1C3ZA

Thp12-carrier protein from yellow meal worm
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords THP12 CARRIER PROTEIN
publication title A new class of hexahelical insect proteins revealed as putative carriers of small hydrophobic ligands.
pubmed doi rcsb
source organism Tenebrio molitor
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1c3zA00
2QEVA 3CDNA 1C3ZA 1ORGA 3NHIA 3B7AA 3B86A 3L47A 3S0FA 2WCLA 3DZTA 2H8VA 3D76A 2PQLA 4JD9A 3S0EA 5EL2A 2WCKA 3V2LA 3CYZA 3PJIA 3R1PA 3DY9A 1OOHA 3BFHA 4FQTA 1T14A 2WCMA 1OW4A 1LS8A 1XFRA 3CZ0A 3D78A 2QEOA 3L4AA 1C3YA 1QWVA 2WCHA 3DYEA 1TWOA 3CZ1A 3BFAA 4INXA 3L4LA 3R1OA 1OOGA 3D74A 3FE6A 3S0AA 3D73A 3OGNA 3NHTA 3D75A 2P70A 1OOFA 2QEHA 3FE8A 5DICA 3B88A 3S0DA 3NGVA 3CABA 2JPOA 2WCJA 2WC5A 3BFBA 2ERBA 4INWA 2FJYA 3CZ2A 3Q8IA 2WC6A 4OZDA 1GM0A 1DQEA 2GTEA 3R72A 2L2CA 3R1VA 3B87A 1OOIX 3VB1A 2QDIA 2QEBA 3N7HA 3FE9A 4F7FA 3DXLA 2P71A 3BJHA 4PT1A 3D77A 3QMEA 3K1EA 3RZSA 3S0GA 3S0BA 3B6XA 1TUJA 2KPHA 1P28A
chains in the Genus database with same CATH superfamily
4IJ7A 2FCDA 2QEVA 2LLSA 3I5HB 1FW4A 3SJSA 3SS5A 2F8PA 1KSOA 1PK0D 3SG5A 1B8CA 1DJWA 2F2OA 3PALA 3TS5C 1M63B 5I2OA 3O6BA 5B8IB 1KQMC 1J55A 2KBIA 2CT9A 3NHIA 1S6IA 4OR9B 3AKBA 2EC6B 3RM1A 1ZMZA 4BY5A 1CDNA 1NUBA 1Y1AA 1ZUZA 3GK2A 1SYMA 2LVJA 2ZRTA 2WORA 4YI8A 1DJZA 3D76A 2JT8A 1WY9A 1KFUS 2I2RE 3NSIA 3VRRA 4P2YB 1KSMA 4E68A 3OP0A 1SCVA 1MF8B 4PE7A 1DJGA 5DKNA 3DD4A 2KI6C 2KFGA 2OTGB 5I8NA 2JU0A 1KK8B 1AP4A 3BUMB 2A4JA 3KO0A 4JWQA 3BUNB 4NDCA 4C0LA 4HREE 3FWBA 2KGRA 3K21A 3PN7B 4OCIA 4WQ3A 2FCEA 4AQIA 4C0KA 2Y4QA 3BUOB 1L2OB 3D10A 1BG1A 2M0RA 2PASA 1Q80A 2JZIA 1C3YA 1CFDA 4PHNA 2KFHA 1BJFA 1SW8A 1OZSA 1K9UA 1M45A 3I5FB 1M31A 2I7AA 1KK7Y 4XYNA 2BAPA 3BFAA 3JTDC 4QJ4B 3L4LA 1SY9A 1U5IB 4GBAA 1CFFA 1SR6C 2KHNA 1CKKA 1OOGA 1ZFSA 1YUUA 4YGDB 3OGNA 1B1GA 1Y1XA 1S3PA 1CMFA 1SKTA 2QEHA 2I94A 4I5JA 2H61A 4NQGA 3VRNA 1IWQA 1W7JB 2LC5A 1ODBA 5KTYA 3EK8A 1VRKA 2ZNDA 2JOJA 1CLBA 1SK6D 1F70A 3O4YA 3JVTC 1CM4A 1N0YA 2SASA 3SIAA 1Z2CB 2QACA 3QRXA 3KF9A 1QIVA 1PVBA 1DELA 1CDMA 1LXFC 1CM1A 1DMOA 2ERBA 2KYFA 4YGAA 2LP3A 1HQVA 3DVKA 1CFCA 1B4CA 1QV0A 1YUTA 2LVKA 4GAOA 2L98A 2M49B 3BQ3A 4OKHA 2K60A 4GFTA 3SIBA 2I18A 1DQEA 1F55A 2WCFA 1SMGA 1GJYA 2K2FA 5ER5A 1UHJA 2WC8A 2L5XB 3GK4X 1OOIX 3OBVA 4IL1A 1IKUA 1BLQA 2QDIA 1XK4A 5ER4X 1ALVA 1SSEB 1MHOA 5CPVA 3BJHA 2E6WA 5I94A 1NPQA 4PT1A 3TDZA 1NX3A 