1RWYA

Crystal structure of rat alpha-parvalbumin at 1.05 resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rat Alpha-Parvalbumin at 1.05 Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
molecule keywords PARVALBUMIN ALPHA
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rwyA00
1F8HA 1SPYA 3LK0A 1QX7A 3NSIA 1K96A 2L0PA 3DVKA 2COLB 5I2OA 2Y4QA 3SG3A 3WHUB 5KTYA 4GGFC 3RM1A 1CDLA 2JTZA 2ISDA 1SNLA 4CFRA 1MQ1A 2K2AA 1FW4A 4YGBB 3ZNIA 4WRIA 1LA3A 2CTNA 2OTGB 1B7TY 1GGZA 2JU0A 3BUOB 2LP3A 4Q04A 4GUKA 5CSNA 1H4BA 3TDZA 3GK4X 1CM4A 5GQQC 1EH2A 1BR1B 1E8AA 1UHHA 1SL9A 1XK4A 1KFUL 1V1GA 2WOSA 1DMOA 2L5XB 4PALA 2NXQA 2M7NA 4MBEA 2BL0C 1RECA 1JUOA 1Y1AA 2PASA 1DJWA 4NDCA 1A4PA 4YGDB 5HKYA 1CFPA 3JVTC 2G9BA 1L2OC 1Y0VH 2LVKA 4XJKA 4PE4A 2MAZA 1J1DA 3TUYC 3KO0A 2IS9A 4U8DA 2EC6B 2M49B 1S5GZ 1BF5A 1KFUS 1S6CA 3OHMB 2RGIA 1J55A 1KQVA 3PALA 1RTP1 1PSBA 2KSPA 5AEQA 2Q4UA 2KAYA 3JTDC 3OB1B 1KK7Z 1NX2A 2MBXA 1A75B 2QPTA 2M8UA 3WNXB 2LUCA 5I8NA 2KBIA 1ZUZA 3DF0B 2KGBC 5AANA 2JNXA 2B1UA 1TNPA 4HSZA 3H4SE 2F3YA 3GK1A 2BCBA 3O2PA 2CT9A 2JC2A 1KK8B 1H8BA 1SY9A 1K93D 1B4CA 1A75A 1M31A 5F6TA 4A4CA 2ZFDA 1CKKA 2KHNA 4PHJA 4TNCA 1OMDA 2BBNA 2LM5A 3SG5A 4A4BA 1DVIA 1KK8C 1XFWO 1L7ZA 1J1EA 2PVBA 2KQ6A 1OZOA 3FS7A 1DJZA 1WRLA 3CTNA 4CPVA 1MXLC 1X02A 1NCZA 3WHTB 2HF5A 1TTXA 1UHNA 2FOTA 2M3WA 3TDIA 2JRFA 2ZNDA 1BG1A 1GJYA 3GOFA 4DRWA 1OSAA 1N2DA 1S1EA 1SK6D 4MRYA 5BPJA 1B8RA 3CZTX 1MF8B 1BMOA 1ZMZA 3CGAA 2EHBA 2BE6A 5D69A 2JWWA 2WORA 1MR8A 1RROA 5DKRA 1C7VA 3KPXA 5ER5A 1CB1A 1FI6A 2KFFA 1QV1A 1DJHA 1SMGA 1B7TZ 2M9GA 4HRGA 4MSPA 1SCMB 4AOMA 3EK8A 1FF1A 1WLZA 2BL0B 2OTGC 1JBAA 2MLEC 2MLFC 2K7DA 2Y1MA 1F54A 4XYNA 2WCFA 4ORCB 4DIRA 3A8RA 4PE7A 2H61A 2L2EA 1B8CA 5CSIA 2LV7A 3C1VA 2JXCA 5HKWA 1G8IA 1CLBA 1QATA 2L50A 1G4YR 4C0JA 1EXRA 4GFTA 1QX2A 1DJIA 1K9KA 1QV0A 1V1FA 2V53A 3BYAA 5HYDA 1F4QA 1M45A 4I5JA 3BUMB 4NDBA 4I5LB 4GBAA 4ICBA 1CNPA 1IGVA 2JOJA 5HLVA 1K90D 2L4IA 2NLNA 2KAVA 1CDNA 1WDCC 2Y1NA 2AAOA 1KWOC 1XO5A 2L51A 1R2UA 3OP0A 4IL1A 5G08A 4D1EA 2EGDA 3EK4A 4YI9A 5ER4X 3DVJA 1AHRA 2M1KB 4YBHB 4N5XA 1BODA 3LCPC 1TNQA 1BU3A 1UWOA 1XFUO 1PSRA 5HKZA 5KU1A 1N0YA 2M97A 2LVIA 2OPOA 1G33A 3FIAA 4CFQA 5HLOA 1IQ3A 5D7FA 5CSJA 3SG7A 2O60A 4CLNA 3I5GB 1Y1UA 4JPZB 4C0KA 2K7CA 1UP5A 5AFPA 1PVBA 1SW8A 1PALA 4GAOA 4P2YB 1J7QA 2JT8A 1YRTB 1UHJA 4XJKB 1UHIA 1QXPA 1W7IB 2DOQA 1JFKA 1N65A 1C7WA 1TNXA 3JTDB 2WNDA 2KOTA 4MZKA 3SG2A 1M46A 4M2OA 1U5IB 1K9UA 1D1OA 1K94A 3PN7C 1B1GA 4OCIA 3FWCA 4PHKA 2KFHA 1MXEA 2K7OA 1EL4A 1C07A 4PHNA 5IBWA 1HQVA 3NSOA 2R2IA 4MLWA 4DCKA 3OX5A 2OS8B 2KDHA 3BUWB 3IF7A 5AXIA 3KEVA 1QLKA 3SG4A 1NX0A 2NZ0A 2OS8C 1OQPA 2PALA 1TIZA 1TCOB 1S26D 1XYDA 4GGNA 1DJXA 3DVMA 1QS7A 1SR6B 1OE9B 2JQ6A 3LK1A 3BUNB 1ALWA 1GGWA 1TOPA 4YI8A 1QASA 5B8IB 3A4UB 1JF2A 1CTRA 3O6BA 1NPQA 3SG6A 1B47A 1B9AA 1PK0D 3CS1A 5JOLA 1IRJA 1DGUA 2PRUA 3HCMA 1F70A 1OZSA 1QVIZ 2MRDA 2LVJA 1JC2A 1SL7A 5K89A 3CLNA 1KFXS 3BOWA 2WCEA 3BXKA 2K0JA 1MUXA 1KSOA 4YGCB 1UUSA 3VRPA 1MHOA 3I5FB 2F33A 2ZN9A 1CLLA 1WLMA 1YUTA 2M0RA 3AAKA 4MZLA 2LAPA 3ICBA 1ZOTB 2ZRTA 2JT3A 4AQJA 1RK9A 1LVCD 3EKJA 3QRXA 4OR9B 1IJ5A 2KI4B 2KNEA 1OMRA 4BY5A 1CFCA 2LUXA 1Y1XA 1QIVA 2LE9B 4OVNF 2CXJA 1QLSA 1YVLA 3EK7A 3M0WA 4MN0A 4UPGA 1KWOB 2BKIB 2LMTA 2F8PA 2ZKMX 1QJTA 4JQ0D 2LP2A 4MVFA 4PHMA 3F45A 1A29A 2H61C 3D0YA 1TCFA 1OMVA 4OKHA 1CLMA 4HRHA 1WRZA 4FTGA 5TNCA 3I5HB 2FCEA 2HQWA 2KI6C 1AP4A 4QJ5B 2BE4A 4F0ZB 2NCPA 3MSEB 1KQMB 1J7OA 2LNKA 3VGOA 2KFGA 3JVTB 1YX7A 2GGZA 2LLUA 5JJGA 2KBMA 4DUQA 3TDUA 5KSZA 1K8UA 2F2PA 1A03A 3CR2A 1DJYA 1J7RA 3KF9A 4M2PA 5DKQA 1XFZO 1YUUA 4OV2A 1S36A 3PFVA 4R1EA 4BY4A 1ALVA 1M39A 1DGVA 2BCAA 5PALA 2ZRSA 2M7LA 3BOWB 2FCDA 2K7BA 4P5OE 1XFXO 3RLZA 1FBVA 2QACA 4I5KA 4CIDA 3OX6A 1QIWA 2JXLA 1CDPA 1NP8A 1JWDA 1YR5A 2JPTA 1QX5B 2H2KA 1GQMA 1R6PA 3NXAA 2KYFA 2LHIA 1KK7Y 3TZ1A 1AJ4A 2AUCA 1NX3A 2KI6D 2L98A 2MHHA 3SJSA 1QVIY 2WCBA 4E68A 4GPLB 1YX8A 2KQYA 1F55A 1PRWA 2CNPA 2PMYA 3CR4X 2MA2A 4DS7A 1SCMC 1IWQA 3PM8A 1XK4C 1NIWA 2HQ8A 1BOCA 3O4YA 2HETA 1UURA 2KI4C 3BQ3A 1F71A 1S6JA 1BLQA 1EG4A 4MZJA 1KFXL 3D0YB 4MRXA 2E30A 3LL8B 3AKBA 4ORBB 4N1FA 2LANA 2LC5A 3ZWHA 1F4OA 1M63B 1J7PA 1YVHA 3SIAA 2I2RE 3TS5C 1FI5A 2CBLA 3FWBA 1KSMA 4QJ3B 4M2QA 1LXFC 1XFVO 1SL8A 2O5GA 3IQQA 5FYXA 1QTXA 1NX1A 3I5IB 1ODBA 2BECA 1LINA 2A4JA 2KYCA 2GV5A 2MJWB 1SYMA 2I7AA 4NQGA 2HPSA 1Q80A 3I5IC 1YRUB 4ETOA 2GGMA 1IG5A 3DD4A 3NSLA 3O78A 3VRNA 1IJ6A 5I2QA 1B8LA 1CMFA 3EVVA 2KGRA 3KHEA 1JFJA 1BR4B 1CMGA 1XVJA 2LVVA 2JULA 4L9MA 3I5GC 1AJ5A 1RJVA 1S3PA 3VROA 1SRAA 3I5FC 2LMVA 1SCVA 5CSFA 1L2OB 3D10A 2F2OA 1YURA 1IH0A 1A2XA 4GGFA 4USLA 3K21A 5DKNA 2JZIA 3DVEA 3VRQA 1LA0A 1W7JB 2KAXA 2ZNEA 4JWQA 3EKHA 2ZN8A 1ZFSA 4ZCVA 1UHKA 3PN7B 3CR5X 1S5GY 2BKHB 2EC6C 3PSRA 1IQ5A 3CWGA 1EG3A 1TNWA 3OB2B 4FQOA 4PE0A 2K61A 4I5NB 4ZCUA 2K2FA 1ZACA 4GNKB 1AK8A 1IKUA 1TRFA 3E3RA 4PE1A 1JSAA 1BT6A 1K9PA 1NWDA 4WQ2A 2JTTA 3LLEA 1YUSA 1Y6WA 1SR6C 4YGEB 1AVSA 4YGAA 3PATA 5AERA 4N1GA 3EVRA 1EJ3A 1SKTA 1VRKA 2E6WA 1U5IA 2LLSA 1K2HA 3IQOA 2G2BA 2Q91A 1K95A 1PVAA 2LCPA 2TN4A 1DF0A 4PCWA 4AQIA 2VRGA 3TS5B 4YRUA 2AMIA 2P6BB 1S6IA 3NSKA 1MWNA 2LHLA 3I5HC 1CDMA 1WY9A 3SIBA 1PULA 1KQMC 2PSRA 1RWYA 1NSHA 1YTZC 4C0LA 1FPWA 2BBMA 4WQ3A 4MEWA 3HX4A 1NCYA 1RFJA 2F3ZA 1NYAA 2JNFA 2JT0A 1HT9A 1CFDA 3AKAA 2I94A 1TN4A 2K8MB 3WXAA 2BCXA 2D8NA 2LMUA 2M29A 1BJFA 1CM1A 1JF0A 3BUXB 3TUYB 1XFYO 3DF0A 4QJ4B 2WC8A 5CPVA 2SASA 1DTLA 1KCYA 1NUBA 1OOJA 2CCMA 3EVUA 1AUIB 1CFFA 2M1UA 2NCOA 1NCXA 2I18A 1WRKA 2LLTA 1DT7B 1WDCB 3PLFB 2SCPA 1SBJA 1XA5A 4PDZA 3GK2A 4ORAB 3VRRA 3AAJA 2Y5IA 4NDDA 1DJGA 5I2LA 1LKJA 2L4HA 2FJUB 4HREE 5J3XA 1DF0B
