1C3ZA

Thp12-carrier protein from yellow meal worm
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THP12 CARRIER PROTEIN
publication title A new class of hexahelical insect proteins revealed as putative carriers of small hydrophobic ligands.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1c3zA00
5EL2A 4OZDA 2WCJA 3CDNA 3R1VA 4FQTA 5DICA 3PJIA 3NHTA 4F7FA 1GM0A 3CZ1A 2WCKA 2L2CA 2WCLA 3D77A 3NHIA 2GTEA 3DY9A 3R1PA 3RZSA 2PQLA 3DYEA 3BFHA 3B6XA 1XFRA 3D74A 1QWVA 3B7AA 1OOFA 4INXA 2H8VA 3S0DA 3NGVA 2WC6A 3S0FA 2QEHA 2ERBA 3FE6A 3S0AA 1C3ZA 3BFBA 3CYZA 3D73A 1T14A 3B86A 3FE9A 3Q8IA 2QEVA 3B87A 2WC5A 3K1EA 1TWOA 3D78A 3CABA 2QEBA 4JD9A 1OOHA 1OOGA 2JPOA 3R72A 3CZ2A 2QDIA 2FJYA 3QMEA 3S0GA 3L4LA 2QEOA 3D76A 3N7HA 2WCHA 3FE8A 3OGNA 3B88A 3DZTA 4INWA 3VB1A 3L4AA 1C3YA 3L47A 3D75A 3BFAA 3CZ0A 1ORGA 1P28A 3V2LA 3S0EA 1OOIX 4PT1A 1LS8A 3R1OA 2WCMA 1OW4A 2KPHA 1TUJA 3BJHA 3S0BA 2P70A 2P71A 1DQEA 3DXLA
chains in the Genus database with same CATH superfamily
1CTRA 3PLFB 2KFHA 2WNDA 1YTZC 1K93D 1AP4A 3R1VA 1PULA 2M49B 2LUCA 1KK7Y 1ZOTB 1TCOB 1M46A 2I7AA 5DICA 2LAPA 3DVMA 1DJIA 4PE7A 1SR6B 1K90D 2FJUB 3CWGA 2M1UA 1YUSA 1SL9A 2M97A 4GGNA 1TNWA 3CZ1A 1JWDA 2KGRA 3CTNA 2WCKA 3GOFA 5I2OA 1Y1AA 1L7ZA 2WCLA 1KCYA 3D77A 3GK4X 3NHIA 1QXPA 1BOCA 4BY5A 1CKKA 2JQ6A 3BUXB 4YGEB 2PMYA 1A2XA 1CFDA 1CB1A 3KO0A 3DYEA 5G08A 4PALA 4MZJA 2HF5A 1QWVA 4CIDA 2KFGA 3B7AA 2LMUA 3KHEA 1QTXA 2GGZA 1CFCA 2K8MB 2KDHA 2IS9A 1CM4A 3CR4X 2H8VA 2PVBA 3S0DA 1EH2A 3JVTB 2G9BA 1NCYA 1G33A 3K21A 4P2YB 3S0FA 1H4BA 1LVCD 3PN7B 4PDZA 2WC8A 1CNPA 2HQ8A 1TOPA 1KQVA 1N0YA 1QIWA 1MQ1A 2A4JA 3CYZA 2M7NA 3D73A 4PHJA 4YBHB 4DIRA 2JWWA 1T14A 2NLNA 2WCBA 1S26D 3FS7A 2M29A 3Q8IA 1OMVA 2QEVA 4L9MA 4OR9B 4YI8A 1NX2A 5TNCA 1FPWA 2F3YA 3D0YB 5AEQA 4DCKA 1S6JA 1U5IA 2BL0B 1OOHA 3LCPC 3PSRA 2JRFA 3OHMB 4PHNA 3CZ2A 2FJYA 4IL1A 2LHLA 1MXEA 2NZ0A 4PE0A 1JSAA 1OMRA 1SNLA 3CZTX 3QMEA 1XYDA 4PHKA 1J1EA 3S0GA 5I94A 1NCZA 3D10A 1DJHA 1YVLA 2PASA 3NSKA 1SR6C 1NX1A 1IQ5A 1LKJA 1S5GY 1XFUO 4E68A 2BCXA 1AJ4A 1RK9A 1KSOA 1LA0A 1L2OB 4NQGA 3DF0A 2ZNDA 1UHHA 3M0WA 1K9KA 1A75A 1EXRA 2NCPA 3H4SE 1KFXL 5CPVA 4PHMA 2CT9A 2KHNA 4MN0A 2F2OA 3PATA 5DKNA 1DEKA 3OBVA 3V2LA 1SW8A 1XVJA 3LLEA 4HRGA 2OTGB 2L5XB 1EL4A 4GPLB 1OE9B 2M3WA 3I5FB 1OZOA 2JNXA 2ISDA 1R2UA 5K89A 3JVTC 4OVNF 3SG5A 3TS5B 1A4PA 1DTLA 1V1FA 2JZIA 3WXAA 1CFFA 2KQYA 4JQ0D 1B47A 2CCMA 