4ICBA 3I5HC 1BR4B 1MXLC 2FOTA 2P6BB 3EK4A 1RTP1 3K1EA 1EJ3A 3VRQA 3RZSA 2L4HA 3LK0A 1AK8A 3CR4X 1ALWA 2JNFA 3DF0A 5JJGA 2BNXA 3AAJA 3AKAA 3I5GB 2E30A 2F3YA 1A29A 5D3OA 1M46A 2BBNA 3D0YA 4PE0A 1UHNA 2EC6C 3RLZA 3ZWHA 1QX2A 4L9MA 1GQMA 2PRUA 3BUWB 1K9KA 1B9AA 1DVIA 1HT9A 1SL7A 1XFWO 2LMUA 2ISDA 1PULA 2OS8B 1K8UA 2KAXA 2LLTA 2JQ6A 3B7AA 4NDBA 2KBMA 2M7NA 3TUYB 2BBMA 3L47A 5CSNA 1FI5A 2M1UA 2JULA 1KQVA 1Y6WA 4DS7A 1JC2A 2NLNA 1S5GY 5G08A 1MR8A 2IS9A 2GV5A 1BODA 1KK8C 1MUXA 1AHRA 1QLKA 4JD9A 3S0EA 2JT3A 1RK9A 3PATA 4CFRA 4JKTA 3PN7C 1IRJA 3V2LA 1EG4A 1JUOA 3CYZA 1TTXA 2Y5IA 1QS7A 3R1PA 2M9GA 4KYNA 4MZJA 1X02A 1YTZC 3BXKA 2HF5A 3DY9A 4M2OA 4TNCA 3ZNIA 1OOJA 2JRFA 2MHHA 3EKHA 2KAYA 3EK7A 1T14A 1RROA 5I2QA 3VGOA 2H2KA 3EVUA 1QTXA 1C7WA 1OW4A 2HQWA 2PSRA 3I5IC 1A03A 1FPWA 3I5FC 1NWDA 2KOTA 3SG7A 1B8RA 3CZ0A 3D78A 4WRIA 4MZKA 1QWVA 2WCHA 2ZN9A 3CR2A 3GK1A 3CR5X 1NCYA 4MSPA 4PHJA 3A4UB 2K7BA 2JXCA 1S5GZ 4CLNA 1LINA 1Y0VH 1F54A 3OB2B 4XJKB 1QVIZ 2HPSA 2KLDA 1DJXA 2BECA 1EXRA 2L51A 3S0AA 1CDPA 3O78A 1DEKA 3D75A 5CSIA 2P70A 3FE8A 3IVTA 5I2LA 1BT6A 1TRFA 4GGFC 1SPYA 4C0JA 1XFUO 1IQ3A 1LKJA 4MN0A 1J7RA 1KCYA 5TNCA 2KI6D 1AJ5A 4HRHA 3VROA 1OQPA 1QV1A 2D8NA 4WQ2A 4N1GA 1W9ZA 3GOFA 1IH0A 1BMOA 1UUSA 2M97A 1E8AA 4ZCVA 1K96A 3TZ1A 4GGFA 2L2EA 3BFBA 1A75A 2PYQA 4INWA 2FJYA 2CTNA 3CZ2A 1H8BA 2GTEA 1WDCB 3R72A 2L2CA 1AVSA 1A2XA 3TDIA 2NCOA 1UWOA 2QEBA 1SBJA 2WNDA 1TN4A 4MEWA 3DXLA 1QASA 1B8LA 5FI6A 3TS5B 3PSRA 2ZNEA 1J7OA 1SRAA 2Y1MA 4F0ZB 3I5GC 1WRKA 1MXEA 1TUZA 1AUIB 1GGZA 1QX7A 4MZLA 5JOLA 1TOPA 3UO9A 3A8RA 5HYDA 1TNQA 1Z4HA 2GGMA 2L4IA 2BL0B 3MSEB 5HLOA 3NSKA 1KWOC 1SL8A 1V1GA 2MJWB 3S0GA 1N2DA 1CFPA 2KPHA 2OS8C 2AUCA 5D7FA 1CLMA 1KK7Z 3BUXB 5IBWA 1F4QA 4BY4A 1YRUB 2WOSA 3TUYC 3LL8B 2MLFC 2LAPA 3CDNA 1C3ZA 1UURA 1RECA 2V53A 3E3RA 4ORAB 3BOWA 2KI4B 2KGBC 1RFJA 2B1UA 2JTTA 3FS7A 1JFJA 2JT0A 1MQ1A 3H4SE 1IQ5A 3B86A 4JPZB 3FIAA 1W7IB 4YBHB 2LHLA 2KDHA 1NX0A 2WCLA 1ZACA 2JXLA 4DUQA 3HCMA 5KSZA 1KFUL 4FQOA 2OPOA 1FF1A 1YX8A 4USLA 1QJTA 3OX6A 1JWDA 1NP8A 3DVJA 5EL2A 1DF0A 1B7TY 2WCKA 2K8MB 1YUSA 4DIRA 3IQOA 2L50A 1TNPA 3PJIA 5HKYA 4N5XA 1Y1UA 2LNKA 1S36A 4GNKB 2M7LA 3WNXB 1OOHA 3O4XA 1LA3A 2ZKMX 3BFHA 3JTDB 4FQTA 5HL1A 5CSFA 2LLUA 1D1OA 3SG6A 1SR6B 2KFFA 2WCMA 2L0PA 1S1EA 3UNWA 2YGUA 2LE9B 3KEVA 4YRUA 4ETOA 4D1EA 1GGWA 4P5OE 1NX2A 1DGUA 1DC1A 2CXJA 1RWYA 1JBAA 2CCMA 2LANA 3L4AA 4Q04A 3DYEA 4R1EA 