chains in the Genus database with same CATH superfamily
1F8HA 1SPYA 3LK0A 1QX7A 3NSIA 1K96A 2L0PA 3DVKA 2COLB 5I2OA 2Y4QA 3SG3A 3WHUB 5KTYA 4GGFC 3RM1A 1CDLA 2JTZA 2ISDA 1SNLA 4CFRA 1MQ1A 3S0EA 2K2AA 2K60A 3NHIA 1FW4A 4YGBB 3ZNIA 4WRIA 1LA3A 2CTNA 2OTGB 1B7TY 1GGZA 2JU0A 3BUOB 2LP3A 4Q04A 4GUKA 5CSNA 3FE8A 3TDZA 1H4BA 3GK4X 1CM4A 5GQQC 1EH2A 1BR1B 1E8AA 1UHHA 1SL9A 1XK4A 1KFUL 1V1GA 2WOSA 1DMOA 2L5XB 4PALA 2NXQA 2M7NA 4MBEA 2BL0C 3S0GA 1RECA 1JUOA 1Y1AA 2PASA 1DJWA 4NDCA 1A4PA 4YGDB 5HKYA 1CFPA 3JVTC 2G9BA 1L2OC 1Y0VH 2LVKA 4XJKA 4PE4A 2MAZA 1J1DA 3TUYC 3KO0A 2IS9A 4U8DA 2EC6B 2M49B 1S5GZ 1BF5A 1KFUS 1S6CA 3OHMB 2RGIA 1J55A 1KQVA 3PALA 1RTP1 1PSBA 2KSPA 5AEQA 2Q4UA 2KAYA 3JTDC 2YGUA 3OB1B 1KK7Z 1NX2A 3D74A 2MBXA 1A75B 2QPTA 2M8UA 3WNXB 2LUCA 5I8NA 3S0FA 2KBIA 1ZUZA 3DF0B 2KGBC 5AANA 2JNXA 2B1UA 1TNPA 4HSZA 2QEBA 3H4SE 3S0BA 2F3YA 3GK1A 3PM2A 2BCBA 3O2PA 2CT9A 2JC2A 1KK8B 1H8BA 1SY9A 1K93D 1B4CA 1A75A 1M31A 5F6TA 4A4CA 1Z2CB 2ZFDA 1CKKA 1TWOA 2KHNA 4PHJA 4TNCA 1OMDA 2BBNA 2LM5A 3SG5A 4A4BA 1DVIA 1KK8C 1DEKA 1XFWO 1L7ZA 1J1EA 2PVBA 2KQ6A 1OZOA 3FS7A 1DJZA 3FE6A 3S0AA 1WRLA 1OOFA 3CTNA 4CPVA 1MXLC 1X02A 1NCZA 3WHTB 2HF5A 2KLDA 1TTXA 1UHNA 2FOTA 2M3WA 2QEOA 2JRFA 3TDIA 2ZNDA 1BG1A 2WCLA 1GJYA 3GOFA 4DRWA 1OSAA 1N2DA 1S1EA 1SK6D 4MRYA 5BPJA 1B8RA 3CZTX 1MF8B 1BMOA 1ZMZA 3CGAA 2EHBA 2BE6A 5D69A 3UO9A 2JWWA 2WORA 1MR8A 1RROA 3SS5A 5DKRA 1C7VA 3KPXA 5ER5A 1CB1A 1FI6A 2KFFA 1QV1A 1DJHA 1SMGA 1B7TZ 2M9GA 4HRGA 4MSPA 1SCMB 4AOMA 3EK8A 1FF1A 1WLZA 2BL0B 2OTGC 1JBAA 2MLEC 2MLFC 2K7DA 2Y1MA 1F54A 4XYNA 2WCFA 4ORCB 4DIRA 3A8RA 4PE7A 2H61A 2L2EA 4INWA 3BFBA 1B8CA 5CSIA 2LV7A 3C1VA 2JXCA 1TUZA 5HKWA 1G8IA 1CLBA 1QATA 2L50A 1G4YR 3FE9A 4C0JA 1EXRA 4GFTA 1QX2A 1DJIA 1K9KA 1QV0A 1V1FA 2V53A 3BYAA 5HYDA 1F4QA 1M45A 4I5JA 3BUMB 4NDBA 4I5LB 4GBAA 4ICBA 1CNPA 1IGVA 3S0DA 2JOJA 5HLVA 1K90D 2L4IA 2NLNA 2KAVA 1CDNA 1WDCC 2Y1NA 2AAOA 1KWOC 1XO5A 2L51A 1R2UA 3OP0A 4IL1A 5G08A 4D1EA 2EGDA 3EK4A 2KPHA 3IVTA 4YI9A 5ER4X 3DVJA 3L4AA 1AHRA 2H8VA 2M1KB 4YBHB 4N5XA 1BODA 3LCPC 1TNQA 1BU3A 1UWOA 1XFUO 1PSRA 5HKZA 5KU1A 1N0YA 2M97A 2LVIA 2OPOA 1G33A 3FIAA 4CFQA 5HLOA 5HL1A 1IQ3A 5D7FA 5CSJA 3SG7A 2O60A 4CLNA 3I5GB 3NGVA 1Y1UA 4JPZB 2WC5A 1OOIX 4C0KA 2K7CA 1UP5A 5AFPA 3D78A 1PVBA 1SW8A 3SS3A 3D75A 1XFRA 1PALA 4GAOA 4P2YB 1J7QA 2JT8A 1YRTB 1UHJA 4XJKB 3O4XA 1UHIA 1QXPA 1W7IB 2DOQA 1JFKA 1N65A 1C7WA 1TNXA 3JTDB 2WNDA 2KOTA 4MZKA 3SG2A 1M46A 4M2OA 1U5IB 1K9UA 1D1OA 1K94A 3PN7C 2WCHA 1B1GA 4OCIA 3FWCA 4PHKA 2KFHA 1MXEA 2K7OA 1Z4HA 1EL4A 1C07A 4KYNA 4PHNA 5IBWA 1HQVA 3NSOA 3D76A 2R2IA 4MLWA 4DCKA 3OX5A 2OS8B 2KDHA 3BUWB 3IF7A 5AXIA 3KEVA 1QLKA 2QDIA 3SG4A 1NX0A 2NZ0A 2OS8C 1OQPA 2PALA 1TIZA 1TCOB 1S26D 1XYDA 4GGNA 1DJXA 1W9ZA 3DVMA 1QS7A 1SR6B 1OE9B 5FI6A 2JQ6A 3LK1A 3BUNB 1ALWA 1GGWA 1TOPA 4YI8A 1QASA 5B8IB 3A4UB 1JF2A 3D77A 1CTRA 3N7HA 3O6BA 1NPQA 3SG6A 1B47A 1B9AA 3EG5B 1PK0D 3CS1A 5JOLA 1IRJA 1DGUA 2PRUA 3HCMA 1F70A 1OZSA 1QVIZ 2ERBA 2MRDA 3D73A 2LVJA 1JC2A 1SL7A 5K89A 3CLNA 1KFXS 3BOWA 1IIOA 2WCEA 3BXKA 1C3YA 2K0JA 1MUXA 1KSOA 4YGCB 1UUSA 2PYQA 3VRPA 1MHOA 3I5FB 2F33A 2ZN9A 1CLLA 1WLMA 1YUTA 2M0RA 3AAKA 4MZLA 2LAPA 3ICBA 1DQEA 1ZOTB 2ZRTA 4INXA 2JT3A 4AQJA 1RK9A 1LVCD 1ORGA 3EKJA 3QRXA 4OR9B 1IJ5A 2FJYA 2KI4B 1OMRA 2KNEA 4BY5A 1CFCA 2LUXA 1Y1XA 1QIVA 2LE9B 4OVNF 3OBVA 2CXJA 1QLSA 1YVLA 3EK7A 3M0WA 3QMEA 4MN0A 4UPGA 4PT1A 1KWOB 2BKIB 2LMTA 2F8PA 2ZKMX 1QJTA 4JQ0D 2LP2A 4MVFA 4IJ7A 3CZ1A 4PHMA 3F45A 1A29A 2H61C 3D0YA 3DY9A 1TCFA 1OMVA 4OKHA 1CLMA 4HRHA 1WRZA 3CYZA 4FTGA 5TNCA 3I5HB 2FCEA 2HQWA 2KI6C 1AP4A 4JD9A 4QJ5B 2BE4A 4F0ZB 2NCPA 3MSEB 1KQMB 1J7OA 2LNKA 3VGOA 2KFGA 3JVTB 1YX7A 2GGZA 2LLUA 3R72A 5JJGA 2KBMA 4DUQA 3TDUA 5KSZA 1K8UA 2F2PA 3B86A 3CR2A 1A03A 1DJYA 1J7RA 3KF9A 4M2PA 5DKQA 1XFZO 1YUUA 4OV2A 1S36A 3B7AA 3PFVA 4R1EA 4BY4A 1ALVA 1M39A 1DGVA 2BCAA 5PALA 2ZRSA 2M7LA 3BOWB 2FCDA 3DZTA 2K7BA 4P5OE 1XFXO 3RLZA 1FBVA 2QACA 4I5KA 4CIDA 2GTEA 3BJHA 3OX6A 1QIWA 2JXLA 1CDPA 1NP8A 3Q8IA 3B88A 1YR5A 2JPTA 1QX5B 1DELA 4FQTA 2H2KA 1JWDA 1GQMA 2P70A 1R6PA 3NXAA 2KYFA 2LHIA 1KK7Y 3TZ1A 1AJ4A 2QEHA 2AUCA 1NX3A 1OOGA 2KI6D 2L98A 2MHHA 3B6XA 5I94A 3SJSA 1QVIY 2WCBA 4E68A 4GPLB 3CZ0A 1YX8A 2KQYA 1F55A 1PRWA 2CNPA 2JPOA 2PMYA 2MA2A 3CR4X 4DS7A 1TUJA 2WC6A 1SCMC 1IWQA 3PM8A 1XK4C 1NIWA 2HQ8A 1BOCA 3O4YA 2HETA 1UURA 2KI4C 3BQ3A 3L4LA 1F71A 1S6JA 1BLQA 1EG4A 2L2CA 4MZJA 1KFXL 3D0YB 4MRXA 2E30A 3LL8B 3AKBA 4ORBB 4N1FA 2LANA 2LC5A 3ZWHA 1F4OA 1M63B 1J7PA 1YVHA 3SIAA 2I2RE 3TS5C 3L47A 1FI5A 2CBLA 3FWBA 1KSMA 3CABA 4M2QA 4QJ3B 3V2LA 1LXFC 1XFVO 1SL8A 2BAPA 2O5GA 3IQQA 5FYXA 1QTXA 1NX1A 3I5IB 1ODBA 2BECA 1LINA 3CZ2A 2A4JA 2KYCA 2GV5A 2MJWB 4F7FA 1SYMA 2WCMA 5FI7A 2I7AA 1OW4A 4NQGA 2HPSA 1Q80A 3I5IC 1YRUB 4ETOA 2GGMA 1IG5A 3DD4A 2P71A 3NSLA 3O78A 1IJ6A 3VRNA 1B8LA 5I2QA 3EVVA 2KGRA 1CMFA 3KHEA 1JFJA 1BR4B 1CMGA 1XVJA 2LVVA 2JULA 4L9MA 3I5GC 3R1VA 1AJ5A 1RJVA 1S3PA 3VROA 1SRAA 3I5FC 2LMVA 1SCVA 1LS8A 5CSFA 1L2OB 1OOHA 3D10A 2F2OA 1YURA 1IH0A 1A2XA 4GGFA 4USLA 3K21A 5DKNA 2JZIA 1SSEB 2QEVA 3DVEA 1C3ZA 