4N1FA 1QIVA 3PN7C 1Z2CB 1LA3A 2CBLA 1H8BA 5PALA 1QX7A 2JULA 1UP5A 2D8NA 1CM1A 2JTTA 2I2RE 2LVIA 1YRUB 2KOTA 2TN4A 3SS3A 2VRGA 4HSZA 3WHTB 1JFJA 3MSEB 1HQVA 4MEWA 4C0LA 2WORA 2LC5A 1MR8A 2M1KB 1LXFC 2JTZA 2O5GA 1F8HA 4FQTA 4PCWA 1MXLC 1KQMB 2BL0C 4KYNA 2JPTA 1WDCB 1DGUA 1DJWA 1S3PA 4UPGA 2JXCA 4GAOA 3RLZA 4YRUA 1SSEB 4ZCVA 1K9UA 2MA2A 2JT0A 1MHOA 1GM0A 5CSFA 2DOQA 2LCPA 1CLBA 1CLLA 2ZN9A 5ER4X 3UO9A 1A03A 1IJ5A 1DJZA 4Q04A 2K60A 2LP3A 3NXAA 4CFRA 1M45A 1HT9A 4XJKA 1NIWA 2QACA 2E6WA 2BCAA 1QLKA 2EC6B 2Y4QA 4ORCB 1CFPA 1L2OC 1UWOA 5HKYA 1SL7A 1S36A 1XFRA 1ZACA 3BXKA 2KI6D 2HETA 1C7WA 4JKTA 1QS7A 3TUYB 1XK4C 2BE6A 1NX3A 2F3ZA 1KK7Z 4JWQA 2HPSA 2QEHA 2OTGC 3A8RA 3LL8B 1QLSA 3E3RA 2LVKA 3FWBA 2ERBA 3C1VA 3FE6A 4N5XA 3RM1A 3I5FC 5J3XA 4NDDA 1JUOA 4OCIA 5B8IB 4QJ4B 1DVIA 1TTXA 3AKAA 3TS5C 1PK0D 1QV0A 2KI6C 3CGAA 1BU3A 3IF7A 5GQQC 4XYNA 4GUKA 2QEBA 3EKHA 1PRWA 2JPOA 1M31A 3OX6A 2KLDA 3I5IB 3WNXB 2BECA 2LMTA 2Y1NA 3EK4A 3O4XA 4M2PA 2QEOA 3EKJA 3FWCA 1AK8A 1KQMC 1TNPA 1FBVA 1WDCC 2WCHA 3BUMB 1F4OA 5FI6A 1DJYA 3FE8A 3I5HB 5AXIA 1FF1A 3B88A 5FI2A 2KAVA 2LNKA 2YGUA 3WHUB 1FI6A 3OP0A 1BG1A 3KPXA 1K9PA 1YVHA 2JOJA 3BOWB 3VB1A 3VROA 1KFUS 4TNCA 2LANA 3O6BA 4OV2A 4ETOA 1TIZA 3L47A 1C3YA 4PE1A 1FI5A 3A4UB 3UNWA 5KU1A 3CZ0A 1ORGA 3EVRA 2EC6C 2KGBC 2MLEC 5CSIA 3S0EA 4YGDB 3SS5A 4DS7A 4HREE 1YR5A 1OOIX 5BPJA 2L51A 5ER5A 2BNXA 2KQ6A 4I5NB 1UHNA 2KSPA 4PT1A 1LS8A 2CNPA 1XFXO 4OKHA 1Y1UA 2MJWB 2ZKMX 3SIBA 3TUYC 2KAXA 2CXJA 2KYFA 1GQMA 1SMGA 1UURA 2WCMA 1OW4A 1WRLA 3SIAA 1DC1A 3BJHA 2V53A 1OZSA 3D0YA 3S0BA 4WQ2A 1S5GZ 1IJ6A 1JBAA 5F6TA 1G8IA 4ORBB 1BJFA 1UUSA 3DXLA 1CDNA 2JT8A 1J55A 3ZNIA 2F33A 1GGZA 1DJGA 1ALVA 1RECA 2GGMA 2WCJA 3CDNA 1AUIB 4OZDA 1UHIA 1WLZA 1SL8A 1WRKA 3TDUA 1K96A 1RROA 1DJXA 2BKIB 5JJGA 2L4HA 2LLTA 4HRHA 1TNXA 1K8UA 2LVJA 4CPVA 3BUNB 4C0KA 4DRWA 1WLMA 3TDZA 1SCMB 1J7QA 4JPZB 1IKUA 3NHTA 4F7FA 1NSHA 1Y1XA 1ZUZA 3I5IC 1W7IB 2LM5A 1OOJA 4DUQA 2L2CA 3NSIA 3PM8A 1J1DA 2LE9B 1N2DA 3TDIA 1ODBA 2JNFA 1DELA 3OB2B 4BY4A 3VGOA 2NXQA 1Z4HA 1F70A 1B8CA 2AUCA 3I5HC 1BMOA 1XK4A 3IVTA 2L5YA 3AAJA 1M39A 4ZCUA 4A4CA 5IBWA 2R2IA 4U8DA 3BFHA 4AQIA 1KWOB 1NWDA 2P6BB 5FI7A 1PSBA 3D74A 2AMIA 1PSRA 1CDLA 2ZRSA 2F8PA 1OOFA 4NDCA 1UHJA 2L0PA 4INXA 1D1OA 2BKHB 2Y1MA 1YX7A 1OQPA 2K7BA 1UHKA 3IQQA 3NGVA 3TZ1A 2K2FA 2MLFC 2FCEA 3LK0A 1KFXS 1N65A 1SRAA 1RWYA 1JFKA 1MUXA 1C3ZA 3BFBA 3O2PA 1B7TY 1SBJA 