1MXEA

Structure of the complex of calmodulin with the target sequence of camki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
144
structure length
144
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 59
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA02
3HX4A 3WHTB 4M2OA 4YGBB 5BPJA 1AP4A 2ZN8A 2PSRA 1NPQA 2GGZA 1CM1A 2KBMA 4JPZB 1YR5A 2M29A 1CB1A 2CTNA 1B8RA 4PALA 3DVKA 1XFXO 3TDIA 2JXCA 1XFVO 1NCYA 4N1FA 2DOQA 4PE0A 2EC6C 3HCMA 4CPVA 1K8UA 2PVBA 4YRUA 1EH2A 1JBAA 3A8RA 2PASA 1QVIY 1S1EA 3TDZA 5JOLA 2LUXA 1TNXA 3PN7C 3TZ1A 1SR6C 2A4JA 1J7RA 3D10A 3DF0A 1Y1UA 2KGRA 4BY5A 1KK7Y 1SL7A 1OMDA 2LMUA 3SG6A 1QIVA 4C0KA 4MZLA 2L0PA 1DMOA 1TCFA 2GGMA 1BU3A 3GOFA 4BY4A 1DVIA 3KO0A 1LINA 1CNPA 4OVNF 1IQ3A 4ORAB 1OQPA 5F6TA 2EHBA 1K2HA 5CPVA 2M1UA 4ZCVA 1FI6A 2LUCA 1WLZA 2R2IA 1KSOA 2BKHB 2EC6B 5KTYA 3CTNA 2P6BB 1NCXA 1Y6WA 3I5HC 4CIDA 1YRUB 3TS5B 3WXAA 4ICBA 1DGUA 1QX2A 3MSEB 3PN7B 5HKWA 1SR6B 3SG3A 1S6JA 1XK4A 1B1GA 5CSFA 2KAYA 1DJXA 1QIWA 1SNLA 2Y1MA 3NSKA 1U5IB 4MSPA 1UHIA 1A75B 1SY9A 2HETA 2LVKA 4PHKA 5AEQA 1UHNA 3EKHA 4MEWA 1NWDA 5CSNA 5K89A 2LHIA 2LAPA 2ZNDA 1RJVA 1SK6D 3QRXA 1L7ZA 1D1OA 1SCMC 2LP2A 1SKTA 1QLKA 2KAVA 5DKNA 4A4CA 1B9AA 2H61C 2HQWA 1KFUS 3SG7A 3EK4A 3TUYB 1C7WA 1WRZA 2LM5A 1EXRA 1J7OA 1H4BA 2JXLA 3I5HB 1AVSA 2M8UA 2BCBA 4YGAA 3BXKA 5I2LA 1QTXA 2JQ6A 1J7QA 3AKAA 2OTGC 1NX0A 1YURA 1DF0A 4WQ3A 5HLOA 1DJZA 4UPGA 1IGVA 1BR1B 3PLFB 1C7VA 3OHMB 3M0WA 1BLQA 1YVLA 2K7DA 1CFPA 2K8MB 3SIBA 5KSZA 5HLVA 1DJYA 1WLMA 4GGFA 1JF0A 1XYDA 2O60A 2SCPA 4PE4A 3IQOA 1SL9A 1GQMA 3IQQA 3A4UB 4ORBB 1BOCA 1Q80A 1F8HA 1CM4A 2L4HA 1DJHA 3FS7A 3BUOB 1SCMB 2FOTA 4PE7A 1CFCA 2KSPA 1ALVA 1CDLA 2K7OA 4WQ2A 1KSMA 2BE4A 2M7NA 3SJSA 3PFVA 1R2UA 1WRKA 4P2YB 1TNQA 2JTZA 4YGDB 2OTGB 4MRXA 1DT7B 1IQ5A 3VRNA 2K61A 1K9KA 1V1GA 1N0YA 1QVIZ 2LE9B 2JWWA 5HKYA 2NCOA 1FPWA 1KK7Z 1PALA 1OZOA 1K95A 4MLWA 3BUNB 1S3PA 2JPTA 1LXFC 2GV5A 2E6WA 1J1EA 1MF8B 3BYAA 4USLA 1Y0VH 4P5OE 3FIAA 4TNCA 1JC2A 1KQVA 1M39A 4XJKB 4AQJA 1YUTA 3ICBA 1SPYA 4CLNA 1F70A 3VGOA 2L98A 2KI6D 5ER5A 2OS8C 2WORA 1QATA 1L2OC 4CFRA 1W7JB 1DF0B 1TNWA 2Y4QA 2LV7A 3TS5C 1TOPA 2JNFA 5HYDA 1S36A 1TNPA 3AAKA 4M2PA 2F3YA 2JNXA 1TCOB 3JTDC 1JUOA 2MHHA 4QJ5B 3JVTB 2KI4C 4PDZA 2JRFA 1GGZA 1A4PA 2LC5A 3VRPA 1ZUZA 3CWGA 1NCZA 2NZ0A 3ZWHA 5PALA 2LLSA 2ZN9A 2OS8B 4DRWA 1L2OB 1XFWO 4CFQA 3KEVA 3TUYC 3DVMA 1YTZC 3IF7A 1SL8A 2AUCA 1SW8A 2ZKMX 4M2QA 1LA3A 1KFXL 1RFJA 2ZRTA 4N5XA 3RM1A 2KFFA 2ZNEA 3JTDB 3DD4A 1YUSA 1K94A 3I5IB 4GGNA 1XFUO 3PSRA 2KI4B 4MN0A 4YBHB 2L2EA 2FJUB 1NYAA 1SCVA 1FW4A 4PHNA 4NQGA 1CLBA 2BCAA 2CBLA 3EK8A 4JQ0D 1AJ4A 2I94A 1A29A 1CMGA 1CKKA 4NDCA 1EJ3A 3OX5A 4QJ3B 2JT0A 1SBJA 2I18A 2ISDA 5IBWA 2TN4A 1IRJA 4DIRA 1TN4A 4WRIA 2V53A 3H4SE 1N65A 2IS9A 1GJYA 5FYXA 3I5GC 2F3ZA 2KFGA 5CSIA 1KCYA 4MRYA 1NX3A 1UUSA 3AAJA 3DF0B 2JU0A 2JTTA 1XK4C 1JFKA 1G33A 2HPSA 2K7BA 1JFJA 4R1EA 1K9UA 2KQYA 1LVCD 2LANA 2LHLA 1OOJA 3NSOA 1UP5A 2I7AA 1QXPA 3PALA 2Y1NA 2CXJA 1M45A 1W7IB 3LK0A 4JWQA 4A4BA 1K96A 1WRLA 1CFDA 1EG3A 2F2OA 2FCDA 1CDPA 1WY9A 1B8CA 2F2PA 2KFHA 3EK7A 2PMYA 4U8DA 4F0ZB 3ZNIA 1M63B 3NXAA 1OE9B 2E30A 3E3RA 1YVHA 4D1EA 1BODA 3CGAA 2NCPA 2BBNA 5KU1A 1S5GZ 2K2FA 1Y1XA 1UHJA 1DJWA 2KI6C 1C07A 2LVJA 4GPLB 2MLFC 4YGEB 2L4IA 1RECA 1XVJA 1Y1AA 3I5GB 3NSIA 2VRGA 4MBEA 3KF9A 1QLSA 1ZMZA 5TNCA 3WNXB 1E8AA 4HRGA 4N1GA 4FTGA 1YX7A 4DS7A 3KPXA 1ODBA 3SG5A 4QJ4B 4DCKA 2AAOA 4GGFC 4IL1A 2SASA 2L51A 3RLZA 1BG1A 4HREE 1YUUA 3JVTC 3BOWA 3SG4A 2KNEA 2D8NA 4PHMA 1CDNA 2Q91A 1S5GY 3FWCA 2KGBC 1PRWA 1B7TY 4MVFA 1TTXA 1NX1A 2MLEC 1PVAA 2HQ8A 4GBAA 2M7LA 1QX5B 1A2XA 2COLB 1RROA 1IJ5A 2B1UA 4OR9B 4ETOA 4XYNA 1B47A 2KYFA 2F8PA 3F45A 2MBXA 5JJGA 2PALA 1EL4A 2JC2A 2BCXA 1UWOA 2G9BA 3I5FB 1M46A 1UURA 4PE1A 1U5IA 3OP0A 2M49B 1QASA 4HRHA 4MZJA 1NSHA 1A75A 1PULA 3LCPC 1BT6A 1SMGA 1VRKA 1CLLA 4Q04A 2BBMA 2KAXA 4ZCUA 3SG2A 3VRQA 1KK8C 1H8BA 5D7FA 3I5IC 3PATA 4YI9A 1JF2A 3EVVA 1ZFSA 2KOTA 1QX7A 2KHNA 4HSZA 3GK1A 1BR4B 1MXLC 1SRAA 1V1FA 1CFFA 3BUWB 1EG4A 1KFXS 5AFPA 2BECA 2Y5IA 1S26D 4NDBA 5AANA 3EVRA 1DTLA 1KQMC 3SIAA 1IG5A 1J1DA 1YRTB 1BJFA 2M9GA 2OPOA 4MZKA 5B8IB 1X02A 2QPTA 1RK9A 3O6BA 1KWOC 2QACA 1OZSA 2NXQA 1IKUA 3D0YA 1NIWA 2LNKA 2M1KB 3KHEA 5GQQC 1IJ6A 1M31A 1S6CA 1PSRA 4OKHA 2I2RE 1F4OA 3GK2A 3DVEA 1FF1A 3CR4X 1KK8B 1IH0A 1FI5A 2MAZA 2RGIA 3GK4X 2KYCA 3O4YA 1MHOA 3BOWB 1N2DA 1K9PA 2LVVA 1G8IA 3FWBA 3WHUB 1TRFA 3LL8B 1LKJA 4OCIA 1RTP1 3CZTX 3OB2B 2LLUA 2MRDA 5D69A 5G08A 2KBIA 1J7PA 1CDMA 2H61A 1F71A 2WOSA 1WDCC 1KQMB 1DJGA 2LMTA 2KDHA 3EVUA 5DKQA 1AHRA 2M0RA 2WCBA 1J55A 5I2OA 3DVJA 5AXIA 3AKBA 1KWOB 1RWYA 1HQVA 2JOJA 2LMVA 4AOMA 5I2QA 1F54A 2BL0C 1XO5A 2PRUA 2JT8A 5I8NA 4GAOA 4PCWA 4YGCB 3O78A 4AQIA 1HT9A 2F33A 5AERA 1TIZA 3CR2A 1MUXA 3EKJA 4NDDA 1NUBA 4PHJA 2MJWB 3BQ3A 4I5LB 1CLMA 1K90D 4ORCB 1OMRA 4L9MA 1AJ5A 2FCEA 4I5JA 3VROA 2WCEA 4OV2A 1ZACA 1CMFA 1PSBA 1DGVA 1QJTA 2CT9A 1ALWA 1NP8A 2M97A 2CNPA 1B8LA 3LK1A 2L5XB 2LVIA 1IWQA 1OMVA 4GFTA 4XJKA 4C0JA 3PM8A 4GUKA 1WDCB 1UHKA 1B4CA 2BKIB 3O2PA 4E68A 5HKZA 1F55A 2LCPA 2BE6A 1B7TZ 1XA5A 2MA2A 5J3XA 2AMIA 2BL0B 3D0YB 1R6PA 2KQ6A 1BF5A 2G2BA 2K0JA 5DKRA 3C1VA 2K7CA 2L50A 1PVBA 1YX8A 2JZIA 3BUMB 1KFUL 3OX6A 3BUXB 1JWDA 1S6IA 2Q4UA 1UHHA 2JULA 3I5FC 1JSAA 1AUIB 1PK0D 1XFZO 2LLTA 1QV0A 1LA0A 2NLNA 5CSJA 2JT3A 2K2AA 1AK8A 2O5GA 2LP3A 3NSLA 4YI8A 1GGWA 1NX2A 1QV1A 2ZFDA 2CCMA 3CS1A 3K21A 1K93D 1QS7A 1A03A 1MXEA 1SYMA 1F4QA 2ZRSA 1ZOTB 2WNDA 4I5NB 4FQOA 1MWNA 4C0LA 3CLNA 3LLEA 2H2KA 1MR8A 4DUQA 1CTRA 1DJIA 3OB1B 1G4YR 1XFYO 2HF5A 2WCFA 3TDUA 2M3WA 3VRRA 4GNKB 5ER4X 4I5KA 2EGDA 1FBVA 2WC8A 1MQ1A 3CR5X 1BMOA 1OSAA