3VRQA 1LA0A 1W7JB 2KAXA 2ZNEA 4JWQA 3EKHA 2L5YA 2ZN8A 1ZFSA 3CDNA 1UHKA 3PN7B 4ZCVA 5FI2A 3CR5X 1S5GY 1T14A 2BKHB 2EC6C 3PSRA 1IQ5A 3CWGA 1EG3A 1TNWA 3OB2B 4FQOA 4PE0A 2K61A 4I5NB 4ZCUA 2K2FA 1ZACA 1GM0A 4GNKB 1AK8A 2KLEA 1IKUA 1TRFA 2WCJA 3E3RA 4PE1A 3B87A 3VB1A 1BT6A 1K9PA 1NWDA 2PQLA 4WQ2A 3RZSA 1JSAA 1P28A 2JTTA 3LLEA 3R1OA 1YUSA 2WCKA 1Y6WA 1SR6C 4YGEB 1AVSA 4YGAA 3PATA 4OZDA 3BFAA 4N1GA 5AERA 3EVRA 3OGNA 4JKTA 1EJ3A 1SKTA 1VRKA 3BFHA 2E6WA 1U5IA 2LLSA 1K2HA 3IQOA 2G2BA 2Q91A 1K95A 1PVAA 2LCPA 2TN4A 1DF0A 4PCWA 4AQIA 2VRGA 3TS5B 3PJIA 4YRUA 2AMIA 2P6BB 1S6IA 3NSKA 1MWNA 2LHLA 1QWVA 3I5HC 1CDMA 1WY9A 3SIBA 1PULA 1KQMC 2PSRA 1RWYA 1NSHA 1YTZC 4C0LA 1FPWA 2BBMA 4WQ3A 4MEWA 5EL2A 3HX4A 3DXLA 1NCYA 1RFJA 2F3ZA 1NYAA 2JNFA 2JT0A 3NHTA 1DC1A 1HT9A 2BNXA 5DICA 1CFDA 3AKAA 2I94A 1TN4A 2K8MB 3WXAA 2BCXA 2D8NA 2LMUA 2M29A 1BJFA 1CM1A 1JF0A 3BUXB 3TUYB 3R1PA 1XFYO 3DF0A 3DYEA 4QJ4B 2WC8A 5CPVA 3UNWA 2SASA 1DTLA 1KCYA 1NUBA 1OOJA 3K1EA 2CCMA 3EVUA 1AUIB 1CFFA 2M1UA 2NCOA 1NCXA 2I18A 1WRKA 2LLTA 1DT7B 1WDCB 3PLFB 2SCPA 1SBJA 3SS4A 1XA5A 4PDZA 3GK2A 4ORAB 3VRRA 3AAJA 2Y5IA 4NDDA 1DJGA 5D3OA 5I2LA 1LKJA 2L4HA 2FJUB 4HREE 5J3XA 1DF0B
chains in the Genus database with same CATH topology
1F8HA 1SPYA 3LK0A 1QX7A 3NSIA 1K96A 2L0PA 3DVKA 2COLB 5I2OA 2Y4QA 3SG3A 3WHUB 5KTYA 4GGFC 3RM1A 1CDLA 2JTZA 2ISDA 1SNLA 4CFRA 1MQ1A 2K2AA 1FW4A 4YGBB 3ZNIA 4WRIA 1LA3A 2CTNA 2OTGB 1B7TY 1GGZA 2JU0A 3BUOB 2LP3A 4Q04A 4GUKA 5CSNA 1H4BA 3TDZA 3GK4X 1CM4A 5GQQC 1EH2A 1BR1B 1E8AA 1UHHA 1SL9A 1XK4A 1KFUL 1V1GA 2WOSA 1DMOA 2L5XB 4PALA 2NXQA 2M7NA 4MBEA 2BL0C 1RECA 1JUOA 1Y1AA 2PASA 1DJWA 4NDCA 1A4PA 4YGDB 5HKYA 1CFPA 3JVTC 2G9BA 1L2OC 1Y0VH 2LVKA 4XJKA 4PE4A 2MAZA 1J1DA 3TUYC 3KO0A 2IS9A 4U8DA 2EC6B 2M49B 1S5GZ 1BF5A 1KFUS 1S6CA 3OHMB 2RGIA 1J55A 1KQVA 3PALA 1RTP1 1PSBA 2KSPA 5AEQA 2Q4UA 2KAYA 3JTDC 3OB1B 1KK7Z 1NX2A 2MBXA 1A75B 2QPTA 2M8UA 3WNXB 2LUCA 5I8NA 2KBIA 1ZUZA 3DF0B 2KGBC 5AANA 2JNXA 2B1UA 1TNPA 4HSZA 3H4SE 2F3YA 3GK1A 2BCBA 3O2PA 2CT9A 2JC2A 1KK8B 1H8BA 1SY9A 1K93D 1B4CA 1A75A 1M31A 5F6TA 4A4CA 2ZFDA 1CKKA 2KHNA 4PHJA 4TNCA 1OMDA 2BBNA 2LM5A 3SG5A 4A4BA 1DVIA 1KK8C 1XFWO 1L7ZA 1J1EA 2PVBA 2KQ6A 1OZOA 3FS7A 1DJZA 1WRLA 3CTNA 4CPVA 1MXLC 1X02A 1NCZA 3WHTB 2HF5A 1TTXA 1UHNA 2FOTA 2M3WA 3TDIA 2JRFA 2ZNDA 1BG1A 1GJYA 3GOFA 4DRWA 1OSAA 1N2DA 1S1EA 1SK6D 4MRYA 5BPJA 1B8RA 3CZTX 1MF8B 1BMOA 1ZMZA 3CGAA 2EHBA 2BE6A 5D69A 2JWWA 2WORA 1MR8A 1RROA 5DKRA 1C7VA 3KPXA 5ER5A 1CB1A 1FI6A 2KFFA 1QV1A 1DJHA 1SMGA 1B7TZ 2M9GA 4HRGA 4MSPA 1SCMB 4AOMA 3EK8A 1FF1A 1WLZA 2BL0B 2OTGC 1JBAA 2MLEC 2MLFC 2K7DA 2Y1MA 1F54A 4XYNA 2WCFA 4ORCB 4DIRA 3A8RA 4PE7A 2H61A 2L2EA 1B8CA 5CSIA 2LV7A 3C1VA 2JXCA 5HKWA 1G8IA 1CLBA 1QATA 2L50A 1G4YR 4C0JA 1EXRA 4GFTA 1QX2A 1DJIA 1K9KA 1QV0A 1V1FA 2V53A 3BYAA 5HYDA 1F4QA 1M45A 4I5JA 3BUMB 4NDBA 4I5LB 4GBAA 4ICBA 1CNPA 1IGVA 2JOJA 5HLVA 1K90D 2L4IA 2NLNA 2KAVA 1CDNA 1WDCC 2Y1NA 2AAOA 1KWOC 1XO5A 2L51A 1R2UA 3OP0A 4IL1A 5G08A 4D1EA 2EGDA 3EK4A 4YI9A 5ER4X 3DVJA 1AHRA 2M1KB 4YBHB 4N5XA 1BODA 3LCPC 1TNQA 1BU3A 1UWOA 1XFUO 1PSRA 5HKZA 5KU1A 1N0YA 2M97A 2LVIA 2OPOA 1G33A 3FIAA 4CFQA 5HLOA 1IQ3A 5D7FA 5CSJA 3SG7A 2O60A 4CLNA 3I5GB 1Y1UA 4JPZB 4C0KA 2K7CA 1UP5A 5AFPA 1PVBA 1SW8A 1PALA 4GAOA 4P2YB 1J7QA 2JT8A 1YRTB 1UHJA 4XJKB 1UHIA 1QXPA 1W7IB 2DOQA 1JFKA 1N65A 1C7WA 1TNXA 3JTDB 2WNDA 2KOTA 4MZKA 3SG2A 1M46A 4M2OA 1U5IB 1K9UA 1D1OA 1K94A 3PN7C 1B1GA 4OCIA 3FWCA 4PHKA 2KFHA 1MXEA 2K7OA 1EL4A 1C07A 4PHNA 5IBWA 1HQVA 3NSOA 2R2IA 4MLWA 4DCKA 3OX5A 2OS8B 2KDHA 3BUWB 3IF7A 5AXIA 3KEVA 1QLKA 3SG4A 1NX0A 2NZ0A 2OS8C 1OQPA 2PALA 1TIZA 1TCOB 1S26D 1XYDA 4GGNA 1DJXA 3DVMA 1QS7A 1SR6B 1OE9B 2JQ6A 3LK1A 3BUNB 1ALWA 1GGWA 1TOPA 4YI8A 1QASA 5B8IB 3A4UB 1JF2A 1CTRA 3O6BA 1NPQA 3SG6A 1B47A 1B9AA 1PK0D 3CS1A 5JOLA 1IRJA 1DGUA 2PRUA 3HCMA 1F70A 1OZSA 1QVIZ 2MRDA 2LVJA 1JC2A 1SL7A 5K89A 3CLNA 1KFXS 3BOWA 2WCEA 3BXKA 2K0JA 1MUXA 1KSOA 4YGCB 1UUSA 3VRPA 1MHOA 3I5FB 2F33A 2ZN9A 1CLLA 1WLMA 1YUTA 2M0RA 3AAKA 4MZLA 2LAPA 3ICBA 1ZOTB 2ZRTA 2JT3A 4AQJA 1RK9A 1LVCD 3EKJA 3QRXA 4OR9B 1IJ5A 2KI4B 2KNEA 1OMRA 4BY5A 1CFCA 2LUXA 1Y1XA 1QIVA 2LE9B 4OVNF 2CXJA 1QLSA 1YVLA 3EK7A 3M0WA 4MN0A 4UPGA 1KWOB 2BKIB 2LMTA 2F8PA 2ZKMX 1QJTA 4JQ0D 2LP2A 4MVFA 4PHMA 3F45A 1A29A 2H61C 3D0YA 1TCFA 1OMVA 4OKHA 1CLMA 4HRHA 1WRZA 4FTGA 5TNCA 3I5HB 2FCEA 2HQWA 2KI6C 1AP4A 4QJ5B 2BE4A 4F0ZB 2NCPA 3MSEB 1KQMB 1J7OA 2LNKA 3VGOA 2KFGA 3JVTB 1YX7A 2GGZA 2LLUA 5JJGA 2KBMA 4DUQA 3TDUA 5KSZA 1K8UA 2F2PA 1A03A 3CR2A 1DJYA 1J7RA 3KF9A 4M2PA 5DKQA 1XFZO 1YUUA 4OV2A 1S36A 3PFVA 4R1EA 4BY4A 1ALVA 1M39A 1DGVA 2BCAA 5PALA 2ZRSA 2M7LA 3BOWB 2FCDA 2K7BA 4P5OE 1XFXO 3RLZA 1FBVA 2QACA 4I5KA 4CIDA 3OX6A 1QIWA 2JXLA 1CDPA 1NP8A 1JWDA 1YR5A 2JPTA 1QX5B 2H2KA 1GQMA 1R6PA 3NXAA 2KYFA 2LHIA 1KK7Y 3TZ1A 1AJ4A 2AUCA 1NX3A 2KI6D 2L98A 2MHHA 3SJSA 1QVIY 2WCBA 4E68A 4GPLB 1YX8A 2KQYA 1F55A 1PRWA 2CNPA 2PMYA 3CR4X 2MA2A 4DS7A 1SCMC 1IWQA 3PM8A 1XK4C 1NIWA 2HQ8A 1BOCA 3O4YA 2HETA 1UURA 2KI4C 3BQ3A 1F71A 1S6JA 1BLQA 1EG4A 4MZJA 1KFXL 3D0YB 4MRXA 2E30A 3LL8B 3AKBA 4ORBB 4N1FA 2LANA 2LC5A 3ZWHA 1F4OA 1M63B 1J7PA 1YVHA 3SIAA 2I2RE 3TS5C 1FI5A 2CBLA 3FWBA 1KSMA 4QJ3B 4M2QA 1LXFC 1XFVO 1SL8A 2O5GA 3IQQA 5FYXA 1QTXA 1NX1A 3I5IB 1ODBA 2BECA 1LINA 2A4JA 2KYCA 2GV5A 2MJWB 1SYMA 2I7AA 4NQGA 2HPSA 1Q80A 3I5IC 1YRUB 4ETOA 2GGMA 1IG5A 