2LHIA 2K2AA 1QX5B 1QX2A 3B86A 2KYCA 3PFVA 1W7JB 3B87A 2WC5A 2I18A 3ICBA 4MVFA 3EVVA 3GK1A 1AVSA 3CABA 4MBEA 1BLQA 4JD9A 1F71A 3PALA 1OOGA 3SG2A 3R72A 2LV7A 3GK2A 2AAOA 2LLUA 1A29A 1QVIY 2MAZA 3VRQA 1E8AA 2GV5A 1NPQA 4USLA 4D1EA 5KSZA 4WRIA 1BR1B 1S6CA 2KI4C 4GGFC 5D3OA 4C0JA 1SCMC 2I94A 1X02A 2L98A 1SK6D 1KSMA 1YURA 1ZFSA 1SKTA 1S6IA 2CTNA 2O60A 2SASA 1TNQA 2KBIA 3OGNA 1VRKA 4GBAA 5AFPA 1F4QA 1JC2A 1BT6A 1QASA 1YRTB 1QV1A 3CLNA 1YUTA 3DZTA 1XFWO 2K7DA 3EK7A 4INWA 4YGAA 3DVJA 3VRRA 1B8RA 4MRXA 5HKWA 5FYXA 1S1EA 3JTDB 5D7FA 3D75A 3BFAA 2LMVA 3F45A 1BODA 3QRXA 1BR4B 2BE4A 3PM2A 2Q91A 2H61C 3SG3A 2K7OA 2FCDA 1KWOC 4MRYA 3DVEA 4WQ3A 1NYAA 5DKQA 1KFUL 2EGDA 3IQOA 3RZSA 3SS4A 1GJYA 5CSNA 2BCBA 3R1OA 2KNEA 2EHBA 5AANA 1IGVA 2LLSA 1SY9A 2KLEA 1K95A 1NUBA 2KPHA 1C07A 1FW4A 1MWNA 3VRNA 1XFZO 1SCVA 1CDPA 2P70A 1KK8B 2L50A 3DD4A 4ICBA 5EL2A 2JXLA 1CLMA 3NSOA 1PVBA 1GGWA 2PRUA 1C7VA 1XFYO 1Y0VH 2SCPA 1RJVA 2PYQA 1U5IB 1JF0A 3BQ3A 3PJIA 1B4CA 2M9GA 3OX5A 2WCFA 2WOSA 2Q4UA 3KF9A 3HX4A 3CR2A 2LVVA 3NSLA 1J7OA 4ORAB 5HKZA 4QJ5B 5CSJA 1DF0B 3CR5X 3BOWA 3EG5B 1SPYA 2QPTA 2GTEA 1WY9A 1SYMA 1PVAA 1Q80A 2K0JA 3DY9A 1RTP1 2OS8B 3R1PA 5KTYA 4FTGA 2H2KA 1W9ZA 2PQLA 1B8LA 1V1GA 1AHRA 2F2PA 2L2EA 2ZRTA 1NX0A 1YX8A 4I5LB 4MLWA 4F0ZB 5I2QA 2E30A 1TUZA 4P5OE 3B6XA 3DF0B 1Y6WA 3AAKA 4CFQA 1A75B 2FOTA 1G4YR 1M63B 3JTDC 1XA5A 3VRPA 4YGBB 2OPOA 1AJ5A 2KI4B 3SG4A 4CLNA 1B1GA 4QJ3B 1DF0A 1B9AA 1XO5A 2WC6A 3HCMA 5HLOA 3DVKA 4R1EA 1TN4A 3SJSA 2NCOA 1TCFA 1IH0A 1J7PA 3S0AA 2JU0A 2LUXA 3I5GB 3SG6A 5HLVA 1BF5A 4PE4A 2ZN8A 1NCXA 2BBNA 5JOLA 2MRDA 4M2OA 2MBXA 3FE9A 2JT3A 1QATA 2BBMA 2PSRA 2KAYA 3K1EA 1TWOA 2HQWA 3D78A 3EVUA 1IIOA 2M8UA 3O4YA 2RGIA 3BYAA 1CMFA 1EJ3A 1EG3A 1KK8C 4GGFA 4IJ7A 1LINA 4GNKB 5I8NA 1IQ3A 1WRZA 1IWQA 2QDIA 4A4BA 1DGVA 1IG5A 1OSAA 2G2BA 3CS1A 1ALWA 1OMDA 3L4LA 3FIAA 2ZFDA 1QJTA 3D76A 1MF8B 1K2HA 3N7HA 4YGCB 5HYDA 5AERA 1JF2A 3SG7A 3AKBA 1R6PA 4I5KA 2M0RA 1TRFA 4FQOA 1XFVO 2H61A 4GFTA 3OB1B 4MZKA 1B7TZ 1RFJA 2JC2A 1J7RA 3L4AA 2Y5IA 2ZNEA 2OS8C 1CDMA 4XJKB 4M2QA 4N1GA 5I2LA 3ZWHA 5D69A 4AQJA 1P28A 2COLB 2LP2A 1F55A 2WCEA 5HL1A 1DT7B 1CMGA 1NP8A 1ZMZA 3O78A 2MHHA 4I5JA 2M7LA 1YUUA 2L4IA 3LK1A 1K94A 4NDBA 3KEVA 1QVIZ 3EK8A 1PALA 2K7CA 2K61A 3BUWB 2B1UA 4MZLA 4YI9A 1DMOA 2PALA 5DKRA 3BUOB 1TUJA 4AOMA 4MSPA 2KBMA 3I5GC 1IRJA 1EG4A 1F54A 2KFFA 2BAPA 2P71A 1DQEA
chains in the Genus database with same CATH topology