chains in the Genus database with same CATH superfamily
3HX4A 3WHTB 4M2OA 4YGBB 5BPJA 1AP4A 2ZN8A 2PSRA 1NPQA 2GGZA 1CM1A 1T14A 2KBMA 3BFBA 4JPZB 1YR5A 2M29A 1CB1A 2CTNA 1B8RA 4PALA 3DVKA 1XFXO 3TDIA 2JXCA 1XFVO 1NCYA 4N1FA 2DOQA 4PE0A 2EC6C 2QEHA 3HCMA 1K8UA 2PVBA 4CPVA 4YRUA 1EH2A 1JBAA 3A8RA 2PASA 1QVIY 1S1EA 3OBVA 3TDZA 5JOLA 1TWOA 2LUXA 1TNXA 3PN7C 3TZ1A 1SR6C 2A4JA 1J7RA 3D10A 3DF0A 1Y1UA 2KGRA 4BY5A 1KK7Y 1SL7A 3SS3A 1DC1A 1OMDA 2LMUA 3SG6A 1QIVA 4C0KA 4MZLA 2L0PA 1DMOA 1TCFA 1DEKA 2GGMA 1BU3A 3GOFA 1DELA 4BY4A 1DVIA 3KO0A 1LINA 1CNPA 4OVNF 1IQ3A 4ORAB 1OQPA 5F6TA 2EHBA 1K2HA 5CPVA 3V2LA 2M1UA 4ZCVA 2P70A 1FI6A 3S0BA 2LUCA 1WLZA 2R2IA 1KSOA 2BKHB 2BAPA 1Z2CB 2WCJA 2EC6B 5KTYA 3CTNA 2P6BB 1NCXA 1Y6WA 3NHTA 3I5HC 2WC5A 4CIDA 1YRUB 3TS5B 3WXAA 5FI6A 4ICBA 1DGUA 1QX2A 3FE8A 3MSEB 3PN7B 1SR6B 4KYNA 5HKWA 3SG3A 1S6JA 1XK4A 1B1GA 5CSFA 2KAYA 1DQEA 3N7HA 1DJXA 1QIWA 1SNLA 2Y1MA 3NSKA 1U5IB 4MSPA 1UHIA 1A75B 1SY9A 2HETA 2LVKA 4IJ7A 4PHKA 5AEQA 1UHNA 3DY9A 3EKHA 4MEWA 3RZSA 1NWDA 5CSNA 5K89A 2LHIA 2LAPA 2ZNDA 3OGNA 1RJVA 1SK6D 3QRXA 1L7ZA 1D1OA 1SCMC 2LP2A 3B88A 1SKTA 1QLKA 2KAVA 5DKNA 2BNXA 4A4CA 1B9AA 2H61C 2HQWA 1KFUS 3SG7A 3EK4A 3TUYB 1C7WA 1WRZA 2LM5A 5I94A 1EXRA 1J7OA 1GM0A 1H4BA 2JXLA 3I5HB 1AVSA 2M8UA 2BCBA 3L47A 4YGAA 3BXKA 3PJIA 5I2LA 1QTXA 2JQ6A 3BJHA 1J7QA 3AKAA 1TUZA 2OTGC 1NX0A 1YURA 1DF0A 4WQ3A 5HLOA 1DJZA 4UPGA 1IGVA 1BR1B 3PLFB 1C7VA 3OHMB 3M0WA 1BLQA 2KLEA 1W9ZA 1YVLA 2K7DA 1Z4HA 2K8MB 3SIBA 5KSZA 5HLVA 1CFPA 1DJYA 1WLMA 4GGFA 1JF0A 1XYDA 2O60A 2SCPA 4PE4A 3IQOA 1SL9A 1GQMA 3IQQA 3A4UB 4ORBB 2QDIA 1Q80A 1BOCA 1CM4A 2L4HA 1F8HA 1DJHA 3FS7A 3BUOB 1SCMB 2FOTA 4PE7A 1OOGA 1CFCA 3VB1A 4MZJA 2KSPA 1ALVA 1CDLA 1XFRA 2K7OA 4WQ2A 1KSMA 2BE4A 2M7NA 3SJSA 3FE9A 3PFVA 1R2UA 1WRKA 4P2YB 1TNQA 2JTZA 3EG5B 4YGDB 2OTGB 4MRXA 1DT7B 2K60A 1IQ5A 3VRNA 2K61A 1K9KA 3B86A 3R1VA 1V1GA 1N0YA 1QVIZ 2LE9B 2JWWA 5HKYA 2NCOA 3K1EA 1FPWA 3D75A 2P71A 1KK7Z 1PALA 1OZOA 1K95A 4MLWA 3BUNB 1C3YA 1S3PA 2JPTA 1LXFC 2GV5A 2E6WA 3UNWA 1J1EA 1MF8B 3BYAA 3L4LA 3Q8IA 4USLA 1Y0VH 4P5OE 3FIAA 4TNCA 1JC2A 1KQVA 1M39A 4XJKB 4AQJA 1YUTA 3ICBA 1SPYA 4CLNA 1F70A 3VGOA 2L98A 3CABA 2KI6D 5ER5A 2OS8C 2WORA 1QATA 1L2OC 4CFRA 1W7JB 1DF0B 1TNWA 2Y4QA 2LV7A 3TS5C 1TOPA 2JNFA 5HYDA 1S36A 1IIOA 1TNPA 3AAKA 3DZTA 4M2PA 2F3YA 2JNXA 1TCOB 3JTDC 3CZ1A 1JUOA 2MHHA 4QJ5B 3JVTB 2KI4C 4PDZA 2L2CA 2JRFA 1GGZA 1A4PA 2LC5A 3VRPA 1ZUZA 3CWGA 1NCZA 3B87A 2NZ0A 3ZWHA 5PALA 2LLSA 2ZN9A 2OS8B 4DRWA 1L2OB 1XFWO 4CFQA 3KEVA 4FQTA 3DVMA 3TUYC 2H8VA 1YTZC 3IF7A 1SL8A 2AUCA 1SW8A 2ZKMX 3B7AA 4M2QA 1LA3A 1KFXL 1RFJA 2ZRTA 4N5XA 3R72A 3RM1A 2KFFA 2ZNEA 3JTDB 3DD4A 1YUSA 1K94A 4JKTA 3I5IB 4GGNA 1XFUO 3PSRA 2KI4B 4MN0A 4YBHB 3S0AA 2L2EA 2FJUB 1NYAA 3L4AA 1SCVA 1FW4A 4PHNA 4NQGA 1CLBA 2BCAA 2CBLA 3EK8A 4JQ0D 1AJ4A 2I94A 1A29A 3D73A 1CMGA 1CKKA 2JPOA 2KLDA 4NDCA 1EJ3A 3OX5A 4QJ3B 2JT0A 3SS4A 1SBJA 1TUJA 2I18A 3D76A 2ISDA 5IBWA 2TN4A 1IRJA 4DIRA 1TN4A 4WRIA 2V53A 3H4SE 1N65A 2IS9A 1GJYA 3BFAA 5FYXA 3I5GC 2F3ZA 2KFGA 5CSIA 1KCYA 4MRYA 1NX3A 1UUSA 3AAJA 3D74A 3DF0B 2JU0A 2JTTA 1XK4C 1JFKA 1G33A 2HPSA 2K7BA 3O4XA 1JFJA 4R1EA 1K9UA 2KQYA 1LVCD 2LANA 2LHLA 1OOJA 3NSOA 1UP5A 2I7AA 3SS5A 1QXPA 3PALA 2Y1NA 2CXJA 1M45A 1W7IB 3LK0A 4JWQA 4A4BA 1K96A 1WRLA 3CYZA 1CFDA 1EG3A 2F2OA 2FCDA 1CDPA 1WY9A 3D77A 1B8CA 2F2PA 2KFHA 2WCMA 3EK7A 2PMYA 4INWA 4U8DA 3ZNIA 1M63B 4F0ZB 2WC6A 3BFHA 1OW4A 1OE9B 2E30A 3NXAA 3E3RA 1YVHA 4D1EA 1BODA 3CGAA 2NCPA 3S0EA 2BBNA 5KU1A 1S5GZ 2K2FA 1Y1XA 1UHJA 1C3ZA 1DJWA 2KI6C 1C07A 2LVJA 4GPLB 2MLFC 4YGEB 2L4IA 1RECA 1XVJA 1Y1AA 3I5GB 3NSIA 2VRGA 4MBEA 3KF9A 1QLSA 1ZMZA 5TNCA 1LS8A 3S0DA 3D78A 2WCHA 3WNXB 1E8AA 4HRGA 3NGVA 4N1GA 1OOIX 4FTGA 1YX7A 4DS7A 3KPXA 1ODBA 3SG5A 4QJ4B 4DCKA 2AAOA 4GGFC 4IL1A 2SASA 2L51A 3RLZA 1BG1A 4HREE 1YUUA 3JVTC 4F7FA 3BOWA 3SG4A 2KNEA 2D8NA 4PHMA 1CDNA 2Q91A 1S5GY 3FWCA 2KGBC 1PRWA 1B7TY 4MVFA 1TTXA 1NX1A 1ORGA 2MLEC 2PQLA 1PVAA 2HQ8A 4GBAA 2M7LA 1QX5B 1A2XA 2COLB 1RROA 1IJ5A 4INXA 2B1UA 4OR9B 4ETOA 4XYNA 1B47A 2KYFA 2F8PA 1SSEB 4PT1A 3F45A 2MBXA 5JJGA 2PALA 1EL4A 5EL2A 2JC2A 2BCXA 1UWOA 2G9BA 3I5FB 1M46A 1UURA 5D3OA 4PE1A 1U5IA 2FJYA 2M49B 2QEOA 1QASA 3OP0A 4HRHA 1NSHA 1A75A 1PULA 3LCPC 1BT6A 1SMGA 1VRKA 1CLLA 2PYQA 2BBMA 2KAXA 4Q04A 4ZCUA 3SG2A 1KK8C 3IVTA 5D7FA 3VRQA 1H8BA 3I5IC 3PATA 4YI9A 1JF2A 3EVVA 1ZFSA 2KOTA 1QX7A 2KHNA 4HSZA 3GK1A 1BR4B 1MXLC 1SRAA 1V1FA 1CFFA 3BUWB 1EG4A 1KFXS 5AFPA 2BECA 2Y5IA 1S26D 4NDBA 5AANA 3EVRA 1DTLA 1KQMC 3SIAA 1IG5A 1J1DA 1YRTB 1BJFA 2M9GA 2OPOA 4MZKA 5B8IB 1X02A 2QPTA 1RK9A 3O6BA 1KWOC 2QACA 1OZSA 2NXQA 1IKUA 1QWVA 3D0YA 1NIWA 2LNKA 2M1KB 3KHEA 5GQQC 1IJ6A 3B6XA 1M31A 1S6CA 1PSRA 4OKHA 2I2RE 1F4OA 3GK2A 3DVEA 1FF1A 3CR4X 1KK8B 1IH0A 1FI5A 2MAZA 2RGIA 3GK4X 2KYCA 3O4YA 1MHOA 3BOWB 1N2DA 1K9PA 2LVVA 1G8IA 3FWBA 3WHUB 1TRFA 3LL8B 1LKJA 4OCIA 1RTP1 2WCKA 3CZTX 3OB2B 2LLUA 2MRDA 5D69A 5G08A 2KBIA 1J7PA 1CDMA 3R1PA 2H61A 3PM2A 1F71A 2WOSA 1WDCC 1KQMB 1DJGA 2LMTA 2KDHA 3EVUA 5DKQA 1AHRA 2M0RA 2WCBA 1J55A 3CZ0A 5I2OA 3DVJA 5AXIA 3FE6A 3AKBA 1KWOB 1RWYA 