3DD4A 3NSLA 3O78A 3VRNA 1IJ6A 5I2QA 1B8LA 1CMFA 3EVVA 2KGRA 3KHEA 1JFJA 1BR4B 1CMGA 1XVJA 2LVVA 2JULA 4L9MA 3I5GC 1AJ5A 1RJVA 1S3PA 3VROA 1SRAA 3I5FC 2LMVA 1SCVA 5CSFA 1L2OB 3D10A 2F2OA 1YURA 1IH0A 1A2XA 4GGFA 4USLA 3K21A 5DKNA 2JZIA 3DVEA 3VRQA 1LA0A 1W7JB 2KAXA 2ZNEA 4JWQA 3EKHA 2ZN8A 1ZFSA 4ZCVA 1UHKA 3PN7B 3CR5X 1S5GY 2BKHB 2EC6C 3PSRA 1IQ5A 3CWGA 1EG3A 1TNWA 3OB2B 4FQOA 4PE0A 2K61A 4I5NB 4ZCUA 2K2FA 1ZACA 4GNKB 1AK8A 1IKUA 1TRFA 3E3RA 4PE1A 1JSAA 1BT6A 1K9PA 1NWDA 4WQ2A 2JTTA 3LLEA 1YUSA 1Y6WA 1SR6C 4YGEB 1AVSA 4YGAA 3PATA 5AERA 4N1GA 3EVRA 1EJ3A 1SKTA 1VRKA 2E6WA 1U5IA 2LLSA 1K2HA 3IQOA 2G2BA 2Q91A 1K95A 1PVAA 2LCPA 2TN4A 1DF0A 4PCWA 4AQIA 2VRGA 3TS5B 4YRUA 2AMIA 2P6BB 1S6IA 3NSKA 1MWNA 2LHLA 3I5HC 1CDMA 1WY9A 3SIBA 1PULA 1KQMC 2PSRA 1RWYA 1NSHA 1YTZC 4C0LA 1FPWA 2BBMA 4WQ3A 4MEWA 3HX4A 1NCYA 1RFJA 2F3ZA 1NYAA 2JNFA 2JT0A 1HT9A 1CFDA 3AKAA 2I94A 1TN4A 2K8MB 3WXAA 2BCXA 2D8NA 2LMUA 2M29A 1BJFA 1CM1A 1JF0A 3BUXB 3TUYB 1XFYO 3DF0A 4QJ4B 2WC8A 5CPVA 2SASA 1DTLA 1KCYA 1NUBA 1OOJA 2CCMA 3EVUA 1AUIB 1CFFA 2M1UA 2NCOA 1NCXA 2I18A 1WRKA 2LLTA 1DT7B 1WDCB 3PLFB 2SCPA 1SBJA 1XA5A 4PDZA 3GK2A 4ORAB 3VRRA 3AAJA 2Y5IA 4NDDA 1DJGA 5I2LA 1LKJA 2L4HA 2FJUB 4HREE 5J3XA 1DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8H A;  1SPY A;  3LK0 A;  1QX7 A;  3NSI A;  1K96 A;  2L0P A;  3DVK A;  2COL B;  5I2O A;  2Y4Q A;  3SG3 A;  3WHU B;  5KTY A;  4GGF C;  3RM1 A;  1CDL A;  2JTZ A;  2ISD A;  1SNL A;  4CFR A;  1MQ1 A;  2K2A A;  1FW4 A;  4YGB B;  3ZNI A;  4WRI A;  1LA3 A;  2CTN A;  2OTG B;  1B7T Y;  1GGZ A;  2JU0 A;  3BUO B;  2LP3 A;  4Q04 A;  4GUK A;  5CSN A;  1H4B A;  3TDZ A;  3GK4 X;  1CM4 A;  5GQQ C;  1EH2 A;  1BR1 B;  1E8A A;  1UHH A;  1SL9 A;  1XK4 A;  1KFU L;  1V1G A;  2WOS A;  1DMO A;  2L5X B;  4PAL A;  2NXQ A;  2M7N A;  4MBE A;  2BL0 C;  1REC A;  1JUO A;  1Y1A A;  2PAS A;  1DJW A;  4NDC A;  1A4P A;  4YGD B;  5HKY A;  1CFP A;  3JVT C;  2G9B A;  1L2O C;  1Y0V H;  2LVK A;  4XJK A;  4PE4 A;  2MAZ A;  1J1D A;  3TUY C;  3KO0 A;  2IS9 A;  4U8D A;  2EC6 B;  2M49 B;  1S5G Z;  1BF5 A;  1KFU S;  1S6C A;  3OHM B;  2RGI A;  1J55 A;  1KQV A;  3PAL A;  1RTP 1;  1PSB A;  2KSP A;  5AEQ A;  2Q4U A;  2KAY A;  3JTD C;  3OB1 B;  1KK7 Z;  1NX2 A;  2MBX A;  1A75 B;  2QPT A;  2M8U A;  3WNX B;  2LUC A;  5I8N A;  2KBI A;  1ZUZ A;  3DF0 B;  2KGB C;  5AAN A;  2JNX A;  2B1U A;  1TNP A;  4HSZ A;  3H4S E;  2F3Y A;  3GK1 A;  2BCB A;  3O2P A;  2CT9 A;  2JC2 A;  1KK8 B;  1H8B A;  1SY9 A;  1K93 D;  1B4C A;  1A75 A;  1M31 A;  5F6T A;  4A4C A;  2ZFD A;  1CKK A;  2KHN A;  4PHJ A;  4TNC A;  1OMD A;  2BBN A;  2LM5 A;  3SG5 A;  4A4B A;  1DVI A;  1KK8 C;  1XFW O;  1L7Z A;  1J1E A;  2PVB A;  2KQ6 A;  1OZO A;  3FS7 A;  1DJZ A;  1WRL A;  3CTN A;  4CPV A;  1MXL C;  1X02 A;  1NCZ A;  3WHT B;  2HF5 A;  1TTX A;  1UHN A;  2FOT A;  2M3W A;  3TDI A;  2JRF A;  2ZND A;  1BG1 A;  1GJY A;  3GOF A;  4DRW A;  1OSA A;  1N2D A;  1S1E A;  1SK6 D;  4MRY A;  5BPJ A;  1B8R A;  3CZT X;  1MF8 B;  1BMO A;  1ZMZ A;  3CGA A;  2EHB A;  2BE6 A;  5D69 A;  2JWW A;  2WOR A;  1MR8 A;  1RRO A;  5DKR A;  1C7V A;  3KPX A;  5ER5 A;  1CB1 A;  1FI6 A;  2KFF A;  1QV1 A;  1DJH A;  1SMG A;  1B7T Z;  2M9G A;  4HRG A;  4MSP A;  1SCM B;  4AOM A;  3EK8 A;  1FF1 A;  1WLZ A;  2BL0 B;  2OTG C;  1JBA A;  2MLE C;  2MLF C;  2K7D A;  2Y1M A;  1F54 A;  4XYN A;  2WCF A;  4ORC B;  4DIR A;  3A8R A;  4PE7 A;  2H61 A;  2L2E A;  1B8C A;  5CSI A;  2LV7 A;  3C1V A;  2JXC A;  5HKW A;  1G8I A;  1CLB A;  1QAT A;  2L50 A;  1G4Y R;  4C0J A;  1EXR A;  4GFT A;  1QX2 A;  1DJI A;  1K9K A;  1QV0 A;  1V1F A;  2V53 A;  3BYA A;  5HYD A;  1F4Q A;  1M45 A;  4I5J A;  3BUM B;  4NDB A;  4I5L B;  4GBA A;  4ICB A;  1CNP A;  1IGV A;  2JOJ A;  5HLV A;  1K90 D;  2L4I A;  2NLN A;  2KAV A;  1CDN A;  1WDC C;  2Y1N A;  2AAO A;  1KWO C;  1XO5 A;  2L51 A;  1R2U A;  3OP0 A;  4IL1 A;  5G08 A;  4D1E A;  2EGD A;  3EK4 A;  4YI9 A;  5ER4 X;  3DVJ A;  1AHR A;  2M1K B;  4YBH B;  4N5X A;  1BOD A;  3LCP C;  1TNQ A;  1BU3 A;  1UWO A;  1XFU O;  1PSR A;  5HKZ A;  5KU1 A;  1N0Y A;  2M97 A;  2LVI A;  2OPO A;  1G33 A;  3FIA A;  4CFQ A;  5HLO A;  1IQ3 A;  5D7F A;  5CSJ A;  3SG7 A;  2O60 A;  4CLN A;  3I5G B;  1Y1U A;  4JPZ B;  4C0K A;  2K7C A;  1UP5 A;  5AFP A;  1PVB A;  1SW8 A;  1PAL A;  4GAO A;  4P2Y B;  1J7Q A;  2JT8 A;  1YRT B;  1UHJ A;  4XJK B;  1UHI A;  1QXP A;  1W7I B;  2DOQ A;  1JFK A;  1N65 A;  1C7W A;  1TNX A;  3JTD B;  2WND A;  2KOT A;  4MZK A;  3SG2 A;  1M46 A;  4M2O A;  1U5I B;  1K9U A;  1D1O A;  1K94 A;  3PN7 C;  1B1G A;  4OCI A;  3FWC A;  4PHK A;  2KFH A;  1MXE A;  2K7O A;  1EL4 A;  1C07 A;  4PHN A;  5IBW A;  1HQV A;  3NSO A;  2R2I A;  4MLW A;  4DCK A;  3OX5 A;  2OS8 B;  2KDH A;  3BUW B;  3IF7 A;  5AXI A;  3KEV A;  1QLK A;  3SG4 A;  1NX0 A;  2NZ0 A;  2OS8 C;  1OQP A;  2PAL A;  1TIZ A;  1TCO B;  1S26 D;  1XYD A;  4GGN A;  1DJX A;  3DVM A;  1QS7 A;  1SR6 B;  1OE9 B;  2JQ6 A;  3LK1 A;  3BUN B;  1ALW A;  1GGW A;  1TOP A;  4YI8 A;  1QAS A;  5B8I B;  3A4U B;  1JF2 A;  1CTR A;  3O6B A;  1NPQ A;  3SG6 A;  1B47 A;  1B9A A;  1PK0 D;  3CS1 A;  5JOL A;  1IRJ A;  1DGU A;  2PRU A;  3HCM A;  1F70 A;  1OZS A;  1QVI Z;  2MRD A;  2LVJ A;  1JC2 A;  1SL7 A;  5K89 A;  3CLN A;  1KFX S;  3BOW A;  2WCE A;  3BXK A;  2K0J A;  1MUX A;  1KSO A;  4YGC B;  1UUS A;  3VRP A;  1MHO A;  