1MXEA

Structure of the complex of calmodulin with the target sequence of camki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
144
structure length
144
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 59
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA02
1SK6D 1SL8A 2BL0C 1BT6A 1TRFA 2JXCA 4WQ2A 1A29A 1UHJA 2LANA 2LHLA 3EVRA 3SG5A 1AJ4A 2V53A 2FOTA 2B1UA 1XVJA 1MR8A 1NP8A 1UHHA 1M39A 1Y1XA 1YUUA 2OTGB 3OB2B 2HETA 1K93D 1EG4A 1KQMC 2DOQA 2PALA 1KWOC 4GGFA 5CSNA 2WNDA 2TN4A 3BUOB 2LCPA 1TCFA 3VRPA 1KCYA 4ORAB 5FYXA 5DKQA 5HKZA 1XK4A 3NSLA 1SR6B 1LXFC 1M31A 1C7VA 5ER4X 3D0YA 1OSAA 1BG1A 1DGVA 5JJGA 1B7TY 1F8HA 1DT7B 3AAJA 1F4QA 1TNQA 1SCVA 1CLMA 3D0YB 5KTYA 1PK0D 1QIVA 3SIAA 1NCYA 1PVBA 3ZWHA 1UHNA 4JPZB 1YX7A 1BR1B 3JTDB 3O2PA 4M2QA 2LNKA 1U5IA 2JT3A 3VROA 1B9AA 3K21A 1EJ3A 2BL0B 2K0JA 2RGIA 3CS1A 4MEWA 2COLB 3ZNIA 1GGWA 1DJGA 1L2OC 4OVNF 2OS8B 3CWGA 3H4SE 5G08A 2JT0A 1NCZA 2CXJA 1M45A 2K7BA 3I5FB 1A75B 3AKBA 3PLFB 5B8IB 1BODA 1KQMB 4Q04A 1DVIA 1KWOB 4I5NB 5I2OA 3FWCA 2I2RE 2EC6C 1IJ6A 2LM5A 2L98A 4HSZA 5DKNA 1TIZA 1LA0A 1IWQA 4L9MA 4GFTA 5J3XA 1KFXS 1CDNA 2BCBA 1K9PA 4MRXA 1SMGA 1S6JA 2P6BB 4E68A 3F45A 1DJYA 1RROA 2NCOA 2Y1NA 4GAOA 2G9BA 3TZ1A 1QV0A 2BECA 3BUWB 1ZACA 4DUQA 1HT9A 1XYDA 2LP2A 2KSPA 1NWDA 5CSFA 2KYCA 3TDIA 3DD4A 1QIWA 1UURA 3RLZA 1DGUA 1NUBA 1GJYA 2F2OA 3BUMB 1LVCD 1TCOB 2WORA 1X02A 1TNXA 4R1EA 1AUIB 1NX1A 1CFCA 1H8BA 1YVHA 2PASA 1XFVO 4CPVA 1C07A 2ZNEA 1K8UA 1L2OB 1ODBA 3LK1A 2ZKMX 3I5IB 3JVTC 3PATA 3VGOA 3WHUB 1FI6A 4N1GA 2KI6D 4N1FA 1CLBA 3SG3A 4MSPA 2EC6B 1S26D 2M29A 1NIWA 1CNPA 2KAVA 2WOSA 4MZKA 2M0RA 2F8PA 2AAOA 5AEQA 1QASA 1WY9A 1BR4B 2KYFA 3KO0A 2LP3A 1XFWO 2NXQA 1KK7Z 3VRNA 2LV7A 4IL1A 1SPYA 1KK8C 2WCBA 2Y1MA 5CSIA 1EXRA 2ZN8A 4GPLB 1KFUL 4AQIA 4M2PA 1SYMA 2JNXA 1CMFA 3CZTX 5JOLA 2CBLA 4D1EA 4PE7A 3DF0B 2JC2A 1XA5A 1WDCC 2JU0A 5I8NA 2L50A 1QLSA 1PULA 5D69A 1BJFA 1MF8B 1LKJA 3JVTB 4GGNA 4NDBA 1TOPA 2KOTA 2F2PA 3EK7A 3O6BA 3CGAA 4PHMA 2M3WA 1S6CA 1CMGA 2ZN9A 2CT9A 1V1GA 2ISDA 2ZRTA 3KPXA 2LAPA 3LCPC 1SL7A 1B8CA 2HPSA 4C0JA 3HX4A 1RFJA 3TUYC 2WCEA 2JT8A 1JSAA 4YI9A 1UHIA 2MHHA 4HREE 2KDHA 2LVIA 4ZCVA 1JC2A 2M1KB 1FBVA 2FCDA 1UP5A 1SY9A 1QVIZ 1TTXA 3IF7A 4MZLA 5HKWA 1BOCA 1BMOA 1KK8B 3OP0A 5IBWA 1Y6WA 2JTZA 1N65A 3KF9A 1PSRA 3C1VA 3NSOA 4MLWA 2M9GA 2SASA 1NX3A 1CDPA 1DJIA 2Q4UA 3GK1A 1K9UA 2Y5IA 3BYAA 3AKAA 1QX7A 4HRGA 1RWYA 1OZSA 1KSOA 2LVJA 4P2YB 1WDCB 5GQQC 1PALA 1W7IB 2KI4C 1RTP1 1A75A 5DKRA 3TDUA 1F55A 1BLQA 1EH2A 1G8IA 1J7QA 2M97A 1FI5A 1E8AA 3FWBA 1KFXL 1J7RA 2KFGA 2LE9B 1F71A 3GK2A 2K7DA 3SG2A 2MLEC 1GGZA 1CFDA 4A4CA 5AFPA 4I5KA 3GK4X 5HLVA 5TNCA 5KU1A 1DMOA 2JULA 3TS5C 5AANA 5KSZA 3TUYB 1V1FA 4PHKA 2BCAA 3EKJA 3HCMA 1FW4A 1XFUO 3SJSA 4GNKB 2BKIB 1MUXA 1QX5B 1MHOA 3IQOA 1F70A 5I2LA 1IGVA 2JXLA 3BOWB 2KQ6A 1CM1A 1XFYO 1RJVA 4NDDA 4PE1A 4QJ4B 1KK7Y 4M2OA 1B8RA 2EHBA 1MWNA 4CFRA 3AAKA 1WLZA 2KQYA 2EGDA 1SL9A 1SCMC 4DCKA 1FF1A 2R2IA 1B4CA 4PE0A 1K90D 1DF0B 3OX6A 3KHEA 4WQ3A 2H61C 4MN0A 3DVMA 1B7TZ 1RK9A 1EL4A 1WRLA 4YGDB 5HYDA 5CPVA 5HKYA 4TNCA 1JUOA 4NDCA 2JQ6A 1M46A 1XFZO 1XO5A 2CTNA 4WRIA 1QS7A 2LUXA 3KEVA 2WCFA 4ICBA 1ZUZA 4C0KA 3ICBA 2PVBA 4PDZA 2NCPA 4XYNA 2MAZA 1Y1AA 3A8RA 3TS5B 2L4HA 1CDLA 2D8NA 2ZRSA 1JF0A 1J1DA 3TDZA 1QTXA 2CNPA 2Y4QA 1QLKA 1IQ3A 1CDMA 1OMRA 3EVVA 2LVVA 3IQQA 2H2KA 1OE9B 1A03A 1NX2A 3MSEB 1PSBA 4P5OE 4MRYA 1TNWA 1QVIY 2WC8A 1KSMA 3DF0A 1OMDA 1SCMB 4A4BA 2NLNA 1DJHA 1S3PA 2LLUA 1J1EA 3D10A 4GUKA 1YR5A 2GGMA 2L4IA 1DJXA 2AUCA 1D1OA 1J55A 2MBXA 2KHNA 3EK4A 4YI8A 1MXEA 1WRKA 1CFFA 2QACA 2L5XB 1M63B 1NSHA 3DVJA 4GGFC 5ER5A 1G4YR 2O5GA 1S1EA 2K8MB 1FPWA 2E30A 3QRXA 1ZMZA 4YGAA 3A4UB 4USLA 1KQVA 5HLOA 4PHNA 4XJKB 1XK4C 1ZOTB 1YUTA 3LLEA 1BU3A 2MJWB 1B1GA 2FCEA 2G2BA 1QV1A 1GQMA 1EG3A 4FQOA 2SCPA 4BY5A 1CKKA 4ZCUA 2K61A 2MLFC 2HQWA 1YRUB 4YGBB 3JTDC 4I5JA 1PRWA 1ALVA 2I94A 1MQ1A 4MBEA 5F6TA 4YRUA 2PSRA 1IJ5A 4F0ZB 3SG7A 1F4OA 2BE6A 2KI6C 2Q91A 3LK0A 1S5GZ 2OS8C 1NPQA 2LC5A 2LLSA 2O60A 4ORBB 1H4BA 2PMYA 3I5FC 3SG4A 3EVUA 5PALA 2VRGA 2JOJA 3WHTB 2L51A 2E6WA 4MVFA 2L2EA 4PHJA 3M0WA 1SNLA 1PVAA 1AHRA 2BBMA 2BCXA 1W7JB 1L7ZA 1JFJA 1Q80A 1QXPA 2A4JA 3CR4X 4PALA 1JBAA 1LA3A 1A2XA 1DJWA 2I7AA 4OKHA 3BQ3A 1K94A 1J7PA 3BUXB 4QJ3B 1IQ5A 1CTRA 2FJUB 2NZ0A 1YURA 2I18A 4AOMA 1CM4A 1AVSA 1K95A 4MZJA 1SKTA 2JZIA 3NSKA 3SG6A 3I5GC 1K96A 2GGZA 2KAYA 1Y1UA 3VRRA 3SIBA 3PN7C 2F33A 4DIRA 2M8UA 3BOWA 5BPJA 1G33A 3O78A 3VRQA 1DTLA 4OCIA 1JF2A 4I5LB 3I5HC 1BF5A 1MXLC 2M7LA 3PM8A 1YUSA 3I5IC 3BUNB 1YVLA 2M49B 4DRWA 1U5IB 1TNPA 2MA2A 2PRUA 3EK8A 1S36A 2LLTA 1DF0A 1RECA 1CLLA 1OQPA 1YRTB 3WNXB 2MRDA 1B47A 5D7FA 1B8LA 3DVKA 2JTTA 1AK8A 1OOJA 5CSJA 3LL8B 1NX0A 4YBHB 2KGBC 1C7WA 1A4PA 2KI4B 4OR9B 1QJTA 4YGCB 1F54A 2KNEA 1IH0A 2K7OA 1OZOA 4CIDA 4CLNA 1SRAA 2KFFA 4PCWA 2IS9A 3CR2A 1N2DA 1SW8A 2LHIA 3OB1B 2F3YA 2F3ZA 2K2AA 3FIAA 3CTNA 1CFPA 3I5GB 1AP4A 3WXAA 2JPTA 5AERA 3PN7B 2L0PA 2KFHA 3O4YA 5I2QA 4ORCB 3PFVA 4CFQA 2AMIA 2JNFA 4BY4A 2LMVA 2KBMA 1Y0VH 1VRKA 1WRZA 3NXAA 2HF5A 3NSIA 2CCMA 1QATA 3I5HB 3CLNA 1IRJA 1YTZC 1CB1A 1K2HA 1K9KA 4ETOA 3GOFA 3PALA 1J7OA 2ZFDA 1NYAA 1OMVA 2K2FA 1UUSA 1TN4A 2K7CA 1R6PA 3FS7A 2QPTA 4PE4A 4C0LA 1AJ5A 1UWOA 2KBIA 1JWDA 2LMUA 2OTGC 1ALWA 2H61A 1S5GY 1R2UA 4YGEB 4DS7A 2KAXA 1XFXO 1N0YA 4JQ0D 4JWQA 1QX2A 4U8DA 1NCXA 2LUCA 4XJKA 1HQVA 1SR6C 3RM1A 3E3RA 4GBAA 2M1UA 2M7NA 2GV5A 4UPGA 1S6IA 4OV2A 2BBNA 1ZFSA 3CR5X 4HRHA 4N5XA 1IG5A 3BXKA 2JRFA 4FTGA 4NQGA 2JWWA 2KGRA 3DVEA 1IKUA 5AXIA 3EKHA 1LINA 4AQJA 1UHKA 3OX5A 2LVKA 3PSRA 2BKHB 1SBJA 1JFKA 2HQ8A 1DJZA 2LMTA 1YX8A 2BE4A 2ZNDA 3OHMB 5K89A 1WLMA 1KFUS 2OPOA 4QJ5B