1HQVA 2JOJA 2LMVA 4AOMA 5HL1A 5I2QA 1F54A 2BL0C 1XO5A 2PRUA 2JT8A 5I8NA 4GAOA 4PCWA 4YGCB 3O78A 4AQIA 1HT9A 2F33A 5AERA 1TIZA 3CR2A 1MUXA 2ERBA 1OOFA 3EKJA 4NDDA 1NUBA 4PHJA 2MJWB 3BQ3A 4I5LB 1CLMA 1K90D 3QMEA 1OMRA 4L9MA 1AJ5A 2QEBA 4ORCB 2QEVA 2FCEA 4I5JA 3VROA 2WCEA 3R1OA 4OV2A 1ZACA 1CMFA 1PSBA 1DGVA 1QJTA 2CT9A 1ALWA 1NP8A 2M97A 2CNPA 1B8LA 3LK1A 2L5XB 2LVIA 1IWQA 1OMVA 4GFTA 4XJKA 4C0JA 3PM8A 4GUKA 1WDCB 1UHKA 1B4CA 2BKIB 3O2PA 3S0FA 4E68A 5HKZA 1F55A 2LCPA 2BE6A 1B7TZ 1XA5A 2MA2A 3DYEA 5DICA 5J3XA 2AMIA 2BL0B 3D0YB 1R6PA 2KQ6A 1BF5A 2G2BA 2K0JA 5DKRA 3C1VA 2K7CA 2L50A 1PVBA 1YX8A 2JZIA 3BUMB 1P28A 1KFUL 3OX6A 4JD9A 3BUXB 3NHIA 1JWDA 5FI2A 5FI7A 1S6IA 2Q4UA 1UHHA 2JULA 3I5FC 1JSAA 1AUIB 1PK0D 1XFZO 3S0GA 2LLTA 1QV0A 1LA0A 2NLNA 5CSJA 2GTEA 3CZ2A 2JT3A 2K2AA 1AK8A 2O5GA 2LP3A 3NSLA 4YI8A 1GGWA 1NX2A 1QV1A 2ZFDA 2CCMA 2YGUA 1OOHA 3CS1A 3K21A 1K93D 1QS7A 1A03A 1MXEA 1SYMA 2L5YA 1F4QA 2ZRSA 1ZOTB 2WNDA 4I5NB 4FQOA 3UO9A 1MWNA 4C0LA 3CLNA 3LLEA 2KPHA 2H2KA 1MR8A 4DUQA 1CTRA 1DJIA 3OB1B 1G4YR 1XFYO 2HF5A 3DXLA 2WCFA 3TDUA 2M3WA 3VRRA 4GNKB 3CDNA 5ER4X 2WCLA 4I5KA 2EGDA 1FBVA 2WC8A 1MQ1A 4OZDA 3CR5X 1BMOA 1OSAA
chains in the Genus database with same CATH topology
3HX4A 3WHTB 4M2OA 4YGBB 5BPJA 1AP4A 2ZN8A 2PSRA 1NPQA 2GGZA 1CM1A 2KBMA 4JPZB 1YR5A 2M29A 1CB1A 2CTNA 1B8RA 4PALA 3DVKA 1XFXO 3TDIA 2JXCA 1XFVO 1NCYA 4N1FA 2DOQA 4PE0A 2EC6C 3HCMA 4CPVA 1K8UA 2PVBA 4YRUA 1EH2A 1JBAA 3A8RA 2PASA 1QVIY 1S1EA 3TDZA 5JOLA 2LUXA 1TNXA 3PN7C 3TZ1A 1SR6C 2A4JA 1J7RA 3D10A 3DF0A 1Y1UA 2KGRA 4BY5A 1KK7Y 1SL7A 1OMDA 2LMUA 3SG6A 1QIVA 4C0KA 4MZLA 2L0PA 1DMOA 1TCFA 2GGMA 1BU3A 3GOFA 4BY4A 1DVIA 3KO0A 1LINA 1CNPA 4OVNF 1IQ3A 4ORAB 1OQPA 5F6TA 2EHBA 1K2HA 5CPVA 2M1UA 4ZCVA 1FI6A 2LUCA 1WLZA 2R2IA 1KSOA 2BKHB 2EC6B 5KTYA 3CTNA 2P6BB 1NCXA 1Y6WA 3I5HC 4CIDA 1YRUB 3TS5B 3WXAA 4ICBA 1DGUA 1QX2A 3MSEB 3PN7B 5HKWA 1SR6B 3SG3A 1S6JA 1XK4A 1B1GA 5CSFA 2KAYA 1DJXA 1QIWA 1SNLA 2Y1MA 3NSKA 1U5IB 4MSPA 1UHIA 1A75B 1SY9A 2HETA 2LVKA 4PHKA 5AEQA 1UHNA 3EKHA 4MEWA 1NWDA 5CSNA 5K89A 2LHIA 2LAPA 2ZNDA 1RJVA 1SK6D 3QRXA 1L7ZA 1D1OA 1SCMC 2LP2A 1SKTA 1QLKA 2KAVA 5DKNA 4A4CA 1B9AA 2H61C 2HQWA 1KFUS 3SG7A 3EK4A 3TUYB 1C7WA 1WRZA 2LM5A 1EXRA 1J7OA 1H4BA 2JXLA 3I5HB 1AVSA 2M8UA 2BCBA 4YGAA 3BXKA 5I2LA 1QTXA 2JQ6A 1J7QA 3AKAA 2OTGC 1NX0A 1YURA 1DF0A 4WQ3A 5HLOA 1DJZA 4UPGA 1IGVA 1BR1B 3PLFB 1C7VA 3OHMB 3M0WA 1BLQA 1YVLA 2K7DA 1CFPA 2K8MB 3SIBA 5KSZA 5HLVA 1DJYA 1WLMA 4GGFA 1JF0A 1XYDA 2O60A 2SCPA 4PE4A 3IQOA 1SL9A 1GQMA 3IQQA 3A4UB 4ORBB 1BOCA 1Q80A 1F8HA 1CM4A 2L4HA 1DJHA 3FS7A 3BUOB 1SCMB 2FOTA 4PE7A 1CFCA 2KSPA 1ALVA 1CDLA 2K7OA 4WQ2A 1KSMA 2BE4A 2M7NA 3SJSA 3PFVA 1R2UA 1WRKA 4P2YB 1TNQA 2JTZA 4YGDB 2OTGB 4MRXA 1DT7B 1IQ5A 3VRNA 2K61A 1K9KA 1V1GA 1N0YA 1QVIZ 2LE9B 2JWWA 5HKYA 2NCOA 1FPWA 1KK7Z 1PALA 1OZOA 1K95A 4MLWA 3BUNB 1S3PA 2JPTA 1LXFC 2GV5A 2E6WA 1J1EA 1MF8B 3BYAA 4USLA 1Y0VH 4P5OE 3FIAA 4TNCA 1JC2A 1KQVA 1M39A 4XJKB 4AQJA 1YUTA 3ICBA 1SPYA 4CLNA 1F70A 3VGOA 2L98A 2KI6D 5ER5A 2OS8C 2WORA 1QATA 1L2OC 4CFRA 1W7JB 1DF0B 1TNWA 2Y4QA 2LV7A 3TS5C 1TOPA 2JNFA 5HYDA 1S36A 1TNPA 3AAKA 4M2PA 2F3YA 2JNXA 1TCOB 3JTDC 1JUOA 2MHHA 4QJ5B 3JVTB 2KI4C 4PDZA 2JRFA 1GGZA 1A4PA 2LC5A 3VRPA 1ZUZA 3CWGA 1NCZA 2NZ0A 3ZWHA 5PALA 2LLSA 2ZN9A 2OS8B 4DRWA 1L2OB 1XFWO 4CFQA 3KEVA 3TUYC 3DVMA 1YTZC 3IF7A 1SL8A 2AUCA 1SW8A 2ZKMX 4M2QA 1LA3A 1KFXL 1RFJA 2ZRTA 4N5XA 3RM1A 2KFFA 2ZNEA 3JTDB 3DD4A 1YUSA 1K94A 3I5IB 4GGNA 1XFUO 3PSRA 2KI4B 4MN0A 4YBHB 2L2EA 2FJUB 1NYAA 1SCVA 1FW4A 4PHNA 4NQGA 1CLBA 2BCAA 2CBLA 3EK8A 4JQ0D 1AJ4A 2I94A 1A29A 1CMGA 1CKKA 4NDCA 1EJ3A 3OX5A 4QJ3B 2JT0A 1SBJA 2I18A 2ISDA 5IBWA 2TN4A 1IRJA 4DIRA 1TN4A 4WRIA 2V53A 3H4SE 1N65A 2IS9A 1GJYA 5FYXA 3I5GC 2F3ZA 2KFGA 5CSIA 1KCYA 4MRYA 1NX3A 1UUSA 3AAJA 3DF0B 2JU0A 2JTTA 1XK4C 1JFKA 1G33A 2HPSA 2K7BA 1JFJA 4R1EA 1K9UA 2KQYA 1LVCD 2LANA 2LHLA 1OOJA 3NSOA 1UP5A 2I7AA 1QXPA 3PALA 2Y1NA 2CXJA 1M45A 1W7IB 3LK0A 4JWQA 4A4BA 1K96A 1WRLA 1CFDA 1EG3A 2F2OA 2FCDA 1CDPA 1WY9A 1B8CA 2F2PA 2KFHA 3EK7A 2PMYA 4U8DA 4F0ZB 3ZNIA 1M63B 3NXAA 1OE9B 2E30A 3E3RA 1YVHA 4D1EA 1BODA 3CGAA 2NCPA 2BBNA 5KU1A 1S5GZ 2K2FA 1Y1XA 1UHJA 1DJWA 2KI6C 1C07A 2LVJA 4GPLB 2MLFC 4YGEB 2L4IA 1RECA 1XVJA 1Y1AA 3I5GB 3NSIA 2VRGA 4MBEA 3KF9A 1QLSA 1ZMZA 5TNCA 3WNXB 1E8AA 4HRGA 4N1GA 4FTGA 1YX7A 4DS7A 3KPXA 1ODBA 3SG5A 4QJ4B 4DCKA 2AAOA 4GGFC 4IL1A 2SASA 2L51A 3RLZA 1BG1A 4HREE 1YUUA 3JVTC 3BOWA 3SG4A 2KNEA 2D8NA 4PHMA 1CDNA 2Q91A 1S5GY 3FWCA 2KGBC 1PRWA 1B7TY 4MVFA 1TTXA 1NX1A 2MLEC 1PVAA 2HQ8A 4GBAA 2M7LA 1QX5B 1A2XA 2COLB 1RROA 1IJ5A 2B1UA 4OR9B 4ETOA 4XYNA 1B47A 2KYFA 2F8PA 3F45A 2MBXA 5JJGA 2PALA 1EL4A 2JC2A 2BCXA 1UWOA 2G9BA 3I5FB 1M46A 1UURA 4PE1A 1U5IA 3OP0A 2M49B 1QASA 4HRHA 4MZJA 1NSHA 1A75A 1PULA 3LCPC 1BT6A 1SMGA 1VRKA 1CLLA 4Q04A 2BBMA 2KAXA 4ZCUA 3SG2A 3VRQA 1KK8C 1H8BA 5D7FA 3I5IC 3PATA 4YI9A 1JF2A 3EVVA 1ZFSA 2KOTA 1QX7A 2KHNA 4HSZA 3GK1A 1BR4B 1MXLC 1SRAA 1V1FA 1CFFA 3BUWB 1EG4A 1KFXS 5AFPA 2BECA 2Y5IA 1S26D 4NDBA 5AANA 3EVRA 1DTLA 1KQMC 3SIAA 1IG5A 1J1DA 1YRTB 1BJFA 2M9GA 2OPOA 4MZKA 5B8IB 1X02A 2QPTA 1RK9A 3O6BA 1KWOC 2QACA 1OZSA 2NXQA 1IKUA 3D0YA 1NIWA 2LNKA 2M1KB 3KHEA 5GQQC 1IJ6A 1M31A 1S6CA 1PSRA 4OKHA 2I2RE 1F4OA 3GK2A 3DVEA 1FF1A 3CR4X 1KK8B 1IH0A 1FI5A 2MAZA 2RGIA 3GK4X 2KYCA 3O4YA 1MHOA 3BOWB 1N2DA 1K9PA 2LVVA 1G8IA 3FWBA 3WHUB 1TRFA 