA 2G2BA 1K8UA 5ER4X 2BE4A 1SCVA 3FWCA 2M1UA 1AUIB 2PRUA 1S6CA 2K7DA 2ZNDA 1KQVA 1E8AA 1SR6B 4PT1A 2JU0A 2K7BA 1JF0A 1K96A 3A8RA 2JT0A 2LM5A 3DF0B 1SMGA 1QVIZ 1WDCB 3VRQA 2HPSA 2LE9B 1ALWA 1G8IA 2KFHA 3NHIA 4WRIA 2KI6D 1QX5B 1TNWA 1WLMA 2JNXA 2KBIA 4JKTA 5FI6A 4DIRA 3CZTX 1XFVO 2BBMA 1NUBA 1X02A 3BXKA 3S0BA 1ZMZA 2HQWA 3EK4A 2I18A 1DGUA 1V1GA 2K2AA 1NWDA 2LV7A 2I7AA 1RFJA 2BKHB 1KFUL 2Y5IA 1BG1A 2WC5A 2CXJA 2E30A 1QX7A 2BECA 4YGDB 5CSFA 2Y1NA 1KK7Z 1NX1A 5I94A 1LVCD 3EKJA 3OB2B 1F8HA 1QIVA 1XFWO 3KEVA 4DUQA 5KSZA 2JXLA 5D69A 1IIOA 2LVJA 3WHTB 1MUXA 2EHBA 3TDIA 1ALVA 3M0WA 2AUCA 3I5FC 2OPOA 1MQ1A 1KQMC 3D0YB 4MLWA 2KNEA 5FYXA 5JJGA 2ZRSA 2BE6A 4P2YB 1TCFA 1AJ5A 1SKTA 3I5IC 2PVBA 1J55A 3SG4A 1J7RA 1DF0A 2F8PA 2FCEA 2KGRA 2PALA 2KGBC 1K9UA 1OZSA 5G08A 1UHNA 3K1EA 5HKYA 1JFKA 3TS5C 4JD9A 3SJSA 2L5YA 4PALA 3S0EA 1CDNA 1OOJA 4A4BA 3I5FB 4Q04A 3SS3A 3GK1A 1KQMB 1SNLA 1Q80A 1LA3A 1OZOA 1PK0D 1OW4A 1OQPA 1WY9A 2PQLA 2VRGA 1U5IB 3SG6A 1MXLC 3K21A 3RM1A 3NHTA 2LVKA 1IJ6A 2Q4UA 3BFBA 2JPOA 2JTTA 3B88A 3O4YA 4FQOA 3KPXA 3BUNB 1RWYA 2V53A 4INXA 4D1EA 1R6PA 5B8IB 4DRWA 1Y1AA 1IRJA 1TCOB 2JT8A 3EG5B 2P6BB 4JPZB 1BU3A 5HLOA 1DJWA 2KPHA 3SIBA 1QLKA 4I5JA 1BJFA 2LP3A 5K89A 3Q8IA 2H2KA 1B47A 3BFAA 3I5GB 3CZ0A 5DKRA 4MBEA 1QLSA 1Y6WA 2F33A 3DZTA 3I5HC 1XFYO 3BOWA 5DKQA 5FI2A 2A4JA 1AP4A 4QJ3B 1FPWA 4M2OA 4CFQA 1DQEA 4FTGA 3DVKA 4P5OE 1M45A 4XYNA 5I2QA 2FJUB 2BCAA 1NSHA 2ZN8A 1K90D 1DTLA 2K7CA 4OCIA 4PHJA 2K0JA 3S0DA 4GAOA 1F54A 1H8BA 3RZSA 1JUOA 2AAOA 2WCKA 3CR5X 4GGFC 5HYDA 1AJ4A 3PATA 4A4CA
chains in the Genus database with same CATH topology
3CWGA 1BOCA 1DJXA 1IKUA 1QTXA 4HREE 1DJYA 2IS9A 1YURA 5GQQC 1UUSA 5AERA 1G4YR 1A29A 1CDMA 1CM1A 1SPYA 2G9BA 4CLNA 1BLQA 1B9AA 1NX0A 1UHKA 4OVNF 3TDUA 4PDZA 1KFUS 5KTYA 2OTGB 3PSRA 1VRKA 2WOSA 4PHNA 1NCYA 1IWQA 1F4QA 2RGIA 4HRHA 4PHKA 2B1UA 2BKIB 3VRPA 1CB1A 3GOFA 3VRRA 5AFPA 1BODA 3SG3A 3DD4A 1B8RA 3D0YA 1IG5A 1F55A 1NP8A 1JF2A 2E6WA 1DT7B 2M97A 2MLEC 1UWOA 3BUWB 4YI9A 1LXFC 2JT3A 2KDHA 3ICBA 1WLZA 1XO5A 2LUXA 2R2IA 3HX4A 3A4UB 1K9KA 3IQOA 1IJ5A 5ER5A 3D10A 1B8CA 4CFRA 5DKNA 1NCXA 3MSEB 2BCBA 1YUSA 4BY4A 3LCPC 4YGCB 1U5IA 5I8NA 4DS7A 1S5GY 2LHLA 1EXRA 5IBWA 1A75B 1Y1UA 2KI6C 3BUXB 1XK4A 1CLLA 2LMVA 1FI5A 1CDPA 3CR2A 1JC2A 3ZNIA 1GJYA 2GGMA 1RROA 2H61C 2L0PA 1IQ5A 1EG3A 1FF1A 1M39A 1MXEA 1EL4A 3IF7A 3DVMA 1M31A 3TZ1A 1K9PA 4PE4A 5D7FA 3ZWHA 2BBNA 1IH0A 1CM4A 1Y1XA 2WC8A 1KSOA 1YRTB 2CBLA 4GPLB 1YTZC 1CFCA 2LP2A 5CPVA 1KK8C 1K94A 1MR8A 3OX5A 1FBVA 5CSNA 3NXAA 2LMTA 2WORA 1S5GZ 2KSPA 3FWBA 4I5KA 1W7IB 2Y4QA 1M46A 3WXAA 1SBJA 3KHEA 3JVTC 3TUYC 1OMVA 2NCPA 3I5IB 1B7TY 1GGWA 4M2QA 2JPTA 1S6JA 1RJVA 3AAKA 1CFFA 1EJ3A 2O60A 1KK8B 2K61A 3TS5B 2CT9A 1YR5A 3OX6A 1LA0A 3IQQA 1K2HA 1JSAA 1HQVA 1QV1A 1S3PA 3JTDC 3JVTB 3TUYB 2MAZA 5HKWA 1YX8A 4N1GA 1HT9A 1DJHA 1BR1B 5HLVA 1A4PA 2MJWB 5KU1A 1NCZA 1UHIA 4JQ0D 1IQ3A 4HSZA 1ZOTB 2L2EA 5AANA 2KI4C 2M8UA 1AK8A 1XYDA 1PVBA 1A2XA 4YGAA 1TNQA 1A03A 1B7TZ 3WHUB 3JTDB 3AKBA 4OV2A 2HETA 3NSLA 1W7JB 5CSIA 1YUTA 2L4HA 4PE0A 1YVHA 2LVVA 3FS7A 1CFDA 1L7ZA 5CSJA 1R2UA 3CLNA 2CCMA 2F3YA 1NYAA 3I5HB 1TRFA 3DF0A 2L98A 3LK0A 1NPQA 3BQ3A 3FIAA 2LLUA 2WNDA 5AEQA 1C7WA 2M9GA 3RLZA 1OE9B 4ETOA 2LC5A 1CKKA 2JWWA 2I2RE 4WQ2A 3BUMB 4ORBB 3EKHA 1JFJA 1EG4A 1KFXL 2JRFA 5JOLA 1A75A 1NIWA 1QXPA 2CTNA 2KAYA 2OS8C 3VRNA 2I94A 2BL0C 2L5XB 2LUCA 3BYAA 3HCMA 3GK4X 3C1VA 2KBMA 1XVJA 4U8DA 2NXQA 1SL7A 1J1EA 2EGDA 4YBHB 1PVAA 2LANA 3LLEA 4WQ3A 1SYMA 2NCOA 1QASA 4UPGA 1EH2A 3OP0A 1OMRA 2LAPA 2ISDA 2KHNA 2Q91A 1N0YA 1NX2A 5J3XA 2OS8B 3DVJA 2MBXA 1F4OA 2BL0B 1UP5A 1S6IA 4ZCVA 1Y0VH 1TNXA 1UURA 1YX7A 1SW8A 3EK7A 1KWOC 2L50A 2MHHA 3PM8A 1SL9A 4MEWA 1ODBA 4IL1A 3F45A 1LINA 1CTRA 1J7PA 3CGAA 2LMUA 2SASA 2KQ6A 4PCWA 1B1GA 1KK7Y 3VROA 2KAVA 4I5NB 1K95A 3O6BA 2ZN9A 1IGVA 1N65A 1XFXO 5I2OA 1CLBA 1LKJA 1QIWA 2ZFDA 1KWOB 2KQYA 1J7QA 2MLFC 1YUUA 4NQGA 3SG5A 1B4CA 1JWDA 1QX2A 1PSBA 1RTP1 2HQ8A 2KFFA 2LCPA 2M29A 1ZFSA 4YRUA 5F6TA 2HF5A 1PALA 4R1EA 3EVRA 1SCMC 2NZ0A 4L9MA 1K93D 1BR4B 2JQ6A 3O78A 2SCPA 1CDLA 