chains in the Genus database with same CATH superfamily
3VB1A 1SK6D 1SL8A 2BL0C 1BT6A 1TRFA 2JXCA 4WQ2A 1A29A 1UHJA 2LANA 2LHLA 3EVRA 3SG5A 1AJ4A 2V53A 2FOTA 1Z2CB 1C3ZA 2B1UA 1XVJA 1MR8A 1NP8A 1UHHA 1M39A 1Y1XA 1YUUA 2OTGB 5FI7A 4KYNA 2QEBA 3OB2B 2HETA 2KLEA 1K93D 1EG4A 1KQMC 2DOQA 2PALA 1KWOC 4GGFA 2FJYA 2WNDA 5CSNA 3S0DA 1DEKA 2L5YA 2YGUA 2TN4A 3BUOB 2LCPA 1TCFA 3VRPA 1KCYA 4ORAB 5FYXA 5DKQA 5HKZA 1XK4A 3NSLA 1SR6B 1LXFC 1M31A 1C7VA 5ER4X 3D0YA 1OSAA 1BG1A 1DGVA 1T14A 5JJGA 1B7TY 1F8HA 1DT7B 1TUJA 3AAJA 1F4QA 1TNQA 1SCVA 1CLMA 3D0YB 5KTYA 1PK0D 3QMEA 1QIVA 3SIAA 1NCYA 1PVBA 3ZWHA 1UHNA 4JPZB 1YX7A 1BR1B 3JTDB 3O2PA 4M2QA 2LNKA 1U5IA 2JT3A 3VROA 1B9AA 3K21A 1EJ3A 2BL0B 2K0JA 5FI2A 2RGIA 3CS1A 4MEWA 2COLB 3ZNIA 1GGWA 1DJGA 1L2OC 2WCKA 4OVNF 2OS8B 3CWGA 3H4SE 3S0FA 5G08A 2JT0A 1NCZA 2CXJA 1M45A 2K7BA 3I5FB 1A75B 3AKBA 3PLFB 5B8IB 1BODA 1KQMB 4Q04A 1DVIA 1KWOB 2KPHA 4I5NB 5I2OA 3FWCA 2I2RE 2EC6C 1IJ6A 2LM5A 2L98A 3O4XA 4HSZA 5DKNA 1TIZA 3FE8A 1LA0A 1IWQA 4L9MA 4GFTA 3S0BA 5J3XA 1KFXS 1CDNA 3NHIA 2BCBA 1K9PA 4MRXA 1SMGA 1S6JA 2P6BB 4E68A 3F45A 1DJYA 1RROA 2NCOA 2Y1NA 4GAOA 2G9BA 3R72A 3TZ1A 1QV0A 2BECA 3BUWB 1ZACA 4DUQA 1HT9A 1XYDA 2LP2A 2KSPA 1NWDA 5CSFA 2KYCA 3TDIA 3DD4A 1QIWA 1UURA 3RLZA 1DGUA 1NUBA 1GJYA 2F2OA 3BUMB 1LVCD 1TCOB 2WORA 1X02A 1TNXA 4R1EA 1AUIB 1NX1A 1CFCA 3FE9A 1H8BA 3CYZA 1YVHA 2PASA 1XFVO 4CPVA 2QEOA 1C07A 1QWVA 2ZNEA 1K8UA 1L2OB 1ODBA 3BJHA 2ZKMX 3I5IB 3JVTC 3LK1A 3PATA 3VGOA 3WHUB 1FI6A 4N1GA 2KI6D 4N1FA 1CLBA 3SG3A 3BFAA 4MSPA 3Q8IA 2EC6B 1S26D 2M29A 1NIWA 1CNPA 2KAVA 2WOSA 4MZKA 2M0RA 2F8PA 2AAOA 5AEQA 1QASA 1WY9A 1BR4B 2KYFA 3KO0A 2LP3A 1XFWO 2NXQA 1KK7Z 3VRNA 2LV7A 4IL1A 2QEHA 1SPYA 1KK8C 2WCBA 2Y1MA 4INWA 5CSIA 1IIOA 1EXRA 2ZN8A 4GPLB 1KFUL 4AQIA 4M2PA 1SYMA 2JNXA 1CMFA 3CZTX 5JOLA 2CBLA 4D1EA 4PE7A 3DF0B 2JC2A 3B88A 1XA5A 1WDCC 3L4AA 2JU0A 5I8NA 2L50A 1QLSA 1PULA 5D69A 5HL1A 1BJFA 3S0GA 1MF8B 1LKJA 3JVTB 4GGNA 4NDBA 1TOPA 2KOTA 2WCLA 2F2PA 3D74A 3EK7A 3O6BA 3CGAA 4PHMA 2M3WA 1S6CA 1CMGA 3UO9A 2ZN9A 2CT9A 1V1GA 2ISDA 2ZRTA 3SS3A 3KPXA 2K60A 2LAPA 3LCPC 1SL7A 1B8CA 1OOHA 2HPSA 4C0JA 3HX4A 1RFJA 2JPOA 3TUYC 2WCEA 2JT8A 1JSAA 4YI9A 1UHIA 2MHHA 4HREE 2KDHA 2LVIA 2WC5A 3IVTA 4ZCVA 1JC2A 2ERBA 2M1KB 1FBVA 2FCDA 1UP5A 1SY9A 1QVIZ 1TTXA 3IF7A 4MZLA 5HKWA 1BOCA 1BMOA 1KK8B 3OP0A 5IBWA 3CZ2A 1Y6WA 2JTZA 1N65A 3KF9A 1PSRA 3C1VA 3NSOA 4MLWA 2M9GA 3CDNA 2SASA 1NX3A 1CDPA 1DJIA 2Q4UA 3GK1A 1K9UA 2Y5IA 3BYAA 3AKAA 1QX7A 4HRGA 1RWYA 1OZSA 1KSOA 2LVJA 4P2YB 1WDCB 5GQQC 1PALA 1W7IB 2KI4C 1RTP1 1A75A 5DKRA 3TDUA 1F55A 1BLQA 1EH2A 1Z4HA 3D78A 1G8IA 2KLDA 5DICA 2M97A 1J7QA 1E8AA 3FWBA 1KFXL 1J7RA 2KFGA 2LE9B 1F71A 3GK2A 2K7DA 4OZDA 3SG2A 2MLEC 1GGZA 1CFDA 4A4CA 1OOGA 2QEVA 5AFPA 4I5KA 3GK4X 5HLVA 5TNCA 5I94A 5KU1A 1DMOA 2JULA 3TS5C 3R1PA 5AANA 3TUYB 1V1FA 4PHKA 2BCAA 5D3OA 5KSZA 3EKJA 3HCMA 1FW4A 1XFUO 3SJSA 4GNKB 2BKIB 1MUXA 1QX5B 1MHOA 1TWOA 1FI5A 3IQOA 1F70A 3DYEA 5I2LA 1IGVA 2JXLA 3BOWB 2KQ6A 1CM1A 1XFYO 1RJVA 4NDDA 4PE1A 4QJ4B 1KK7Y 4M2OA 1B8RA 2EHBA 1MWNA 4CFRA 3AAKA 1WLZA 2KQYA 2P71A 2EGDA 1SL9A 1SCMC 3FE6A 4DCKA 1FF1A 2R2IA 3D77A 1B4CA 4PE0A 1K90D 1DF0B 3OX6A 3KHEA 2L2CA 4WQ3A 2H61C 3DXLA 4MN0A 3DVMA 1B7TZ 1RK9A 1EL4A 3V2LA 1WRLA 4YGDB 5HYDA 5CPVA 5HKYA 4TNCA 1JUOA 4NDCA 2JQ6A 1M46A 1XFZO 3CZ1A 1XO5A 4INXA 2CTNA 4WRIA 1QS7A 2LUXA 3KEVA 2WCFA 3B86A 3DZTA 1ZUZA 4ICBA 3ICBA 2PVBA 4PDZA 2NCPA 4XYNA 2MAZA 4C0KA 1Y1AA 2H8VA 3A8RA 3TS5B 2WCMA 2L4HA 1W9ZA 1CDLA 2D8NA 2ZRSA 1JF0A 1J1DA 3TDZA 1QTXA 2CNPA 2Y4QA 1QLKA 1IQ3A 1CDMA 1OMRA 3EVVA 2LVVA 3IQQA 2H2KA 1OE9B 1LS8A 1A03A 1NX2A 3EG5B 3MSEB 1PSBA 4PT1A 4P5OE 4MRYA 1TNWA 1QVIY 2WC8A 1KSMA 3DF0A 1OMDA 1SCMB 4IJ7A 2NLNA 4A4BA 1DJHA 1S3PA 2LLUA 1J1EA 3D10A 4GUKA 1YR5A 2GGMA 2L4IA 1DJXA 2AUCA 1D1OA 1J55A 2MBXA 1GM0A 2KHNA 3EK4A 4YI8A 1MXEA 1WRKA 1CFFA 3PJIA 2QACA 2L5XB 1M63B 1NSHA 3DVJA 4GGFC 5ER5A 1G4YR 2O5GA 1S1EA 2K8MB 1FPWA 2E30A 3QRXA 1ZMZA 4YGAA 3B87A 3A4UB 4USLA 1DELA 1KQVA 5HLOA 4PHNA 4XJKB 1XK4C 1ZOTB 1YUTA 3LLEA 1BU3A 2MJWB 1B1GA 2FCEA 2G2BA 1QV1A 1GQMA 1EG3A 2BNXA 4FQOA 2SCPA 4BY5A 1CKKA 4ZCUA 2K61A 2MLFC 2HQWA 1YRUB 1DC1A 4YGBB 2WC6A 3JTDC 4I5JA 1PRWA 4JKTA 1ALVA 2I94A 1MQ1A 4MBEA 5F6TA 3S0EA 1OOIX 4YRUA 2PSRA 3R1VA 1IJ5A 4F0ZB 3SG7A 1F4OA 2BE6A 5FI6A 2KI6C 2Q91A 3LK0A 1S5GZ 2OS8C 1NPQA 2LC5A 2LLSA 2O60A 3PM2A 4ORBB 1H4BA 2PMYA 3I5FC 3SG4A 3EVUA 2WCHA 5PALA 2VRGA 2JOJA 3WHTB 1OW4A 2L51A 2E6WA 4MVFA 2L2EA 4PHJA 3M0WA 1SNLA 1PVAA 1AHRA 2BBMA 2BCXA 1W7JB 4F7FA 1C3YA 1L7ZA 1JFJA 1Q80A 1QXPA 2A4JA 3CR4X 3DY9A 2PYQA 3BFHA 3NHTA 4PALA 1JBAA 1LA3A 3NGVA 3UNWA 1A2XA 1DJWA 2I7AA 4OKHA 3BQ3A 1K94A 1J7PA 3BUXB 4QJ3B 1IQ5A 1CTRA 2FJUB 1ORGA 2NZ0A 1YURA 2I18A 4AOMA 1CM4A 1AVSA 1K95A 4MZJA 1SKTA 2JZIA 3NSKA 3SG6A 3I5GC 1K96A 2GGZA 2KAYA 1Y1UA 4JD9A 3SIBA 3PN7C 3VRRA 2F33A 3L47A 2M8UA 4DIRA 1XFRA 3BOWA 5BPJA 1G33A 3O78A 3VRQA 1DTLA 4OCIA 1JF2A 4I5LB 3I5HC 1BF5A 1MXLC 2M7LA 3PM8A 1YUSA 3CABA 3I5IC 3BUNB 2GTEA 1YVLA 2M49B 5EL2A 1U5IB 4DRWA 1TNPA 2MA2A 2PRUA 3EK8A 1S36A 2LLTA 1DF0A 1TUZA 1RECA 1CLLA 1OQPA 1YRTB 