1MXEA

Structure of the complex of calmodulin with the target sequence of camki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
144
structure length
144
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 59
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxeA02
4PE0A 2L51A 2LANA 1PVBA 3GOFA 3DVEA 1OE9B 1FPWA 1UUSA 1HT9A 1VRKA 1KFXS 1FBVA 3SG5A 3PLFB 1KK7Y 1A75A 1J7QA 2JTTA 2Y4QA 1SNLA 4OCIA 2CBLA 1SYMA 5DKNA 3CZTX 5HKYA 1L7ZA 1YRUB 1D1OA 1NCZA 3PN7C 1XK4C 4ORCB 1PRWA 1TNWA 1QX2A 2LUXA 1SRAA 2F3ZA 1ZOTB 1UURA 5PALA 2MAZA 4AQIA 2MJWB 4JPZB 4I5JA 1BU3A 3WNXB 5HKWA 3PM8A 1M45A 2I7AA 5BPJA 5I2OA 3I5HC 2L0PA 3CR2A 3CR4X 2WOSA 3D0YA 3KF9A 2A4JA 4WRIA 5CSFA 4ORAB 4GGFC 3NSKA 2QACA 1KK8B 1G33A 3GK4X 3FWBA 2LVKA 1OZSA 1ALWA 3OB1B 1J55A 1XFVO 3VRNA 3I5HB 1MXLC 1NX2A 4YGBB 3SG3A 2LVJA 3IQOA 1DGUA 3LCPC 2LLTA 4WQ2A 5HYDA 4MVFA 1QLSA 2K2AA 1OQPA 2JRFA 2FCEA 5HKZA 5JOLA 3TDZA 5HLOA 2QPTA 2JPTA 1KSMA 2M49B 2SCPA 4XYNA 4PALA 3DVMA 5JJGA 1DMOA 1TRFA 4GGNA 4U8DA 3LK1A 4E68A 4CLNA 1XA5A 4OV2A 2ZRTA 1F54A 1WRLA 1WDCB 1N65A 4N1GA 2KI6C 1JSAA 4A4CA 1A4PA 1XK4A 1K96A 2M0RA 1SCMB 2WC8A 2H2KA 1ZMZA 5I8NA 2O5GA 1Y0VH 4QJ3B 3OX6A 1JFJA 1H8BA 4C0LA 3FS7A 5I2QA 3NXAA 1CFDA 1KFUS 1RWYA 3DF0A 4AQJA 2NZ0A 1AVSA 1MF8B 3GK2A 3FIAA 2KDHA 1DVIA 1TCOB 1B8RA 3LL8B 4JWQA 4JQ0D 3SJSA 1PSRA 2KGRA 1S26D 2LMVA 4OKHA 1Y1AA 4MZLA 2ZRSA 4DUQA 2K7OA 2LMUA 2ZN8A 1DJZA 1NX1A 2H61A 2OTGC 3I5GC 3KPXA 1BF5A 1RK9A 3AKBA 3O6BA 1SCVA 2DOQA 2PSRA 1UHHA 2CNPA 1UHJA 3CLNA 2LP3A 1DF0A 5D7FA 2CCMA 1IQ5A 1SMGA 1S6IA 3LK0A 4M2PA 4CFRA 1TOPA 1MHOA 1AP4A 2HQWA 1OMRA 3ZNIA 1J7PA 1NYAA 1CFCA 1S5GY 2OPOA 2JNXA 4PHMA 2JT0A 3SG7A 2M1UA 2JQ6A 1R2UA 1EG4A 1NWDA 2L98A 4IL1A 1RFJA 5AFPA 4PCWA 5KSZA 1H4BA 2JULA 2LV7A 1QLKA 1C07A 4PE7A 1QS7A 1G4YR 1TN4A 1XFZO 4YGCB 3VRPA 2G9BA 2BL0B 