3LL8B 1LKJA 4OCIA 1RTP1 3CZTX 3OB2B 2LLUA 2MRDA 5D69A 5G08A 2KBIA 1J7PA 1CDMA 2H61A 1F71A 2WOSA 1WDCC 1KQMB 1DJGA 2LMTA 2KDHA 3EVUA 5DKQA 1AHRA 2M0RA 2WCBA 1J55A 5I2OA 3DVJA 5AXIA 3AKBA 1KWOB 1RWYA 1HQVA 2JOJA 2LMVA 4AOMA 5I2QA 1F54A 2BL0C 1XO5A 2PRUA 2JT8A 5I8NA 4GAOA 4PCWA 4YGCB 3O78A 4AQIA 1HT9A 2F33A 5AERA 1TIZA 3CR2A 1MUXA 3EKJA 4NDDA 1NUBA 4PHJA 2MJWB 3BQ3A 4I5LB 1CLMA 1K90D 4ORCB 1OMRA 4L9MA 1AJ5A 2FCEA 4I5JA 3VROA 2WCEA 4OV2A 1ZACA 1CMFA 1PSBA 1DGVA 1QJTA 2CT9A 1ALWA 1NP8A 2M97A 2CNPA 1B8LA 3LK1A 2L5XB 2LVIA 1IWQA 1OMVA 4GFTA 4XJKA 4C0JA 3PM8A 4GUKA 1WDCB 1UHKA 1B4CA 2BKIB 3O2PA 4E68A 5HKZA 1F55A 2LCPA 2BE6A 1B7TZ 1XA5A 2MA2A 5J3XA 2AMIA 2BL0B 3D0YB 1R6PA 2KQ6A 1BF5A 2G2BA 2K0JA 5DKRA 3C1VA 2K7CA 2L50A 1PVBA 1YX8A 2JZIA 3BUMB 1KFUL 3OX6A 3BUXB 1JWDA 1S6IA 2Q4UA 1UHHA 2JULA 3I5FC 1JSAA 1AUIB 1PK0D 1XFZO 2LLTA 1QV0A 1LA0A 2NLNA 5CSJA 2JT3A 2K2AA 1AK8A 2O5GA 2LP3A 3NSLA 4YI8A 1GGWA 1NX2A 1QV1A 2ZFDA 2CCMA 3CS1A 3K21A 1K93D 1QS7A 1A03A 1MXEA 1SYMA 1F4QA 2ZRSA 1ZOTB 2WNDA 4I5NB 4FQOA 1MWNA 4C0LA 3CLNA 3LLEA 2H2KA 1MR8A 4DUQA 1CTRA 1DJIA 3OB1B 1G4YR 1XFYO 2HF5A 2WCFA 3TDUA 2M3WA 3VRRA 4GNKB 5ER4X 4I5KA 2EGDA 1FBVA 2WC8A 1MQ1A 3CR5X 1BMOA 1OSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX4 A;  3WHT B;  4M2O A;  4YGB B;  5BPJ A;  1AP4 A;  2ZN8 A;  2PSR A;  1NPQ A;  2GGZ A;  1CM1 A;  2KBM A;  4JPZ B;  1YR5 A;  2M29 A;  1CB1 A;  2CTN A;  1B8R A;  4PAL A;  3DVK A;  1XFX O;  3TDI A;  2JXC A;  1XFV O;  1NCY A;  4N1F A;  2DOQ A;  4PE0 A;  2EC6 C;  3HCM A;  4CPV A;  1K8U A;  2PVB A;  4YRU A;  1EH2 A;  1JBA A;  3A8R A;  2PAS A;  1QVI Y;  1S1E A;  3TDZ A;  5JOL A;  2LUX A;  1TNX A;  3PN7 C;  3TZ1 A;  1SR6 C;  2A4J A;  1J7R A;  3D10 A;  3DF0 A;  1Y1U A;  2KGR A;  4BY5 A;  1KK7 Y;  1SL7 A;  1OMD A;  2LMU A;  3SG6 A;  1QIV A;  4C0K A;  4MZL A;  2L0P A;  1DMO A;  1TCF A;  2GGM A;  1BU3 A;  3GOF A;  4BY4 A;  1DVI A;  3KO0 A;  1LIN A;  1CNP A;  4OVN F;  1IQ3 A;  4ORA B;  1OQP A;  5F6T A;  2EHB A;  1K2H A;  5CPV A;  2M1U A;  4ZCV A;  1FI6 A;  2LUC A;  1WLZ A;  2R2I A;  1KSO A;  2BKH B;  2EC6 B;  5KTY A;  3CTN A;  2P6B B;  1NCX A;  1Y6W A;  3I5H C;  4CID A;  1YRU B;  3TS5 B;  3WXA A;  4ICB A;  1DGU A;  1QX2 A;  3MSE B;  3PN7 B;  5HKW A;  1SR6 B;  3SG3 A;  1S6J A;  1XK4 A;  1B1G A;  5CSF A;  2KAY A;  1DJX A;  1QIW A;  1SNL A;  2Y1M A;  3NSK A;  1U5I B;  4MSP A;  1UHI A;  1A75 B;  1SY9 A;  2HET A;  2LVK A;  4PHK A;  5AEQ A;  1UHN A;  3EKH A;  4MEW A;  1NWD A;  5CSN A;  5K89 A;  2LHI A;  2LAP A;  2ZND A;  1RJV A;  1SK6 D;  3QRX A;  1L7Z A;  1D1O A;  1SCM C;  2LP2 A;  1SKT A;  1QLK A;  2KAV A;  5DKN A;  4A4C A;  1B9A A;  2H61 C;  2HQW A;  1KFU S;  3SG7 A;  3EK4 A;  3TUY B;  1C7W A;  1WRZ A;  2LM5 A;  1EXR A;  1J7O A;  1H4B A;  2JXL A;  3I5H B;  1AVS A;  2M8U A;  2BCB A;  4YGA A;  3BXK A;  5I2L A;  1QTX A;  2JQ6 A;  1J7Q A;  3AKA A;  2OTG C;  1NX0 A;  1YUR A;  1DF0 A;  4WQ3 A;  5HLO A;  1DJZ A;  4UPG A;  1IGV A;  1BR1 B;  3PLF B;  1C7V A;  3OHM B;  3M0W A;  1BLQ A;  1YVL A;  2K7D A;  1CFP A;  2K8M B;  3SIB A;  5KSZ A;  5HLV A;  1DJY A;  1WLM A;  4GGF A;  1JF0 A;  1XYD A;  2O60 A;  2SCP A;  4PE4 A;  3IQO A;  1SL9 A;  1GQM A;  3IQQ A;  3A4U B;  4ORB B;  1BOC A;  1Q80 A;  1F8H A;  1CM4 A;  2L4H A;  1DJH A;  3FS7 A;  3BUO B;  1SCM B;  2FOT A;  4PE7 A;  1CFC A;  2KSP A;  1ALV A;  1CDL A;  2K7O A;  4WQ2 A;  1KSM A;  2BE4 A;  2M7N A;  3SJS A;  3PFV A;  1R2U A;  1WRK A;  4P2Y B;  1TNQ A;  2JTZ A;  4YGD B;  2OTG B;  4MRX A;  1DT7 B;  1IQ5 A;  3VRN A;  2K61 A;  1K9K A;  1V1G A;  1N0Y A;  1QVI Z;  2LE9 B;  2JWW A;  5HKY A;  2NCO A;  1FPW A;  1KK7 Z;  1PAL A;  1OZO A;  1K95 A;  4MLW A;  3BUN B;  1S3P A;  2JPT A;  1LXF C;  2GV5 A;  2E6W A;  1J1E A;  1MF8 B;  3BYA A;  4USL A;  1Y0V H;  4P5O E;  3FIA A;  4TNC A;  1JC2 A;  1KQV A;  1M39 A;  4XJK B;  4AQJ A;  1YUT A;  3ICB A;  1SPY A;  4CLN A;  1F70 A;  3VGO A;  2L98 A;  2KI6 D;  5ER5 A;  2OS8 C;  2WOR A;  1QAT A;  1L2O C;  4CFR A;  1W7J B;  1DF0 B;  1TNW A;  2Y4Q A;  2LV7 A;  3TS5 C;  1TOP A;  2JNF A;  5HYD A;  1S36 A;  1TNP A;  3AAK A;  4M2P A;  2F3Y A;  2JNX A;  1TCO B;  3JTD C;  1JUO A;  2MHH A;  4QJ5 B;  3JVT B;  2KI4 C;  4PDZ A;  2JRF A;  1GGZ A;  1A4P A;  2LC5 A;  3VRP A;  1ZUZ A;  3CWG A;  1NCZ A;  2NZ0 A;  3ZWH A;  5PAL A;  2LLS A;  2ZN9 A;  2OS8 B;  4DRW A;  1L2O B;  1XFW O;  4CFQ A;  3KEV A;  3TUY C;  3DVM A;  1YTZ C;  3IF7 A;  1SL8 A;  2AUC A;  1SW8 A;  2ZKM X;  4M2Q A;  1LA3 A;  1KFX L;  1RFJ A;  2ZRT A;  4N5X A;  3RM1 A;  2KFF A;  2ZNE A;  3JTD B;  3DD4 A;  1YUS A;  1K94 A;  3I5I B;  4GGN A;  1XFU O;  3PSR A;  2KI4 B;  4MN0 A;  4YBH B;  2L2E A;  2FJU B;  1NYA A;  1SCV A;  1FW4 A;  4PHN A;  4NQG A;  1CLB A;  2BCA A;  2CBL A;  3EK8 A;  4JQ0 D;  1AJ4 A;  2I94 A;  1A29 A;  1CMG A;  1CKK A;  4NDC A;  1EJ3 A;  3OX5 A;  4QJ3 B;  2JT0 A;  1SBJ A;  2I18 A;  2ISD A;  5IBW A;  2TN4 A;  1IRJ A;  4DIR A;  1TN4 A;  4WRI A;  2V53 A;  3H4S E;  1N65 A;  2IS9 A;  1GJY A;  5FYX A;  3I5G C;  2F3Z A;  2KFG A;  5CSI A;  1KCY A;  4MRY A;  1NX3 A;  1UUS A;  3AAJ A;  3DF0 B;  2JU0 A;  2JTT A;  1XK4 C;  1JFK A;  1G33 A;  2HPS A;  2K7B A;  1JFJ A;  4R1E A;  1K9U A;  2KQY A;  1LVC D;  2LAN A;  2LHL A;  1OOJ A;  3NSO A;  1UP5 A;  2I7A A;  1QXP A;  3PAL A;  2Y1N A;  2CXJ A;  1M45 A;  1W7I B;  3LK0 A;  4JWQ A;  4A4B A;  1K96 A;  1WRL A;  1CFD A;  1EG3 A;  2F2O A;  2FCD A;  1CDP A;  1WY9 A;  1B8C A;  2F2P A;  2KFH A;  3EK7 A;  2PMY A;  4U8D A;  4F0Z B;  3ZNI A;  1M63 B;  3NXA A;  1OE9 B;  2E30 A;  3E3R A;  1YVH A;  4D1E A;  1BOD A;  3CGA A;  2NCP A;  2BBN A;  5KU1 A;  1S5G Z;  2K2F A;  1Y1X A;  1UHJ A;  1DJW A;  2KI6 C;  1C07 A;  2LVJ A;  4GPL B;  2MLF C;  4YGE B;  2L4I A;  1REC A;  1XVJ A;  1Y1A A;  3I5G B;  3NSI A;  2VRG A;  4MBE A;  3KF9 A;  1QLS A;  1ZMZ A;  5TNC A;  3WNX B;  1E8A A;  4HRG A;  4N1G A;  4FTG A;  1YX7 A;  4DS7 A;  3KPX A;  1ODB A;  3SG5 A;  4QJ4 B;  4DCK A;  2AAO A;  4GGF C;  4IL1 A;  2SAS A;  2L51 A;  3RLZ A;  1BG1 A;  4HRE E;  1YUU A;  3JVT C;  3BOW A;  3SG4 A;  2KNE A;  2D8N A;  4PHM A;  1CDN A;  2Q91 A;  1S5G Y;  3FWC A;  2KGB C;  1PRW A;  1B7T Y;  4MVF A;  1TTX A;  1NX1 A;  2MLE C;  1PVA A;  2HQ8 A;  4GBA A;  2M7L A;  1QX5 B;  1A2X A;  2COL B;  1RRO A;  1IJ5 A;  2B1U A;  4OR9 B;  4ETO A;  4XYN A;  1B47 A;  2KYF A;  2F8P A;  3F45 A;  2MBX A;  5JJG A;  2PAL A;  1EL4 A;  2JC2 A;  2BCX A;  1UWO A;  2G9B A;  3I5F B;  1M46 A;  1UUR A;  4PE1 A;  1U5I A;  3OP0 A;  2M49 B;  1QAS A;  4HRH A;  4MZJ A;  1NSH A;  1A75 A;  1PUL A;  3LCP C;  1BT6 A;  1SMG A;  1VRK A;  1CLL A;  4Q04 A;  2BBM A;  2KAX A;  4ZCU A;  3SG2 A;  3VRQ A;  1KK8 C;  1H8B A;  5D7F A;  3I5I C;  3PAT A;  4YI9 A;  1JF2 A;  3EVV A;  1ZFS A;  2KOT A;  1QX7 A;  2KHN A;  4HSZ A;  3GK1 A;  1BR4 B;  1MXL C;  1SRA A;  1V1F A;  1CFF A;  3BUW B;  1EG4 A;  1KFX S;  5AFP A;  2BEC A;  2Y5I A;  1S26 D;  4NDB A;  5AAN A;  3EVR A;  1DTL A;  1KQM C;  3SIA A;  1IG5 A;  1J1D A;  1YRT B;  1BJF A;  2M9G A;  2OPO A;  4MZK A;  5B8I B;  1X02 A;  2QPT A;  1RK9 A;  3O6B A;  1KWO C;  2QAC A;  1OZS A;  2NXQ A;  1IKU A;  3D0Y A;  1NIW A;  2LNK A;  2M1K B;  3KHE A;  5GQQ C;  1IJ6 A;  1M31 A;  1S6C A;  1PSR A;  4OKH A;  2I2R E;  1F4O A;  3GK2 A;  3DVE A;  1FF1 A;  3CR4 X;  1KK8 B;  1IH0 A;  1FI5 A;  2MAZ A;  2RGI A;  3GK4 X;  2KYC A;  3O4Y A;  1MHO A;  3BOW B;  1N2D A;  1K9P A;  2LVV A;  1G8I A;  3FWB A;  3WHU B;  1TRF A;  3LL8 B;  1LKJ A;  4OCI A;  1RTP 1;  3CZT X;  3OB2 B;  2LLU A;  2MRD A;  5D69 A;  5G08 A;  2KBI A;  1J7P A;  1CDM A;  2H61 A;  1F71 A;  2WOS A;  1WDC C;  1KQM B;  1DJG A;  2LMT A;  2KDH A;  3EVU A;  5DKQ A;  1AHR A;  2M0R A;  2WCB A;  1J55 A;  5I2O A;  3DVJ A;  5AXI A;  3AKB A;  1KWO B;  1RWY A;  1HQV A;  2JOJ A;  2LMV A;  4AOM A;  5I2Q A;  1F54 A;  2BL0 C;  1XO5 A;  2PRU A;  2JT8 A;  5I8N A;  4GAO A;  4PCW A;  4YGC B;  3O78 A;  4AQI A;  1HT9 A;  2F33 A;  5AER A;  1TIZ A;  3CR2 A;  1MUX A;  3EKJ A;  4NDD A;  1NUB A;  4PHJ A;  2MJW B;  3BQ3 A;  4I5L B;  1CLM A;  1K90 D;  4ORC B;  1OMR A;  4L9M A;  1AJ5 A;  2FCE A;  4I5J A;  3VRO A;  2WCE A;  4OV2 A;  1ZAC A;  1CMF A;  1PSB A;  1DGV A;  1QJT A;  2CT9 A;  1ALW A;  1NP8 A;  2M97 A;  2CNP A;  1B8L A;  3LK1 A;  2L5X B;  2LVI A;  1IWQ A;  1OMV A;  4GFT A;  4XJK A;  4C0J A;  3PM8 A;  4GUK A;  1WDC B;  1UHK A;  1B4C A;  2BKI B;  3O2P A;  4E68 A;  5HKZ A;  1F55 A;  2LCP A;  2BE6 A;  1B7T Z;  1XA5 A;  2MA2 A;  5J3X A;  2AMI A;  2BL0 B;  3D0Y B;  1R6P A;  2KQ6 A;  1BF5 A;  2G2B A;  2K0J A;  5DKR A;  3C1V A;  2K7C A;  2L50 A;  1PVB A;  1YX8 A;  2JZI A;  3BUM B;  1KFU L;  3OX6 A;  3BUX B;  1JWD A;  1S6I A;  2Q4U A;  1UHH A;  2JUL A;  3I5F C;  1JSA A;  1AUI B;  1PK0 D;  1XFZ O;  2LLT A;  1QV0 A;  1LA0 A;  2NLN A;  5CSJ A;  2JT3 A;  2K2A A;  1AK8 A;  2O5G A;  2LP3 A;  3NSL A;  4YI8 A;  1GGW A;  1NX2 A;  1QV1 A;  2ZFD A;  2CCM A;  3CS1 A;  3K21 A;  1K93 D;  1QS7 A;  1A03 A;  1MXE A;  1SYM A;  1F4Q A;  2ZRS A;  1ZOT B;  2WND A;  4I5N B;  4FQO A;  1MWN A;  4C0L A;  3CLN A;  3LLE A;  2H2K A;  1MR8 A;  4DUQ A;  1CTR A;  1DJI A;  3OB1 B;  1G4Y R;  1XFY O;  2HF5 A;  2WCF A;  3TDU A;  2M3W A;  3VRR A;  4GNK B;  5ER4 X;  4I5K A;  2EGD A;  1FBV A;  2WC8 A;  1MQ1 A;  3CR5 X;  1BMO A;  1OSA A; 
#chains in the Genus database with same CATH topology
 3HX4 A;  3WHT B;  4M2O A;  4YGB B;  5BPJ A;  1AP4 A;  2ZN8 A;  2PSR A;  1NPQ A;  2GGZ A;  1CM1 A;  1T14 A;  2KBM A;  3BFB A;  4JPZ B;  1YR5 A;  2M29 A;  1CB1 A;  2CTN A;  1B8R A;  4PAL A;  3DVK A;  1XFX O;  3TDI A;  2JXC A;  1XFV O;  1NCY A;  4N1F A;  2DOQ A;  4PE0 A;  2EC6 C;  2QEH A;  3HCM A;  1K8U A;  2PVB A;  4CPV A;  4YRU A;  1EH2 A;  1JBA A;  3A8R A;  2PAS A;  1QVI Y;  1S1E A;  3OBV A;  3TDZ A;  5JOL A;  1TWO A;  2LUX A;  1TNX A;  3PN7 C;  3TZ1 A;  1SR6 C;  2A4J A;  1J7R A;  3D10 A;  3DF0 A;  1Y1U A;  2KGR A;  4BY5 A;  1KK7 Y;  1SL7 A;  3SS3 A;  1DC1 A;  1OMD A;  2LMU A;  3SG6 A;  1QIV A;  4C0K A;  4MZL A;  2L0P A;  1DMO A;  1TCF A;  1DEK A;  2GGM A;  1BU3 A;  3GOF A;  1DEL A;  4BY4 A;  1DVI A;  3KO0 A;  1LIN A;  1CNP A;  4OVN F;  1IQ3 A;  4ORA B;  1OQP A;  5F6T A;  2EHB A;  1K2H A;  5CPV A;  3V2L A;  2M1U A;  4ZCV A;  2P70 A;  1FI6 A;  3S0B A;  2LUC A;  1WLZ A;  2R2I A;  1KSO A;  2BKH B;  2BAP A;  1Z2C B;  2WCJ A;  2EC6 B;  5KTY A;  3CTN A;  2P6B B;  1NCX A;  1Y6W A;  3NHT A;  3I5H C;  2WC5 A;  4CID A;  1YRU B;  3TS5 B;  3WXA A;  5FI6 A;  4ICB A;  1DGU A;  1QX2 A;  3FE8 A;  3MSE B;  3PN7 B;  1SR6 B;  4KYN A;  5HKW A;  3SG3 A;  1S6J A;  1XK4 A;  1B1G A;  5CSF A;  2KAY A;  1DQE A;  3N7H A;  1DJX A;  1QIW A;  1SNL A;  2Y1M A;  3NSK A;  1U5I B;  4MSP A;  1UHI A;  1A75 B;  1SY9 