1GQMA 3O2PA 4MRXA 4PE1A 3SG7A 3WNXB 1MF8B 1FI6A 1PULA 2JXCA 3CR4X 4AQJA 1AVSA 1SL8A 2F2OA 4USLA 3OHMB 1YVLA 1TN4A 2ZKMX 1XFUO 2BCXA 4OR9B 3BUOB 1PRWA 3E3RA 1SCMB 2M49B 3GK2A 5PALA 2WCEA 3NSOA 1L2OC 2LLSA 4C0KA 4XJKB 1TNPA 1KSMA 2PMYA 1QS7A 1SK6D 3PALA 1NX3A 3SIAA 1BF5A 1F71A 4AOMA 1OSAA 1FW4A 2MA2A 2K2FA 3NSIA 3OB1B 2WCFA 1V1FA 4YI8A 2L51A 4GUKA 2LHIA 1S1EA 5TNCA 2F2PA 1XK4C 2FOTA 4GGNA 1L2OB 2F3ZA 1OMDA 2LNKA 2M7NA 4MSPA 1WRKA 2NLNA 1TOPA 4YGEB 3LK1A 2FCDA 4GNKB 2M7LA 1XFZO 2Y1MA 2CNPA 2GV5A 4NDCA 1KFXS 4GGFA 1CNPA 4ORCB 1RECA 3I5GC 4MRYA 1KCYA 1BMOA 2JZIA 4AQIA 4GFTA 1DVIA 3QRXA 2JTZA 2L4IA 1B8LA 1ZACA 2LVIA 2PSRA 3PFVA 3PN7C 4OKHA 2JNFA 3CTNA 1ZUZA 4CIDA 1QATA 1DJGA 4MZKA 4ZCUA 4N1FA 2K8MB 4MN0A 4MZLA 4MZJA 2MRDA 5I2LA 1QV0A 2JOJA 3LL8B 1S36A 2KAXA 2KI4B 2KYFA 4JWQA 1MHOA 2GGZA 1DF0B 1J1DA 3EK8A 4QJ5B 3AAJA 3PN7B 1UHJA 1DJZA 1PSRA 3TDZA 4C0LA 1SY9A 1C7VA 4BY5A 1F70A 4GBAA 1TIZA 3KO0A 1N2DA 1D1OA 2KOTA 3DVEA 1H4BA 1MWNA 2ZRTA 4HRGA 4PE7A 4PHMA 3H4SE 4TNCA 2M3WA 4F0ZB 2QPTA 1CLMA 1YRUB 2COLB 2OTGC 4DCKA 1G33A 1J7OA 4N5XA 2M0RA 2EC6C 2O5GA 1RK9A 3KF9A 1BT6A 1QJTA 2M1KB 1S26D 4M2PA 4QJ4B 1DGVA 2JULA 2WCBA 1AHRA 3EVVA 2JC2A 3NSKA 4I5LB 1QVIY 4NDBA 4MVFA 4E68A 1C07A 1CMGA 2DOQA 1CFPA 5HKZA 2QACA 1UHHA 2PASA 2LLTA 1M63B 3PLFB 4CPVA 2TN4A 4ICBA 1SRAA 2ZNEA 3EVUA 2EC6B 5BPJA 1SR6C 2KFGA 1GGZA 3BOWB 1XA5A 2H61A 4NDDA 1WDCC 3VGOA 2K7OA 1JBAA 1DMOA 4YGBB 5AXIA 1WRLA 3CS1A 4XJKA 3SG2A 2AMIA 1DJIA 1WRZA 1TTXA 2D8NA 4ORAB 3AKAA 1CMFA 2KYCA 4C0JA 2G2BA 1K8UA 5ER4X 2BE4A 1SCVA 3FWCA 2M1UA 1AUIB 2PRUA 1S6CA 2K7DA 2ZNDA 1KQVA 1E8AA 1SR6B 2JU0A 2K7BA 1JF0A 1K96A 3A8RA 2JT0A 2LM5A 3DF0B 1SMGA 1QVIZ 1WDCB 3VRQA 2HPSA 2LE9B 1ALWA 1G8IA 2KFHA 4WRIA 2KI6D 1QX5B 1TNWA 1WLMA 2JNXA 2KBIA 4DIRA 3CZTX 1XFVO 2BBMA 1NUBA 1X02A 3BXKA 1ZMZA 2HQWA 3EK4A 2I18A 1DGUA 1V1GA 2K2AA 1NWDA 2LV7A 2I7AA 1RFJA 2BKHB 1KFUL 2Y5IA 1BG1A 2CXJA 2E30A 1QX7A 2BECA 4YGDB 5CSFA 2Y1NA 1KK7Z 1NX1A 1LVCD 3EKJA 3OB2B 1F8HA 1QIVA 1XFWO 3KEVA 4DUQA 5KSZA 2JXLA 5D69A 2LVJA 3WHTB 1MUXA 2EHBA 3TDIA 1ALVA 3M0WA 2AUCA 3I5FC 2OPOA 1MQ1A 1KQMC 3D0YB 4MLWA 2KNEA 5FYXA 5JJGA 2ZRSA 2BE6A 4P2YB 1TCFA 1AJ5A 1SKTA 3I5IC 2PVBA 1J55A 3SG4A 1J7RA 1DF0A 2F8PA 2FCEA 2KGRA 2PALA 2KGBC 1K9UA 1OZSA 5G08A 1UHNA 5HKYA 1JFKA 3TS5C 3SJSA 4PALA 1CDNA 1OOJA 4A4BA 3I5FB 4Q04A 3GK1A 1KQMB 1SNLA 1Q80A 1LA3A 1OZOA 1PK0D 1WY9A 1OQPA 3SG6A 2VRGA 1U5IB 1MXLC 3K21A 3RM1A 2LVKA 1IJ6A 2Q4UA 2JTTA 4FQOA 3O4YA 3KPXA 3BUNB 1RWYA 2V53A 4D1EA 1R6PA 5B8IB 4DRWA 1Y1AA 1IRJA 1TCOB 2JT8A 2P6BB 4JPZB 1BU3A 5HLOA 1DJWA 3SIBA 1QLKA 4I5JA 1BJFA 2LP3A 5K89A 2H2KA 1B47A 3I5GB 5DKRA 4MBEA 1QLSA 1Y6WA 2F33A 3I5HC 1XFYO 3BOWA 5DKQA 2A4JA 1AP4A 4QJ3B 1FPWA 4M2OA 4CFQA 4FTGA 3DVKA 4P5OE 1M45A 4XYNA 5I2QA 2FJUB 2BCAA 1NSHA 2ZN8A 1K90D 1DTLA 2K7CA 4OCIA 4PHJA 2K0JA 4GAOA 1F54A 1H8BA 1JUOA 2AAOA 3CR5X 4GGFC 5HYDA 1AJ4A 3PATA 4A4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWG A;  1BOC A;  1DJX A;  1IKU A;  1QTX A;  4HRE E;  1DJY A;  2IS9 A;  1YUR A;  5GQQ C;  1UUS A;  5AER A;  1G4Y R;  1A29 A;  1CDM A;  1CM1 A;  1SPY A;  2G9B A;  4CLN A;  1BLQ A;  1B9A A;  1NX0 A;  1UHK A;  4OVN F;  3TDU A;  4PDZ A;  1KFU S;  5KTY A;  2OTG B;  3PSR A;  1VRK A;  2WOS A;  4PHN A;  1NCY A;  1IWQ A;  1F4Q A;  2RGI A;  4HRH A;  4PHK A;  2B1U A;  2BKI B;  3VRP A;  1CB1 A;  3GOF A;  3VRR A;  5AFP A;  1BOD A;  3SG3 A;  3DD4 A;  1B8R A;  3D0Y A;  1IG5 A;  1F55 A;  1NP8 A;  1JF2 A;  2E6W A;  1DT7 B;  2M97 A;  2MLE C;  1UWO A;  3BUW B;  4YI9 A;  1LXF C;  2JT3 A;  2KDH A;  3ICB A;  1WLZ A;  1XO5 A;  2LUX A;  2R2I A;  3HX4 A;  3A4U B;  1K9K A;  3IQO A;  1IJ5 A;  5ER5 A;  3D10 A;  1B8C A;  4CFR A;  5DKN A;  1NCX A;  3MSE B;  2BCB A;  1YUS A;  4BY4 A;  3LCP C;  4YGC B;  1U5I A;  5I8N A;  4DS7 A;  1S5G Y;  2LHL A;  1EXR A;  5IBW A;  1A75 B;  1Y1U A;  2KI6 C;  3BUX B;  1XK4 A;  1CLL A;  2LMV A;  1FI5 A;  1CDP A;  3CR2 A;  1JC2 A;  3ZNI A;  1GJY A;  2GGM A;  1RRO A;  2H61 C;  2L0P A;  1IQ5 A;  1EG3 A;  1FF1 A;  1M39 A;  1MXE A;  1EL4 A;  3IF7 A;  