3I5F B;  2F33 A;  2ZN9 A;  1CLL A;  1WLM A;  1YUT A;  2M0R A;  3AAK A;  4MZL A;  2LAP A;  3ICB A;  1ZOT B;  2ZRT A;  2JT3 A;  4AQJ A;  1RK9 A;  1LVC D;  3EKJ A;  3QRX A;  4OR9 B;  1IJ5 A;  2KI4 B;  2KNE A;  1OMR A;  4BY5 A;  1CFC A;  2LUX A;  1Y1X A;  1QIV A;  2LE9 B;  4OVN F;  2CXJ A;  1QLS A;  1YVL A;  3EK7 A;  3M0W A;  4MN0 A;  4UPG A;  1KWO B;  2BKI B;  2LMT A;  2F8P A;  2ZKM X;  1QJT A;  4JQ0 D;  2LP2 A;  4MVF A;  4PHM A;  3F45 A;  1A29 A;  2H61 C;  3D0Y A;  1TCF A;  1OMV A;  4OKH A;  1CLM A;  4HRH A;  1WRZ A;  4FTG A;  5TNC A;  3I5H B;  2FCE A;  2HQW A;  2KI6 C;  1AP4 A;  4QJ5 B;  2BE4 A;  4F0Z B;  2NCP A;  3MSE B;  1KQM B;  1J7O A;  2LNK A;  3VGO A;  2KFG A;  3JVT B;  1YX7 A;  2GGZ A;  2LLU A;  5JJG A;  2KBM A;  4DUQ A;  3TDU A;  5KSZ A;  1K8U A;  2F2P A;  1A03 A;  3CR2 A;  1DJY A;  1J7R A;  3KF9 A;  4M2P A;  5DKQ A;  1XFZ O;  1YUU A;  4OV2 A;  1S36 A;  3PFV A;  4R1E A;  4BY4 A;  1ALV A;  1M39 A;  1DGV A;  2BCA A;  5PAL A;  2ZRS A;  2M7L A;  3BOW B;  2FCD A;  2K7B A;  4P5O E;  1XFX O;  3RLZ A;  1FBV A;  2QAC A;  4I5K A;  4CID A;  3OX6 A;  1QIW A;  2JXL A;  1CDP A;  1NP8 A;  1JWD A;  1YR5 A;  2JPT A;  1QX5 B;  2H2K A;  1GQM A;  1R6P A;  3NXA A;  2KYF A;  2LHI A;  1KK7 Y;  3TZ1 A;  1AJ4 A;  2AUC A;  1NX3 A;  2KI6 D;  2L98 A;  2MHH A;  3SJS A;  1QVI Y;  2WCB A;  4E68 A;  4GPL B;  1YX8 A;  2KQY A;  1F55 A;  1PRW A;  2CNP A;  2PMY A;  3CR4 X;  2MA2 A;  4DS7 A;  1SCM C;  1IWQ A;  3PM8 A;  1XK4 C;  1NIW A;  2HQ8 A;  1BOC A;  3O4Y A;  2HET A;  1UUR A;  2KI4 C;  3BQ3 A;  1F71 A;  1S6J A;  1BLQ A;  1EG4 A;  4MZJ A;  1KFX L;  3D0Y B;  4MRX A;  2E30 A;  3LL8 B;  3AKB A;  4ORB B;  4N1F A;  2LAN A;  2LC5 A;  3ZWH A;  1F4O A;  1M63 B;  1J7P A;  1YVH A;  3SIA A;  2I2R E;  3TS5 C;  1FI5 A;  2CBL A;  3FWB A;  1KSM A;  4QJ3 B;  4M2Q A;  1LXF C;  1XFV O;  1SL8 A;  2O5G A;  3IQQ A;  5FYX A;  1QTX A;  1NX1 A;  3I5I B;  1ODB A;  2BEC A;  1LIN A;  2A4J A;  2KYC A;  2GV5 A;  2MJW B;  1SYM A;  2I7A A;  4NQG A;  2HPS A;  1Q80 A;  3I5I C;  1YRU B;  4ETO A;  2GGM A;  1IG5 A;  3DD4 A;  3NSL A;  3O78 A;  3VRN A;  1IJ6 A;  5I2Q A;  1B8L A;  1CMF A;  3EVV A;  2KGR A;  3KHE A;  1JFJ A;  1BR4 B;  1CMG A;  1XVJ A;  2LVV A;  2JUL A;  4L9M A;  3I5G C;  1AJ5 A;  1RJV A;  1S3P A;  3VRO A;  1SRA A;  3I5F C;  2LMV A;  1SCV A;  5CSF A;  1L2O B;  3D10 A;  2F2O A;  1YUR A;  1IH0 A;  1A2X A;  4GGF A;  4USL A;  3K21 A;  5DKN A;  2JZI A;  3DVE A;  3VRQ A;  1LA0 A;  1W7J B;  2KAX A;  2ZNE A;  4JWQ A;  3EKH A;  2ZN8 A;  1ZFS A;  4ZCV A;  1UHK A;  3PN7 B;  3CR5 X;  1S5G Y;  2BKH B;  2EC6 C;  3PSR A;  1IQ5 A;  3CWG A;  1EG3 A;  1TNW A;  3OB2 B;  4FQO A;  4PE0 A;  2K61 A;  4I5N B;  4ZCU A;  2K2F A;  1ZAC A;  4GNK B;  1AK8 A;  1IKU A;  1TRF A;  3E3R A;  4PE1 A;  1JSA A;  1BT6 A;  1K9P A;  1NWD A;  4WQ2 A;  2JTT A;  3LLE A;  1YUS A;  1Y6W A;  1SR6 C;  4YGE B;  1AVS A;  4YGA A;  3PAT A;  5AER A;  4N1G A;  3EVR A;  1EJ3 A;  1SKT A;  1VRK A;  2E6W A;  1U5I A;  2LLS A;  1K2H A;  3IQO A;  2G2B A;  2Q91 A;  1K95 A;  1PVA A;  2LCP A;  2TN4 A;  1DF0 A;  4PCW A;  4AQI A;  2VRG A;  3TS5 B;  4YRU A;  2AMI A;  2P6B B;  1S6I A;  3NSK A;  1MWN A;  2LHL A;  3I5H C;  1CDM A;  1WY9 A;  3SIB A;  1PUL A;  1KQM C;  2PSR A;  1RWY A;  1NSH A;  1YTZ C;  4C0L A;  1FPW A;  2BBM A;  4WQ3 A;  4MEW A;  3HX4 A;  1NCY A;  1RFJ A;  2F3Z A;  1NYA A;  2JNF A;  2JT0 A;  1HT9 A;  1CFD A;  3AKA A;  2I94 A;  1TN4 A;  2K8M B;  3WXA A;  2BCX A;  2D8N A;  2LMU A;  2M29 A;  1BJF A;  1CM1 A;  1JF0 A;  3BUX B;  3TUY B;  1XFY O;  3DF0 A;  4QJ4 B;  2WC8 A;  5CPV A;  2SAS A;  1DTL A;  1KCY A;  1NUB A;  1OOJ A;  2CCM A;  3EVU A;  1AUI B;  1CFF A;  2M1U A;  2NCO A;  1NCX A;  2I18 A;  1WRK A;  2LLT A;  1DT7 B;  1WDC B;  3PLF B;  2SCP A;  1SBJ A;  1XA5 A;  4PDZ A;  3GK2 A;  4ORA B;  3VRR A;  3AAJ A;  2Y5I A;  4NDD A;  1DJG A;  5I2L A;  1LKJ A;  2L4H A;  2FJU B;  4HRE E;  5J3X A;  1DF0 B; 
#chains in the Genus database with same CATH topology
 1F8H A;  1SPY A;  3LK0 A;  1QX7 A;  3NSI A;  1K96 A;  2L0P A;  3DVK A;  2COL B;  5I2O A;  2Y4Q A;  3SG3 A;  3WHU B;  5KTY A;  4GGF C;  3RM1 A;  1CDL A;  2JTZ A;  2ISD A;  1SNL A;  4CFR A;  1MQ1 A;  3S0E A;  2K2A A;  2K60 A;  3NHI A;  1FW4 A;  4YGB B;  3ZNI A;  4WRI A;  1LA3 A;  2CTN A;  2OTG B;  1B7T Y;  1GGZ A;  2JU0 A;  3BUO B;  2LP3 A;  4Q04 A;  4GUK A;  5CSN A;  3FE8 A;  3TDZ A;  1H4B A;  3GK4 X;  1CM4 A;  5GQQ C;  1EH2 A;  1BR1 B;  1E8A A;  1UHH A;  1SL9 A;  1XK4 A;  1KFU L;  1V1G A;  2WOS A;  1DMO A;  2L5X B;  4PAL A;  2NXQ A;  2M7N A;  4MBE A;  2BL0 C;  3S0G A;  1REC A;  1JUO A;  1Y1A A;  2PAS A;  1DJW A;  4NDC A;  1A4P A;  4YGD B;  5HKY A;  1CFP A;  3JVT C;  2G9B A;  1L2O C;  1Y0V H;  2LVK A;  4XJK A;  4PE4 A;  2MAZ A;  1J1D A;  3TUY C;  3KO0 A;  2IS9 A;  4U8D A;  2EC6 B;  2M49 B;  1S5G Z;  1BF5 A;  1KFU S;  1S6C A;  3OHM B;  2RGI A;  1J55 A;  1KQV A;  3PAL A;  1RTP 1;  1PSB A;  2KSP A;  5AEQ A;  2Q4U A;  2KAY A;  3JTD C;  2YGU A;  3OB1 B;  1KK7 Z;  1NX2 A;  3D74 A;  2MBX A;  1A75 B;  2QPT A;  2M8U A;  3WNX B;  2LUC A;  5I8N A;  3S0F A;  2KBI A;  1ZUZ A;  3DF0 B;  2KGB C;  5AAN A;  2JNX A;  2B1U A;  1TNP A;  4HSZ A;  2QEB A;  3H4S E;  3S0B A;  2F3Y A;  3GK1 A;  3PM2 A;  2BCB A;  3O2P A;  2CT9 A;  2JC2 A;  1KK8 B;  1H8B A;  1SY9 A;  1K93 D;  1B4C A;  1A75 A;  1M31 