3WNXB 1P28A 1B47A 2MRDA 5D7FA 1B8LA 3DVKA 2JTTA 1AK8A 1OOJA 5CSJA 3LL8B 1NX0A 4YBHB 3B7AA 2KGBC 1C7WA 1A4PA 2KI4B 4OR9B 1DQEA 1QJTA 4YGCB 3D76A 1F54A 2KNEA 1IH0A 2K7OA 1OZOA 4CIDA 4CLNA 1SRAA 2KFFA 3SS5A 4PCWA 2IS9A 3OGNA 3CR2A 1N2DA 1SW8A 2LHIA 3S0AA 3N7HA 3OB1B 2F3YA 2F3ZA 2K2AA 3FIAA 3CTNA 3L4LA 1CFPA 3B6XA 3I5GB 1AP4A 3WXAA 2JPTA 5AERA 3PN7B 2L0PA 2KFHA 3O4YA 5I2QA 4ORCB 3PFVA 4CFQA 2AMIA 2JNFA 2WCJA 4BY4A 2LMVA 2KBMA 1Y0VH 1VRKA 1WRZA 3NXAA 2HF5A 3NSIA 2CCMA 3K1EA 1QATA 3I5HB 3CLNA 3SS4A 1IRJA 1YTZC 1CB1A 1K2HA 1K9KA 4ETOA 3GOFA 3PALA 1J7OA 2ZFDA 1NYAA 1OMVA 2K2FA 1UUSA 1TN4A 2K7CA 1R6PA 3FS7A 2QPTA 4PE4A 4C0LA 1AJ5A 1UWOA 2KBIA 1JWDA 2LMUA 2OTGC 1ALWA 2H61A 3D75A 1OOFA 1R2UA 1S5GY 4YGEB 4DS7A 2KAXA 1XFXO 1N0YA 4JQ0D 4JWQA 3OBVA 1QX2A 4U8DA 3BFBA 1NCXA 2LUCA 4XJKA 1HQVA 1SR6C 3RM1A 3E3RA 4GBAA 2PQLA 2M1UA 2QDIA 2M7NA 2GV5A 2P70A 4UPGA 1S6IA 4OV2A 3D73A 2BBNA 1ZFSA 3CR5X 4HRHA 4N5XA 1IG5A 3BXKA 2JRFA 3RZSA 4FTGA 4NQGA 2BAPA 4FQTA 2JWWA 2KGRA 1SSEB 3DVEA 1IKUA 5AXIA 3EKHA 1LINA 4AQJA 1UHKA 3OX5A 2LVKA 3PSRA 3R1OA 2BKHB 1SBJA 1JFKA 2HQ8A 1DJZA 2LMTA 1YX8A 2BE4A 2ZNDA 3CZ0A 3OHMB 5K89A 1WLMA 1KFUS 2OPOA 4QJ5B
chains in the Genus database with same CATH topology
1SK6D 1SL8A 2BL0C 1BT6A 1TRFA 2JXCA 4WQ2A 1A29A 1UHJA 2LANA 2LHLA 3EVRA 3SG5A 1AJ4A 2V53A 2FOTA 2B1UA 1XVJA 1MR8A 1NP8A 1UHHA 1M39A 1Y1XA 1YUUA 2OTGB 3OB2B 2HETA 1K93D 1EG4A 1KQMC 2DOQA 2PALA 1KWOC 4GGFA 5CSNA 2WNDA 2TN4A 3BUOB 2LCPA 1TCFA 3VRPA 1KCYA 4ORAB 5FYXA 5DKQA 5HKZA 1XK4A 3NSLA 1SR6B 1LXFC 1M31A 1C7VA 5ER4X 3D0YA 1OSAA 1BG1A 1DGVA 5JJGA 1B7TY 1F8HA 1DT7B 3AAJA 1F4QA 1TNQA 1SCVA 1CLMA 3D0YB 5KTYA 1PK0D 1QIVA 3SIAA 1NCYA 1PVBA 3ZWHA 1UHNA 4JPZB 1YX7A 1BR1B 3JTDB 3O2PA 4M2QA 2LNKA 1U5IA 2JT3A 3VROA 1B9AA 3K21A 1EJ3A 2BL0B 2K0JA 2RGIA 3CS1A 4MEWA 2COLB 3ZNIA 1GGWA 1DJGA 1L2OC 4OVNF 2OS8B 3CWGA 3H4SE 5G08A 2JT0A 1NCZA 2CXJA 1M45A 2K7BA 3I5FB 1A75B 3AKBA 3PLFB 5B8IB 1BODA 1KQMB 4Q04A 1DVIA 1KWOB 4I5NB 5I2OA 3FWCA 2I2RE 2EC6C 1IJ6A 2LM5A 2L98A 4HSZA 5DKNA 1TIZA 1LA0A 1IWQA 4L9MA 4GFTA 5J3XA 1KFXS 1CDNA 2BCBA 1K9PA 4MRXA 1SMGA 1S6JA 2P6BB 4E68A 3F45A 1DJYA 1RROA 2NCOA 2Y1NA 4GAOA 2G9BA 3TZ1A 1QV0A 2BECA 3BUWB 1ZACA 4DUQA 1HT9A 1XYDA 2LP2A 2KSPA 1NWDA 5CSFA 2KYCA 3TDIA 3DD4A 1QIWA 1UURA 3RLZA 1DGUA 1NUBA 1GJYA 2F2OA 3BUMB 1LVCD 1TCOB 2WORA 1X02A 1TNXA 4R1EA 1AUIB 1NX1A 1CFCA 1H8BA 1YVHA 2PASA 1XFVO 4CPVA 1C07A 2ZNEA 1K8UA 1L2OB 1ODBA 3LK1A 2ZKMX 3I5IB 3JVTC 3PATA 3VGOA 3WHUB 1FI6A 4N1GA 2KI6D 4N1FA 1CLBA 3SG3A 4MSPA 2EC6B 1S26D 2M29A 1NIWA 1CNPA 2KAVA 2WOSA 4MZKA 2M0RA 2F8PA 2AAOA 5AEQA 1QASA 1WY9A 1BR4B 2KYFA 3KO0A 2LP3A 1XFWO 2NXQA 1KK7Z 3VRNA 2LV7A 4IL1A 1SPYA 1KK8C 2WCBA 2Y1MA 5CSIA 1EXRA 2ZN8A 4GPLB 1KFUL 4AQIA 4M2PA 1SYMA 2JNXA 1CMFA 3CZTX 5JOLA 2CBLA 4D1EA 4PE7A 3DF0B 2JC2A 1XA5A 1WDCC 2JU0A 5I8NA 2L50A 1QLSA 1PULA 5D69A 1BJFA 1MF8B 1LKJA 3JVTB 4GGNA 4NDBA 1TOPA 2KOTA 2F2PA 3EK7A 3O6BA 3CGAA 4PHMA 2M3WA 1S6CA 1CMGA 2ZN9A 2CT9A 1V1GA 2ISDA 2ZRTA 3KPXA 2LAPA 3LCPC 1SL7A 1B8CA 2HPSA 4C0JA 3HX4A 1RFJA 3TUYC 2WCEA 2JT8A 1JSAA 4YI9A 1UHIA 2MHHA 4HREE 2KDHA 2LVIA 4ZCVA 1JC2A 2M1KB 1FBVA 2FCDA 1UP5A 1SY9A 1QVIZ 1TTXA 3IF7A 4MZLA 5HKWA 1BOCA 1BMOA 1KK8B 3OP0A 5IBWA 1Y6WA 2JTZA 1N65A 3KF9A 1PSRA 3C1VA 3NSOA 4MLWA 2M9GA 2SASA 1NX3A 1CDPA 1DJIA 2Q4UA 3GK1A 1K9UA 2Y5IA 3BYAA 3AKAA 1QX7A 4HRGA 1RWYA 1OZSA 1KSOA 2LVJA 4P2YB 1WDCB 5GQQC 1PALA 1W7IB 2KI4C 1RTP1 1A75A 5DKRA 3TDUA 1F55A 1BLQA 1EH2A 1G8IA 1J7QA 2M97A 1FI5A 1E8AA 3FWBA 1KFXL 1J7RA 2KFGA 2LE9B 1F71A 3GK2A 2K7DA 3SG2A 2MLEC 1GGZA 1CFDA 4A4CA 5AFPA 4I5KA 3GK4X 5HLVA 5TNCA 5KU1A 1DMOA 2JULA 3TS5C 5AANA 5KSZA 3TUYB 1V1FA 4PHKA 2BCAA 3EKJA 3HCMA 1FW4A 1XFUO 3SJSA 4GNKB 2BKIB 1MUXA 1QX5B 1MHOA 3IQOA 1F70A 5I2LA 1IGVA 2JXLA 3BOWB 2KQ6A 1CM1A 1XFYO 1RJVA 4NDDA 4PE1A 4QJ4B 1KK7Y 4M2OA 1B8RA 2EHBA 1MWNA 4CFRA 3AAKA 1WLZA 2KQYA 2EGDA 1SL9A 1SCMC 4DCKA 1FF1A 2R2IA 1B4CA 4PE0A 1K90D 1DF0B 3OX6A 3KHEA 4WQ3A 2H61C 4MN0A 3DVMA 1B7TZ 1RK9A 1EL4A 1WRLA 4YGDB 5HYDA 5CPVA 5HKYA 4TNCA 1JUOA 4NDCA 2JQ6A 1M46A 1XFZO 1XO5A 2CTNA 4WRIA 1QS7A 2LUXA 3KEVA 2WCFA 4ICBA 1ZUZA 4C0KA 3ICBA 2PVBA 4PDZA 2NCPA 4XYNA 2MAZA 1Y1AA 3A8RA 3TS5B 2L4HA 1CDLA 2D8NA 2ZRSA 1JF0A 1J1DA 3TDZA 1QTXA 2CNPA 2Y4QA 1QLKA 1IQ3A 1CDMA 1OMRA 3EVVA 2LVVA 3IQQA 2H2KA 1OE9B 1A03A 1NX2A 3MSEB 1PSBA 4P5OE 4MRYA 1TNWA 1QVIY 2WC8A 1KSMA 3DF0A 1OMDA 1SCMB 4A4BA 2NLNA 1DJHA 1S3PA 2LLUA 1J1EA 3D10A 4GUKA 1YR5A 2GGMA 2L4IA 1DJXA 2AUCA 1D1OA 1J55A 2MBXA 2KHNA 3EK4A 4YI8A 1MXEA 1WRKA 1CFFA 2QACA 2L5XB 1M63B 1NSHA 3DVJA 4GGFC 5ER5A 1G4YR 2O5GA 1S1EA 2K8MB 1FPWA 2E30A 3QRXA 1ZMZA 4YGAA 3A4UB 4USLA 1KQVA 5HLOA 4PHNA 4XJKB 1XK4C 1ZOTB 1YUTA 3LLEA 1BU3A 2MJWB 1B1GA 2FCEA 2G2BA 1QV1A 1GQMA 1EG3A 4FQOA 2SCPA 4BY5A 1CKKA 4ZCUA 2K61A 2MLFC 2HQWA 1YRUB 4YGBB 3JTDC 4I5JA 1PRWA 1ALVA 2I94A 1MQ1A 4MBEA 5F6TA 4YRUA 2PSRA 1IJ5A 4F0ZB 3SG7A 1F4OA 2BE6A 2KI6C 2Q91A 3LK0A 1S5GZ 2OS8C 1NPQA 2LC5A 2LLSA 2O60A 4ORBB 1H4BA 2PMYA 3I5FC 3SG4A 3EVUA 5PALA 2VRGA 2JOJA 3WHTB 2L51A 2E6WA 4MVFA 2L2EA 4PHJA 3M0WA 1SNLA 1PVAA 1AHRA 2BBMA 2BCXA 1W7JB 1L7ZA 1JFJA 1Q80A 1QXPA 2A4JA 3CR4X 4PALA 1JBAA 1LA3A 1A2XA 1DJWA 2I7AA 4OKHA 3BQ3A 1K94A 1J7PA 3BUXB 4QJ3B 1IQ5A 1CTRA 2FJUB 2NZ0A 1YURA 2I18A 4AOMA 1CM4A 1AVSA 1K95A 4MZJA 1SKTA 2JZIA 3NSKA 3SG6A 3I5GC 1K96A 2GGZA 2KAYA 1Y1UA 3VRRA 3SIBA 3PN7C 2F33A 4DIRA 2M8UA 3BOWA 5BPJA 1G33A 3O78A 3VRQA 1DTLA 4OCIA 1JF2A 4I5LB 3I5HC 1BF5A 1MXLC 2M7LA 3PM8A 1YUSA 3I5IC 3BUNB 1YVLA 2M49B 4DRWA 1U5IB 1TNPA 2MA2A 2PRUA 3EK8A 1S36A 2LLTA 1DF0A 1RECA 1CLLA 1OQPA 1YRTB 3WNXB 2MRDA 1B47A 5D7FA 1B8LA 3DVKA 2JTTA 1AK8A 1OOJA 5CSJA 3LL8B 1NX0A 4YBHB 2KGBC 1C7WA 1A4PA 2KI4B 4OR9B 1QJTA 4YGCB 1F54A 2KNEA 1IH0A 2K7OA 1OZOA 4CIDA 4CLNA 1SRAA 2KFFA 4PCWA 2IS9A 3CR2A 1N2DA 1SW8A 2LHIA 3OB1B 2F3YA 2F3ZA 2K2AA 3FIAA 3CTNA 1CFPA 3I5GB 1AP4A 3WXAA 2JPTA 5AERA 3PN7B 2L0PA 2KFHA 3O4YA 5I2QA 4ORCB 3PFVA 4CFQA 2AMIA 2JNFA 4BY4A 2LMVA 2KBMA 1Y0VH 1VRKA 1WRZA 3NXAA 2HF5A 3NSIA 2CCMA 1QATA 3I5HB 3CLNA 1IRJA 1YTZC 1CB1A 1K2HA 1K9KA 4ETOA 3GOFA 3PALA 1J7OA 2ZFDA 1NYAA 1OMVA 2K2FA 1UUSA 1TN4A 2K7CA 1R6PA 3FS7A 2QPTA 4PE4A 4C0LA 1AJ5A 1UWOA 2KBIA 1JWDA 2LMUA 2OTGC 1ALWA 2H61A 1S5GY 1R2UA 4YGEB 4DS7A 2KAXA 1XFXO 1N0YA 4JQ0D 4JWQA 1QX2A 4U8DA 1NCXA 2LUCA 4XJKA 1HQVA 1SR6C 3RM1A 3E3RA 4GBAA 2M1UA 2M7NA 2GV5A 4UPGA 1S6IA 4OV2A 2BBNA 1ZFSA 3CR5X 4HRHA 4N5XA 1IG5A 3BXKA 2JRFA 4FTGA 4NQGA 2JWWA 2KGRA 3DVEA 1IKUA 5AXIA 3EKHA 1LINA 4AQJA 1UHKA 3OX5A 2LVKA 3PSRA 2BKHB 1SBJA 1JFKA 2HQ8A 1DJZA 2LMTA 1YX8A 2BE4A 2ZNDA 3OHMB 5K89A 1WLMA 1KFUS 2OPOA 4QJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK6 D;  1SL8 A;  2BL0 C;  1BT6 A;  1TRF A;  2JXC A;  4WQ2 A;  1A29 A;  1UHJ A;  2LAN A;  2LHL A;  3EVR A;  3SG5 A;  1AJ4 A;  2V53 A;  2FOT A;  2B1U A;  1XVJ A;  1MR8 A;  1NP8 A;  1UHH A;  1M39 A;  1Y1X A;  1YUU A;  2OTG B;  3OB2 B;  2HET A;  1K93 D;  1EG4 A;  1KQM C;  2DOQ A;  2PAL A;  1KWO C;  4GGF A;  5CSN A;  2WND A;  2TN4 A;  3BUO B;  2LCP A;  1TCF A;  3VRP A;  1KCY A;  4ORA B;  5FYX A;  5DKQ A;  5HKZ A;  1XK4 A;  3NSL A;  1SR6 B;  1LXF C;  1M31 A;  1C7V A;  5ER4 X;  3D0Y A;  1OSA A;  1BG1 A;  1DGV A;  5JJG A;  1B7T Y;  1F8H A;  1DT7 B;  3AAJ A;  1F4Q A;  1TNQ A;  1SCV A;  1CLM A;  3D0Y B;  5KTY A;  1PK0 D;  1QIV A;  3SIA A;  1NCY A;  1PVB A;  3ZWH A;  1UHN A;  4JPZ B;  1YX7 A;  1BR1 B;  3JTD B;  3O2P A;  4M2Q A;  2LNK A;  1U5I A;  2JT3 A;  3VRO A;  1B9A A;  3K21 A;  1EJ3 A;  2BL0 B;  2K0J A;  2RGI A;  3CS1 A;  4MEW A;  2COL B;  3ZNI A;  1GGW A;  1DJG A;  1L2O C;  4OVN F;  2OS8 B;  3CWG A;  3H4S E;  5G08 A;  2JT0 A;  1NCZ A;  2CXJ A;  1M45 A;  2K7B A;  3I5F B;  1A75 B;  3AKB A;  3PLF B;  5B8I B;  1BOD A;  1KQM B;  4Q04 A;  1DVI A;  1KWO B;  4I5N B;  5I2O A;  3FWC A;  2I2R E;  2EC6 C;  1IJ6 A;  2LM5 A;  2L98 A;  4HSZ A;  5DKN A;  1TIZ A;  1LA0 A;  1IWQ A;  4L9M A;  4GFT A;  5J3X A;  1KFX S;  1CDN A;  2BCB A;  1K9P A;  4MRX A;  1SMG A;  1S6J A;  2P6B B;  4E68 A;  3F45 A;  1DJY A;  1RRO A;  2NCO A;  2Y1N A;  4GAO A;  2G9B A;  3TZ1 A;  1QV0 A;  2BEC A;  3BUW B;  1ZAC A;  4DUQ A;  1HT9 A;  1XYD A;  2LP2 A;  2KSP A;  1NWD A;  5CSF A;  2KYC A;  3TDI A;  3DD4 A;  1QIW A;  1UUR A;  3RLZ A;  1DGU A;  1NUB A;  1GJY A;  2F2O A;  3BUM B;  1LVC D;  1TCO B;  2WOR A;  1X02 A;  1TNX A;  4R1E A;  1AUI B;  1NX1 A;  1CFC A;  1H8B A;  1YVH A;  2PAS A;  1XFV O;  4CPV A;  1C07 A;  2ZNE A;  1K8U A;  1L2O B;  1ODB A;  3LK1 A;  2ZKM X;  3I5I B;  3JVT C;  3PAT A;  3VGO A;  3WHU B;  1FI6 A;  4N1G A;  2KI6 D;  4N1F A;  1CLB A;  3SG3 A;  4MSP A;  2EC6 B;  1S26 D;  2M29 A;  1NIW A;  1CNP A;  2KAV A;  2WOS A;  4MZK A;  2M0R A;  2F8P A;  2AAO A;  5AEQ A;  1QAS A;  1WY9 A;  1BR4 B;  2KYF A;  3KO0 A;  2LP3 A;  1XFW O;  2NXQ A;  1KK7 Z;  3VRN A;  2LV7 A;  4IL1 A;  1SPY A;  1KK8 C;  2WCB A;  2Y1M A;  5CSI A;  1EXR A;  2ZN8 A;  4GPL B;  1KFU L;  4AQI A;  4M2P A;  1SYM A;  2JNX A;  1CMF A;  3CZT X;  5JOL A;  2CBL A;  4D1E A;  4PE7 A;  3DF0 B;  2JC2 A;  1XA5 A;  1WDC C;  2JU0 A;  5I8N A;  2L50 A;  1QLS A;  1PUL A;  5D69 A;  1BJF A;  1MF8 B;  1LKJ A;  3JVT B;  4GGN A;  4NDB A;  1TOP A;  2KOT A;  2F2P A;  3EK7 A;  3O6B A;  3CGA A;  4PHM A;  2M3W A;  1S6C A;  1CMG A;  2ZN9 A;  2CT9 A;  1V1G A;  2ISD A;  2ZRT A;  3KPX A;  2LAP A;  3LCP C;  1SL7 A;  1B8C A;  2HPS A;  4C0J A;  3HX4 A;  1RFJ A;  3TUY C;  2WCE A;  2JT8 A;  1JSA A;  4YI9 A;  1UHI A;  2MHH A;  4HRE E;  2KDH A;  2LVI A;  4ZCV A;  1JC2 A;  2M1K B;  1FBV A;  2FCD A;  1UP5 A;  1SY9 A;  1QVI Z;  1TTX A;  3IF7 A;  4MZL A;  5HKW A;  1BOC A;  1BMO A;  1KK8 B;  3OP0 A;  5IBW A;  1Y6W A;  2JTZ A;  1N65 A;  3KF9 A;  1PSR A;  3C1V A;  3NSO A;  4MLW A;  2M9G A;  2SAS A;  1NX3 A;  1CDP A;  1DJI A;  2Q4U A;  3GK1 A;  1K9U A;  2Y5I A;  3BYA A;  3AKA A;  1QX7 A;  4HRG A;  1RWY A;  1OZS A;  1KSO A;  2LVJ A;  4P2Y B;  1WDC B;  5GQQ C;  1PAL A;  1W7I B;  2KI4 C;  1RTP 1;  1A75 A;  5DKR A;  3TDU A;  1F55 A;  1BLQ A;  1EH2 A;  1G8I A;  1J7Q A;  2M97 A;  1FI5 A;  1E8A A;  3FWB A;  1KFX L;  1J7R A;  2KFG A;  2LE9 B;  1F71 A;  3GK2 A;  2K7D A;  3SG2 A;  2MLE C;  1GGZ A;  1CFD A;  4A4C A;  5AFP A;  4I5K A;  3GK4 X;  5HLV A;  5TNC A;  5KU1 A;  1DMO A;  2JUL A;  3TS5 C;  5AAN A;  5KSZ A;  3TUY B;  1V1F A;  4PHK A;  2BCA A;  3EKJ A;  3HCM A;  1FW4 A;  1XFU O;  3SJS A;  4GNK B;  2BKI B;  1MUX A;  1QX5 B;  1MHO A;  3IQO A;  1F70 A;  5I2L A;  1IGV A;  2JXL A;  3BOW B;  2KQ6 A;  1CM1 A;  1XFY O;  1RJV A;  4NDD A;  4PE1 A;  4QJ4 B;  1KK7 Y;  4M2O A;  1B8R A;  2EHB A;  1MWN A;  4CFR A;  3AAK A;  1WLZ A;  2KQY A;  2EGD A;  1SL9 A;  1SCM C;  4DCK A;  1FF1 A;  2R2I A;  1B4C A;  4PE0 A;  1K90 D;  1DF0 B;  3OX6 A;  3KHE A;  4WQ3 A;  2H61 