3DVM A;  1M31 A;  3TZ1 A;  1K9P A;  4PE4 A;  5D7F A;  3ZWH A;  2BBN A;  1IH0 A;  1CM4 A;  1Y1X A;  2WC8 A;  1KSO A;  1YRT B;  2CBL A;  4GPL B;  1YTZ C;  1CFC A;  2LP2 A;  5CPV A;  1KK8 C;  1K94 A;  1MR8 A;  3OX5 A;  1FBV A;  5CSN A;  3NXA A;  2LMT A;  2WOR A;  1S5G Z;  2KSP A;  3FWB A;  4I5K A;  1W7I B;  2Y4Q A;  1M46 A;  3WXA A;  1SBJ A;  3KHE A;  3JVT C;  3TUY C;  1OMV A;  2NCP A;  3I5I B;  1B7T Y;  1GGW A;  4M2Q A;  2JPT A;  1S6J A;  1RJV A;  3AAK A;  1CFF A;  1EJ3 A;  2O60 A;  1KK8 B;  2K61 A;  3TS5 B;  2CT9 A;  1YR5 A;  3OX6 A;  1LA0 A;  3IQQ A;  1K2H A;  1JSA A;  1HQV A;  1QV1 A;  1S3P A;  3JTD C;  3JVT B;  3TUY B;  2MAZ A;  5HKW A;  1YX8 A;  4N1G A;  1HT9 A;  1DJH A;  1BR1 B;  5HLV A;  1A4P A;  2MJW B;  5KU1 A;  1NCZ A;  1UHI A;  4JQ0 D;  1IQ3 A;  4HSZ A;  1ZOT B;  2L2E A;  5AAN A;  2KI4 C;  2M8U A;  1AK8 A;  1XYD A;  1PVB A;  1A2X A;  4YGA A;  1TNQ A;  1A03 A;  1B7T Z;  3WHU B;  3JTD B;  3AKB A;  4OV2 A;  2HET A;  3NSL A;  1W7J B;  5CSI A;  1YUT A;  2L4H A;  4PE0 A;  1YVH A;  2LVV A;  3FS7 A;  1CFD A;  1L7Z A;  5CSJ A;  1R2U A;  3CLN A;  2CCM A;  2F3Y A;  1NYA A;  3I5H B;  1TRF A;  3DF0 A;  2L98 A;  3LK0 A;  1NPQ A;  3BQ3 A;  3FIA A;  2LLU A;  2WND A;  5AEQ A;  1C7W A;  2M9G A;  3RLZ A;  1OE9 B;  4ETO A;  2LC5 A;  1CKK A;  2JWW A;  2I2R E;  4WQ2 A;  3BUM B;  4ORB B;  3EKH A;  1JFJ A;  1EG4 A;  1KFX L;  2JRF A;  5JOL A;  1A75 A;  1NIW A;  1QXP A;  2CTN A;  2KAY A;  2OS8 C;  3VRN A;  2I94 A;  2BL0 C;  2L5X B;  2LUC A;  3BYA A;  3HCM A;  3GK4 X;  3C1V A;  2KBM A;  1XVJ A;  4U8D A;  2NXQ A;  1SL7 A;  1J1E A;  2EGD A;  4YBH B;  1PVA A;  2LAN A;  3LLE A;  4WQ3 A;  1SYM A;  2NCO A;  1QAS A;  4UPG A;  1EH2 A;  3OP0 A;  1OMR A;  2LAP A;  2ISD A;  2KHN A;  2Q91 A;  1N0Y A;  1NX2 A;  5J3X A;  2OS8 B;  3DVJ A;  2MBX A;  1F4O A;  2BL0 B;  1UP5 A;  1S6I A;  4ZCV A;  1Y0V H;  1TNX A;  1UUR A;  1YX7 A;  1SW8 A;  3EK7 A;  1KWO C;  2L50 A;  2MHH A;  3PM8 A;  1SL9 A;  4MEW A;  1ODB A;  4IL1 A;  3F45 A;  1LIN A;  1CTR A;  1J7P A;  3CGA A;  2LMU A;  2SAS A;  2KQ6 A;  4PCW A;  1B1G A;  1KK7 Y;  3VRO A;  2KAV A;  4I5N B;  1K95 A;  3O6B A;  2ZN9 A;  1IGV A;  1N65 A;  1XFX O;  5I2O A;  1CLB A;  1LKJ A;  1QIW A;  2ZFD A;  1KWO B;  2KQY A;  1J7Q A;  2MLF C;  1YUU A;  4NQG A;  3SG5 A;  1B4C A;  1JWD A;  1QX2 A;  1PSB A;  1RTP 1;  2HQ8 A;  2KFF A;  2LCP A;  2M29 A;  1ZFS A;  4YRU A;  5F6T A;  2HF5 A;  1PAL A;  4R1E A;  3EVR A;  1SCM C;  2NZ0 A;  4L9M A;  1K93 D;  1BR4 B;  2JQ6 A;  3O78 A;  2SCP A;  1CDL A;  1GQM A;  3O2P A;  4MRX A;  4PE1 A;  3SG7 A;  3WNX B;  1MF8 B;  1FI6 A;  1PUL A;  2JXC A;  3CR4 X;  4AQJ A;  1AVS A;  1SL8 A;  2F2O A;  4USL A;  3OHM B;  1YVL A;  1TN4 A;  2ZKM X;  1XFU O;  2BCX A;  4OR9 B;  3BUO B;  1PRW A;  3E3R A;  1SCM B;  2M49 B;  3GK2 A;  5PAL A;  2WCE A;  3NSO A;  1L2O C;  2LLS A;  4C0K A;  4XJK B;  1TNP A;  1KSM A;  2PMY A;  1QS7 A;  1SK6 D;  3PAL A;  1NX3 A;  3SIA A;  1BF5 A;  1F71 A;  4AOM A;  1OSA A;  1FW4 A;  2MA2 A;  2K2F A;  3NSI A;  3OB1 B;  2WCF A;  1V1F A;  4YI8 A;  2L51 A;  4GUK A;  2LHI A;  1S1E A;  5TNC A;  2F2P A;  1XK4 C;  2FOT A;  4GGN A;  1L2O B;  2F3Z A;  1OMD A;  2LNK A;  2M7N A;  4MSP A;  1WRK A;  2NLN A;  1TOP A;  4YGE B;  3LK1 A;  2FCD A;  4GNK B;  2M7L A;  1XFZ O;  2Y1M A;  2CNP A;  2GV5 A;  4NDC A;  1KFX S;  4GGF A;  1CNP A;  4ORC B;  1REC A;  3I5G C;  4MRY A;  1KCY A;  1BMO A;  2JZI A;  4AQI A;  4GFT A;  1DVI A;  3QRX A;  2JTZ A;  2L4I A;  1B8L A;  1ZAC A;  2LVI A;  2PSR A;  3PFV A;  3PN7 C;  4OKH A;  2JNF A;  3CTN A;  1ZUZ A;  4CID A;  1QAT A;  1DJG A;  4MZK A;  4ZCU A;  4N1F A;  2K8M B;  4MN0 A;  4MZL A;  4MZJ A;  2MRD A;  5I2L A;  1QV0 A;  2JOJ A;  3LL8 B;  1S36 A;  2KAX A;  2KI4 B;  2KYF A;  4JWQ A;  1MHO A;  2GGZ A;  1DF0 B;  1J1D A;  3EK8 A;  4QJ5 B;  3AAJ A;  3PN7 B;  1UHJ A;  1DJZ A;  1PSR A;  3TDZ A;  4C0L A;  1SY9 A;  1C7V A;  4BY5 A;  1F70 A;  4GBA A;  1TIZ A;  3KO0 A;  1N2D A;  1D1O A;  2KOT A;  3DVE A;  1H4B A;  1MWN A;  2ZRT A;  4HRG A;  4PE7 A;  4PHM A;  3H4S