1F8HA 2K7OA 1K94A 3EG5B 2OTGC 1S6CA 3LLEA 1CMGA 1UHKA 1ZOTB 3CZ1A 3JVTB 4PALA 4INXA 2K0JA 3SS3A 1OMVA 2LMTA 2LM5A 4GGNA 3M0WA 1AJ4A 1L2OC 3D74A 2EHBA 5AXIA 1S26D 1XA5A 2KAVA 3CLNA 4CFQA 2MAZA 1OOFA 1IG5A 2O60A 5FYXA 1PVAA 1R6PA 5J3XA 3SG3A 1TCOB 2ZRSA 1A4PA 4PCWA 1DTLA 3NGVA 3WHTB 1CTRA 1EG3A 1LA0A 2JNXA 4MLWA 3OHMB 3HX4A 2BCAA 5AFPA 2HETA 2JPOA 3O2PA 1SNLA 3VRPA 1UP5A 3DF0B 1YURA 2KQ6A 2WC5A 1NCZA 2DOQA 3AAKA 1K9PA 1WDCC 2NCPA 2QPTA 4HSZA 1N65A 3D0YB 2PALA 2WCBA 1SL9A 1TCFA 3SG4A 3Q8IA 2CBLA 2JWWA 3CS1A 3EVVA 4M2PA 1WRZA 1XYDA 4OZDA 3TDUA 1OMRA 4CIDA 1GM0A 1OZOA 5FI2A 1U5IA 3C1VA 2JC2A 1L7ZA 2MRDA 5BPJA 2LCPA 2K2AA 1QATA 2M3WA 4GUKA 4UPGA 4NDDA 1JSAA 1SCMB 1BR1B 1G33A 3N7HA 2M1KB 5PALA 4HRGA 2AAOA 4OVNF 1R2UA 2P71A 1OE9B 2BL0C 1NYAA 1TNXA 1QIWA 4MVFA 1DJYA 3KPXA 3D77A 3QMEA 4MRXA 4YGCB 1J7PA 1QXPA 4DRWA 1TIZA 2LMVA 3CTNA 3DVEA 3CZTX 2MBXA 3PFVA 1WLZA 1TNWA 2R2IA 4PE4A 1JF0A 2BCXA 2KSPA 2KI4C 2M29A 1TUJA 5D69A 3S0BA 5FI7A 1J7QA 4YI9A 4I5LB 3EKJA 1QLSA 3SS4A 1KFXL 4YGBB 2LP2A 3BYAA 2JTZA 2KQYA 4ORBB 4MBEA 4PHKA 1K90D 5F6TA 3NXAA 3WXAA 4FTGA 1ORGA 1RJVA 4M2QA 1PSRA 3KHEA 1FI6A 3ICBA 1H4BA 2BKHB 3OX5A 2BE6A 3DVMA 5HKZA 1K93D 2JPTA 3S0FA 2Q91A 4PE1A 4I5NB 1OSAA 3DZTA 1KQMB 2H8VA 1YVLA 3I5IB 2PQLA 1YRTB 2H61C 2NZ0A 3LK1A 3NSLA 5AEQA 3SG2A 2PMYA 1DT7B 2F33A 1FBVA 4N1FA 3LCPC 1LVCD 3NSOA 3PM8A 1QX5B 5AERA 5CSJA 3CWGA 1IGVA 5DKQA 4A4CA 1XFVO 1NSHA 1DJIA 4U8DA 3PLFB 2K7CA 4A4BA 1LS8A 1XFRA 2KLEA 3EVRA 4PDZA 2KNEA 2Y1NA 2RGIA 2QEOA 4AQJA 1G4YR 1YX7A 3FWCA 4GPLB 1UHIA 1A75B 1NIWA 4ZCUA 2COLB 2M8UA 4QJ3B 3OB1B 1K2HA 1TWOA 4JQ0D 1S6JA 1XK4C 1PSBA 4OV2A 1BF5A 1YVHA 1IIOA 4AOMA 1NX1A 5AANA 2BKIB 2PVBA 1K95A 1XVJA 3R1OA 2F3ZA 1F4OA 3FE6A 1CDLA 1JF2A 3D73A 3WHUB 3NHTA 4MRYA 1WLMA 2BE4A 3S0DA 1XFXO 5DICA 3B88A 2NXQA 4CPVA 2CNPA 2K61A 2Q4UA 1C07A 4ORCB 3CABA 3CGAA 4YGEB 1F71A 2LVIA 2G9BA 2SCPA 2FJUB 1V1FA 2EGDA 2LV7A 3PM2A 1B47A 3F45A 5KU1A 2WCJA 1BOCA 2AMIA 2L5YA 1J1EA 1OMDA 2K7DA 4QJ5B 1EH2A 1JFKA 2LHIA 1IJ5A 1PRWA 2GGZA 1SCMC 1IJ6A 2WC6A 2ZN8A 1DJHA 1NCXA 2KYCA 2LUXA 2TN4A 3BOWB 1CB1A 1XFYO 4I5KA 1B7TZ 1KFXS 2LVVA 4XJKA 1KWOB 3R1VA 3B87A 1M39A 4DCKA 3VB1A 1XO5A 3IQQA 1CLLA 3FE9A 4F7FA 1XFZO 5DKRA 2MA2A 1MWNA 2LUCA 2MLEC 3IF7A 1BU3A 5HLVA 4PHMA 1YR5A 5K89A 5HKWA 5GQQC 1DF0B 2HQ8A 1DGVA 1G8IA 1WRLA 1QVIY 1C7VA 2G2BA 2F2PA 1CNPA 2VRGA 1PALA 1J1DA 2BCBA 1EL4A 2O5GA 1UHHA 2WCEA 2ZFDA 3B6XA 1P28A