5EL2A 4OZDA 2WCJA 3CDNA 3R1VA 4FQTA 5DICA 3PJIA 3NHTA 4F7FA 1GM0A 3CZ1A 2WCKA 2L2CA 2WCLA 3D77A 3NHIA 2GTEA 3DY9A 3R1PA 3RZSA 2PQLA 3DYEA 3BFHA 3B6XA 1XFRA 3D74A 1QWVA 3B7AA 1OOFA 4INXA 2H8VA 3S0DA 3NGVA 2WC6A 3S0FA 2QEHA 2ERBA 3FE6A 3S0AA 1C3ZA 3BFBA 3CYZA 3D73A 1T14A 3B86A 3FE9A 3Q8IA 2QEVA 3B87A 2WC5A 3K1EA 1TWOA 3D78A 3CABA 2QEBA 4JD9A 1OOHA 1OOGA 2JPOA 3R72A 3CZ2A 2QDIA 2FJYA 3QMEA 3S0GA 3L4LA 2QEOA 3D76A 3N7HA 2WCHA 3FE8A 3OGNA 3B88A 3DZTA 4INWA 3VB1A 3L4AA 1C3YA 3L47A 3D75A 3BFAA 3CZ0A 1ORGA 1P28A 3V2LA 3S0EA 1OOIX 4PT1A 1LS8A 3R1OA 2WCMA 1OW4A 2KPHA 1TUJA 3BJHA 3S0BA 2P70A 2P71A 1DQEA 3DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EL2 A;  4OZD A;  2WCJ A;  3CDN A;  3R1V A;  4FQT A;  5DIC A;  3PJI A;  3NHT A;  4F7F A;  1GM0 A;  3CZ1 A;  2WCK A;  2L2C A;  2WCL A;  3D77 A;  3NHI A;  2GTE A;  3DY9 A;  3R1P A;  3RZS A;  2PQL A;  3DYE A;  3BFH A;  3B6X A;  1XFR A;  3D74 A;  1QWV A;  3B7A A;  1OOF A;  4INX A;  2H8V A;  3S0D A;  3NGV A;  2WC6 A;  3S0F A;  2QEH A;  2ERB A;  3FE6 A;  3S0A A;  1C3Z A;  3BFB A;  3CYZ A;  3D73 A;  1T14 A;  3B86 A;  3FE9 A;  3Q8I A;  2QEV A;  3B87 A;  2WC5 A;  3K1E A;  1TWO A;  3D78 A;  3CAB A;  2QEB A;  4JD9 A;  1OOH A;  1OOG A;  2JPO A;  3R72 A;  3CZ2 A;  2QDI A;  2FJY A;  3QME A;  3S0G A;  3L4L A;  2QEO A;  3D76 A;  3N7H A;  2WCH A;  3FE8 A;  3OGN A;  3B88 A;  3DZT A;  4INW A;  3VB1 A;  3L4A A;  1C3Y A;  3L47 A;  3D75 A;  3BFA A;  3CZ0 A;  1ORG A;  1P28 A;  3V2L A;  3S0E A;  1OOI X;  4PT1 A;  1LS8 A;  3R1O A;  2WCM A;  1OW4 A;  2KPH A;  1TUJ A;  3BJH A;  3S0B A;  2P70 A;  2P71 A;  1DQE A;  3DXL A; 
#chains in the Genus database with same CATH topology
 1CTR A;  3PLF B;  2KFH A;  2WND A;  1YTZ C;  1K93 D;  1AP4 A;  3R1V A;  1PUL A;  2M49 B;  2LUC A;  1KK7 Y;  1ZOT B;  1TCO B;  1M46 A;  2I7A A;  5DIC A;  2LAP A;  3DVM A;  1DJI A;  4PE7 A;  1SR6 B;  1K90 D;  2FJU B;  3CWG A;  2M1U A;  1YUS A;  1SL9 A;  2M97 A;  4GGN A;  1TNW A;  3CZ1 A;  1JWD A;  2KGR A;  3CTN A;  2WCK A;  3GOF A;  5I2O A;  1Y1A A;  1L7Z A;  2WCL A;  1KCY A;  3D77 A;  3GK4 X;  3NHI A;  1QXP A;  1BOC A;  4BY5 A;  1CKK A;  2JQ6 A;  3BUX B;  4YGE B;  2PMY A;  1A2X A;  1CFD A;  1CB1 A;  3KO0 A;  3DYE A;  5G08 A;  4PAL A;  4MZJ A;  2HF5 A;  1QWV A;  4CID A;  2KFG A;  3B7A A;  2LMU A;  3KHE A;  1QTX A;  2GGZ A;  1CFC A;  2K8M B;  2KDH A;  2IS9 A;  