E;  4TNC A;  2M3W A;  4F0Z B;  2QPT A;  1CLM A;  1YRU B;  2COL B;  2OTG C;  4DCK A;  1G33 A;  1J7O A;  4N5X A;  2M0R A;  2EC6 C;  2O5G A;  1RK9 A;  3KF9 A;  1BT6 A;  1QJT A;  2M1K B;  1S26 D;  4M2P A;  4QJ4 B;  1DGV A;  2JUL A;  2WCB A;  1AHR A;  3EVV A;  2JC2 A;  3NSK A;  4I5L B;  1QVI Y;  4NDB A;  4MVF A;  4E68 A;  1C07 A;  1CMG A;  2DOQ A;  1CFP A;  5HKZ A;  2QAC A;  1UHH A;  2PAS A;  2LLT A;  1M63 B;  3PLF B;  4CPV A;  2TN4 A;  4ICB A;  1SRA A;  2ZNE A;  3EVU A;  2EC6 B;  5BPJ A;  1SR6 C;  2KFG A;  1GGZ A;  3BOW B;  1XA5 A;  2H61 A;  4NDD A;  1WDC C;  3VGO A;  2K7O A;  1JBA A;  1DMO A;  4YGB B;  5AXI A;  1WRL A;  3CS1 A;  4XJK A;  3SG2 A;  2AMI A;  1DJI A;  1WRZ A;  1TTX A;  2D8N A;  4ORA B;  3AKA A;  1CMF A;  2KYC A;  4C0J A;  2G2B A;  1K8U A;  5ER4 X;  2BE4 A;  1SCV A;  3FWC A;  2M1U A;  1AUI B;  2PRU A;  1S6C A;  2K7D A;  2ZND A;  1KQV A;  1E8A A;  1SR6 B;  2JU0 A;  2K7B A;  1JF0 A;  1K96 A;  3A8R A;  2JT0 A;  2LM5 A;  3DF0 B;  1SMG A;  1QVI Z;  1WDC B;  3VRQ A;  2HPS A;  2LE9 B;  1ALW A;  1G8I A;  2KFH A;  4WRI A;  2KI6 D;  1QX5 B;  1TNW A;  1WLM A;  2JNX A;  2KBI A;  4DIR A;  3CZT X;  1XFV O;  2BBM A;  1NUB A;  1X02 A;  3BXK A;  1ZMZ A;  2HQW A;  3EK4 A;  2I18 A;  1DGU A;  1V1G A;  2K2A A;  1NWD A;  2LV7 A;  2I7A A;  1RFJ A;  2BKH B;  1KFU L;  2Y5I A;  1BG1 A;  2CXJ A;  2E30 A;  1QX7 A;  2BEC A;  4YGD B;  5CSF A;  2Y1N A;  1KK7 Z;  1NX1 A;  1LVC D;  3EKJ A;  3OB2 B;  1F8H A;  1QIV A;  1XFW O;  3KEV A;  4DUQ A;  5KSZ A;  2JXL A;  5D69 A;  2LVJ A;  3WHT B;  1MUX A;  2EHB A;  3TDI A;  1ALV A;  3M0W A;  2AUC A;  3I5F C;  2OPO A;  1MQ1 A;  1KQM C;  3D0Y B;  4MLW A;  2KNE A;  5FYX A;  5JJG A;  2ZRS A;  2BE6 A;  4P2Y B;  1TCF A;  1AJ5 A;  1SKT A;  3I5I C;  2PVB A;  1J55 A;  3SG4 A;  1J7R A;  1DF0 A;  2F8P A;  2FCE A;  2KGR A;  2PAL A;  2KGB C;  1K9U A;  1OZS A;  5G08 A;  1UHN A;  5HKY A;  1JFK A;  3TS5 C;  3SJS A;  4PAL A;  1CDN A;  1OOJ A;  4A4B A;  3I5F B;  4Q04 A;  3GK1 A;  1KQM B;  1SNL A;  1Q80 A;  1LA3 A;  1OZO A;  1PK0 D;  1WY9 A;  1OQP A;  3SG6 A;  2VRG A;  1U5I B;  1MXL C;  3K21 A;  3RM1 A;  2LVK A;  1IJ6 A;  2Q4U A;  2JTT A;  4FQO A;  3O4Y A;  3KPX A;  3BUN B;  1RWY A;  2V53 A;  4D1E A;  1R6P A;  5B8I B;  4DRW A;  1Y1A A;  1IRJ A;  1TCO B;  2JT8 A;  2P6B B;  4JPZ B;  1BU3 A;  5HLO A;  1DJW A;  3SIB A;  1QLK A;  4I5J A;  1BJF A;  2LP3 A;  5K89 A;  2H2K A;  1B47 A;  3I5G B;  5DKR A;  4MBE A;  1QLS A;  1Y6W A;  2F33 A;  3I5H C;  1XFY O;  3BOW A;  5DKQ A;  2A4J A;  1AP4 A;  4QJ3 B;  1FPW A;  4M2O A;  4CFQ A;  4FTG A;  3DVK A;  4P5O E;  1M45 A;  4XYN A;  5I2Q A;  2FJU B;  2BCA A;  1NSH A;  2ZN8 A;  1K90 D;  1DTL A;  2K7C A;  4OCI A;  4PHJ A;  2K0J A;  4GAO A;  1F54 A;  1H8B A;  1JUO A;  2AAO A;  3CR5 X;  4GGF C;  5HYD A;  1AJ4 A;  3PAT A;  4A4C A; 
#chains in the Genus database with same CATH topology
 3CWG A;  1BOC A;  1DJX A;  1IKU A;  1QTX A;  2PYQ A;  4HRE E;  1DJY A;  2IS9 A;  1YUR A;  5GQQ C;  1UUS A;  5AER A;  1G4Y R;  3PJI A;  3PM2 A;  1A29 A;  1CDM A;  1CM1 A;  1SPY A;  2G9B A;  4CLN A;  1BLQ A;  1B9A A;  2GTE A;  1NX0 A;  1UHK A;  4OVN F;  2P71 A;  4PDZ A;  1KFU S;  3TDU A;  5KTY A;  2OTG B;  3PSR A;  1VRK A;  2WOS A;  4PHN A;  1NCY A;  1IWQ A;  1F4Q A;  2QEH A;  2RGI A;  3QME A;  4HRH A;  3WNX B;  1ORG A;  4PHK A;  2B1U A;  2BKI B;  3VRP A;  1CB1 A;  3GOF A;  2WCJ A;  3VRR A;  5AFP A;  1BOD A;  3SG3 A;  3DD4 A;  1B8R A;  3D0Y A;  1IG5 A;  1F55 A;  3R1V A;  1NP8 A;  1JF2 A;  2E6W A;  1DT7 B;  2M97 A;  2MLE C;  1UWO A;  3BUW B;  4YI9 A;  1LXF C;  2JT3 A;  2KDH A;  3ICB A;  1WLZ A;  1XO5 A;  2LUX A;  2R2I A;  3HX4 A;  3A4U B;  1K9K A;  3IQO A;  1IJ5 A;  5ER5 A;  3D10 A;  1B8C A;  4CFR A;  5DKN A;  3D74 A;  1P28 A;  1NCX A;  3MSE B;  2BCB A;  1TWO A;  1YUS A;  4BY4 A;  3LCP C;  1GM0 A;  4YGC B;  1U5I A;  3SS5 A;  2K60 A;  5I8N A;  4DS7 A;  1C3Y A;  1S5G Y;  2LHL A;  1EXR A;  5IBW A;  1A75 B;  1Y1U A;  2KI6 C;  3BUX B;  1XK4 A;  1Z4H A;  1CLL A;  2LMV A;  1FI5 A;  1CDP A;  3CZ2 A;  3CR2 A;  