chains in the Genus database with same CATH topology
2QEVA 3CDNA 1C3ZA 1ORGA 3NHIA 3B7AA 3B86A 3L47A 3S0FA 2WCLA 3DZTA 2H8VA 3D76A 2PQLA 4JD9A 3S0EA 5EL2A 2WCKA 3V2LA 3CYZA 3PJIA 3R1PA 3DY9A 1OOHA 3BFHA 4FQTA 1T14A 2WCMA 1OW4A 1LS8A 1XFRA 3CZ0A 3D78A 2QEOA 3L4AA 1C3YA 1QWVA 2WCHA 3DYEA 1TWOA 3CZ1A 3BFAA 4INXA 3L4LA 3R1OA 1OOGA 3D74A 3FE6A 3S0AA 3D73A 3OGNA 3NHTA 3D75A 2P70A 1OOFA 2QEHA 3FE8A 5DICA 3B88A 3S0DA 3NGVA 3CABA 2JPOA 2WCJA 2WC5A 3BFBA 2ERBA 4INWA 2FJYA 3CZ2A 3Q8IA 2WC6A 4OZDA 1GM0A 1DQEA 2GTEA 3R72A 2L2CA 3R1VA 3B87A 1OOIX 3VB1A 2QDIA 2QEBA 3N7HA 3FE9A 4F7FA 3DXLA 2P71A 3BJHA 4PT1A 3D77A 3QMEA 3K1EA 3RZSA 3S0GA 3S0BA 3B6XA 1TUJA 2KPHA 1P28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEV A;  3CDN A;  1C3Z A;  1ORG A;  3NHI A;  3B7A A;  3B86 A;  3L47 A;  3S0F A;  2WCL A;  3DZT A;  2H8V A;  3D76 A;  2PQL A;  4JD9 A;  3S0E A;  5EL2 A;  2WCK A;  3V2L A;  3CYZ A;  3PJI A;  3R1P A;  3DY9 A;  1OOH A;  3BFH A;  4FQT A;  1T14 A;  2WCM A;  1OW4 A;  1LS8 A;  1XFR A;  3CZ0 A;  3D78 A;  2QEO A;  3L4A A;  1C3Y A;  1QWV A;  2WCH A;  3DYE A;  1TWO A;  3CZ1 A;  3BFA A;  4INX A;  3L4L A;  3R1O A;  1OOG A;  3D74 A;  3FE6 A;  3S0A A;  3D73 A;  3OGN A;  3NHT A;  3D75 A;  2P70 A;  1OOF A;  2QEH A;  3FE8 A;  5DIC A;  3B88 A;  3S0D A;  3NGV A;  3CAB A;  2JPO A;  2WCJ A;  2WC5 A;  3BFB A;  2ERB A;  4INW A;  2FJY A;  3CZ2 A;  3Q8I A;  2WC6 A;  4OZD A;  1GM0 A;  1DQE A;  2GTE A;  3R72 A;  2L2C A;  3R1V A;  3B87 A;  1OOI X;  3VB1 A;  2QDI A;  2QEB A;  3N7H A;  3FE9 A;  4F7F A;  3DXL A;  2P71 A;  3BJH A;  4PT1 A;  3D77 A;  3QME A;  3K1E A;  3RZS A;  3S0G A;  3S0B A;  3B6X A;  1TUJ A;  2KPH A;  1P28 A; 
#chains in the Genus database with same CATH topology
 4IJ7 A;  2FCD A;  2QEV A;  2LLS A;  3I5H B;  1FW4 A;  3SJS A;  3SS5 A;  2F8P A;  1KSO A;  1PK0 D;  3SG5 A;  1B8C A;  1DJW A;  2F2O A;  3PAL A;  3TS5 C;  1M63 B;  5I2O A;  3O6B A;  5B8I B;  1KQM C;  1J55 A;  2KBI A;  2CT9 A;  3NHI A;  1S6I A;  4OR9 B;  3AKB A;  2EC6 B;  3RM1 A;  1ZMZ A;  4BY5 A;  1CDN A;  1NUB A;  1Y1A A;  1ZUZ A;  3GK2 A;  1SYM A;  2LVJ A;  2ZRT A;  2WOR A;  4YI8 A;  1DJZ A;  3D76 A;  2JT8 A;  1WY9 A;  1KFU S;  2I2R E;  3NSI A;  3VRR A;  4P2Y B;  1KSM A;  4E68 A;  3OP0 A;  1SCV A;  1MF8 B;  4PE7 A;  1DJG A;  5DKN A;  3DD4 A;  2KI6 C;  2KFG A;  2OTG B;  5I8N A;  2JU0 A;  1KK8 B;  1AP4 A;  3BUM B;  2A4J A;  3KO0 A;  