A;  5F6T A;  4A4C A;  1Z2C B;  2ZFD A;  1CKK A;  1TWO A;  2KHN A;  4PHJ A;  4TNC A;  1OMD A;  2BBN A;  2LM5 A;  3SG5 A;  4A4B A;  1DVI A;  1KK8 C;  1DEK A;  1XFW O;  1L7Z A;  1J1E A;  2PVB A;  2KQ6 A;  1OZO A;  3FS7 A;  1DJZ A;  3FE6 A;  3S0A A;  1WRL A;  1OOF A;  3CTN A;  4CPV A;  1MXL C;  1X02 A;  1NCZ A;  3WHT B;  2HF5 A;  2KLD A;  1TTX A;  1UHN A;  2FOT A;  2M3W A;  2QEO A;  2JRF A;  3TDI A;  2ZND A;  1BG1 A;  2WCL A;  1GJY A;  3GOF A;  4DRW A;  1OSA A;  1N2D A;  1S1E A;  1SK6 D;  4MRY A;  5BPJ A;  1B8R A;  3CZT X;  1MF8 B;  1BMO A;  1ZMZ A;  3CGA A;  2EHB A;  2BE6 A;  5D69 A;  3UO9 A;  2JWW A;  2WOR A;  1MR8 A;  1RRO A;  3SS5 A;  5DKR A;  1C7V A;  3KPX A;  5ER5 A;  1CB1 A;  1FI6 A;  2KFF A;  1QV1 A;  1DJH A;  1SMG A;  1B7T Z;  2M9G A;  4HRG A;  4MSP A;  1SCM B;  4AOM A;  3EK8 A;  1FF1 A;  1WLZ A;  2BL0 B;  2OTG C;  1JBA A;  2MLE C;  2MLF C;  2K7D A;  2Y1M A;  1F54 A;  4XYN A;  2WCF A;  4ORC B;  4DIR A;  3A8R A;  4PE7 A;  2H61 A;  2L2E A;  4INW A;  3BFB A;  1B8C A;  5CSI A;  2LV7 A;  3C1V A;  2JXC A;  1TUZ A;  5HKW A;  1G8I A;  1CLB A;  1QAT A;  2L50 A;  1G4Y R;  3FE9 A;  4C0J A;  1EXR A;  4GFT A;  1QX2 A;  1DJI A;  1K9K A;  1QV0 A;  1V1F A;  2V53 A;  3BYA A;  5HYD A;  1F4Q A;  1M45 A;  4I5J A;  3BUM B;  4NDB A;  4I5L B;  4GBA A;  4ICB A;  1CNP A;  1IGV A;  3S0D A;  2JOJ A;  5HLV A;  1K90 D;  2L4I A;  2NLN A;  2KAV A;  1CDN A;  1WDC C;  2Y1N A;  2AAO A;  1KWO C;  1XO5 A;  2L51 A;  1R2U A;  3OP0 A;  4IL1 A;  5G08 A;  4D1E A;  2EGD A;  3EK4 A;  2KPH A;  3IVT A;  4YI9 A;  5ER4 X;  3DVJ A;  3L4A A;  1AHR A;  2H8V A;  2M1K B;  4YBH B;  4N5X A;  1BOD A;  3LCP C;  1TNQ A;  1BU3 A;  1UWO A;  1XFU O;  1PSR A;  5HKZ A;  5KU1 A;  1N0Y A;  2M97 A;  2LVI A;  2OPO A;  1G33 A;  3FIA A;  4CFQ A;  5HLO A;  5HL1 A;  1IQ3 A;  5D7F A;  5CSJ A;  3SG7 A;  2O60 A;  4CLN A;  3I5G B;  3NGV A;  1Y1U A;  4JPZ B;  2WC5 A;  1OOI X;  4C0K A;  2K7C A;  1UP5 A;  5AFP A;  3D78 A;  1PVB A;  1SW8 A;  3SS3 A;  3D75 A;  1XFR A;  1PAL A;  4GAO A;  4P2Y B;  1J7Q A;  2JT8 A;  1YRT B;  1UHJ A;  4XJK B;  3O4X A;  1UHI A;  1QXP A;  1W7I B;  2DOQ A;  1JFK A;  1N65 A;  1C7W A;  1TNX A;  3JTD B;  2WND A;  2KOT A;  4MZK A;  3SG2 A;  1M46 A;  4M2O A;  1U5I B;  1K9U A;  1D1O A;  1K94 A;  3PN7 C;  2WCH A;  1B1G A;  4OCI A;  3FWC A;  4PHK A;  2KFH A;  1MXE A;  2K7O A;  1Z4H A;  1EL4 A;  1C07 A;  4KYN A;  4PHN A;  5IBW A;  1HQV A;  3NSO A;  3D76 A;  2R2I A;  4MLW A;  4DCK A;  3OX5 A;  2OS8 B;  2KDH A;  3BUW B;  3IF7 A;  5AXI A;  3KEV A;  1QLK A;  2QDI A;  3SG4 A;  1NX0 A;  2NZ0 A;  2OS8 C;  1OQP A;  2PAL A;  1TIZ A;  1TCO B;  1S26 D;  1XYD A;  4GGN A;  1DJX A;  1W9Z A;  3DVM A;  1QS7 A;  1SR6 B;  1OE9 B;  5FI6 A;  2JQ6 A;  3LK1 A;  3BUN B;  1ALW A;  1GGW A;  1TOP A;  4YI8 A;  1QAS A;  5B8I B;  3A4U B;  1JF2 A;  3D77 A;  1CTR A;  3N7H A;  3O6B A;  1NPQ A;  3SG6 A;  1B47 A;  1B9A A;  3EG5 B;  1PK0 D;  3CS1 A;  5JOL A;  1IRJ A;  1DGU A;  2PRU A;  3HCM A;  1F70 A;  1OZS A;  1QVI Z;  2ERB A;  2MRD A;  3D73 A;  2LVJ A;  1JC2 A;  1SL7 A;  5K89 A;  3CLN A;  1KFX S;  3BOW A;  1IIO A;  2WCE A;  3BXK A;  1C3Y A;  2K0J A;  1MUX A;  1KSO A;  4YGC B;  1UUS A;  2PYQ A;  3VRP A;  1MHO A;  3I5F B;  2F33 A;  2ZN9 A;  1CLL A;  1WLM A;  1YUT A;  2M0R A;  3AAK A;  4MZL A;  2LAP A;  3ICB A;  1DQE A;  1ZOT B;  2ZRT A;  4INX A;  2JT3 A;  4AQJ A;  1RK9 A;  1LVC D;  1ORG A;  3EKJ A;  3QRX A;  4OR9 B;  1IJ5 A;  2FJY A;  2KI4 B;  1OMR A;  2KNE A;  4BY5 A;  1CFC A;  2LUX A;  1Y1X A;  1QIV A;  2LE9 B;  4OVN F;  3OBV A;  2CXJ A;  1QLS A;  1YVL A;  3EK7 A;  3M0W A;  3QME A;  4MN0 A;  4UPG A;  4PT1 A;  1KWO B;  2BKI B;  2LMT A;  2F8P A;  2ZKM X;  1QJT A;  4JQ0 D;  2LP2 A;  4MVF A;  4IJ7 A;  3CZ1 A;  4PHM A;  3F45 A;  1A29 A;  2H61 C;  3D0Y A;  3DY9 A;  1TCF A;  1OMV A;  4OKH A;  1CLM A;  4HRH A;  1WRZ A;  3CYZ A;  4FTG A;  5TNC A;  3I5H B;  2FCE A;  2HQW A;  2KI6 C;  1AP4 A;  4JD9 A;  4QJ5 B;  2BE4 A;  4F0Z B;  2NCP A;  3MSE B;  1KQM B;  1J7O A;  2LNK A;  3VGO A;  2KFG A;  3JVT B;  1YX7 A;  2GGZ A;  2LLU A;  3R72 A;  5JJG A;  2KBM A;  4DUQ A;  3TDU A;  5KSZ A;  1K8U A;  2F2P A;  3B86 A;  3CR2 A;  1A03 A;  1DJY A;  1J7R A;  3KF9 A;  4M2P A;  5DKQ A;  1XFZ O;  1YUU A;  4OV2 A;  1S36 A;  3B7A A;  3PFV A;  4R1E A;  4BY4 A;  1ALV A;  1M39 A;  1DGV A;  2BCA A;  5PAL A;  2ZRS A;  2M7L A;  3BOW B;  2FCD A;  3DZT A;  2K7B A;  4P5O E;  1XFX O;  3RLZ A;  1FBV A;  2QAC A;  4I5K A;  4CID A;  2GTE A;  3BJH A;  3OX6 A;  1QIW A;  2JXL A;  1CDP A;  1NP8 A;  3Q8I A;  3B88 A;  1YR5 A;  2JPT A;  1QX5 B;  1DEL A;  4FQT A;  2H2K A;  1JWD A;  1GQM A;  2P70 A;  1R6P A;  3NXA A;  2KYF A;  2LHI A;  1KK7 Y;  3TZ1 A;  1AJ4 A;  2QEH A;  2AUC A;  1NX3 A;  1OOG A;  2KI6 D;  2L98 A;  2MHH A;  3B6X A;  5I94 A;  3SJS A;  1QVI Y;  2WCB A;  4E68 A;  4GPL B;  3CZ0 A;  1YX8 A;  2KQY A;  1F55 A;  1PRW A;  2CNP A;  2JPO A;  2PMY A;  2MA2 A;  3CR4 X;  4DS7 A;  1TUJ A;  2WC6 A;  1SCM C;  1IWQ A;  3PM8 A;  1XK4 C;  1NIW A;  2HQ8 A;  1BOC A;  3O4Y A;  2HET A;  1UUR A;  2KI4 C;  3BQ3 A;  3L4L A;  1F71 A;  1S6J A;  1BLQ A;  1EG4 A;  2L2C A;  4MZJ A;  1KFX L;  3D0Y B;  4MRX A;  2E30 A;  3LL8 B;  3AKB A;  4ORB B;  4N1F A;  2LAN A;  2LC5 A;  3ZWH A;  1F4O A;  1M63 B;  1J7P A;  1YVH A;  3SIA A;  2I2R E;  3TS5 C;  3L47 A;  1FI5 A;  2CBL A;  3FWB