1CM4 A;  3CR4 X;  2H8V A;  2PVB A;  3S0D A;  1EH2 A;  3JVT B;  2G9B A;  1NCY A;  1G33 A;  3K21 A;  4P2Y B;  3S0F A;  1H4B A;  1LVC D;  3PN7 B;  4PDZ A;  2WC8 A;  1CNP A;  2HQ8 A;  1TOP A;  1KQV A;  1N0Y A;  1QIW A;  1MQ1 A;  2A4J A;  3CYZ A;  2M7N A;  3D73 A;  4PHJ A;  4YBH B;  4DIR A;  2JWW A;  1T14 A;  2NLN A;  2WCB A;  1S26 D;  3FS7 A;  2M29 A;  3Q8I A;  1OMV A;  2QEV A;  4L9M A;  4OR9 B;  4YI8 A;  1NX2 A;  5TNC A;  1FPW A;  2F3Y A;  3D0Y B;  5AEQ A;  4DCK A;  1S6J A;  1U5I A;  2BL0 B;  1OOH A;  3LCP C;  3PSR A;  2JRF A;  3OHM B;  4PHN A;  3CZ2 A;  2FJY A;  4IL1 A;  2LHL A;  1MXE A;  2NZ0 A;  4PE0 A;  1JSA A;  1OMR A;  1SNL A;  3CZT X;  3QME A;  1XYD A;  4PHK A;  1J1E A;  3S0G A;  5I94 A;  1NCZ A;  3D10 A;  1DJH A;  1YVL A;  2PAS A;  3NSK A;  1SR6 C;  1NX1 A;  1IQ5 A;  1LKJ A;  1S5G Y;  1XFU O;  4E68 A;  2BCX A;  1AJ4 A;  1RK9 A;  1KSO A;  1LA0 A;  1L2O B;  4NQG A;  3DF0 A;  2ZND A;  1UHH A;  3M0W A;  1K9K A;  1A75 A;  1EXR A;  2NCP A;  3H4S E;  1KFX L;  5CPV A;  4PHM A;  2CT9 A;  2KHN A;  4MN0 A;  2F2O A;  3PAT A;  5DKN A;  1DEK A;  3OBV A;  3V2L A;  1SW8 A;  1XVJ A;  3LLE A;  4HRG A;  2OTG B;  2L5X B;  1EL4 A;  4GPL B;  1OE9 B;  2M3W A;  3I5F B;  1OZO A;  2JNX A;  2ISD A;  1R2U A;  5K89 A;  3JVT C;  4OVN F;  3SG5 A;  3TS5 B;  1A4P A;  1DTL A;  1V1F A;  2JZI A;  3WXA A;  1CFF A;  2KQY A;  4JQ0 D;  1B47 A;  2CCM A;  4N1F A;  1QIV A;  3PN7 C;  1Z2C B;  1LA3 A;  2CBL A;  1H8B A;  5PAL A;  1QX7 A;  2JUL A;  1UP5 A;  2D8N A;  1CM1 A;  2JTT A;  2I2R E;  2LVI A;  1YRU B;  2KOT A;  2TN4 A;  3SS3 A;  2VRG A;  4HSZ A;  3WHT B;  1JFJ A;  3MSE B;  1HQV A;  4MEW A;  4C0L A;  2WOR A;  2LC5 A;  1MR8 A;  2M1K B;  1LXF C;  2JTZ A;  2O5G A;  1F8H A;  4FQT A;  4PCW A;  1MXL C;  1KQM B;  2BL0 C;  4KYN A;  2JPT A;  1WDC B;  1DGU A;  1DJW A;  1S3P A;  4UPG A;  2JXC A;  4GAO A;  3RLZ A;  4YRU A;  1SSE B;  4ZCV A;  1K9U A;  2MA2 A;  2JT0 A;  1MHO A;  1GM0 A;  5CSF A;  2DOQ A;  2LCP A;  1CLB A;  1CLL A;  2ZN9 A;  5ER4 X;  3UO9 A;  1A03 A;  1IJ5 A;  1DJZ A;  4Q04 A;  2K60 A;  2LP3 A;  3NXA A;  4CFR A;  1M45 A;  1HT9 A;  4XJK A;  1NIW A;  2QAC A;  2E6W A;  2BCA A;  1QLK A;  2EC6 B;  2Y4Q A;  4ORC B;  1CFP A;  1L2O C;  1UWO A;  5HKY A;  1SL7 A;  1S36 A;  1XFR A;  1ZAC A;  3BXK A;  2KI6 D;  2HET A;  1C7W A;  4JKT A;  1QS7 A;  3TUY B;  1XK4 C;  2BE6 A;  1NX3 A;  2F3Z A;  1KK7 Z;  4JWQ A;  