A;  2HET A;  2LVK A;  4IJ7 A;  4PHK A;  5AEQ A;  1UHN A;  3DY9 A;  3EKH A;  4MEW A;  3RZS A;  1NWD A;  5CSN A;  5K89 A;  2LHI A;  2LAP A;  2ZND A;  3OGN A;  1RJV A;  1SK6 D;  3QRX A;  1L7Z A;  1D1O A;  1SCM C;  2LP2 A;  3B88 A;  1SKT A;  1QLK A;  2KAV A;  5DKN A;  2BNX A;  4A4C A;  1B9A A;  2H61 C;  2HQW A;  1KFU S;  3SG7 A;  3EK4 A;  3TUY B;  1C7W A;  1WRZ A;  2LM5 A;  5I94 A;  1EXR A;  1J7O A;  1GM0 A;  1H4B A;  2JXL A;  3I5H B;  1AVS A;  2M8U A;  2BCB A;  3L47 A;  4YGA A;  3BXK A;  3PJI A;  5I2L A;  1QTX A;  2JQ6 A;  3BJH A;  1J7Q A;  3AKA A;  1TUZ A;  2OTG C;  1NX0 A;  1YUR A;  1DF0 A;  4WQ3 A;  5HLO A;  1DJZ A;  4UPG A;  1IGV A;  1BR1 B;  3PLF B;  1C7V A;  3OHM B;  3M0W A;  1BLQ A;  2KLE A;  1W9Z A;  1YVL A;  2K7D A;  1Z4H A;  2K8M B;  3SIB A;  5KSZ A;  5HLV A;  1CFP A;  1DJY A;  1WLM A;  4GGF A;  1JF0 A;  1XYD A;  2O60 A;  2SCP A;  4PE4 A;  3IQO A;  1SL9 A;  1GQM A;  3IQQ A;  3A4U B;  4ORB B;  2QDI A;  1Q80 A;  1BOC A;  1CM4 A;  2L4H A;  1F8H A;  1DJH A;  3FS7 A;  3BUO B;  1SCM B;  2FOT A;  4PE7 A;  1OOG A;  1CFC A;  3VB1 A;  4MZJ A;  2KSP A;  1ALV A;  1CDL A;  1XFR A;  2K7O A;  4WQ2 A;  1KSM A;  2BE4 A;  2M7N A;  3SJS A;  3FE9 A;  3PFV A;  1R2U A;  1WRK A;  4P2Y B;  1TNQ A;  2JTZ A;  3EG5 B;  4YGD B;  2OTG B;  4MRX A;  1DT7 B;  2K60 A;  1IQ5 A;  3VRN A;  2K61 A;  1K9K A;  3B86 A;  3R1V A;  1V1G A;  1N0Y A;  1QVI Z;  2LE9 B;  2JWW A;  5HKY A;  2NCO A;  3K1E A;  1FPW A;  3D75 A;  2P71 A;  1KK7 Z;  1PAL A;  1OZO A;  1K95 A;  4MLW A;  3BUN B;  1C3Y A;  1S3P A;  2JPT A;  1LXF C;  2GV5 A;  2E6W A;  3UNW A;  1J1E A;  1MF8 B;  3BYA A;  3L4L A;  3Q8I A;  4USL A;  1Y0V H;  4P5O E;  3FIA A;  4TNC A;  1JC2 A;  1KQV A;  1M39 A;  4XJK B;  4AQJ A;  1YUT A;  3ICB A;  1SPY A;  4CLN A;  1F70 A;  3VGO A;  2L98 A;  3CAB A;  2KI6 D;  5ER5 A;  2OS8 C;  2WOR A;  1QAT A;  1L2O C;  4CFR A;  1W7J B;  1DF0 B;  1TNW A;  2Y4Q A;  2LV7 A;  3TS5 C;  1TOP A;  2JNF A;  5HYD A;  1S36 A;  1IIO A;  1TNP A;  3AAK A;  3DZT A;  4M2P A;  2F3Y A;  2JNX A;  1TCO B;  3JTD C;  3CZ1 A;  1JUO A;  2MHH A;  4QJ5 B;  3JVT B;  2KI4 C;  4PDZ A;  2L2C A;  2JRF A;  1GGZ A;  1A4P A;  2LC5 A;  3VRP A;  1ZUZ A;  3CWG A;  1NCZ A;  3B87 A;  2NZ0 A;  3ZWH A;  5PAL A;  2LLS A;  2ZN9 A;  2OS8 B;  4DRW A;  1L2O B;  1XFW O;  4CFQ A;  3KEV A;  4FQT A;  3DVM A;  3TUY C;  2H8V A;  1YTZ C;  3IF7 A;  1SL8 A;  2AUC A;  1SW8 A;  2ZKM X;  3B7A A;  4M2Q A;  1LA3 A;  1KFX L;  1RFJ A;  2ZRT A;  4N5X A;  3R72 A;  3RM1 A;  2KFF A;  2ZNE A;  3JTD B;  3DD4 A;  1YUS A;  1K94 A;  4JKT A;  3I5I B;  4GGN A;  1XFU O;  3PSR A;  2KI4 B;  4MN0 A;  4YBH B;  3S0A A;  2L2E A;  2FJU B;  1NYA A;  3L4A A;  1SCV A;  1FW4 A;  4PHN A;  4NQG A;  1CLB A;  2BCA A;  2CBL A;  3EK8 A;  4JQ0 D;  1AJ4 A;  2I94 A;  1A29 A;  3D73 A;  1CMG A;  1CKK A;  2JPO A;  2KLD A;  4NDC A;  1EJ3 A;  3OX5 A;  4QJ3 B;  2JT0 A;  3SS4 A;  1SBJ A;  1TUJ A;  2I18 A;  3D76 A;  2ISD A;  5IBW A;  2TN4 A;  1IRJ A;  4DIR A;  1TN4 A;  4WRI A;  2V53 A;  3H4S E;  1N65 A;  2IS9 A;  1GJY A;  3BFA A;  5FYX A;  3I5G C;  2F3Z A;  2KFG A;  5CSI A;  1KCY A;  4MRY A;  1NX3 A;  1UUS A;  3AAJ A;  3D74 A;  3DF0 B;  2JU0 A;  2JTT A;  1XK4 C;  1JFK A;  1G33 A;  2HPS A;  2K7B A;  3O4X A;  1JFJ A;  4R1E A;  1K9U A;  2KQY A;  1LVC D;  2LAN A;  2LHL A;  1OOJ A;  3NSO A;  1UP5 A;  2I7A A;  3SS5 A;  1QXP A;  3PAL A;  2Y1N A;  2CXJ A;  1M45 A;  1W7I B;  3LK0 A;  4JWQ A;  4A4B A;  1K96 A;  1WRL A;  3CYZ A;  1CFD A;  1EG3 A;  2F2O A;  2FCD A;  1CDP A;  1WY9 A;  3D77 A;  1B8C A;  2F2P A;  2KFH A;  2WCM A;  3EK7 A;  2PMY A;  4INW A;  4U8D A;  3ZNI A;  1M63 B;  4F0Z B;  2WC6 A;  3BFH A;  1OW4 A;  1OE9 B;  2E30 A;  3NXA A;  3E3R A;  1YVH A;  4D1E A;  1BOD A;  3CGA A;  2NCP A;  3S0E A;  2BBN A;  5KU1 A;  1S5G Z;  2K2F A;  1Y1X A;  1UHJ A;  1C3Z A;  1DJW A;  2KI6 C;  1C07 A;  2LVJ A;  4GPL B;  2MLF C;  4YGE B;  2L4I A;  1REC A;  1XVJ A;  1Y1A A;  3I5G B;  3NSI A;  2VRG A;  4MBE A;  3KF9 A;  1QLS A;  1ZMZ A;  5TNC A;  1LS8 A;  3S0D A;  3D78 A;  2WCH A;  3WNX B;  1E8A A;  4HRG A;  3NGV A;  4N1G A;  1OOI X;  4FTG A;  1YX7 A;  4DS7 A;  3KPX A;  1ODB A;  3SG5 A;  4QJ4 B;  4DCK A;  2AAO A;  4GGF C;  4IL1 A;  2SAS A;  2L51 A;  3RLZ A;  1BG1 A;  4HRE E;  1YUU A;  3JVT C;  4F7F A;  3BOW A;  3SG4 A;  2KNE A;  2D8N A;  4PHM A;  1CDN A;  2Q91 A;  1S5G Y;  3FWC A;  2KGB C;  1PRW A;  1B7T Y;  4MVF A;  1TTX A;  1NX1 A;  1ORG A;  2MLE C;  2PQL A;  1PVA A;  2HQ8 A;  4GBA A;  2M7L A;  1QX5 B;  1A2X A;  2COL B;  1RRO A;  1IJ5 A;  4INX A;  2B1U A;  4OR9 B;  4ETO A;  4XYN A;  1B47 A;  2KYF A;  2F8P A;  1SSE B;  4PT1 A;  3F45 A;  2MBX A;  5JJG A;  2PAL A;  1EL4 A;  5EL2 A;  2JC2 A;  2BCX A;  1UWO A;  2G9B A;  3I5F B;  1M46 A;  1UUR A;  5D3O A;  4PE1 A;  1U5I A;  2FJY A;  2M49 B;  2QEO A;  1QAS A;  3OP0 A;  4HRH A;  1NSH A;  1A75 A;  1PUL A;  3LCP C;  1BT6 A;  1SMG A;  1VRK A;  1CLL A;  2PYQ A;  2BBM A;  2KAX A;  4Q04 A;  4ZCU A;  3SG2 A;  1KK8 C;  3IVT A;  5D7F A;  3VRQ A;  1H8B A;  3I5I C;  3PAT A;  4YI9 A;  1JF2 A;  3EVV A;  1ZFS A;  2KOT A;  1QX7 A;  2KHN A;  4HSZ A;  3GK1 A;  1BR4 B;  1MXL C;  1SRA A;  1V1F A;  1CFF A;  3BUW B;  1EG4 A;  1KFX S;  5AFP A;  2BEC A;  2Y5I A;  1S26 D;  4NDB A;  5AAN A;  3EVR A;  1DTL A;  1KQM C;  3SIA A;  1IG5 A;  1J1D A;  1YRT B;  1BJF A;  2M9G A;  