1JC2 A;  3ZNI A;  1GJY A;  2GGM A;  1RRO A;  2H61 C;  2L0P A;  1IQ5 A;  3B86 A;  1EG3 A;  1FF1 A;  1M39 A;  1MXE A;  1EL4 A;  3IF7 A;  3DVM A;  1M31 A;  5EL2 A;  3TZ1 A;  1K9P A;  4PE4 A;  5D7F A;  3ZWH A;  2BBN A;  1IH0 A;  1CM4 A;  1Y1X A;  2WC8 A;  1KSO A;  1YRT B;  2CBL A;  4GPL B;  1YTZ C;  1CFC A;  2LP2 A;  5CPV A;  1KK8 C;  1K94 A;  1TUZ A;  3DYE A;  1MR8 A;  3OX5 A;  1FBV A;  5CSN A;  3NXA A;  2LMT A;  2WOR A;  1S5G Z;  2KSP A;  3FWB A;  4I5K A;  1W7I B;  2Y4Q A;  1M46 A;  3WXA A;  1SBJ A;  3KHE A;  3JVT C;  3TUY C;  1OMV A;  2NCP A;  2QDI A;  3I5I B;  3IVT A;  1B7T Y;  1GGW A;  4M2Q A;  2JPT A;  1S6J A;  1RJV A;  3AAK A;  3B6X A;  1CFF A;  1EJ3 A;  2O60 A;  1KK8 B;  2K61 A;  3FE8 A;  3TS5 B;  2CT9 A;  2YGU A;  1YR5 A;  3OX6 A;  1LA0 A;  3IQQ A;  1K2H A;  1JSA A;  3FE6 A;  1HQV A;  1OOG A;  1QV1 A;  1S3P A;  2WCL A;  3JTD C;  3JVT B;  2MAZ A;  5HKW A;  1YX8 A;  3TUY B;  4N1G A;  1HT9 A;  1DJH A;  1BR1 B;  5HLV A;  3S0A A;  1A4P A;  2MJW B;  5KU1 A;  1NCZ A;  1UHI A;  3L4L A;  4JQ0 D;  1IQ3 A;  3D76 A;  4INW A;  3B7A A;  1ZOT B;  4HSZ A;  2L2E A;  5AAN A;  2KI4 C;  2M8U A;  2WCH A;  1AK8 A;  1XYD A;  1PVB A;  1A2X A;  4YGA A;  3VB1 A;  1TNQ A;  1A03 A;  1B7T Z;  3WHU B;  3JTD B;  3AKB A;  4OV2 A;  2HET A;  3NSL A;  1W7J B;  5CSI A;  1YUT A;  2L4H A;  4PE0 A;  1YVH A;  2LVV A;  3FS7 A;  1CFD A;  1L7Z A;  1Z2C B;  5CSJ A;  1R2U A;  3CLN A;  2CCM A;  2F3Y A;  1NYA A;  3I5H B;  1TRF A;  3DF0 A;  2L98 A;  3LK0 A;  1OOF A;  1NPQ A;  3BJH A;  3BQ3 A;  3FIA A;  2LLU A;  2WND A;  3UNW A;  5AEQ A;  1C7W A;  2BNX A;  2M9G A;  1OE9 B;  3RLZ A;  4ETO A;  2LC5 A;  1OOH A;  1CKK A;  2JWW A;  2I2R E;  3CAB A;  4WQ2 A;  3BUM B;  4ORB B;  3EKH A;  2QEO A;  1JFJ A;  1EG4 A;  3D73 A;  3R72 A;  1KFX L;  2JRF A;  5JOL A;  1A75 A;  1NIW A;  1QXP A;  2CTN A;  2KAY A;  2OS8 C;  3R1O A;  2I94 A;  3VRN A;  2BL0 C;  2L5X B;  3N7H A;  2WCM A;  2LUC A;  3BYA A;  3HCM A;  3GK4 X;  1QWV A;  3C1V A;  2KBM A;  1XVJ A;  3L47 A;  4U8D A;  2NXQ A;  1SL7 A;  1J1E A;  2EGD A;  1OOI X;  4YBH B;  1PVA A;  2LAN A;  3LLE A;  4WQ3 A;  1SYM A;  3R1P A;  2NCO A;  1QAS A;  4UPG A;  1EH2 A;  3OP0 A;  1OMR A;  2LAP A;  2ISD A;  2KHN A;  3S0G A;  2Q91 A;  1N0Y A;  1NX2 A;  2KLD A;  5J3X A;  2OS8 B;  3DVJ A;  2MBX A;  1F4O A;  2BL0 B;  1UP5 A;  1S6I A;  4ZCV A;  1Y0V H;  1TNX A;  1UUR A;  1YX7 A;  1SW8 A;  3EK7 A;  3S0F A;  2WC6 A;  3CDN A;  1KWO C;  2L50 A;  2MHH A;  3PM8 A;  1SL9 A;  4MEW A;  1ODB A;  2KLE A;  4IL1 A;  3F45 A;  1LIN A;  1CTR A;  1J7P A;  3CGA A;  3OBV A;  2LMU A;  2SAS A;  2KQ6 A;  4PCW A;  1B1G A;  1KK7 Y;  3VRO A;  2KAV A;  4I5N B;  1K95 A;  3O6B A;  2ZN9 A;  3V2L A;  1IGV A;  1N65 A;  1XFX O;  3NGV A;  5FI7 A;  5I2O A;  1CLB A;  1LKJ A;  1QIW A;  2QEV A;  2ZFD A;  1KWO B;  2KQY A;  3B87 A;  2MLF C;  1YUU A;  4NQG A;  3SG5 A;  1B4C A;  1J7Q A;  1JWD A;  1QX2 A;  1PSB A;  1RTP 1;  2HQ8 A;  2KFF A;  2LCP A;  2M29 A;  1ZFS A;  4YRU A;  2H8V A;  1DC1 A;  5F6T A;  2HF5 A;  1PAL A;  4R1E A;  3EVR A;  1SCM C;  2NZ0 A;  4L9M A;  1K93 D;  1BR4 B;  2JQ6 A;  3O78 A;  2SCP A;  1CDL A;  1GQM A;  3O2P A;  4MRX A;  2QEB A;  4PE1 A;  1TUJ A;  1MF8 B;  3SG7 A;  1FI6 A;  1PUL A;  2JXC A;  3CR4 X;  4AQJ A;  1AVS A;  1SL8 A;  4OZD A;  2F2O A;  4USL A;  3OHM B;  1YVL A;  1TN4 A;  2ZKM X;  1W9Z A;  1XFU O;  2BAP A;  4F7F A;  2BCX A;  4OR9 B;  3BUO B;  1PRW A;  3E3R A;  1SCM B;  2M49 B;  3GK2 A;  5PAL A;  2WCE A;  3NSO A;  1L2O C;  2LLS A;  2P70 A;  4C0K A;  4XJK B;  1TNP A;  5DIC A;  1KSM A;  2PMY A;  1QS7 A;  1SK6 D;  3L4A A;  1NX3 A;  3PAL A;  3SIA A;  1BF5 A;  4AOM A;  1OSA A;  1F71 A;  1FW4 A;  2MA2 A;  5HL1 A;  2K2F A;  3NSI A;  3OB1 B;  2WCF A;  1V1F A;  1XFR A;  2L51 A;  4YI8 A;  4GUK A;  1DEL A;  2LHI A;  1S1E A;  5TNC A;  3BFH A;  2F2P A;  1XK4 C;  2FOT A;  4GGN A;  1L2O B;  2F3Z A;  1OMD A;  2LNK A;  2M7N A;  4MSP A;  1WRK A;  2NLN A;  1TOP A;  4YGE B;  3LK1 A;  2FCD A;  4GNK B;  3DXL A;  1XFZ O;  2Y1M A;  2M7L A;  2CNP A;  2GV5 A;  4NDC