2HPS A;  2QEH A;  2OTG C;  3A8R A;  3LL8 B;  1QLS A;  3E3R A;  2LVK A;  3FWB A;  2ERB A;  3C1V A;  3FE6 A;  4N5X A;  3RM1 A;  3I5F C;  5J3X A;  4NDD A;  1JUO A;  4OCI A;  5B8I B;  4QJ4 B;  1DVI A;  1TTX A;  3AKA A;  3TS5 C;  1PK0 D;  1QV0 A;  2KI6 C;  3CGA A;  1BU3 A;  3IF7 A;  5GQQ C;  4XYN A;  4GUK A;  2QEB A;  3EKH A;  1PRW A;  2JPO A;  1M31 A;  3OX6 A;  2KLD A;  3I5I B;  3WNX B;  2BEC A;  2LMT A;  2Y1N A;  3EK4 A;  3O4X A;  4M2P A;  2QEO A;  3EKJ A;  3FWC A;  1AK8 A;  1KQM C;  1TNP A;  1FBV A;  1WDC C;  2WCH A;  3BUM B;  1F4O A;  5FI6 A;  1DJY A;  3FE8 A;  3I5H B;  5AXI A;  1FF1 A;  3B88 A;  5FI2 A;  2KAV A;  2LNK A;  2YGU A;  3WHU B;  1FI6 A;  3OP0 A;  1BG1 A;  3KPX A;  1K9P A;  1YVH A;  2JOJ A;  3BOW B;  3VB1 A;  3VRO A;  1KFU S;  4TNC A;  2LAN A;  3O6B A;  4OV2 A;  4ETO A;  1TIZ A;  3L47 A;  1C3Y A;  4PE1 A;  1FI5 A;  3A4U B;  3UNW A;  5KU1 A;  3CZ0 A;  1ORG A;  3EVR A;  2EC6 C;  2KGB C;  2MLE C;  5CSI A;  3S0E A;  4YGD B;  3SS5 A;  4DS7 A;  4HRE E;  1YR5 A;  1OOI X;  5BPJ A;  2L51 A;  5ER5 A;  2BNX A;  2KQ6 A;  4I5N B;  1UHN A;  2KSP A;  4PT1 A;  1LS8 A;  2CNP A;  1XFX O;  4OKH A;  1Y1U A;  2MJW B;  2ZKM X;  3SIB A;  3TUY C;  2KAX A;  2CXJ A;  2KYF A;  1GQM A;  1SMG A;  1UUR A;  2WCM A;  1OW4 A;  1WRL A;  3SIA A;  1DC1 A;  3BJH A;  2V53 A;  1OZS A;  3D0Y A;  3S0B A;  4WQ2 A;  1S5G Z;  1IJ6 A;  1JBA A;  5F6T A;  1G8I A;  4ORB B;  1BJF A;  1UUS A;  3DXL A;  1CDN A;  2JT8 A;  1J55 A;  3ZNI A;  2F33 A;  1GGZ A;  1DJG A;  1ALV A;  1REC A;  2GGM A;  2WCJ A;  3CDN A;  1AUI B;  4OZD A;  1UHI A;  1WLZ A;  1SL8 A;  1WRK A;  3TDU A;  1K96 A;  1RRO A;  1DJX A;  2BKI B;  5JJG A;  2L4H A;  2LLT A;  4HRH A;  1TNX A;  1K8U A;  2LVJ A;  4CPV A;  3BUN B;  4C0K A;  4DRW A;  1WLM A;  3TDZ A;  1SCM B;  1J7Q A;  4JPZ B;  1IKU A;  3NHT A;  4F7F A;  1NSH A;  1Y1X A;  1ZUZ A;  3I5I C;  1W7I B;  2LM5 A;  1OOJ A;  4DUQ A;  2L2C A;  3NSI A;  3PM8 A;  1J1D A;  2LE9 B;  1N2D A;  3TDI A;  1ODB A;  2JNF A;  1DEL A;  3OB2 B;  4BY4 A;  3VGO A;  2NXQ A;  1Z4H A;  1F70 A;  1B8C A;  2AUC A;  3I5H C;  1BMO A;  1XK4 A;  3IVT A;  2L5Y A;  3AAJ A;  1M39 A;  4ZCU A;  4A4C A;  5IBW A;  2R2I A;  4U8D A;  3BFH A;  4AQI A;  1KWO B;  1NWD A;  2P6B B;  5FI7 A;  1PSB A;  3D74 A;  2AMI A;  1PSR A;  1CDL A;  2ZRS A;  2F8P A;  1OOF A;  4NDC A;  1UHJ A;  2L0P A;  4INX A;  1D1O A;  2BKH B;  2Y1M A;  1YX7 A;  