C;  4MN0 A;  3DVM A;  1B7T Z;  1RK9 A;  1EL4 A;  1WRL A;  4YGD B;  5HYD A;  5CPV A;  5HKY A;  4TNC A;  1JUO A;  4NDC A;  2JQ6 A;  1M46 A;  1XFZ O;  1XO5 A;  2CTN A;  4WRI A;  1QS7 A;  2LUX A;  3KEV A;  2WCF A;  4ICB A;  1ZUZ A;  4C0K A;  3ICB A;  2PVB A;  4PDZ A;  2NCP A;  4XYN A;  2MAZ A;  1Y1A A;  3A8R A;  3TS5 B;  2L4H A;  1CDL A;  2D8N A;  2ZRS A;  1JF0 A;  1J1D A;  3TDZ A;  1QTX A;  2CNP A;  2Y4Q A;  1QLK A;  1IQ3 A;  1CDM A;  1OMR A;  3EVV A;  2LVV A;  3IQQ A;  2H2K A;  1OE9 B;  1A03 A;  1NX2 A;  3MSE B;  1PSB A;  4P5O E;  4MRY A;  1TNW A;  1QVI Y;  2WC8 A;  1KSM A;  3DF0 A;  1OMD A;  1SCM B;  4A4B A;  2NLN A;  1DJH A;  1S3P A;  2LLU A;  1J1E A;  3D10 A;  4GUK A;  1YR5 A;  2GGM A;  2L4I A;  1DJX A;  2AUC A;  1D1O A;  1J55 A;  2MBX A;  2KHN A;  3EK4 A;  4YI8 A;  1MXE A;  1WRK A;  1CFF A;  2QAC A;  2L5X B;  1M63 B;  1NSH A;  3DVJ A;  4GGF C;  5ER5 A;  1G4Y R;  2O5G A;  1S1E A;  2K8M B;  1FPW A;  2E30 A;  3QRX A;  1ZMZ A;  4YGA A;  3A4U B;  4USL A;  1KQV A;  5HLO A;  4PHN A;  4XJK B;  1XK4 C;  1ZOT B;  1YUT A;  3LLE A;  1BU3 A;  2MJW B;  1B1G A;  2FCE A;  2G2B A;  1QV1 A;  1GQM A;  1EG3 A;  4FQO A;  2SCP A;  4BY5 A;  1CKK A;  4ZCU A;  2K61 A;  2MLF C;  2HQW A;  1YRU B;  4YGB B;  3JTD C;  4I5J A;  1PRW A;  1ALV A;  2I94 A;  1MQ1 A;  4MBE A;  5F6T A;  4YRU A;  2PSR A;  1IJ5 A;  4F0Z B;  3SG7 A;  1F4O A;  2BE6 A;  2KI6 C;  2Q91 A;  3LK0 A;  1S5G Z;  2OS8 C;  1NPQ A;  2LC5 A;  2LLS A;  2O60 A;  4ORB B;  1H4B A;  2PMY A;  3I5F C;  3SG4 A;  3EVU A;  5PAL A;  2VRG A;  2JOJ A;  3WHT B;  2L51 A;  2E6W A;  4MVF A;  2L2E A;  4PHJ A;  3M0W A;  1SNL A;  1PVA A;  1AHR A;  2BBM A;  2BCX A;  1W7J B;  1L7Z A;  1JFJ A;  1Q80 A;  1QXP A;  2A4J A;  3CR4 X;  4PAL A;  1JBA A;  1LA3 A;  1A2X A;  1DJW A;  2I7A A;  4OKH A;  3BQ3 A;  1K94 A;  1J7P A;  3BUX B;  4QJ3 B;  1IQ5 A;  1CTR A;  2FJU B;  2NZ0 A;  1YUR A;  2I18 A;  4AOM A;  1CM4 A;  1AVS A;  1K95 A;  4MZJ A;  1SKT A;  2JZI A;  3NSK A;  3SG6 A;  3I5G C;  1K96 A;  2GGZ A;  2KAY A;  1Y1U A;  3VRR A;  3SIB A;  3PN7 C;  2F33 A;  4DIR A;  2M8U A;  3BOW A;  5BPJ A;  1G33 A;  3O78 A;  3VRQ A;  1DTL A;  4OCI A;  1JF2 A;  4I5L B;  3I5H C;  1BF5 A;  1MXL C;  2M7L A;  3PM8 A;  1YUS A;  3I5I C;  3BUN B;  1YVL A;  2M49 B;  4DRW A;  1U5I B;  1TNP A;  2MA2 A;  2PRU A;  3EK8 A;  1S36 A;  2LLT A;  1DF0 A;  1REC A;  1CLL A;  1OQP A;  1YRT B;  3WNX B;  2MRD A;  1B47 A;  5D7F A;  1B8L A;  3DVK A;  2JTT A;  1AK8 A;  1OOJ A;  5CSJ A;  3LL8 B;  1NX0 A;  4YBH B;  2KGB C;  1C7W A;  1A4P A;  2KI4 B;  4OR9 B;  1QJT A;  4YGC B;  1F54 A;  2KNE A;  1IH0 A;  2K7O A;  1OZO A;  4CID A;  4CLN A;  1SRA A;  2KFF A;  4PCW A;  2IS9 A;  3CR2 A;  1N2D A;  1SW8 A;  2LHI A;  3OB1 B;  2F3Y A;  2F3Z A;  2K2A A;  3FIA A;  3CTN A;  1CFP A;  3I5G B;  1AP4 A;  3WXA A;  2JPT A;  5AER A;  3PN7 B;  2L0P A;  2KFH A;  3O4Y A;  5I2Q A;  4ORC B;  3PFV A;  4CFQ A;  2AMI A;  2JNF A;  4BY4 A;  2LMV A;  2KBM A;  1Y0V H;  1VRK A;  1WRZ A;  3NXA A;  2HF5 A;  3NSI A;  2CCM A;  1QAT A;  3I5H B;  3CLN A;  1IRJ A;  1YTZ C;  1CB1 A;  1K2H A;  1K9K A;  4ETO A;  3GOF A;  3PAL A;  1J7O A;  2ZFD A;  1NYA A;  1OMV A;  2K2F A;  1UUS A;  1TN4 A;  2K7C A;  1R6P A;  3FS7 A;  2QPT A;  4PE4 A;  4C0L A;  1AJ5 A;  1UWO A;  2KBI A;  1JWD A;  2LMU A;  2OTG C;  1ALW A;  2H61 A;  1S5G Y;  1R2U A;  4YGE B;  4DS7 A;  2KAX A;  1XFX O;  1N0Y A;  4JQ0 D;  4JWQ A;  1QX2 A;  4U8D A;  1NCX A;  2LUC A;  4XJK A;  1HQV A;  1SR6 C;  3RM1 A;  3E3R A;  4GBA A;  2M1U A;  2M7N A;  2GV5 A;  4UPG A;  1S6I A;  4OV2 A;  2BBN A;  1ZFS A;  3CR5 X;  4HRH A;  4N5X A;  1IG5 A;  3BXK A;  2JRF A;  4FTG A;  4NQG A;  2JWW A;  2KGR A;  3DVE A;  1IKU A;  5AXI A;  3EKH A;  1LIN A;  4AQJ A;  1UHK A;  3OX5 A;  2LVK A;  3PSR A;  2BKH B;  1SBJ A;  1JFK A;  2HQ8 A;  1DJZ A;  2LMT A;  1YX8 A;  2BE4 A;  2ZND A;  3OHM B;  5K89 A;  1WLM A;  1KFU S;  2OPO A;  4QJ5 B; 
#chains in the Genus database with same CATH topology
 3VB1 A;  1SK6 D;  1SL8 A;  2BL0 C;  1BT6 A;  1TRF A;  2JXC A;  4WQ2 A;  1A29 A;  1UHJ A;  2LAN A;  2LHL A;  3EVR A;  3SG5 A;  1AJ4 A;  2V53 A;  2FOT A;  1Z2C B;  1C3Z A;  2B1U A;  1XVJ A;  1MR8 A;  1NP8 A;  1UHH A;  1M39 A;  1Y1X A;  1YUU A;  2OTG B;  5FI7 A;  4KYN A;  2QEB A;  3OB2 B;  2HET A;  2KLE A;  1K93 D;  1EG4 A;  1KQM C;  2DOQ A;  2PAL A;  1KWO C;  4GGF A;  2FJY A;  2WND A;  5CSN A;  3S0D A;  1DEK A;  2L5Y A;  2YGU A;  2TN4 A;  3BUO B;  2LCP A;  1TCF A;  3VRP A;  1KCY A;  4ORA B;  5FYX A;  5DKQ A;  5HKZ A;  1XK4 A;  3NSL A;  1SR6 B;  1LXF C;  1M31 A;  1C7V A;  5ER4 X;  3D0Y A;  1OSA A;  1BG1 A;  1DGV A;  1T14 A;  5JJG A;  1B7T Y;  1F8H A;  1DT7 B;  1TUJ A;  3AAJ A;  1F4Q A;  1TNQ A;  1SCV A;  1CLM A;  3D0Y B;  5KTY A;  1PK0 D;  3QME A;  1QIV A;  3SIA A;  1NCY A;  1PVB A;  3ZWH A;  1UHN A;  4JPZ B;  1YX7 A;  1BR1 B;  3JTD B;  3O2P A;  4M2Q A;  2LNK A;  1U5I A;  2JT3 A;  3VRO A;  1B9A A;  3K21 A;  1EJ3 A;  2BL0 B;  2K0J A;  5FI2 A;  2RGI A;  3CS1 A;  4MEW A;  2COL B;  3ZNI A;  1GGW A;  1DJG A;  1L2O C;  2WCK A;  4OVN F;  2OS8 B;  3CWG A;  3H4S E;  3S0F A;  5G08 A;  2JT0 A;  1NCZ A;  2CXJ A;  1M45 A;  2K7B A;  3I5F B;  1A75 B;  3AKB A;  3PLF B;  5B8I B;  1BOD A;  1KQM B;  4Q04 A;  1DVI A;  1KWO B;  2KPH A;  4I5N B;  5I2O A;  3FWC A;  2I2R E;  2EC6 C;  1IJ6 A;  2LM5 A;  2L98 