4JWQ A;  3BUN B;  4NDC A;  4C0L A;  4HRE E;  3FWB A;  2KGR A;  3K21 A;  3PN7 B;  4OCI A;  4WQ3 A;  2FCE A;  4AQI A;  4C0K A;  2Y4Q A;  3BUO B;  1L2O B;  3D10 A;  1BG1 A;  2M0R A;  2PAS A;  1Q80 A;  2JZI A;  1C3Y A;  1CFD A;  4PHN A;  2KFH A;  1BJF A;  1SW8 A;  1OZS A;  1K9U A;  1M45 A;  3I5F B;  1M31 A;  2I7A A;  1KK7 Y;  4XYN A;  2BAP A;  3BFA A;  3JTD C;  4QJ4 B;  3L4L A;  1SY9 A;  1U5I B;  4GBA A;  1CFF A;  1SR6 C;  2KHN A;  1CKK A;  1OOG A;  1ZFS A;  1YUU A;  4YGD B;  3OGN A;  1B1G A;  1Y1X A;  1S3P A;  1CMF A;  1SKT A;  2QEH A;  2I94 A;  4I5J A;  2H61 A;  4NQG A;  3VRN A;  1IWQ A;  1W7J B;  2LC5 A;  1ODB A;  5KTY A;  3EK8 A;  1VRK A;  2ZND A;  2JOJ A;  1CLB A;  1SK6 D;  1F70 A;  3O4Y A;  3JVT C;  1CM4 A;  1N0Y A;  2SAS A;  3SIA A;  1Z2C B;  2QAC A;  3QRX A;  3KF9 A;  1QIV A;  1PVB A;  1DEL A;  1CDM A;  1LXF C;  1CM1 A;  1DMO A;  2ERB A;  2KYF A;  4YGA A;  2LP3 A;  1HQV A;  3DVK A;  1CFC A;  1B4C A;  1QV0 A;  1YUT A;  2LVK A;  4GAO A;  2L98 A;  2M49 B;  3BQ3 A;  4OKH A;  2K60 A;  4GFT A;  3SIB A;  2I18 A;  1DQE A;  1F55 A;  2WCF A;  1SMG A;  1GJY A;  2K2F A;  5ER5 A;  1UHJ A;  2WC8 A;  2L5X B;  3GK4 X;  1OOI X;  3OBV A;  4IL1 A;  1IKU A;  1BLQ A;  2QDI A;  1XK4 A;  5ER4 X;  1ALV A;  1SSE B;  1MHO A;  5CPV A;  3BJH A;  2E6W A;  5I94 A;  1NPQ A;  4PT1 A;  3TDZ A;  1NX3 A;  4ICB A;  3I5H C;  1BR4 B;  1MXL C;  2FOT A;  2P6B B;  3EK4 A;  1RTP 1;  3K1E A;  1EJ3 A;  3VRQ A;  3RZS A;  2L4H A;  3LK0 A;  1AK8 A;  3CR4 X;  1ALW A;  2JNF A;  3DF0 A;  5JJG A;  2BNX A;  3AAJ A;  3AKA A;  3I5G B;  2E30 A;  2F3Y A;  1A29 A;  5D3O A;  1M46 A;  2BBN A;  3D0Y A;  4PE0 A;  1UHN A;  2EC6 C;  3RLZ A;  3ZWH A;  1QX2 A;  4L9M A;  1GQM A;  2PRU A;  3BUW B;  1K9K A;  1B9A A;  1DVI A;  1HT9 A;  1SL7 A;  1XFW O;  2LMU A;  2ISD A;  1PUL A;  2OS8 B;  1K8U A;  2KAX A;  2LLT A;  2JQ6 A;  3B7A A;  4NDB A;  2KBM A;  2M7N A;  3TUY B;  2BBM A;  3L47 A;  5CSN A;  1FI5 A;  2M1U A;  2JUL A;  1KQV A;  1Y6W A;  4DS7 A;  1JC2 A;  2NLN A;  1S5G Y;  5G08 A;  1MR8 A;  2IS9 A;  2GV5 A;  1BOD A;  1KK8 C;  1MUX A;  1AHR A;  1QLK A;  4JD9 A;  3S0E A;  2JT3 A;  1RK9 A;  3PAT A;  4CFR A;  4JKT A;  3PN7 C;  1IRJ A;  3V2L A;  1EG4 A;  1JUO A;  3CYZ A;  1TTX A;  2Y5I A;  1QS7 A;  3R1P A;  2M9G A;  4KYN A;  4MZJ A;  1X02 A;  1YTZ C;  3BXK A;  2HF5 A;  3DY9 A;  4M2O A;  4TNC A;  3ZNI A;  1OOJ A;  2JRF A;  2MHH A;  3EKH A;  