1OQP A;  2K7B A;  1UHK A;  3IQQ A;  3NGV A;  3TZ1 A;  2K2F A;  2MLF C;  2FCE A;  3LK0 A;  1KFX S;  1N65 A;  1SRA A;  1RWY A;  1JFK A;  1MUX A;  1C3Z A;  3BFB A;  3O2P A;  1B7T Y;  1SBJ A;  2LHI A;  2K2A A;  1QX5 B;  1QX2 A;  3B86 A;  2KYC A;  3PFV A;  1W7J B;  3B87 A;  2WC5 A;  2I18 A;  3ICB A;  4MVF A;  3EVV A;  3GK1 A;  1AVS A;  3CAB A;  4MBE A;  1BLQ A;  4JD9 A;  1F71 A;  3PAL A;  1OOG A;  3SG2 A;  3R72 A;  2LV7 A;  3GK2 A;  2AAO A;  2LLU A;  1A29 A;  1QVI Y;  2MAZ A;  3VRQ A;  1E8A A;  2GV5 A;  1NPQ A;  4USL A;  4D1E A;  5KSZ A;  4WRI A;  1BR1 B;  1S6C A;  2KI4 C;  4GGF C;  5D3O A;  4C0J A;  1SCM C;  2I94 A;  1X02 A;  2L98 A;  1SK6 D;  1KSM A;  1YUR A;  1ZFS A;  1SKT A;  1S6I A;  2CTN A;  2O60 A;  2SAS A;  1TNQ A;  2KBI A;  3OGN A;  1VRK A;  4GBA A;  5AFP A;  1F4Q A;  1JC2 A;  1BT6 A;  1QAS A;  1YRT B;  1QV1 A;  3CLN A;  1YUT A;  3DZT A;  1XFW O;  2K7D A;  3EK7 A;  4INW A;  4YGA A;  3DVJ A;  3VRR A;  1B8R A;  4MRX A;  5HKW A;  5FYX A;  1S1E A;  3JTD B;  5D7F A;  3D75 A;  3BFA A;  2LMV A;  3F45 A;  1BOD A;  3QRX A;  1BR4 B;  2BE4 A;  3PM2 A;  2Q91 A;  2H61 C;  3SG3 A;  2K7O A;  2FCD A;  1KWO C;  4MRY A;  3DVE A;  4WQ3 A;  1NYA A;  5DKQ A;  1KFU L;  2EGD A;  3IQO A;  3RZS A;  3SS4 A;  1GJY A;  5CSN A;  2BCB A;  3R1O A;  2KNE A;  2EHB A;  5AAN A;  1IGV A;  2LLS A;  1SY9 A;  2KLE A;  1K95 A;  1NUB A;  2KPH A;  1C07 A;  1FW4 A;  1MWN A;  3VRN A;  1XFZ O;  1SCV A;  1CDP A;  2P70 A;  1KK8 B;  2L50 A;  3DD4 A;  4ICB A;  5EL2 A;  2JXL A;  1CLM A;  3NSO A;  1PVB A;  1GGW A;  2PRU A;  1C7V A;  1XFY O;  1Y0V H;  2SCP A;  1RJV A;  2PYQ A;  1U5I B;  1JF0 A;  3BQ3 A;  3PJI A;  1B4C A;  2M9G A;  3OX5 A;  2WCF A;  2WOS A;  2Q4U A;  3KF9 A;  3HX4 A;  3CR2 A;  2LVV A;  3NSL A;  1J7O A;  4ORA B;  5HKZ A;  4QJ5 B;  5CSJ A;  1DF0 B;  3CR5 X;  3BOW A;  3EG5 B;  1SPY A;  2QPT A;  2GTE A;  1WY9 A;  1SYM A;  1PVA A;  1Q80 A;  2K0J A;  3DY9 A;  1RTP 1;  2OS8 B;  3R1P A;  5KTY A;  4FTG A;  2H2K A;  1W9Z A;  2PQL A;  1B8L A;  1V1G A;  1AHR A;  2F2P A;  2L2E A;  2ZRT A;  1NX0 A;  1YX8 A;  4I5L B;  4MLW A;  4F0Z B;  5I2Q A;  2E30 A;  1TUZ A;  4P5O E;  3B6X A;  3DF0 B;  1Y6W A;  3AAK A;  4CFQ A;  1A75 B;  2FOT A;  1G4Y R;  1M63 B;  3JTD C;  1XA5 A;  3VRP A;  4YGB B;  2OPO A;  1AJ5 A;  2KI4 B;  3SG4 A;  4CLN A;  1B1G A;  4QJ3 B;  1DF0 A;  1B9A A;  1XO5 A;  2WC6 A;  3HCM A;  5HLO A;  3DVK A;  4R1E