A;  3D78 A;  1KFX S;  4GGF A;  1CNP A;  4ORC B;  1REC A;  3FE9 A;  3I5G C;  4MRY A;  1KCY A;  1BMO A;  2JZI A;  4AQI A;  4GFT A;  1DVI A;  3QRX A;  2JTZ A;  2L4I A;  1B8L A;  1ZAC A;  2LVI A;  2PSR A;  3PFV A;  2L2C A;  3PN7 C;  4OKH A;  2JNF A;  3CTN A;  1ZUZ A;  4CID A;  1QAT A;  1DJG A;  4MZK A;  4ZCU A;  4N1F A;  1DEK A;  2K8M B;  4MN0 A;  4MZL A;  4MZJ A;  2ERB A;  2MRD A;  5I2L A;  1QV0 A;  2JOJ A;  3LL8 B;  1S36 A;  2KAX A;  2KI4 B;  2KYF A;  4JWQ A;  1MHO A;  2GGZ A;  3OGN A;  1DF0 B;  1J1D A;  3EK8 A;  4QJ5 B;  3AAJ A;  3PN7 B;  1UHJ A;  1DJZ A;  1LS8 A;  1PSR A;  3TDZ A;  4C0L A;  1SY9 A;  1C7V A;  2FJY A;  4BY5 A;  1F70 A;  4GBA A;  1TIZ A;  3KO0 A;  1N2D A;  1D1O A;  2KOT A;  3D75 A;  3DVE A;  1MWN A;  1H4B A;  2ZRT A;  4HRG A;  4PE7 A;  4PHM A;  1T14 A;  3H4S E;  4TNC A;  2M3W A;  4F0Z B;  2QPT A;  1CLM A;  1YRU B;  2COL B;  2OTG C;  3CYZ A;  4FQT A;  4DCK A;  1G33 A;  1J7O A;  4N5X A;  1C3Z A;  2M0R A;  2EC6 C;  2O5G A;  1RK9 A;  3KF9 A;  1BT6 A;  1QJT A;  2M1K B;  1S26 D;  4M2P A;  3SS4 A;  4QJ4 B;  1DGV A;  2JUL A;  2WCB A;  1AHR A;  3EVV A;  1SSE B;  2JC2 A;  3NSK A;  4I5L B;  1QVI Y;  4NDB A;  4MVF A;  4E68 A;  1C07 A;  1CMG A;  2DOQ A;  1CFP A;  5HKZ A;  2QAC A;  1UHH A;  2PAS A;  2LLT A;  1M63 B;  3PLF B;  3UO9 A;  3D77 A;  4CPV A;  2TN4 A;  3CZ1 A;  4ICB A;  1SRA A;  2ZNE A;  3EVU A;  2EC6 B;  5BPJ A;  1SR6 C;  2KFG A;  1GGZ A;  3DY9 A;  3BOW B;  1XA5 A;  2H61 A;  4NDD A;  1WDC C;  5D3O A;  3VGO A;  4IJ7 A;  2K7O A;  1JBA A;  1DMO A;  4YGB B;  5AXI A;  3O4X A;  1WRL A;  3CS1 A;  4XJK A;  3SG2 A;  2AMI A;  1DJI A;  1WRZ A;  1TTX A;  2D8N A;  4ORA B;  3AKA A;  4KYN A;  1CMF A;  2KYC A;  4C0J A;  2G2B A;  1K8U A;  5ER4 X;  2BE4 A;  1SCV A;  3FWC A;  2M1U A;  1AUI B;  2PRU A;  1S6C A;  2K7D A;  2ZND A;  1KQV A;  1E8A A;  1SR6 B;  4PT1 A;  2JU0 A;  2K7B A;  1JF0 A;  1K96 A;  3A8R A;  2JT0 A;  2LM5 A;  3DF0 B;  1SMG A;  1QVI Z;  1WDC B;  3VRQ A;  2HPS A;  2LE9 B;  1ALW A;  1G8I A;  2KFH A;  3NHI A;  4WRI A;  2KI6 D;  1QX5 B;  1TNW A;  1WLM A;  2JNX A;  2KBI A;  4JKT A;  5FI6 A;  4DIR A;  3CZT X;  1XFV O;  2BBM A;  1NUB A;  1X02 A;  3BXK A;  3S0B A;  1ZMZ A;  2HQW A;  3EK4 A;  2I18 A;  1DGU A;  1V1G A;  2K2A A;  1NWD A;  2LV7 A;  2I7A A;  1RFJ A;  2BKH B;  1KFU L;  2Y5I A;  1BG1 A;  2WC5 A;  2CXJ A;  2E30 A;  1QX7 A;  2BEC A;  4YGD B;  5CSF A;  2Y1N A;  1KK7 Z;  1NX1 A;  5I94 A;  1LVC D;  3EKJ A;  3OB2 B;  1F8H A;  1QIV A;  1XFW O;  3KEV A;  4DUQ A;  5KSZ A;  2JXL A;  5D69 A;  1IIO A;  2LVJ A;  3WHT B;  1MUX A;  2EHB A;  3TDI A;  1ALV A;  3M0W A;  2AUC A;  3I5F C;  2OPO A;  1MQ1 A;  1KQM C;  3D0Y B;  4MLW A;  2KNE A;  5FYX A;  5JJG A;  2ZRS A;  2BE6 A;  4P2Y B;  1TCF A;  1AJ5 A;  1SKT A;  3I5I C;  2PVB A;  1J55 A;  3SG4 A;  1J7R A;  1DF0 A;  2F8P A;  2FCE A;  2KGR A;  2PAL A;  2KGB C;  1K9U A;  1OZS A;  5G08 A;  1UHN A;  3K1E A;  5HKY A;  1JFK A;  3TS5 C;  4JD9 A;  3SJS A;  2L5Y A;  4PAL A;  3S0E A;  1CDN A;  1OOJ A;  4A4B A;  3I5F B;  4Q04 A;  3SS3 A;  3GK1 A;  1KQM B;  1SNL A;  1Q80 A;  1LA3 A;  1OZO A;  1PK0 D;  1OW4 A;  1OQP A;  1WY9 A;  2PQL A;  2VRG A;  1U5I B;  3SG6 A;  1MXL C;  3K21 A;  3RM1 A;  3NHT A;  2LVK A;  1IJ6 A;  2Q4U A;  3BFB A;  2JPO A;  2JTT A;  3B88 A;  3O4Y A;  4FQO A;  3KPX A;  3BUN B;  1RWY A;  2V53 A;  4INX A;  4D1E A;  1R6P A;  5B8I B;  4DRW A;  1Y1A A;  1IRJ A;  1TCO B;  2JT8 A;  3EG5 B;  2P6B B;  4JPZ B;  1BU3 A;  5HLO A;  1DJW A;  2KPH A;  3SIB A;  1QLK A;  4I5J A;  1BJF A;  2LP3 A;  5K89 A;  3Q8I A;  2H2K A;  1B47 A;  3BFA A;  3I5G B;  3CZ0 A;  5DKR A;  4MBE A;  1QLS A;  1Y6W A;  2F33 A;  3DZT A;  3I5H C;  1XFY O;  3BOW A;  5DKQ A;  5FI2 A;  2A4J A;  1AP4 A;  4QJ3 B;  1FPW A;  4M2O A;  4CFQ A;  1DQE A;  4FTG A;  3DVK A;  4P5O E;  1M45 A;  4XYN A;  5I2Q A;  2FJU B;  2BCA A;  1NSH A;  2ZN8 A;  1K90 D;  1DTL A;  2K7C A;  4OCI A;  4PHJ A;  2K0J A;  3S0D A;  4GAO A;  1F54 A;  1H8B A;  3RZS A;  1JUO A;  2AAO A;  2WCK A;  3CR5 X;  4GGF C;  5HYD A;  1AJ4 A;  3PAT A;  4A4C A; 