2KAY A;  3EK7 A;  1T14 A;  1RRO A;  5I2Q A;  3VGO A;  2H2K A;  3EVU A;  1QTX A;  1C7W A;  1OW4 A;  2HQW A;  2PSR A;  3I5I C;  1A03 A;  1FPW A;  3I5F C;  1NWD A;  2KOT A;  3SG7 A;  1B8R A;  3CZ0 A;  3D78 A;  4WRI A;  4MZK A;  1QWV A;  2WCH A;  2ZN9 A;  3CR2 A;  3GK1 A;  3CR5 X;  1NCY A;  4MSP A;  4PHJ A;  3A4U B;  2K7B A;  2JXC A;  1S5G Z;  4CLN A;  1LIN A;  1Y0V H;  1F54 A;  3OB2 B;  4XJK B;  1QVI Z;  2HPS A;  2KLD A;  1DJX A;  2BEC A;  1EXR A;  2L51 A;  3S0A A;  1CDP A;  3O78 A;  1DEK A;  3D75 A;  5CSI A;  2P70 A;  3FE8 A;  3IVT A;  5I2L A;  1BT6 A;  1TRF A;  4GGF C;  1SPY A;  4C0J A;  1XFU O;  1IQ3 A;  1LKJ A;  4MN0 A;  1J7R A;  1KCY A;  5TNC A;  2KI6 D;  1AJ5 A;  4HRH A;  3VRO A;  1OQP A;  1QV1 A;  2D8N A;  4WQ2 A;  4N1G A;  1W9Z A;  3GOF A;  1IH0 A;  1BMO A;  1UUS A;  2M97 A;  1E8A A;  4ZCV A;  1K96 A;  3TZ1 A;  4GGF A;  2L2E A;  3BFB A;  1A75 A;  2PYQ A;  4INW A;  2FJY A;  2CTN A;  3CZ2 A;  1H8B A;  2GTE A;  1WDC B;  3R72 A;  2L2C A;  1AVS A;  1A2X A;  3TDI A;  2NCO A;  1UWO A;  2QEB A;  1SBJ A;  2WND A;  1TN4 A;  4MEW A;  3DXL A;  1QAS A;  1B8L A;  5FI6 A;  3TS5 B;  3PSR A;  2ZNE A;  1J7O A;  1SRA A;  2Y1M A;  4F0Z B;  3I5G C;  1WRK A;  1MXE A;  1TUZ A;  1AUI B;  1GGZ A;  1QX7 A;  4MZL A;  5JOL A;  1TOP A;  3UO9 A;  3A8R A;  5HYD A;  1TNQ A;  1Z4H A;  2GGM A;  2L4I A;  2BL0 B;  3MSE B;  5HLO A;  3NSK A;  1KWO C;  1SL8 A;  1V1G A;  2MJW B;  3S0G A;  1N2D A;  1CFP A;  2KPH A;  2OS8 C;  2AUC A;  5D7F A;  1CLM A;  1KK7 Z;  3BUX B;  5IBW A;  1F4Q A;  4BY4 A;  1YRU B;  2WOS A;  3TUY C;  3LL8 B;  2MLF C;  2LAP A;  3CDN A;  1C3Z A;  1UUR A;  1REC A;  2V53 A;  3E3R A;  4ORA B;  3BOW A;  2KI4 B;  2KGB C;  1RFJ A;  2B1U A;  2JTT A;  3FS7 A;  1JFJ A;  2JT0 A;  1MQ1 A;  3H4S E;  1IQ5 A;  3B86 A;  4JPZ B;  3FIA A;  1W7I B;  4YBH B;  2LHL A;  2KDH A;  1NX0 A;  2WCL A;  1ZAC A;  2JXL A;  4DUQ A;  3HCM A;  5KSZ A;  1KFU L;  4FQO A;  2OPO A;  1FF1 A;  1YX8 A;  4USL A;  1QJT A;  3OX6 A;  1JWD A;  1NP8 A;  3DVJ A;  5EL2 A;  1DF0 A;  1B7T Y;  2WCK A;  2K8M B;  1YUS A;  4DIR A;  3IQO A;  2L50 A;  1TNP A;  3PJI A;  5HKY A;  4N5X A;  1Y1U A;  2LNK A;  1S36 A;  4GNK B;  2M7L A;  3WNX B;  1OOH A;  3O4X A;  1LA3 A;  2ZKM X;  3BFH A;  3JTD B;  4FQT A;  5HL1 A;  5CSF A;  2LLU A;  1D1O A;  3SG6 A;  1SR6 B;  2KFF A;  2WCM A;  2L0P A;  1S1E A;  3UNW A;  2YGU A;  2LE9 B;  3KEV A;  4YRU A;  4ETO A;  