A;  1TN4 A;  3SJS A;  2NCO A;  1TCF A;  1IH0 A;  1J7P A;  3S0A A;  2JU0 A;  2LUX A;  3I5G B;  3SG6 A;  5HLV A;  1BF5 A;  4PE4 A;  2ZN8 A;  1NCX A;  2BBN A;  5JOL A;  2MRD A;  4M2O A;  2MBX A;  3FE9 A;  2JT3 A;  1QAT A;  2BBM A;  2PSR A;  2KAY A;  3K1E A;  1TWO A;  2HQW A;  3D78 A;  3EVU A;  1IIO A;  2M8U A;  3O4Y A;  2RGI A;  3BYA A;  1CMF A;  1EJ3 A;  1EG3 A;  1KK8 C;  4GGF A;  4IJ7 A;  1LIN A;  4GNK B;  5I8N A;  1IQ3 A;  1WRZ A;  1IWQ A;  2QDI A;  4A4B A;  1DGV A;  1IG5 A;  1OSA A;  2G2B A;  3CS1 A;  1ALW A;  1OMD A;  3L4L A;  3FIA A;  2ZFD A;  1QJT A;  3D76 A;  1MF8 B;  1K2H A;  3N7H A;  4YGC B;  5HYD A;  5AER A;  1JF2 A;  3SG7 A;  3AKB A;  1R6P A;  4I5K A;  2M0R A;  1TRF A;  4FQO A;  1XFV O;  2H61 A;  4GFT A;  3OB1 B;  4MZK A;  1B7T Z;  1RFJ A;  2JC2 A;  1J7R A;  3L4A A;  2Y5I A;  2ZNE A;  2OS8 C;  1CDM A;  4XJK B;  4M2Q A;  4N1G A;  5I2L A;  3ZWH A;  5D69 A;  4AQJ A;  1P28 A;  2COL B;  2LP2 A;  1F55 A;  2WCE A;  5HL1 A;  1DT7 B;  1CMG A;  1NP8 A;  1ZMZ A;  3O78 A;  2MHH A;  4I5J A;  2M7L A;  1YUU A;  2L4I A;  3LK1 A;  1K94 A;  4NDB A;  3KEV A;  1QVI Z;  3EK8 A;  1PAL A;  2K7C A;  2K61 A;  3BUW B;  2B1U A;  4MZL A;  4YI9 A;  1DMO A;  2PAL A;  5DKR A;  3BUO B;  1TUJ A;  4AOM A;  4MSP A;  2KBM A;  3I5G C;  1IRJ A;  1EG4 A;  1F54 A;  2KFF A;  2BAP A;  2P71 A;  1DQE A; 
#chains in the Genus database with same CATH homology
 5EL2 A;  4OZD A;  2WCJ A;  3CDN A;  3R1V A;  4FQT A;  5DIC A;  3PJI A;  3NHT A;  4F7F A;  1GM0 A;  3CZ1 A;  2WCK A;  2L2C A;  2WCL A;  3D77 A;  3NHI A;  2GTE A;  3DY9 A;  3R1P A;  3RZS A;  2PQL A;  3DYE A;  3BFH A;  3B6X A;  1XFR A;  3D74 A;  1QWV A;  3B7A A;  1OOF A;  4INX A;  2H8V A;  3S0D A;  3NGV A;  2WC6 A;  3S0F A;  2QEH A;  2ERB A;  3FE6 A;  3S0A A;  1C3Z A;  3BFB A;  3CYZ A;  3D73 A;  1T14 A;  3B86 A;  3FE9 A;  3Q8I A;  2QEV A;  3B87 A;  2WC5 A;  3K1E A;  1TWO A;  3D78 A;  3CAB A;  2QEB A;  4JD9 A;  1OOH A;  1OOG A;  2JPO A;  3R72 A;  3CZ2 A;  2QDI A;  2FJY A;  3QME A;  3S0G A;  3L4L A;  2QEO A;  3D76 A;  3N7H A;  2WCH A;  3FE8 A;  3OGN A;  3B88 A;  3DZT A;  4INW A;  3VB1 A;  3L4A A;  1C3Y A;  3L47 A;  3D75 A;  3BFA A;  3CZ0 A;  1ORG A;  1P28 A;  3V2L A;  3S0E A;  1OOI X;  4PT1 A;  1LS8 A;  3R1O A;  2WCM A;  1OW4 A;  2KPH A;  1TUJ A;  3BJH A;  3S0B A;  2P70 A;  2P71 A;  1DQE A;  3DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...