A;  1KSM A;  3CAB A;  4M2Q A;  4QJ3 B;  3V2L A;  1LXF C;  1XFV O;  1SL8 A;  2BAP A;  2O5G A;  3IQQ A;  5FYX A;  1QTX A;  1NX1 A;  3I5I B;  1ODB A;  2BEC A;  1LIN A;  3CZ2 A;  2A4J A;  2KYC A;  2GV5 A;  2MJW B;  4F7F A;  1SYM A;  2WCM A;  5FI7 A;  2I7A A;  1OW4 A;  4NQG A;  2HPS A;  1Q80 A;  3I5I C;  1YRU B;  4ETO A;  2GGM A;  1IG5 A;  3DD4 A;  2P71 A;  3NSL A;  3O78 A;  1IJ6 A;  3VRN A;  1B8L A;  5I2Q A;  3EVV A;  2KGR A;  1CMF A;  3KHE A;  1JFJ A;  1BR4 B;  1CMG A;  1XVJ A;  2LVV A;  2JUL A;  4L9M A;  3I5G C;  3R1V A;  1AJ5 A;  1RJV A;  1S3P A;  3VRO A;  1SRA A;  3I5F C;  2LMV A;  1SCV A;  1LS8 A;  5CSF A;  1L2O B;  1OOH A;  3D10 A;  2F2O A;  1YUR A;  1IH0 A;  1A2X A;  4GGF A;  4USL A;  3K21 A;  5DKN A;  2JZI A;  1SSE B;  2QEV A;  3DVE A;  1C3Z A;  3VRQ A;  1LA0 A;  1W7J B;  2KAX A;  2ZNE A;  4JWQ A;  3EKH A;  2L5Y A;  2ZN8 A;  1ZFS A;  3CDN A;  1UHK A;  3PN7 B;  4ZCV A;  5FI2 A;  3CR5 X;  1S5G Y;  1T14 A;  2BKH B;  2EC6 C;  3PSR A;  1IQ5 A;  3CWG A;  1EG3 A;  1TNW A;  3OB2 B;  4FQO A;  4PE0 A;  2K61 A;  4I5N B;  4ZCU A;  2K2F A;  1ZAC A;  1GM0 A;  4GNK B;  1AK8 A;  2KLE A;  1IKU A;  1TRF A;  2WCJ A;  3E3R A;  4PE1 A;  3B87 A;  3VB1 A;  1BT6 A;  1K9P A;  1NWD A;  2PQL A;  4WQ2 A;  3RZS A;  1JSA A;  1P28 A;  2JTT A;  3LLE A;  3R1O A;  1YUS A;  2WCK A;  1Y6W A;  1SR6 C;  4YGE B;  1AVS A;  4YGA A;  3PAT A;  4OZD A;  3BFA A;  4N1G A;  5AER A;  3EVR A;  3OGN A;  4JKT A;  1EJ3 A;  1SKT A;  1VRK A;  3BFH A;  2E6W A;  1U5I A;  2LLS A;  1K2H A;  3IQO A;  2G2B A;  2Q91 A;  1K95 A;  1PVA A;  2LCP A;  2TN4 A;  1DF0 A;  4PCW A;  4AQI A;  2VRG A;  3TS5 B;  3PJI A;  4YRU A;  2AMI A;  2P6B B;  1S6I A;  3NSK A;  1MWN A;  2LHL A;  1QWV A;  3I5H C;  1CDM A;  1WY9 A;  3SIB A;  1PUL A;  1KQM C;  2PSR A;  1RWY A;  1NSH A;  1YTZ C;  4C0L A;  1FPW A;  2BBM A;  4WQ3 A;  4MEW A;  5EL2 A;  3HX4 A;  3DXL A;  1NCY A;  1RFJ A;  2F3Z A;  1NYA A;  2JNF A;  2JT0 A;  3NHT A;  1DC1 A;  1HT9 A;  2BNX A;  5DIC A;  1CFD A;  3AKA A;  2I94 A;  1TN4 A;  2K8M B;  3WXA A;  2BCX A;  2D8N A;  2LMU A;  2M29 A;  1BJF A;  1CM1 A;  1JF0 A;  3BUX B;  3TUY B;  3R1P A;  1XFY O;  3DF0 A;  3DYE A;  4QJ4 B;  2WC8 A;  5CPV A;  3UNW A;  2SAS A;  1DTL A;  1KCY A;  1NUB A;  1OOJ A;  3K1E A;  2CCM A;  3EVU A;  1AUI B;  1CFF A;  2M1U A;  2NCO A;  1NCX A;  2I18 A;  1WRK A;  2LLT A;  1DT7 B;  1WDC B;  3PLF B;  2SCP A;  1SBJ A;  3SS4 A;  1XA5 A;  4PDZ A;  3GK2 A;  4ORA B;  3VRR A;  3AAJ A;  2Y5I A;  4NDD A;  1DJG A;  5D3O A;  5I2L A;  1LKJ A;  2L4H A;  2FJU B;  4HRE E;  5J3X A;  1DF0 B; 
#chains in the Genus database with same CATH homology
 1F8H A;  1SPY A;  3LK0 A;  1QX7 A;  3NSI A;  1K96 A;  2L0P A;  3DVK A;  2COL B;  5I2O A;  2Y4Q A;  3SG3 A;  3WHU B;  5KTY A;  4GGF C;  3RM1 A;  1CDL A;  2JTZ A;  2ISD A;  1SNL A;  4CFR A;  1MQ1 A;  2K2A A;  1FW4 A;  4YGB B;  3ZNI A;  4WRI A;  1LA3 A;  2CTN A;  2OTG B;  1B7T Y;  1GGZ A;  2JU0 A;  3BUO B;  2LP3 A;  4Q04 A;  4GUK A;  5CSN A;  1H4B A;  3TDZ A;  3GK4 X;  1CM4 A;  5GQQ C;  1EH2 A;  1BR1 B;  1E8A A;  1UHH A;  1SL9 A;  1XK4 A;  1KFU L;  1V1G A;  2WOS A;  1DMO A;  2L5X B;  4PAL A;  2NXQ A;  2M7N A;  4MBE A;  2BL0 C;  1REC A;  1JUO A;  1Y1A A;  2PAS A;  1DJW A;  4NDC A;  1A4P A;  4YGD B;  5HKY A;  1CFP A;  3JVT C;  2G9B A;  1L2O C;  1Y0V H;  2LVK A;  4XJK A;  4PE4 A;  2MAZ A;  1J1D A;  3TUY C;  3KO0 A;  2IS9 A;  4U8D A;  2EC6 B;  2M49 B;  1S5G Z;  1BF5 A;  1KFU S;  1S6C A;  3OHM B;  2RGI A;  1J55 A;  1KQV A;  3PAL A;  1RTP 1;  1PSB A;  2KSP A;  5AEQ A;  2Q4U A;  2KAY A;  3JTD C;  3OB1 B;  1KK7 Z;  1NX2 A;  2MBX A;  1A75 B;  2QPT A;  2M8U A;  3WNX B;  2LUC A;  5I8N A;  2KBI A;  1ZUZ A;  3DF0 B;  2KGB C;  5AAN A;  2JNX A;  2B1U A;  1TNP A;  4HSZ A;  3H4S E;  2F3Y A;  3GK1 A;  2BCB A;  3O2P A;  2CT9 A;  2JC2 A;  1KK8 B;  1H8B A;  1SY9 A;  1K93 D;  1B4C A;  1A75 A;  1M31 A;  5F6T A;  4A4C A;  2ZFD A;  1CKK A;  2KHN A;  4PHJ A;  4TNC A;  1OMD A;  2BBN A;  2LM5 A;  3SG5 A;  4A4B A;  1DVI A;  1KK8 C;  1XFW O;  1L7Z A;  1J1E A;  2PVB A;  2KQ6 A;  1OZO A;  3FS7 A;  1DJZ A;  1WRL A;  3CTN A;  4CPV A;  1MXL C;  1X02 A;  1NCZ A;  3WHT B;  2HF5 A;  1TTX A;  1UHN A;  2FOT A;  2M3W A;  3TDI A;  2JRF A;  2ZND A;  1BG1 A;  1GJY A;  3GOF A;  4DRW A;  1OSA A;  1N2D A;  1S1E A;  1SK6 D;  4MRY A;  5BPJ A;  1B8R A;  3CZT X;  1MF8 B;  1BMO A;  1ZMZ A;  3CGA A;  2EHB A;  2BE6 A;  5D69 A;  2JWW A;  2WOR A;  1MR8 A;  1RRO A;  5DKR A;  1C7V A;  3KPX A;  5ER5 A;  1CB1 A;  1FI6 A;  2KFF A;  1QV1 A;  1DJH A;  1SMG A;  1B7T Z;  2M9G A;  4HRG A;  4MSP A;  1SCM B;  4AOM A;  3EK8 A;  1FF1 A;  1WLZ A;  2BL0 B;  2OTG C;  1JBA A;  2MLE C;  2MLF C;  2K7D A;  2Y1M A;  1F54 A;  4XYN A;  2WCF A;  4ORC B;  4DIR A;  3A8R A;  4PE7 A;  2H61 A;  2L2E A;  1B8C A;  5CSI A;  2LV7 A;  3C1V A;  2JXC A;  5HKW A;  1G8I A;  1CLB A;  1QAT A;  2L50 A;  1G4Y R;  4C0J A;  1EXR A;  4GFT A;  1QX2 A;  1DJI A;  1K9K A;  1QV0 A;  1V1F A;  2V53 A;  3BYA A;  5HYD A;  1F4Q A;  1M45 A;  4I5J A;  3BUM B;  4NDB A;  4I5L B;  4GBA A;  4ICB A;  1CNP A;  1IGV A;  2JOJ A;  5HLV A;  1K90 D;  2L4I A;  2NLN A;  2KAV A;  1CDN A;  1WDC C;  2Y1N A;  2AAO A;  1KWO C;  1XO5 A;  2L51 A;  1R2U A;  3OP0 A;  4IL1 A;  5G08 A;  4D1E A;  2EGD A;  3EK4 A;  4YI9 A;  5ER4 X;  3DVJ A;  1AHR A;  2M1K B;  4YBH B;  4N5X A;  