4D1E A;  1GGW A;  4P5O E;  1NX2 A;  1DGU A;  1DC1 A;  2CXJ A;  1RWY A;  1JBA A;  2CCM A;  2LAN A;  3L4A A;  4Q04 A;  3DYE A;  4R1E A;  1F8H A;  2K7O A;  1K94 A;  3EG5 B;  2OTG C;  1S6C A;  3LLE A;  1CMG A;  1UHK A;  1ZOT B;  3CZ1 A;  3JVT B;  4PAL A;  4INX A;  2K0J A;  3SS3 A;  1OMV A;  2LMT A;  2LM5 A;  4GGN A;  3M0W A;  1AJ4 A;  1L2O C;  3D74 A;  2EHB A;  5AXI A;  1S26 D;  1XA5 A;  2KAV A;  3CLN A;  4CFQ A;  2MAZ A;  1OOF A;  1IG5 A;  2O60 A;  5FYX A;  1PVA A;  1R6P A;  5J3X A;  3SG3 A;  1TCO B;  2ZRS A;  1A4P A;  4PCW A;  1DTL A;  3NGV A;  3WHT B;  1CTR A;  1EG3 A;  1LA0 A;  2JNX A;  4MLW A;  3OHM B;  3HX4 A;  2BCA A;  5AFP A;  2HET A;  2JPO A;  3O2P A;  1SNL A;  3VRP A;  1UP5 A;  3DF0 B;  1YUR A;  2KQ6 A;  2WC5 A;  1NCZ A;  2DOQ A;  3AAK A;  1K9P A;  1WDC C;  2NCP A;  2QPT A;  4HSZ A;  1N65 A;  3D0Y B;  2PAL A;  2WCB A;  1SL9 A;  1TCF A;  3SG4 A;  3Q8I A;  2CBL A;  2JWW A;  3CS1 A;  3EVV A;  4M2P A;  1WRZ A;  1XYD A;  4OZD A;  3TDU A;  1OMR A;  4CID A;  1GM0 A;  1OZO A;  5FI2 A;  1U5I A;  3C1V A;  2JC2 A;  1L7Z A;  2MRD A;  5BPJ A;  2LCP A;  2K2A A;  1QAT A;  2M3W A;  4GUK A;  4UPG A;  4NDD A;  1JSA A;  1SCM B;  1BR1 B;  1G33 A;  3N7H A;  2M1K B;  5PAL A;  4HRG A;  2AAO A;  4OVN F;  1R2U A;  2P71 A;  1OE9 B;  2BL0 C;  1NYA A;  1TNX A;  1QIW A;  4MVF A;  1DJY A;  3KPX A;  3D77 A;  3QME A;  4MRX A;  4YGC B;  1J7P A;  1QXP A;  4DRW A;  1TIZ A;  2LMV A;  3CTN A;  3DVE A;  3CZT X;  2MBX A;  3PFV A;  1WLZ A;  1TNW A;  2R2I A;  4PE4 A;  1JF0 A;  2BCX A;  2KSP A;  2KI4 C;  2M29 A;  1TUJ A;  5D69 A;  3S0B A;  5FI7 A;  1J7Q A;  4YI9 A;  4I5L B;  3EKJ A;  1QLS A;  3SS4 A;  1KFX L;  4YGB B;  2LP2 A;  3BYA A;  2JTZ A;  2KQY A;  4ORB B;  4MBE A;  4PHK A;  1K90 D;  5F6T A;  3NXA A;  3WXA A;  4FTG A;  1ORG A;  1RJV A;  4M2Q A;  1PSR A;  3KHE A;  1FI6 A;  3ICB A;  1H4B A;  2BKH B;  3OX5 A;  2BE6 A;  3DVM A;  5HKZ A;  1K93 D;  2JPT A;  3S0F A;  2Q91 A;  4PE1 A;  4I5N B;  1OSA A;  3DZT A;  1KQM B;  2H8V A;  1YVL A;  3I5I B;  2PQL A;  1YRT B;  2H61 C;  2NZ0 A;  3LK1 A;  3NSL A;  5AEQ A;  3SG2 A;  2PMY A;  1DT7 B;  2F33 A;  1FBV A;  4N1F A;  3LCP C;  1LVC D;  3NSO A;  3PM8 A;  1QX5 B;  5AER A;  5CSJ A;  3CWG A;  1IGV A;  5DKQ A;  4A4C A;  1XFV O;  1NSH A;  1DJI A;  4U8D A;  3PLF B;  2K7C A;  4A4B A;  1LS8 A;  1XFR A;  2KLE A;  3EVR A;  4PDZ A;  2KNE A;  2Y1N A;  2RGI A;  2QEO A;  4AQJ A;  