#chains in the Genus database with same CATH homology
 3CWG A;  1BOC A;  1DJX A;  1IKU A;  1QTX A;  4HRE E;  1DJY A;  2IS9 A;  1YUR A;  5GQQ C;  1UUS A;  5AER A;  1G4Y R;  1A29 A;  1CDM A;  1CM1 A;  1SPY A;  2G9B A;  4CLN A;  1BLQ A;  1B9A A;  1NX0 A;  1UHK A;  4OVN F;  3TDU A;  4PDZ A;  1KFU S;  5KTY A;  2OTG B;  3PSR A;  1VRK A;  2WOS A;  4PHN A;  1NCY A;  1IWQ A;  1F4Q A;  2RGI A;  4HRH A;  4PHK A;  2B1U A;  2BKI B;  3VRP A;  1CB1 A;  3GOF A;  3VRR A;  5AFP A;  1BOD A;  3SG3 A;  3DD4 A;  1B8R A;  3D0Y A;  1IG5 A;  1F55 A;  1NP8 A;  1JF2 A;  2E6W A;  1DT7 B;  2M97 A;  2MLE C;  1UWO A;  3BUW B;  4YI9 A;  1LXF C;  2JT3 A;  2KDH A;  3ICB A;  1WLZ A;  1XO5 A;  2LUX A;  2R2I A;  3HX4 A;  3A4U B;  1K9K A;  3IQO A;  1IJ5 A;  5ER5 A;  3D10 A;  1B8C A;  4CFR A;  5DKN A;  1NCX A;  3MSE B;  2BCB A;  1YUS A;  4BY4 A;  3LCP C;  4YGC B;  1U5I A;  5I8N A;  4DS7 A;  1S5G Y;  2LHL A;  1EXR A;  5IBW A;  1A75 B;  1Y1U A;  2KI6 C;  3BUX B;  1XK4 A;  1CLL A;  2LMV A;  1FI5 A;  1CDP A;  3CR2 A;  1JC2 A;  3ZNI A;  1GJY A;  2GGM A;  1RRO A;  2H61 C;  2L0P A;  1IQ5 A;  1EG3 A;  1FF1 A;  1M39 A;  1MXE A;  1EL4 A;  3IF7 A;  3DVM A;  1M31 A;  3TZ1 A;  1K9P A;  4PE4 A;  5D7F A;  3ZWH A;  2BBN A;  1IH0 A;  1CM4 A;  1Y1X A;  2WC8 A;  1KSO A;  1YRT B;  2CBL A;  4GPL B;  1YTZ C;  1CFC A;  2LP2 A;  5CPV A;  1KK8 C;  1K94 A;  1MR8 A;  3OX5 A;  1FBV A;  5CSN A;  3NXA A;  2LMT A;  2WOR A;  1S5G Z;  2KSP A;  3FWB A;  4I5K A;  1W7I B;  2Y4Q A;  1M46 A;  3WXA A;  1SBJ A;  3KHE A;  3JVT C;  3TUY C;  1OMV A;  2NCP A;  3I5I B;  1B7T Y;  1GGW A;  4M2Q A;  2JPT A;  1S6J A;  1RJV A;  3AAK A;  1CFF A;  1EJ3 A;  2O60 A;  1KK8 B;  2K61 A;  3TS5 B;  2CT9 A;  1YR5 A;  3OX6 A;  1LA0 A;  3IQQ A;  1K2H A;  1JSA A;  1HQV A;  1QV1 A;  1S3P A;  3JTD C;  3JVT B;  3TUY B;  2MAZ A;  5HKW A;  1YX8 A;  4N1G A;  1HT9 A;  1DJH A;  1BR1 B;  5HLV A;  1A4P A;  2MJW B;  5KU1 A;  1NCZ A;  1UHI A;  4JQ0 D;  1IQ3 A;  4HSZ A;  1ZOT B;  2L2E A;  5AAN A;  2KI4 C;  2M8U A;  1AK8 A;  1XYD A;  1PVB A;  1A2X A;  4YGA A;  1TNQ A;  1A03 A;  1B7T Z;  3WHU B;  3JTD B;  3AKB A;  4OV2 A;  2HET A;  3NSL A;  1W7J B;  5CSI A;  1YUT A;  2L4H A;  4PE0 A;  1YVH A;  2LVV A;  3FS7 A;  1CFD A;  1L7Z A;  5CSJ A;  1R2U A;  3CLN A;  2CCM A;  2F3Y A;  1NYA A;  3I5H B;  1TRF A;  3DF0 A;  2L98 A;  3LK0 A;  1NPQ A;  3BQ3 A;  3FIA A;  2LLU A;  2WND A;  5AEQ A;  1C7W A;  2M9G A;  3RLZ A;  1OE9 B;  4ETO A;  2LC5 A;  1CKK A;  2JWW A;  2I2R E;  4WQ2 A;  3BUM B;  4ORB B;  3EKH A;  1JFJ A;  1EG4 A;  1KFX L;  2JRF A;  5JOL A;  1A75 A;  1NIW A;  1QXP A;  2CTN A;  2KAY A;  2OS8 C;  3VRN A;  2I94 A;  2BL0 C;  2L5X B;  2LUC A;  3BYA A;  3HCM A;  3GK4 X;  3C1V A;  2KBM A;  1XVJ A;  4U8D A;  2NXQ A;  1SL7 A;  1J1E A;  2EGD A;  4YBH B;  1PVA A;  2LAN A;  3LLE A;  4WQ3 A;  1SYM A;  2NCO A;  1QAS A;  4UPG A;  1EH2 A;  3OP0 A;  1OMR A;  2LAP A;  2ISD A;  2KHN A;  2Q91 A;  1N0Y A;  1NX2 A;  5J3X A;  2OS8 B;  3DVJ A;  2MBX A;  1F4O A;  2BL0 B;  1UP5 A;  1S6I A;  4ZCV A;  1Y0V H;  1TNX A;  1UUR A;  1YX7 A;  1SW8 A;  3EK7 A;  1KWO C;  2L50 A;  2MHH A;  3PM8 A;  1SL9 A;  4MEW A;  1ODB A;  4IL1 A;  3F45 A;  1LIN A;  1CTR A;  1J7P A;  3CGA A;  2LMU A;  2SAS A;  2KQ6 A;  4PCW A;  1B1G A;  1KK7 Y;  3VRO A;  2KAV A;  4I5N B;  1K95 A;  3O6B A;  2ZN9 A;  1IGV A;  1N65 A;  1XFX O;  5I2O A;  1CLB A;  1LKJ A;  1QIW A;  2ZFD A;  1KWO B;  2KQY A;  1J7Q A;  2MLF C;  1YUU A;  4NQG A;  3SG5 A;  1B4C A;  1JWD A;  1QX2 A;  1PSB A;  1RTP 1;  2HQ8 A;  2KFF A;  2LCP A;  2M29 A;  1ZFS A;  4YRU A;  5F6T A;  2HF5 A;  1PAL A;  4R1E A;  3EVR A;  1SCM C;  2NZ0 A;  4L9M A;  1K93 D;  1BR4 B;  2JQ6 A;  3O78 A;  2SCP A;  1CDL A;  1GQM A;  3O2P A;  4MRX A;  4PE1 A;  3SG7 A;  3WNX B;  1MF8 B;  1FI6 A;  1PUL A;  2JXC A;  3CR4 X;  4AQJ A;  1AVS A;  1SL8 A;  2F2O A;  4USL A;  3OHM B;  1YVL A;  1TN4 A;  2ZKM X;  1XFU O;  2BCX A;  4OR9 B;  3BUO B;  1PRW A;  3E3R A;  1SCM B;  2M49 B;  3GK2 A;  5PAL A;  2WCE A;  3NSO A;  1L2O C;  2LLS A;  4C0K A;  4XJK B;  