1BOD A;  3LCP C;  1TNQ A;  1BU3 A;  1UWO A;  1XFU O;  1PSR A;  5HKZ A;  5KU1 A;  1N0Y A;  2M97 A;  2LVI A;  2OPO A;  1G33 A;  3FIA A;  4CFQ A;  5HLO A;  1IQ3 A;  5D7F A;  5CSJ A;  3SG7 A;  2O60 A;  4CLN A;  3I5G B;  1Y1U A;  4JPZ B;  4C0K A;  2K7C A;  1UP5 A;  5AFP A;  1PVB A;  1SW8 A;  1PAL A;  4GAO A;  4P2Y B;  1J7Q A;  2JT8 A;  1YRT B;  1UHJ A;  4XJK B;  1UHI A;  1QXP A;  1W7I B;  2DOQ A;  1JFK A;  1N65 A;  1C7W A;  1TNX A;  3JTD B;  2WND A;  2KOT A;  4MZK A;  3SG2 A;  1M46 A;  4M2O A;  1U5I B;  1K9U A;  1D1O A;  1K94 A;  3PN7 C;  1B1G A;  4OCI A;  3FWC A;  4PHK A;  2KFH A;  1MXE A;  2K7O A;  1EL4 A;  1C07 A;  4PHN A;  5IBW A;  1HQV A;  3NSO A;  2R2I A;  4MLW A;  4DCK A;  3OX5 A;  2OS8 B;  2KDH A;  3BUW B;  3IF7 A;  5AXI A;  3KEV A;  1QLK A;  3SG4 A;  1NX0 A;  2NZ0 A;  2OS8 C;  1OQP A;  2PAL A;  1TIZ A;  1TCO B;  1S26 D;  1XYD A;  4GGN A;  1DJX A;  3DVM A;  1QS7 A;  1SR6 B;  1OE9 B;  2JQ6 A;  3LK1 A;  3BUN B;  1ALW A;  1GGW A;  1TOP A;  4YI8 A;  1QAS A;  5B8I B;  3A4U B;  1JF2 A;  1CTR A;  3O6B A;  1NPQ A;  3SG6 A;  1B47 A;  1B9A A;  1PK0 D;  3CS1 A;  5JOL A;  1IRJ A;  1DGU A;  2PRU A;  3HCM A;  1F70 A;  1OZS A;  1QVI Z;  2MRD A;  2LVJ A;  1JC2 A;  1SL7 A;  5K89 A;  3CLN A;  1KFX S;  3BOW A;  2WCE A;  3BXK A;  2K0J A;  1MUX A;  1KSO A;  4YGC B;  1UUS A;  3VRP A;  1MHO A;  3I5F B;  2F33 A;  2ZN9 A;  1CLL A;  1WLM A;  1YUT A;  2M0R A;  3AAK A;  4MZL A;  2LAP A;  3ICB A;  1ZOT B;  2ZRT A;  2JT3 A;  4AQJ A;  1RK9 A;  1LVC D;  3EKJ A;  3QRX A;  4OR9 B;  1IJ5 A;  2KI4 B;  2KNE A;  1OMR A;  4BY5 A;  1CFC A;  2LUX A;  1Y1X A;  1QIV A;  2LE9 B;  4OVN F;  2CXJ A;  1QLS A;  1YVL A;  3EK7 A;  3M0W A;  4MN0 A;  4UPG A;  1KWO B;  2BKI B;  2LMT A;  2F8P A;  2ZKM X;  1QJT A;  4JQ0 D;  2LP2 A;  4MVF A;  4PHM A;  3F45 A;  1A29 A;  2H61 C;  3D0Y A;  1TCF A;  1OMV A;  4OKH A;  1CLM A;  4HRH A;  1WRZ A;  4FTG A;  5TNC A;  3I5H B;  2FCE A;  2HQW A;  2KI6 C;  1AP4 A;  4QJ5 B;  2BE4 A;  4F0Z B;  2NCP A;  3MSE B;  1KQM B;  1J7O A;  2LNK A;  3VGO A;  2KFG A;  3JVT B;  1YX7 A;  2GGZ A;  2LLU A;  5JJG A;  2KBM A;  4DUQ A;  3TDU A;  5KSZ A;  1K8U A;  2F2P A;  1A03 A;  3CR2 A;  1DJY A;  1J7R A;  3KF9 A;  4M2P A;  5DKQ A;  1XFZ O;  1YUU A;  4OV2 A;  1S36 A;  3PFV A;  4R1E A;  4BY4 A;  1ALV A;  1M39 A;  1DGV A;  2BCA A;  5PAL A;  2ZRS A;  2M7L A;  3BOW B;  2FCD A;  2K7B A;  4P5O E;  1XFX O;  3RLZ A;  1FBV A;  2QAC A;  4I5K A;  4CID A;  3OX6 A;  1QIW A;  2JXL A;  1CDP A;  1NP8 A;  1JWD A;  1YR5 A;  2JPT A;  1QX5 B;  2H2K A;  1GQM A;  1R6P A;  3NXA A;  2KYF A;  2LHI A;  1KK7 Y;  3TZ1 A;  1AJ4 A;  2AUC A;  1NX3 A;  2KI6 D;  2L98 A;  2MHH A;  3SJS A;  1QVI Y;  2WCB A;  4E68 A;  4GPL B;  1YX8 A;  2KQY A;  1F55 A;  1PRW A;  2CNP A;  2PMY A;  3CR4 X;  2MA2 A;  4DS7 A;  1SCM C;  1IWQ A;  3PM8 A;  1XK4 C;  1NIW A;  2HQ8 A;  1BOC A;  3O4Y A;  2HET A;  1UUR A;  2KI4 C;  3BQ3 A;  1F71 A;  1S6J A;  1BLQ A;  1EG4 A;  4MZJ A;  1KFX L;  3D0Y B;  4MRX A;  2E30 A;  3LL8 B;  3AKB A;  4ORB B;  4N1F A;  2LAN A;  2LC5 A;  3ZWH A;  1F4O A;  1M63 B;  1J7P A;  1YVH A;  3SIA A;  2I2R E;  3TS5 C;  1FI5 A;  2CBL A;  3FWB A;  1KSM A;  4QJ3 B;  4M2Q A;  1LXF C;  1XFV O;  1SL8 A;  2O5G A;  3IQQ A;  5FYX A;  1QTX A;  1NX1 A;  3I5I B;  1ODB A;  2BEC A;  1LIN A;  2A4J A;  2KYC A;  2GV5 A;  2MJW B;  1SYM A;  2I7A A;  4NQG A;  2HPS A;  1Q80 A;  3I5I C;  1YRU B;  4ETO A;  2GGM A;  1IG5 A;  3DD4 A;  3NSL A;  3O78 A;  3VRN A;  1IJ6 A;  5I2Q A;  1B8L A;  1CMF A;  3EVV A;  2KGR A;  3KHE A;  1JFJ A;  1BR4 B;  1CMG A;  1XVJ A;  2LVV A;  2JUL A;  4L9M A;  3I5G C;  1AJ5 A;  1RJV A;  1S3P A;  3VRO A;  1SRA A;  3I5F C;  2LMV A;  1SCV A;  5CSF A;  1L2O B;  3D10 A;  2F2O A;  1YUR A;  1IH0 A;  1A2X A;  4GGF A;  4USL A;  3K21 A;  5DKN A;  2JZI A;  3DVE A;  3VRQ A;  1LA0 A;  1W7J B;  2KAX A;  2ZNE A;  4JWQ A;  3EKH A;  2ZN8 A;  1ZFS A;  4ZCV A;  1UHK A;  3PN7 B;  3CR5 X;  1S5G Y;  2BKH B;  2EC6 C;  3PSR A;  1IQ5 A;  3CWG A;  1EG3 A;  1TNW A;  3OB2 B;  4FQO A;  4PE0 A;  2K61 A;  4I5N B;  4ZCU A;  2K2F A;  1ZAC A;  4GNK B;  1AK8 A;  1IKU A;  1TRF A;  3E3R A;  4PE1 A;  1JSA A;  1BT6 A;  1K9P A;  1NWD A;  4WQ2 A;  2JTT A;  3LLE A;  1YUS A;  1Y6W A;  1SR6 C;  4YGE B;  1AVS A;  4YGA A;  3PAT A;  5AER A;  4N1G A;  3EVR A;  1EJ3 A;  1SKT A;  1VRK A;  2E6W A;  1U5I A;  2LLS A;  1K2H A;  3IQO A;  2G2B A;  2Q91 A;  1K95 A;  1PVA A;  2LCP A;  2TN4 A;  1DF0 A;  4PCW A;  4AQI A;  2VRG A;  3TS5 B;  4YRU A;  2AMI A;  2P6B B;  1S6I A;  3NSK A;  1MWN A;  2LHL A;  3I5H C;  1CDM A;  1WY9 A;  3SIB A;  1PUL A;  1KQM C;  2PSR A;  1RWY A;  1NSH A;  1YTZ C;  4C0L A;  1FPW A;  2BBM A;  4WQ3 A;  4MEW A;  3HX4 A;  1NCY A;  1RFJ A;  2F3Z A;  1NYA A;  2JNF A;  2JT0 A;  1HT9 A;  1CFD A;  3AKA A;  2I94 A;  1TN4 A;  2K8M B;  3WXA A;  2BCX A;  2D8N A;  2LMU A;  2M29 A;  1BJF A;  1CM1 A;  1JF0 A;  3BUX B;  3TUY B;  1XFY O;  3DF0 A;  4QJ4 B;  2WC8 A;  5CPV A;  2SAS A;  1DTL A;  1KCY A;  1NUB A;  1OOJ A;  2CCM A;  3EVU A;  1AUI B;  1CFF A;  2M1U A;  2NCO A;  1NCX A;  2I18 A;  1WRK A;  2LLT A;  1DT7 B;  1WDC B;  3PLF B;  2SCP A;  1SBJ A;  1XA5 A;  4PDZ A;  3GK2 A;  4ORA B;  3VRR A;  3AAJ A;  2Y5I A;  4NDD A;  1DJG A;  5I2L A;  1LKJ A;  2L4H A;  2FJU B;  4HRE E;  5J3X A;  1DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...