2OPO A;  4MZK A;  5B8I B;  1X02 A;  2QPT A;  1RK9 A;  3O6B A;  1KWO C;  2QAC A;  1OZS A;  2NXQ A;  1IKU A;  1QWV A;  3D0Y A;  1NIW A;  2LNK A;  2M1K B;  3KHE A;  5GQQ C;  1IJ6 A;  3B6X A;  1M31 A;  1S6C A;  1PSR A;  4OKH A;  2I2R E;  1F4O A;  3GK2 A;  3DVE A;  1FF1 A;  3CR4 X;  1KK8 B;  1IH0 A;  1FI5 A;  2MAZ A;  2RGI A;  3GK4 X;  2KYC A;  3O4Y A;  1MHO A;  3BOW B;  1N2D A;  1K9P A;  2LVV A;  1G8I A;  3FWB A;  3WHU B;  1TRF A;  3LL8 B;  1LKJ A;  4OCI A;  1RTP 1;  2WCK A;  3CZT X;  3OB2 B;  2LLU A;  2MRD A;  5D69 A;  5G08 A;  2KBI A;  1J7P A;  1CDM A;  3R1P A;  2H61 A;  3PM2 A;  1F71 A;  2WOS A;  1WDC C;  1KQM B;  1DJG A;  2LMT A;  2KDH A;  3EVU A;  5DKQ A;  1AHR A;  2M0R A;  2WCB A;  1J55 A;  3CZ0 A;  5I2O A;  3DVJ A;  5AXI A;  3FE6 A;  3AKB A;  1KWO B;  1RWY A;  1HQV A;  2JOJ A;  2LMV A;  4AOM A;  5HL1 A;  5I2Q A;  1F54 A;  2BL0 C;  1XO5 A;  2PRU A;  2JT8 A;  5I8N A;  4GAO A;  4PCW A;  4YGC B;  3O78 A;  4AQI A;  1HT9 A;  2F33 A;  5AER A;  1TIZ A;  3CR2 A;  1MUX A;  2ERB A;  1OOF A;  3EKJ A;  4NDD A;  1NUB A;  4PHJ A;  2MJW B;  3BQ3 A;  4I5L B;  1CLM A;  1K90 D;  3QME A;  1OMR A;  4L9M A;  1AJ5 A;  2QEB A;  4ORC B;  2QEV A;  2FCE A;  4I5J A;  3VRO A;  2WCE A;  3R1O A;  4OV2 A;  1ZAC A;  1CMF A;  1PSB A;  1DGV A;  1QJT A;  2CT9 A;  1ALW A;  1NP8 A;  2M97 A;  2CNP A;  1B8L A;  3LK1 A;  2L5X B;  2LVI A;  1IWQ A;  1OMV A;  4GFT A;  4XJK A;  4C0J A;  3PM8 A;  4GUK A;  1WDC B;  1UHK A;  1B4C A;  2BKI B;  3O2P A;  3S0F A;  4E68 A;  5HKZ A;  1F55 A;  2LCP A;  2BE6 A;  1B7T Z;  1XA5 A;  2MA2 A;  3DYE A;  5DIC A;  5J3X A;  2AMI A;  2BL0 B;  3D0Y B;  1R6P A;  2KQ6 A;  1BF5 A;  2G2B A;  2K0J A;  5DKR A;  3C1V A;  2K7C A;  2L50 A;  1PVB A;  1YX8 A;  2JZI A;  3BUM B;  1P28 A;  1KFU L;  3OX6 A;  4JD9 A;  3BUX B;  3NHI A;  1JWD A;  5FI2 A;  5FI7 A;  1S6I A;  2Q4U A;  1UHH A;  2JUL A;  3I5F C;  1JSA A;  1AUI B;  1PK0 D;  1XFZ O;  3S0G A;  2LLT A;  1QV0 A;  1LA0 A;  2NLN A;  5CSJ A;  2GTE A;  3CZ2 A;  2JT3 A;  2K2A A;  1AK8 A;  2O5G A;  2LP3 A;  3NSL A;  4YI8 A;  1GGW A;  1NX2 A;  1QV1 A;  2ZFD A;  2CCM A;  2YGU A;  1OOH A;  3CS1 A;  3K21 A;  1K93 D;  1QS7 A;  1A03 A;  1MXE A;  1SYM A;  2L5Y A;  1F4Q A;  2ZRS A;  1ZOT B;  2WND A;  4I5N B;  4FQO A;  3UO9 A;  1MWN A;  4C0L A;  3CLN A;  3LLE A;  2KPH A;  2H2K A;  1MR8 A;  4DUQ A;  1CTR A;  1DJI A;  3OB1 B;  1G4Y R;  1XFY O;  2HF5 A;  3DXL A;  2WCF A;  3TDU A;  2M3W A;  3VRR A;  4GNK B;  3CDN A;  5ER4 X;  2WCL A;  4I5K A;  2EGD A;  1FBV A;  2WC8 A;  1MQ1 A;  4OZD A;  3CR5 X;  1BMO A;  1OSA A; 
#chains in the Genus database with same CATH homology
 3HX4 A;  3WHT B;  4M2O A;  4YGB B;  5BPJ A;  1AP4 A;  2ZN8 A;  2PSR A;  1NPQ A;  2GGZ A;  1CM1 A;  2KBM A;  4JPZ B;  1YR5 A;  2M29 A;  1CB1 A;  2CTN A;  1B8R A;  4PAL A;  3DVK A;  1XFX O;  3TDI A;  2JXC A;  1XFV O;  1NCY A;  4N1F A;  2DOQ A;  4PE0 A;  2EC6 C;  3HCM A;  4CPV A;  1K8U A;  2PVB A;  4YRU A;  1EH2 A;  1JBA A;  3A8R A;  2PAS A;  1QVI Y;  1S1E A;  3TDZ A;  5JOL A;  2LUX A;  1TNX A;  3PN7 C;  3TZ1 A;  1SR6 C;  2A4J A;  1J7R A;  3D10 A;  3DF0 A;  1Y1U A;  2KGR A;  4BY5 A;  1KK7 Y;  1SL7 A;  1OMD A;  2LMU A;  3SG6 A;  1QIV A;  4C0K A;  4MZL A;  2L0P A;  1DMO A;  1TCF A;  2GGM A;  1BU3 A;  3GOF A;  4BY4 A;  1DVI A;  3KO0 A;  1LIN A;  1CNP A;  4OVN F;  1IQ3 A;  4ORA B;  1OQP A;  5F6T A;  2EHB A;  1K2H A;  5CPV A;  2M1U A;  4ZCV A;  1FI6 A;  2LUC A;  1WLZ A;  2R2I A;  1KSO A;  2BKH B;  2EC6 B;  5KTY A;  3CTN A;  2P6B B;  1NCX A;  1Y6W A;  3I5H C;  4CID A;  1YRU B;  3TS5 B;  3WXA A;  4ICB A;  1DGU A;  1QX2 A;  3MSE B;  3PN7 B;  5HKW A;  1SR6 B;  3SG3 A;  1S6J A;  1XK4 A;  1B1G A;  5CSF A;  2KAY A;  1DJX A;  1QIW A;  1SNL A;  2Y1M A;  3NSK A;  1U5I B;  4MSP A;  1UHI A;  1A75 B;  1SY9 A;  2HET A;  2LVK A;  4PHK A;  5AEQ A;  1UHN A;  3EKH A;  4MEW A;  1NWD A;  5CSN A;  5K89 A;  2LHI A;  2LAP A;  2ZND A;  1RJV A;  1SK6 D;  3QRX A;  1L7Z A;  1D1O A;  1SCM C;  2LP2 A;  1SKT A;  1QLK A;  2KAV A;  5DKN A;  4A4C A;  1B9A A;  2H61 C;  2HQW A;  1KFU S;  3SG7 A;  3EK4 A;  3TUY B;  1C7W A;  1WRZ A;  2LM5 A;  1EXR A;  1J7O A;  1H4B A;  2JXL A;  3I5H B;  1AVS A;  2M8U A;  2BCB A;  4YGA A;  3BXK A;  5I2L A;  1QTX A;  2JQ6 A;  1J7Q A;  3AKA A;  2OTG C;  1NX0 A;  1YUR A;  1DF0 A;  4WQ3 A;  5HLO A;  1DJZ A;  4UPG A;  1IGV A;  1BR1 B;  3PLF B;  1C7V A;  3OHM B;  3M0W A;  1BLQ A;  1YVL A;  2K7D A;  1CFP A;  2K8M B;  3SIB A;  5KSZ A;  5HLV A;  1DJY A;  1WLM A;  4GGF A;  1JF0 A;  1XYD A;  2O60 A;  2SCP A;  4PE4 A;  3IQO A;  1SL9 A;  1GQM A;  3IQQ A;  3A4U B;  4ORB B;  1BOC A;  1Q80 A;  1F8H A;  1CM4 A;  2L4H A;  1DJH A;  3FS7 A;  3BUO B;  1SCM B;  2FOT A;  4PE7 A;  1CFC A;  2KSP A;  1ALV A;  1CDL A;  2K7O A;  4WQ2 A;  1KSM A;  2BE4 A;  2M7N A;  3SJS A;  3PFV A;  1R2U A;  1WRK A;  4P2Y B;  1TNQ A;  2JTZ A;  4YGD B;  2OTG B;  4MRX A;  1DT7 B;  1IQ5 A;  3VRN A;  2K61 A;  1K9K A;  1V1G A;  1N0Y A;  1QVI Z;  2LE9 B;  2JWW A;  5HKY A;  2NCO A;  1FPW A;  1KK7 Z;  1PAL A;  1OZO A;  1K95 A;  4MLW A;  3BUN B;  1S3P A;  2JPT A;  1LXF C;  2GV5 A;  2E6W A;  1J1E A;  1MF8 B;  3BYA A;  4USL A;  1Y0V H;  4P5O E;  3FIA A;  4TNC A;  1JC2 A;  1KQV A;  1M39 A;  4XJK B;  4AQJ A;  1YUT A;  3ICB A;  1SPY A;  4CLN A;  1F70 A;  3VGO A;  2L98 A;  2KI6 D;  5ER5 A;  2OS8 C;  2WOR A;  