1TNP A;  1KSM A;  2PMY A;  1QS7 A;  1SK6 D;  3PAL A;  1NX3 A;  3SIA A;  1BF5 A;  1F71 A;  4AOM A;  1OSA A;  1FW4 A;  2MA2 A;  2K2F A;  3NSI A;  3OB1 B;  2WCF A;  1V1F A;  4YI8 A;  2L51 A;  4GUK A;  2LHI A;  1S1E A;  5TNC A;  2F2P A;  1XK4 C;  2FOT A;  4GGN A;  1L2O B;  2F3Z A;  1OMD A;  2LNK A;  2M7N A;  4MSP A;  1WRK A;  2NLN A;  1TOP A;  4YGE B;  3LK1 A;  2FCD A;  4GNK B;  2M7L A;  1XFZ O;  2Y1M A;  2CNP A;  2GV5 A;  4NDC A;  1KFX S;  4GGF A;  1CNP A;  4ORC B;  1REC A;  3I5G C;  4MRY A;  1KCY A;  1BMO A;  2JZI A;  4AQI A;  4GFT A;  1DVI A;  3QRX A;  2JTZ A;  2L4I A;  1B8L A;  1ZAC A;  2LVI A;  2PSR A;  3PFV A;  3PN7 C;  4OKH A;  2JNF A;  3CTN A;  1ZUZ A;  4CID A;  1QAT A;  1DJG A;  4MZK A;  4ZCU A;  4N1F A;  2K8M B;  4MN0 A;  4MZL A;  4MZJ A;  2MRD A;  5I2L A;  1QV0 A;  2JOJ A;  3LL8 B;  1S36 A;  2KAX A;  2KI4 B;  2KYF A;  4JWQ A;  1MHO A;  2GGZ A;  1DF0 B;  1J1D A;  3EK8 A;  4QJ5 B;  3AAJ A;  3PN7 B;  1UHJ A;  1DJZ A;  1PSR A;  3TDZ A;  4C0L A;  1SY9 A;  1C7V A;  4BY5 A;  1F70 A;  4GBA A;  1TIZ A;  3KO0 A;  1N2D A;  1D1O A;  2KOT A;  3DVE A;  1H4B A;  1MWN A;  2ZRT A;  4HRG A;  4PE7 A;  4PHM A;  3H4S E;  4TNC A;  2M3W A;  4F0Z B;  2QPT A;  1CLM A;  1YRU B;  2COL B;  2OTG C;  4DCK A;  1G33 A;  1J7O A;  4N5X A;  2M0R A;  2EC6 C;  2O5G A;  1RK9 A;  3KF9 A;  1BT6 A;  1QJT A;  2M1K B;  1S26 D;  4M2P A;  4QJ4 B;  1DGV A;  2JUL A;  2WCB A;  1AHR A;  3EVV A;  2JC2 A;  3NSK A;  4I5L B;  1QVI Y;  4NDB A;  4MVF A;  4E68 A;  1C07 A;  1CMG A;  2DOQ A;  1CFP A;  5HKZ A;  2QAC A;  1UHH A;  2PAS A;  2LLT A;  1M63 B;  3PLF B;  4CPV A;  2TN4 A;  4ICB A;  1SRA A;  2ZNE A;  3EVU A;  2EC6 B;  5BPJ A;  1SR6 C;  2KFG A;  1GGZ A;  3BOW B;  1XA5 A;  2H61 A;  4NDD A;  1WDC C;  3VGO A;  2K7O A;  1JBA A;  1DMO A;  4YGB B;  5AXI A;  1WRL A;  3CS1 A;  4XJK A;  3SG2 A;  2AMI A;  1DJI A;  1WRZ A;  1TTX A;  2D8N A;  4ORA B;  3AKA A;  1CMF A;  2KYC A;  4C0J A;  2G2B A;  1K8U A;  5ER4 X;  2BE4 A;  1SCV A;  3FWC A;  2M1U A;  1AUI B;  2PRU A;  1S6C A;  2K7D A;  2ZND A;  1KQV A;  1E8A A;  1SR6 B;  2JU0 A;  2K7B A;  1JF0 A;  1K96 A;  3A8R A;  2JT0 A;  2LM5 A;  3DF0 B;  1SMG A;  1QVI Z;  1WDC B;  3VRQ A;  2HPS A;  2LE9 B;  1ALW A;  1G8I A;  2KFH A;  4WRI A;  2KI6 D;  1QX5 B;  1TNW A;  1WLM A;  2JNX A;  2KBI A;  4DIR A;  3CZT X;  1XFV O;  2BBM A;  1NUB A;  1X02 A;  3BXK A;  1ZMZ A;  2HQW A;  3EK4 A;  2I18 A;  1DGU A;  1V1G A;  2K2A A;  1NWD A;  2LV7 A;  2I7A A;  1RFJ A;  2BKH B;  1KFU L;  2Y5I A;  1BG1 A;  2CXJ A;  2E30 A;  1QX7 A;  2BEC A;  4YGD B;  5CSF A;  2Y1N A;  1KK7 Z;  1NX1 A;  1LVC D;  3EKJ A;  3OB2 B;  1F8H A;  1QIV A;  1XFW O;  3KEV A;  4DUQ A;  5KSZ A;  2JXL A;  5D69 A;  2LVJ A;  3WHT B;  1MUX A;  2EHB A;  3TDI A;  1ALV A;  3M0W A;  2AUC A;  3I5F C;  2OPO A;  1MQ1 A;  1KQM C;  3D0Y B;  4MLW A;  2KNE A;  5FYX A;  5JJG A;  2ZRS A;  2BE6 A;  4P2Y B;  1TCF A;  1AJ5 A;  1SKT A;  3I5I C;  2PVB A;  1J55 A;  3SG4 A;  1J7R A;  1DF0 A;  2F8P A;  2FCE A;  2KGR A;  2PAL A;  2KGB C;  1K9U A;  1OZS A;  5G08 A;  1UHN A;  5HKY A;  1JFK A;  3TS5 C;  3SJS A;  4PAL A;  1CDN A;  1OOJ A;  4A4B A;  3I5F B;  4Q04 A;  3GK1 A;  1KQM B;  1SNL A;  1Q80 A;  1LA3 A;  1OZO A;  1PK0 D;  1WY9 A;  1OQP A;  3SG6 A;  2VRG A;  1U5I B;  1MXL C;  3K21 A;  3RM1 A;  2LVK A;  1IJ6 A;  2Q4U A;  2JTT A;  4FQO A;  3O4Y A;  3KPX A;  3BUN B;  1RWY A;  2V53 A;  4D1E A;  1R6P A;  5B8I B;  4DRW A;  1Y1A A;  1IRJ A;  1TCO B;  2JT8 A;  2P6B B;  4JPZ B;  1BU3 A;  5HLO A;  1DJW A;  3SIB A;  1QLK A;  4I5J A;  1BJF A;  2LP3 A;  5K89 A;  2H2K A;  1B47 A;  3I5G B;  5DKR A;  4MBE A;  1QLS A;  1Y6W A;  2F33 A;  3I5H C;  1XFY O;  3BOW A;  5DKQ A;  2A4J A;  1AP4 A;  4QJ3 B;  1FPW A;  4M2O A;  4CFQ A;  4FTG A;  3DVK A;  4P5O E;  1M45 A;  4XYN A;  5I2Q A;  2FJU B;  2BCA A;  1NSH A;  2ZN8 A;  1K90 D;  1DTL A;  2K7C A;  4OCI A;  4PHJ A;  2K0J A;  4GAO A;  1F54 A;  1H8B A;  1JUO A;  2AAO A;  3CR5 X;  4GGF C;  5HYD A;  1AJ4 A;  3PAT A;  4A4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...