1G4Y R;  1YX7 A;  3FWC A;  4GPL B;  1UHI A;  1A75 B;  1NIW A;  4ZCU A;  2COL B;  2M8U A;  4QJ3 B;  3OB1 B;  1K2H A;  1TWO A;  4JQ0 D;  1S6J A;  1XK4 C;  1PSB A;  4OV2 A;  1BF5 A;  1YVH A;  1IIO A;  4AOM A;  1NX1 A;  5AAN A;  2BKI B;  2PVB A;  1K95 A;  1XVJ A;  3R1O A;  2F3Z A;  1F4O A;  3FE6 A;  1CDL A;  1JF2 A;  3D73 A;  3WHU B;  3NHT A;  4MRY A;  1WLM A;  2BE4 A;  3S0D A;  1XFX O;  5DIC A;  3B88 A;  2NXQ A;  4CPV A;  2CNP A;  2K61 A;  2Q4U A;  1C07 A;  4ORC B;  3CAB A;  3CGA A;  4YGE B;  1F71 A;  2LVI A;  2G9B A;  2SCP A;  2FJU B;  1V1F A;  2EGD A;  2LV7 A;  3PM2 A;  1B47 A;  3F45 A;  5KU1 A;  2WCJ A;  1BOC A;  2AMI A;  2L5Y A;  1J1E A;  1OMD A;  2K7D A;  4QJ5 B;  1EH2 A;  1JFK A;  2LHI A;  1IJ5 A;  1PRW A;  2GGZ A;  1SCM C;  1IJ6 A;  2WC6 A;  2ZN8 A;  1DJH A;  1NCX A;  2KYC A;  2LUX A;  2TN4 A;  3BOW B;  1CB1 A;  1XFY O;  4I5K A;  1B7T Z;  1KFX S;  2LVV A;  4XJK A;  1KWO B;  3R1V A;  3B87 A;  1M39 A;  4DCK A;  3VB1 A;  1XO5 A;  3IQQ A;  1CLL A;  3FE9 A;  4F7F A;  1XFZ O;  5DKR A;  2MA2 A;  1MWN A;  2LUC A;  2MLE C;  3IF7 A;  1BU3 A;  5HLV A;  4PHM A;  1YR5 A;  5K89 A;  5HKW A;  5GQQ C;  1DF0 B;  2HQ8 A;  1DGV A;  1G8I A;  1WRL A;  1QVI Y;  1C7V A;  2G2B A;  2F2P A;  1CNP A;  2VRG A;  1PAL A;  1J1D A;  2BCB A;  1EL4 A;  2O5G A;  1UHH A;  2WCE A;  2ZFD A;  3B6X A;  1P28 A; 
#chains in the Genus database with same CATH homology
 2QEV A;  3CDN A;  1C3Z A;  1ORG A;  3NHI A;  3B7A A;  3B86 A;  3L47 A;  3S0F A;  2WCL A;  3DZT A;  2H8V A;  3D76 A;  2PQL A;  4JD9 A;  3S0E A;  5EL2 A;  2WCK A;  3V2L A;  3CYZ A;  3PJI A;  3R1P A;  3DY9 A;  1OOH A;  3BFH A;  4FQT A;  1T14 A;  2WCM A;  1OW4 A;  1LS8 A;  1XFR A;  3CZ0 A;  3D78 A;  2QEO A;  3L4A A;  1C3Y A;  1QWV A;  2WCH A;  3DYE A;  1TWO A;  3CZ1 A;  3BFA A;  4INX A;  3L4L A;  3R1O A;  1OOG A;  3D74 A;  3FE6 A;  3S0A A;  3D73 A;  3OGN A;  3NHT A;  3D75 A;  2P70 A;  1OOF A;  2QEH A;  3FE8 A;  5DIC A;  3B88 A;  3S0D A;  3NGV A;  3CAB A;  2JPO A;  2WCJ A;  2WC5 A;  3BFB A;  2ERB A;  4INW A;  2FJY A;  3CZ2 A;  3Q8I A;  2WC6 A;  4OZD A;  1GM0 A;  1DQE A;  2GTE A;  3R72 A;  2L2C A;  3R1V A;  3B87 A;  1OOI X;  3VB1 A;  2QDI A;  2QEB A;  3N7H A;  3FE9 A;  4F7F A;  3DXL A;  2P71 A;  3BJH A;  4PT1 A;  3D77 A;  3QME A;  3K1E A;  3RZS A;  3S0G A;  3S0B A;  3B6X A;  1TUJ A;  2KPH A;  1P28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...