A;  3O4X A;  4HSZ A;  5DKN A;  1TIZ A;  3FE8 A;  1LA0 A;  1IWQ A;  4L9M A;  4GFT A;  3S0B A;  5J3X A;  1KFX S;  1CDN A;  3NHI A;  2BCB A;  1K9P A;  4MRX A;  1SMG A;  1S6J A;  2P6B B;  4E68 A;  3F45 A;  1DJY A;  1RRO A;  2NCO A;  2Y1N A;  4GAO A;  2G9B A;  3R72 A;  3TZ1 A;  1QV0 A;  2BEC A;  3BUW B;  1ZAC A;  4DUQ A;  1HT9 A;  1XYD A;  2LP2 A;  2KSP A;  1NWD A;  5CSF A;  2KYC A;  3TDI A;  3DD4 A;  1QIW A;  1UUR A;  3RLZ A;  1DGU A;  1NUB A;  1GJY A;  2F2O A;  3BUM B;  1LVC D;  1TCO B;  2WOR A;  1X02 A;  1TNX A;  4R1E A;  1AUI B;  1NX1 A;  1CFC A;  3FE9 A;  1H8B A;  3CYZ A;  1YVH A;  2PAS A;  1XFV O;  4CPV A;  2QEO A;  1C07 A;  1QWV A;  2ZNE A;  1K8U A;  1L2O B;  1ODB A;  3BJH A;  2ZKM X;  3I5I B;  3JVT C;  3LK1 A;  3PAT A;  3VGO A;  3WHU B;  1FI6 A;  4N1G A;  2KI6 D;  4N1F A;  1CLB A;  3SG3 A;  3BFA A;  4MSP A;  3Q8I A;  2EC6 B;  1S26 D;  2M29 A;  1NIW A;  1CNP A;  2KAV A;  2WOS A;  4MZK A;  2M0R A;  2F8P A;  2AAO A;  5AEQ A;  1QAS A;  1WY9 A;  1BR4 B;  2KYF A;  3KO0 A;  2LP3 A;  1XFW O;  2NXQ A;  1KK7 Z;  3VRN A;  2LV7 A;  4IL1 A;  2QEH A;  1SPY A;  1KK8 C;  2WCB A;  2Y1M A;  4INW A;  5CSI A;  1IIO A;  1EXR A;  2ZN8 A;  4GPL B;  1KFU L;  4AQI A;  4M2P A;  1SYM A;  2JNX A;  1CMF A;  3CZT X;  5JOL A;  2CBL A;  4D1E A;  4PE7 A;  3DF0 B;  2JC2 A;  3B88 A;  1XA5 A;  1WDC C;  3L4A A;  2JU0 A;  5I8N A;  2L50 A;  1QLS A;  1PUL A;  5D69 A;  5HL1 A;  1BJF A;  3S0G A;  1MF8 B;  1LKJ A;  3JVT B;  4GGN A;  4NDB A;  1TOP A;  2KOT A;  2WCL A;  2F2P A;  3D74 A;  3EK7 A;  3O6B A;  3CGA A;  4PHM A;  2M3W A;  1S6C A;  1CMG A;  3UO9 A;  2ZN9 A;  2CT9 A;  1V1G A;  2ISD A;  2ZRT A;  3SS3 A;  3KPX A;  2K60 A;  2LAP A;  3LCP C;  1SL7 A;  1B8C A;  1OOH A;  2HPS A;  4C0J A;  3HX4 A;  1RFJ A;  2JPO A;  3TUY C;  2WCE A;  2JT8 A;  1JSA A;  4YI9 A;  1UHI A;  2MHH A;  4HRE E;  2KDH A;  2LVI A;  2WC5 A;  3IVT A;  4ZCV A;  1JC2 A;  2ERB A;  2M1K B;  1FBV A;  2FCD A;  1UP5 A;  1SY9 A;  1QVI Z;  1TTX A;  3IF7 A;  4MZL A;  5HKW A;  1BOC A;  1BMO A;  1KK8 B;  3OP0 A;  5IBW A;  3CZ2 A;  1Y6W A;  2JTZ A;  1N65 A;  3KF9 A;  1PSR A;  3C1V A;  3NSO A;  4MLW A;  2M9G A;  3CDN A;  2SAS A;  1NX3 A;  1CDP A;  1DJI A;  2Q4U A;  3GK1 A;  1K9U A;  2Y5I A;  3BYA A;  3AKA A;  1QX7 A;  4HRG A;  1RWY A;  1OZS A;  1KSO A;  2LVJ A;  4P2Y B;  1WDC B;  5GQQ C;  1PAL A;  1W7I B;  2KI4 C;  1RTP 1;  1A75 A;  5DKR A;  3TDU A;  1F55 A;  1BLQ A;  1EH2 A;  1Z4H A;  3D78 A;  1G8I A;  2KLD A;  5DIC A;  2M97 A;  1J7Q A;  1E8A A;  3FWB A;  1KFX L;  1J7R A;  2KFG A;  2LE9 B;  1F71 A;  3GK2 A;  2K7D A;  4OZD A;  3SG2 A;  2MLE C;  1GGZ A;  1CFD A;  4A4C A;  1OOG A;  2QEV A;  5AFP A;  4I5K A;  3GK4 X;  5HLV A;  5TNC A;  5I94 A;  5KU1 A;  1DMO A;  2JUL A;  3TS5 C;  3R1P A;  5AAN A;  3TUY B;  1V1F A;  4PHK A;  2BCA A;  5D3O A;  5KSZ A;  3EKJ A;  3HCM A;  1FW4 A;  1XFU O;  3SJS A;  4GNK B;  2BKI B;  1MUX A;  1QX5 B;  1MHO A;  1TWO A;  1FI5 A;  3IQO A;  1F70 A;  3DYE A;  5I2L A;  1IGV A;  2JXL A;  3BOW B;  2KQ6 A;  1CM1 A;  1XFY O;  1RJV A;  4NDD A;  4PE1 A;  4QJ4 B;  1KK7 Y;  4M2O A;  1B8R A;  2EHB A;  1MWN A;  4CFR A;  3AAK A;  1WLZ A;  2KQY A;  2P71 A;  2EGD A;  1SL9 A;  1SCM C;  3FE6 A;  4DCK A;  1FF1 A;  2R2I A;  3D77 A;  1B4C A;  4PE0 A;  1K90 D;  1DF0 B;  3OX6 A;  3KHE A;  2L2C A;  4WQ3 A;  2H61 C;  3DXL A;  4MN0 A;  3DVM A;  1B7T Z;  1RK9 A;  1EL4 A;  3V2L A;  1WRL A;  4YGD B;  5HYD A;  5CPV A;  5HKY A;  4TNC A;  1JUO A;  4NDC A;  2JQ6 A;  1M46 A;  1XFZ O;  3CZ1 A;  1XO5 A;  4INX A;  2CTN A;  4WRI A;  1QS7 A;  2LUX A;  3KEV A;  2WCF A;  3B86 A;  3DZT A;  1ZUZ A;  4ICB A;  3ICB A;  2PVB A;  4PDZ A;  2NCP A;  4XYN A;  2MAZ A;  4C0K A;  1Y1A A;  2H8V A;  3A8R A;  3TS5 B;  2WCM A;  2L4H A;  1W9Z A;  1CDL A;  2D8N A;  2ZRS A;  1JF0 A;  1J1D A;  3TDZ A;  1QTX A;  2CNP A;  2Y4Q A;  1QLK A;  1IQ3 A;  1CDM A;  1OMR A;  3EVV A;  2LVV A;  3IQQ A;  2H2K A;  1OE9 B;  1LS8 A;  1A03 A;  1NX2 A;  3EG5 B;  3MSE B;  1PSB A;  4PT1 A;  4P5O E;  4MRY A;  1TNW A;  1QVI Y;  2WC8 A;  1KSM A;  3DF0 A;  1OMD A;  1SCM B;  4IJ7 A;  2NLN A;  4A4B A;  1DJH A;  1S3P A;  2LLU A;  1J1E A;  3D10 A;  4GUK A;  1YR5 A;  2GGM A;  2L4I A;  1DJX A;  2AUC A;  1D1O A;  1J55 A;  2MBX A;  1GM0 A;  2KHN A;  3EK4 A;  4YI8 A;  1MXE A;  1WRK A;  1CFF A;  3PJI A;  2QAC A;  2L5X B;  1M63 B;  1NSH A;  3DVJ A;  4GGF C;  5ER5 A;  1G4Y R;  2O5G A;  1S1E A;  2K8M B;  1FPW A;  2E30 A;  3QRX A;  1ZMZ A;  4YGA A;  3B87 A;  3A4U B;  4USL A;  1DEL A;  1KQV A;  5HLO A;  4PHN A;  4XJK B;  1XK4 C;  1ZOT B;  1YUT A;  3LLE A;  1BU3 A;  2MJW B;  1B1G A;  2FCE A;  2G2B A;  1QV1 A;  1GQM A;  1EG3 A;  2BNX A;  4FQO A;  2SCP A;  4BY5 A;  1CKK A;  4ZCU A;  2K61 A;  2MLF C;  2HQW A;  1YRU B;  1DC1 A;  4YGB B;  2WC6 A;  3JTD C;  4I5J A;  1PRW A;  4JKT A;  1ALV A;  2I94 A;  1MQ1 A;  4MBE A;  5F6T A;  3S0E A;  1OOI X;  4YRU A;  2PSR A;  3R1V A;  1IJ5 A;  4F0Z B;  3SG7 A;  1F4O A;  2BE6 A;  5FI6 A;  2KI6 C;  2Q91 A;  3LK0 A;  1S5G Z;  2OS8 C;  1NPQ A;  2LC5 A;  2LLS A;  2O60 A;  3PM2 A;  4ORB B;  1H4B A;  2PMY A;  3I5F C;  3SG4 A;  3EVU A;  2WCH A;  5PAL A;  2VRG A;  2JOJ A;  3WHT B;  1OW4 A;  2L51 A;  2E6W A;  4MVF A;  2L2E A;  4PHJ A;  3M0W A;  1SNL A;  1PVA A;  1AHR A;  2BBM A;  2BCX A;  1W7J B;  4F7F A;  1C3Y A;  1L7Z A;  1JFJ A;  1Q80 A;  1QXP A;  