1QAT A;  1L2O C;  4CFR A;  1W7J B;  1DF0 B;  1TNW A;  2Y4Q A;  2LV7 A;  3TS5 C;  1TOP A;  2JNF A;  5HYD A;  1S36 A;  1TNP A;  3AAK A;  4M2P A;  2F3Y A;  2JNX A;  1TCO B;  3JTD C;  1JUO A;  2MHH A;  4QJ5 B;  3JVT B;  2KI4 C;  4PDZ A;  2JRF A;  1GGZ A;  1A4P A;  2LC5 A;  3VRP A;  1ZUZ A;  3CWG A;  1NCZ A;  2NZ0 A;  3ZWH A;  5PAL A;  2LLS A;  2ZN9 A;  2OS8 B;  4DRW A;  1L2O B;  1XFW O;  4CFQ A;  3KEV A;  3TUY C;  3DVM A;  1YTZ C;  3IF7 A;  1SL8 A;  2AUC A;  1SW8 A;  2ZKM X;  4M2Q A;  1LA3 A;  1KFX L;  1RFJ A;  2ZRT A;  4N5X A;  3RM1 A;  2KFF A;  2ZNE A;  3JTD B;  3DD4 A;  1YUS A;  1K94 A;  3I5I B;  4GGN A;  1XFU O;  3PSR A;  2KI4 B;  4MN0 A;  4YBH B;  2L2E A;  2FJU B;  1NYA A;  1SCV A;  1FW4 A;  4PHN A;  4NQG A;  1CLB A;  2BCA A;  2CBL A;  3EK8 A;  4JQ0 D;  1AJ4 A;  2I94 A;  1A29 A;  1CMG A;  1CKK A;  4NDC A;  1EJ3 A;  3OX5 A;  4QJ3 B;  2JT0 A;  1SBJ A;  2I18 A;  2ISD A;  5IBW A;  2TN4 A;  1IRJ A;  4DIR A;  1TN4 A;  4WRI A;  2V53 A;  3H4S E;  1N65 A;  2IS9 A;  1GJY A;  5FYX A;  3I5G C;  2F3Z A;  2KFG A;  5CSI A;  1KCY A;  4MRY A;  1NX3 A;  1UUS A;  3AAJ A;  3DF0 B;  2JU0 A;  2JTT A;  1XK4 C;  1JFK A;  1G33 A;  2HPS A;  2K7B A;  1JFJ A;  4R1E A;  1K9U A;  2KQY A;  1LVC D;  2LAN A;  2LHL A;  1OOJ A;  3NSO A;  1UP5 A;  2I7A A;  1QXP A;  3PAL A;  2Y1N A;  2CXJ A;  1M45 A;  1W7I B;  3LK0 A;  4JWQ A;  4A4B A;  1K96 A;  1WRL A;  1CFD A;  1EG3 A;  2F2O A;  2FCD A;  1CDP A;  1WY9 A;  1B8C A;  2F2P A;  2KFH A;  3EK7 A;  2PMY A;  4U8D A;  4F0Z B;  3ZNI A;  1M63 B;  3NXA A;  1OE9 B;  2E30 A;  3E3R A;  1YVH A;  4D1E A;  1BOD A;  3CGA A;  2NCP A;  2BBN A;  5KU1 A;  1S5G Z;  2K2F A;  1Y1X A;  1UHJ A;  1DJW A;  2KI6 C;  1C07 A;  2LVJ A;  4GPL B;  2MLF C;  4YGE B;  2L4I A;  1REC A;  1XVJ A;  1Y1A A;  3I5G B;  3NSI A;  2VRG A;  4MBE A;  3KF9 A;  1QLS A;  1ZMZ A;  5TNC A;  3WNX B;  1E8A A;  4HRG A;  4N1G A;  4FTG A;  1YX7 A;  4DS7 A;  3KPX A;  1ODB A;  3SG5 A;  4QJ4 B;  4DCK A;  2AAO A;  4GGF C;  4IL1 A;  2SAS A;  2L51 A;  3RLZ A;  1BG1 A;  4HRE E;  1YUU A;  3JVT C;  3BOW A;  3SG4 A;  2KNE A;  2D8N A;  4PHM A;  1CDN A;  2Q91 A;  1S5G Y;  3FWC A;  2KGB C;  1PRW A;  1B7T Y;  4MVF A;  1TTX A;  1NX1 A;  2MLE C;  1PVA A;  2HQ8 A;  4GBA A;  2M7L A;  1QX5 B;  1A2X A;  2COL B;  1RRO A;  1IJ5 A;  2B1U A;  4OR9 B;  4ETO A;  4XYN A;  1B47 A;  2KYF A;  2F8P A;  3F45 A;  2MBX A;  5JJG A;  2PAL A;  1EL4 A;  2JC2 A;  2BCX A;  1UWO A;  2G9B A;  3I5F B;  1M46 A;  1UUR A;  4PE1 A;  1U5I A;  3OP0 A;  2M49 B;  1QAS A;  4HRH A;  4MZJ A;  1NSH A;  1A75 A;  1PUL A;  3LCP C;  1BT6 A;  1SMG A;  1VRK A;  1CLL A;  4Q04 A;  2BBM A;  2KAX A;  4ZCU A;  3SG2 A;  3VRQ A;  1KK8 C;  1H8B A;  5D7F A;  3I5I C;  3PAT A;  4YI9 A;  1JF2 A;  3EVV A;  1ZFS A;  2KOT A;  1QX7 A;  2KHN A;  4HSZ A;  3GK1 A;  1BR4 B;  1MXL C;  1SRA A;  1V1F A;  1CFF A;  3BUW B;  1EG4 A;  1KFX S;  5AFP A;  2BEC A;  2Y5I A;  1S26 D;  4NDB A;  5AAN A;  3EVR A;  1DTL A;  1KQM C;  3SIA A;  1IG5 A;  1J1D A;  1YRT B;  1BJF A;  2M9G A;  2OPO A;  4MZK A;  5B8I B;  1X02 A;  2QPT A;  1RK9 A;  3O6B A;  1KWO C;  2QAC A;  1OZS A;  2NXQ A;  1IKU A;  3D0Y A;  1NIW A;  2LNK A;  2M1K B;  3KHE A;  5GQQ C;  1IJ6 A;  1M31 A;  1S6C A;  1PSR A;  4OKH A;  2I2R E;  1F4O A;  3GK2 A;  3DVE A;  1FF1 A;  3CR4 X;  1KK8 B;  1IH0 A;  1FI5 A;  2MAZ A;  2RGI A;  3GK4 X;  2KYC A;  3O4Y A;  1MHO A;  3BOW B;  1N2D A;  1K9P A;  2LVV A;  1G8I A;  3FWB A;  3WHU B;  1TRF A;  3LL8 B;  1LKJ A;  4OCI A;  1RTP 1;  3CZT X;  3OB2 B;  2LLU A;  2MRD A;  5D69 A;  5G08 A;  2KBI A;  1J7P A;  1CDM A;  2H61 A;  1F71 A;  2WOS A;  1WDC C;  1KQM B;  1DJG A;  2LMT A;  2KDH A;  3EVU A;  5DKQ A;  1AHR A;  2M0R A;  2WCB A;  1J55 A;  5I2O A;  3DVJ A;  5AXI A;  3AKB A;  1KWO B;  1RWY A;  1HQV A;  2JOJ A;  2LMV A;  4AOM A;  5I2Q A;  1F54 A;  2BL0 C;  1XO5 A;  2PRU A;  2JT8 A;  5I8N A;  4GAO A;  4PCW A;  4YGC B;  3O78 A;  4AQI A;  1HT9 A;  2F33 A;  5AER A;  1TIZ A;  3CR2 A;  1MUX A;  3EKJ A;  4NDD A;  1NUB A;  4PHJ A;  2MJW B;  3BQ3 A;  4I5L B;  1CLM A;  1K90 D;  4ORC B;  1OMR A;  4L9M A;  1AJ5 A;  2FCE A;  4I5J A;  3VRO A;  2WCE A;  4OV2 A;  1ZAC A;  1CMF A;  1PSB A;  1DGV A;  1QJT A;  2CT9 A;  1ALW A;  1NP8 A;  2M97 A;  2CNP A;  1B8L A;  3LK1 A;  2L5X B;  2LVI A;  1IWQ A;  1OMV A;  4GFT A;  4XJK A;  4C0J A;  3PM8 A;  4GUK A;  1WDC B;  1UHK A;  1B4C A;  2BKI B;  3O2P A;  4E68 A;  5HKZ A;  1F55 A;  2LCP A;  2BE6 A;  1B7T Z;  1XA5 A;  2MA2 A;  5J3X A;  2AMI A;  2BL0 B;  3D0Y B;  1R6P A;  2KQ6 A;  1BF5 A;  2G2B A;  2K0J A;  5DKR A;  3C1V A;  2K7C A;  2L50 A;  1PVB A;  1YX8 A;  2JZI A;  3BUM B;  1KFU L;  3OX6 A;  3BUX B;  1JWD A;  1S6I A;  2Q4U A;  1UHH A;  2JUL A;  3I5F C;  1JSA A;  1AUI B;  1PK0 D;  1XFZ O;  2LLT A;  1QV0 A;  1LA0 A;  2NLN A;  5CSJ A;  2JT3 A;  2K2A A;  1AK8 A;  2O5G A;  2LP3 A;  3NSL A;  4YI8 A;  1GGW A;  1NX2 A;  1QV1 A;  2ZFD A;  2CCM A;  3CS1 A;  3K21 A;  1K93 D;  1QS7 A;  1A03 A;  1MXE A;  1SYM A;  1F4Q A;  2ZRS A;  1ZOT B;  2WND A;  4I5N B;  4FQO A;  1MWN A;  4C0L A;  3CLN A;  3LLE A;  2H2K A;  1MR8 A;  4DUQ A;  1CTR A;  1DJI A;  3OB1 B;  1G4Y R;  1XFY O;  2HF5 A;  2WCF A;  3TDU A;  2M3W A;  3VRR A;  4GNK B;  5ER4 X;  4I5K A;  2EGD A;  1FBV A;  2WC8 A;  1MQ1 A;  3CR5 X;  1BMO A;  1OSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...