2A4J A;  3CR4 X;  3DY9 A;  2PYQ A;  3BFH A;  3NHT A;  4PAL A;  1JBA A;  1LA3 A;  3NGV A;  3UNW A;  1A2X A;  1DJW A;  2I7A A;  4OKH A;  3BQ3 A;  1K94 A;  1J7P A;  3BUX B;  4QJ3 B;  1IQ5 A;  1CTR A;  2FJU B;  1ORG A;  2NZ0 A;  1YUR A;  2I18 A;  4AOM A;  1CM4 A;  1AVS A;  1K95 A;  4MZJ A;  1SKT A;  2JZI A;  3NSK A;  3SG6 A;  3I5G C;  1K96 A;  2GGZ A;  2KAY A;  1Y1U A;  4JD9 A;  3SIB A;  3PN7 C;  3VRR A;  2F33 A;  3L47 A;  2M8U A;  4DIR A;  1XFR A;  3BOW A;  5BPJ A;  1G33 A;  3O78 A;  3VRQ A;  1DTL A;  4OCI A;  1JF2 A;  4I5L B;  3I5H C;  1BF5 A;  1MXL C;  2M7L A;  3PM8 A;  1YUS A;  3CAB A;  3I5I C;  3BUN B;  2GTE A;  1YVL A;  2M49 B;  5EL2 A;  1U5I B;  4DRW A;  1TNP A;  2MA2 A;  2PRU A;  3EK8 A;  1S36 A;  2LLT A;  1DF0 A;  1TUZ A;  1REC A;  1CLL A;  1OQP A;  1YRT B;  3WNX B;  1P28 A;  1B47 A;  2MRD A;  5D7F A;  1B8L A;  3DVK A;  2JTT A;  1AK8 A;  1OOJ A;  5CSJ A;  3LL8 B;  1NX0 A;  4YBH B;  3B7A A;  2KGB C;  1C7W A;  1A4P A;  2KI4 B;  4OR9 B;  1DQE A;  1QJT A;  4YGC B;  3D76 A;  1F54 A;  2KNE A;  1IH0 A;  2K7O A;  1OZO A;  4CID A;  4CLN A;  1SRA A;  2KFF A;  3SS5 A;  4PCW A;  2IS9 A;  3OGN A;  3CR2 A;  1N2D A;  1SW8 A;  2LHI A;  3S0A A;  3N7H A;  3OB1 B;  2F3Y A;  2F3Z A;  2K2A A;  3FIA A;  3CTN A;  3L4L A;  1CFP A;  3B6X A;  3I5G B;  1AP4 A;  3WXA A;  2JPT A;  5AER A;  3PN7 B;  2L0P A;  2KFH A;  3O4Y A;  5I2Q A;  4ORC B;  3PFV A;  4CFQ A;  2AMI A;  2JNF A;  2WCJ A;  4BY4 A;  2LMV A;  2KBM A;  1Y0V H;  1VRK A;  1WRZ A;  3NXA A;  2HF5 A;  3NSI A;  2CCM A;  3K1E A;  1QAT A;  3I5H B;  3CLN A;  3SS4 A;  1IRJ A;  1YTZ C;  1CB1 A;  1K2H A;  1K9K A;  4ETO A;  3GOF A;  3PAL A;  1J7O A;  2ZFD A;  1NYA A;  1OMV A;  2K2F A;  1UUS A;  1TN4 A;  2K7C A;  1R6P A;  3FS7 A;  2QPT A;  4PE4 A;  4C0L A;  1AJ5 A;  1UWO A;  2KBI A;  1JWD A;  2LMU A;  2OTG C;  1ALW A;  2H61 A;  3D75 A;  1OOF A;  1R2U A;  1S5G Y;  4YGE B;  4DS7 A;  2KAX A;  1XFX O;  1N0Y A;  4JQ0 D;  4JWQ A;  3OBV A;  1QX2 A;  4U8D A;  3BFB A;  1NCX A;  2LUC A;  4XJK A;  1HQV A;  1SR6 C;  3RM1 A;  3E3R A;  4GBA A;  2PQL A;  2M1U A;  2QDI A;  2M7N A;  2GV5 A;  2P70 A;  4UPG A;  1S6I A;  4OV2 A;  3D73 A;  2BBN A;  1ZFS A;  3CR5 X;  4HRH A;  4N5X A;  1IG5 A;  3BXK A;  2JRF A;  3RZS A;  4FTG A;  4NQG A;  2BAP A;  4FQT A;  2JWW A;  2KGR A;  1SSE B;  3DVE A;  1IKU A;  5AXI A;  3EKH A;  1LIN A;  4AQJ A;  1UHK A;  3OX5 A;  2LVK A;  3PSR A;  3R1O A;  2BKH B;  1SBJ A;  1JFK A;  2HQ8 A;  1DJZ A;  2LMT A;  1YX8 A;  2BE4 A;  2ZND A;  3CZ0 A;  3OHM B;  5K89 A;  1WLM A;  1KFU S;  2OPO A;  4QJ5 B; 
#chains in the Genus database with same CATH homology
 1SK6 D;  1SL8 A;  2BL0 C;  1BT6 A;  1TRF A;  2JXC A;  4WQ2 A;  1A29 A;  1UHJ A;  2LAN A;  2LHL A;  3EVR A;  3SG5 A;  1AJ4 A;  2V53 A;  2FOT A;  2B1U A;  1XVJ A;  1MR8 A;  1NP8 A;  1UHH A;  1M39 A;  1Y1X A;  1YUU A;  2OTG B;  3OB2 B;  2HET A;  1K93 D;  1EG4 A;  1KQM C;  2DOQ A;  2PAL A;  1KWO C;  4GGF A;  5CSN A;  2WND A;  2TN4 A;  3BUO B;  2LCP A;  1TCF A;  3VRP A;  1KCY A;  4ORA B;  5FYX A;  5DKQ A;  5HKZ A;  1XK4 A;  3NSL A;  1SR6 B;  1LXF C;  1M31 A;  1C7V A;  5ER4 X;  3D0Y A;  1OSA A;  1BG1 A;  1DGV A;  5JJG A;  1B7T Y;  1F8H A;  1DT7 B;  3AAJ A;  1F4Q A;  1TNQ A;  1SCV A;  1CLM A;  3D0Y B;  5KTY A;  1PK0 D;  1QIV A;  3SIA A;  1NCY A;  1PVB A;  3ZWH A;  1UHN A;  4JPZ B;  1YX7 A;  1BR1 B;  3JTD B;  3O2P A;  4M2Q A;  2LNK A;  1U5I A;  2JT3 A;  3VRO A;  1B9A A;  3K21 A;  1EJ3 A;  2BL0 B;  2K0J A;  2RGI A;  3CS1 A;  4MEW A;  2COL B;  3ZNI A;  1GGW A;  1DJG A;  1L2O C;  4OVN F;  2OS8 B;  3CWG A;  3H4S E;  5G08 A;  2JT0 A;  1NCZ A;  2CXJ A;  1M45 A;  2K7B A;  3I5F B;  1A75 B;  3AKB A;  3PLF B;  5B8I B;  1BOD A;  1KQM B;  4Q04 A;  1DVI A;  1KWO B;  4I5N B;  5I2O A;  3FWC A;  2I2R E;  2EC6 C;  1IJ6 A;  2LM5 A;  2L98 A;  4HSZ A;  5DKN A;  1TIZ A;  1LA0 A;  1IWQ A;  4L9M A;  4GFT A;  5J3X A;  1KFX S;  1CDN A;  2BCB A;  1K9P A;  4MRX A;  1SMG A;  1S6J A;  2P6B B;  4E68 A;  3F45 A;  1DJY A;  1RRO A;  2NCO A;  2Y1N A;  4GAO A;  2G9B A;  3TZ1 A;  1QV0 A;  2BEC A;  3BUW B;  1ZAC A;  4DUQ A;  1HT9 A;  1XYD A;  2LP2 A;  2KSP A;  1NWD A;  5CSF A;  2KYC A;  3TDI A;  3DD4 A;  1QIW A;  1UUR A;  3RLZ A;  1DGU A;  1NUB A;  1GJY A;  2F2O A;  3BUM B;  1LVC D;  1TCO B;  2WOR A;  1X02 A;  1TNX A;  4R1E A;  1AUI B;  1NX1 A;  1CFC A;  1H8B A;  1YVH A;  2PAS A;  1XFV O;  4CPV A;  1C07 A;  2ZNE A;  1K8U A;  1L2O B;  1ODB A;  3LK1 A;  2ZKM X;  3I5I B;  3JVT C;  3PAT A;  3VGO A;  3WHU B;  1FI6 A;  4N1G A;  2KI6 D;  4N1F A;  1CLB A;  3SG3 A;  4MSP A;  2EC6 B;  1S26 D;  2M29 A;  1NIW A;  1CNP A;  2KAV A;  2WOS A;  4MZK A;  2M0R A;  2F8P A;  2AAO A;  5AEQ A;  1QAS A;  1WY9 A;  1BR4 B;  2KYF A;  3KO0 A;  2LP3 A;  1XFW O;  2NXQ A;  1KK7 Z;  3VRN A;  2LV7 A;  4IL1 A;  1SPY A;  1KK8 C;  2WCB A;  2Y1M A;  5CSI A;  1EXR A;  2ZN8 A;  4GPL B;  1KFU L;  4AQI A;  4M2P A;  1SYM A;  2JNX A;  1CMF A;  3CZT X;  5JOL A;  2CBL A;  4D1E A;  4PE7 A;  3DF0 B;  2JC2 A;  1XA5 A;  1WDC C;  2JU0 A;  5I8N A;  2L50 A;  1QLS A;  1PUL A;  5D69 A;  1BJF A;  1MF8 B;  1LKJ A;  3JVT B;  4GGN A;  4NDB A;  1TOP A;  2KOT A;  2F2P A;  3EK7 A;  3O6B A;  3CGA A;  4PHM A;  2M3W A;  1S6C A;  1CMG A;  2ZN9 A;  2CT9 A;  1V1G A;  2ISD A;  2ZRT A;  3KPX A;  2LAP A;  3LCP C;  1SL7 A;  1B8C A;  2HPS A;  4C0J A;  3HX4 A;  1RFJ A;  3TUY C;  2WCE A;  2JT8 A;  1JSA A;  4YI9 A;  1UHI A;  2MHH A;  4HRE E;  2KDH A;  2LVI A;  4ZCV A;  1JC2 A;  2M1K B;  1FBV A;  2FCD A;  1UP5 A;  1SY9 A;  1QVI Z;  1TTX A;  3IF7 A;  4MZL A;  5HKW A;  1BOC A;  1BMO A;  1KK8 B;  3OP0 A;  5IBW A;  1Y6W A;  2JTZ A;  1N65 A;  3KF9 A;  1PSR A;  3C1V A;  3NSO A;  4MLW A;  2M9G A;  2SAS A;  1NX3 A;  1CDP A;  1DJI A;  2Q4U A;  3GK1 A;  1K9U A;  2Y5I A;  3BYA A;  3AKA A;  1QX7 A;  4HRG A;  1RWY A;  1OZS A;  1KSO A;  2LVJ A;  4P2Y B;  1WDC B;  5GQQ C;  1PAL A;  1W7I B;  2KI4 C;  1RTP 1;  1A75 A;  5DKR A;  3TDU A;  1F55 A;  1BLQ A;  1EH2 A;  1G8I A;  1J7Q A;  2M97 A;  1FI5 A;  1E8A A;  3FWB A;  1KFX L;  1J7R A;  2KFG A;  2LE9 B;  1F71 A;  3GK2 A;  2K7D A;  3SG2 A;  2MLE C;  1GGZ A;  1CFD A;  4A4C A;  5AFP A;  4I5K A;  3GK4 X;  5HLV A;  5TNC A;  5KU1 A;  1DMO A;  2JUL A;  3TS5 C;  5AAN A;  5KSZ A;  3TUY B;  1V1F A;  4PHK A;  2BCA A;  3EKJ A;  3HCM A;  1FW4 A;  1XFU O;  3SJS A;  4GNK B;  2BKI B;  1MUX A;  1QX5 B;  1MHO A;  3IQO A;  1F70 A;  5I2L A;  1IGV A;  2JXL A;  3BOW B;  2KQ6 A;  1CM1 A;  1XFY O;  1RJV A;  4NDD A;  4PE1 A;  4QJ4 B;  1KK7 Y;  4M2O A;  1B8R A;  2EHB A;  1MWN A;  4CFR A;  3AAK A;  1WLZ A;  2KQY A;  2EGD A;  1SL9 A;  1SCM C;  4DCK A;  1FF1 A;  2R2I A;  1B4C A;  4PE0 A;  1K90 D;  1DF0 B;  3OX6 A;  3KHE A;  4WQ3 A;  2H61 C;  4MN0 A;  3DVM A;  1B7T Z;  1RK9 A;  1EL4 A;  1WRL A;  4YGD B;  5HYD A;  5CPV A;  5HKY A;  4TNC A;  1JUO A;  4NDC A;  2JQ6 A;  1M46 A;  1XFZ O;  1XO5 A;  2CTN A;  4WRI A;  1QS7 A;  2LUX A;  3KEV A;  2WCF A;  4ICB A;  1ZUZ A;  4C0K A;  3ICB A;  2PVB A;  4PDZ A;  2NCP A;  4XYN A;  2MAZ A;  1Y1A A;  3A8R A;  3TS5 B;  2L4H A;  1CDL A;  2D8N A;  2ZRS A;  1JF0 A;  1J1D A;  3TDZ A;  1QTX A;  2CNP A;  2Y4Q A;  1QLK A;  1IQ3 A;  1CDM A;  1OMR A;  3EVV A;  2LVV A;  3IQQ A;  2H2K A;  1OE9 B;  1A03 A;  1NX2 A;  3MSE B;  1PSB A;  4P5O E;  4MRY A;  1TNW A;  1QVI Y;  2WC8 A;  1KSM A;  3DF0 A;  1OMD A;  1SCM B;  4A4B A;  2NLN A;  1DJH A;  1S3P A;  2LLU A;  1J1E A;  3D10 A;  4GUK A;  1YR5 A;  2GGM A;  2L4I A;  1DJX A;  2AUC A;  1D1O A;  1J55 A;  2MBX A;  2KHN A;  3EK4 A;  4YI8 A;  1MXE A;  1WRK A;  1CFF A;  2QAC A;  2L5X B;  1M63 B;  1NSH A;  3DVJ A;  4GGF C;  5ER5 A;  1G4Y R;  2O5G A;  1S1E A;  2K8M B;  1FPW A;  2E30 A;  3QRX A;  1ZMZ A;  4YGA A;  3A4U B;  4USL A;  1KQV A;  5HLO A;  4PHN A;  4XJK B;  1XK4 C;  1ZOT B;  1YUT A;  3LLE A;  1BU3 A;  2MJW B;  1B1G A;  2FCE A;  2G2B A;  1QV1 A;  1GQM A;  1EG3 A;  4FQO A;  2SCP A;  4BY5 A;  1CKK A;  4ZCU A;  2K61 A;  2MLF C;  2HQW A;  1YRU B;  4YGB B;  3JTD C;  4I5J A;  1PRW A;  1ALV A;  2I94 A;  1MQ1 A;  4MBE A;  5F6T A;  4YRU A;  2PSR A;  1IJ5 A;  4F0Z B;  3SG7 A;  1F4O A;  2BE6 A;  2KI6 C;  2Q91 A;  3LK0 A;  1S5G Z;  2OS8 C;  1NPQ A;  2LC5 A;  2LLS A;  2O60 A;  4ORB B;  1H4B A;  2PMY A;  3I5F C;  3SG4 A;  3EVU A;  5PAL A;  2VRG A;  2JOJ A;  3WHT B;  2L51 A;  2E6W A;  4MVF A;  2L2E A;  4PHJ A;  3M0W A;  1SNL A;  1PVA A;  1AHR A;  2BBM A;  2BCX A;  1W7J B;  1L7Z A;  1JFJ A;  1Q80 A;  1QXP A;  2A4J A;  3CR4 X;  4PAL A;  1JBA A;  1LA3 A;  1A2X A;  1DJW A;  2I7A A;  4OKH A;  3BQ3 A;  1K94 A;  1J7P A;  3BUX B;  4QJ3 B;  1IQ5 A;  1CTR A;  2FJU B;  2NZ0 A;  1YUR A;  2I18 A;  4AOM A;  1CM4 A;  1AVS A;  1K95 A;  4MZJ A;  1SKT A;  2JZI A;  3NSK A;  3SG6 A;  3I5G C;  1K96 A;  2GGZ A;  2KAY A;  1Y1U A;  3VRR A;  3SIB A;  3PN7 C;  2F33 A;  4DIR A;  2M8U A;  3BOW A;  5BPJ A;  1G33 A;  3O78 A;  3VRQ A;  1DTL A;  4OCI A;  1JF2 A;  4I5L B;  3I5H C;  1BF5 A;  1MXL C;  2M7L A;  3PM8 A;  1YUS A;  3I5I C;  3BUN B;  1YVL A;  2M49 B;  4DRW A;  1U5I B;  1TNP A;  2MA2 A;  2PRU A;  3EK8 A;  1S36 A;  2LLT A;  1DF0 A;  1REC A;  1CLL A;  1OQP A;  1YRT B;  3WNX B;  2MRD A;  1B47 A;  5D7F A;  1B8L A;  3DVK A;  2JTT A;  1AK8 A;  1OOJ A;  5CSJ A;  3LL8 B;  1NX0 A;  4YBH B;  2KGB C;  1C7W A;  1A4P A;  2KI4 B;  4OR9 B;  1QJT A;  4YGC B;  1F54 A;  2KNE A;  1IH0 A;  2K7O A;  1OZO A;  4CID A;  4CLN A;  1SRA A;  2KFF A;  4PCW A;  2IS9 A;  3CR2 A;  1N2D A;  1SW8 A;  2LHI A;  3OB1 B;  2F3Y A;  2F3Z A;  2K2A A;  3FIA A;  3CTN A;  1CFP A;  3I5G B;  1AP4 A;  3WXA A;  2JPT A;  5AER A;  3PN7 B;  2L0P A;  2KFH A;  3O4Y A;  5I2Q A;  4ORC B;  3PFV A;  4CFQ A;  2AMI A;  2JNF A;  4BY4 A;  2LMV A;  2KBM A;  1Y0V H;  1VRK A;  1WRZ A;  3NXA A;  2HF5 A;  3NSI A;  2CCM A;  1QAT A;  3I5H B;  3CLN A;  1IRJ A;  1YTZ C;  1CB1 A;  1K2H A;  1K9K A;  4ETO A;  3GOF A;  3PAL A;  1J7O A;  2ZFD A;  1NYA A;  1OMV A;  2K2F A;  1UUS A;  1TN4 A;  2K7C A;  1R6P A;  3FS7 A;  2QPT A;  4PE4 A;  4C0L A;  1AJ5 A;  1UWO A;  2KBI A;  1JWD A;  2LMU A;  2OTG C;  1ALW A;  2H61 A;  1S5G Y;  1R2U A;  4YGE B;  4DS7 A;  2KAX A;  1XFX O;  1N0Y A;  4JQ0 D;  4JWQ A;  1QX2 A;  4U8D A;  1NCX A;  2LUC A;  4XJK A;  1HQV A;  1SR6 C;  3RM1 A;  3E3R A;  4GBA A;  2M1U A;  2M7N A;  2GV5 A;  4UPG A;  1S6I A;  4OV2 A;  2BBN A;  1ZFS A;  3CR5 X;  4HRH A;  4N5X A;  1IG5 A;  3BXK A;  2JRF A;  4FTG A;  4NQG A;  2JWW A;  2KGR A;  3DVE A;  1IKU A;  5AXI A;  3EKH A;  1LIN A;  4AQJ A;  1UHK A;  3OX5 A;  2LVK A;  3PSR A;  2BKH B;  1SBJ A;  1JFK A;  2HQ8 A;  1DJZ A;  2LMT A;  1YX8 A;  2BE4 A;  2ZND A;  3OHM B;  5K89 A;  1WLM A;  1KFU S;  2OPO A;  4QJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...