1DJGA 2ZKMX 1IG5A 1OZOA 1QIVA 3TUYC 1NIWA 5AANA 3TS5B 1B7TY 1MWNA 1CMGA 1SL7A 3O78A 1F4QA 1SPYA 2NCPA 1MR8A 4NQGA 1ZUZA 3BUMB 3JTDC 1A75B 1A29A 3D10A 3BOWB 3SIBA 1B8CA 2RGIA 3MSEB 1YURA 3OP0A 4OR9B 2K61A 2M97A 1F4OA 1CM4A 2JT8A 2KOTA 5K89A 5KU1A 2KNEA 4P5OE 4DS7A 2JNFA 3VRRA 1J1DA 1GGZA 1ALVA 2Y1NA 1UHKA 1BJFA 1SW8A 1QVIZ 2GV5A 2KFHA 4WQ3A 3VRQA 1YVHA 4I5NB 2COLB 2BBMA 3BUXB 2LE9B 1PULA 2K2FA 3WXAA 2EC6C 1RJVA 2LLSA 3GK1A 1AHRA 1NSHA 1UHNA 2GGZA 1YRTB 2E6WA 1SK6D 2F33A 1AJ5A 2ZN9A 3LLEA 4AOMA 2FOTA 4ORBB 1U5IB 3TZ1A 1V1FA 2ZNDA 3TUYB 1BG1A 1UP5A 3NSIA 2KI6D 2K7DA 3I5IC 3EKJA 3VROA 1M63B 1WRKA 2KGBC 2I18A 5ER4X 1CLMA 3SG4A 2M3WA 4MZJA 2NLNA 1SL9A 1YTZC 1N0YA 2L4HA 2F2PA 2MA2A 1JUOA 2BCBA 5ER5A 1GGWA 1QX5B 2NCOA 1CFPA 1QATA 1K9UA 4GBAA 1EXRA 2JWWA 1YR5A 2Q91A 1CTRA 3JVTB 4HRHA 2Y5IA 1KWOB 1JBAA 5CSJA 1BLQA 4UPGA 1G8IA 2K7CA 2PRUA 4XJKA 5I2LA 1CLBA 1QTXA 2JC2A 4GUKA 2M29A 3AAJA 1PK0D 4M2OA 4NDBA 1TTXA 1YUTA 1IJ6A 1KQMC 2G2BA 2LHLA 3CS1A 3SG2A 2PMYA 1LVCD 2KSPA 1LKJA 3ZWHA 2P6BB 2CTNA 3QRXA 4ETOA 1S36A 3BUOB 2KAXA 1AK8A 2MHHA 4OVNF 2WORA 2Q4UA 3BUWB 1ZACA 2FJUB 4N5XA 1RTP1 2KI4C 2F2OA 5F6TA 4C0KA 1CMFA 1KCYA 4HREE 3NSLA 4ICBA 1DJWA 4DIRA 1NX0A 1RECA 1B47A 2OTGB 3I5GB 2BKHB 4HRGA 4A4BA 1W7IB 4YGEB 1CDPA 1SKTA 3H4SE 4C0JA 3PALA 1CDNA 2M7LA 1XO5A 2AAOA 4GGFA 4USLA 1SL8A 2SASA 3DD4A 3EVVA 4TNCA 1FI5A 1CDLA 1WLZA 4GNKB 1WRZA 2CXJA 4HSZA 1QV1A 1EJ3A 2WCFA 2M1KB 3OB2B 2LVIA 4CFQA 3CR5X 3WHUB 1CB1A 1QX7A 3ICBA 1KWOC 1SBJA 1DF0B 3M0WA 1ODBA 3JVTC 1SR6C 1B9AA 4YI9A 1F55A 1Y6WA 3OHMB 1NX3A 1W7JB 3DVKA 2BBNA 2BECA 2LM5A 2LCPA 1KK8C 4F0ZB 2L50A 1J1EA 1XFUO 2NXQA 4PE4A 1K90D 2I2RE 2KAYA 1YX8A 1WDCC 1QXPA 2JT3A 1MQ1A 1S6CA 2L4IA 3WHTB 3EVUA 3AAKA 2HPSA 1BMOA 3BYAA 1GJYA 1BT6A 1V1GA 1KQVA 2JTZA 2KYCA 3A4UB 1AJ4A 4YBHB 1JC2A 1R6PA 4MN0A 5TNCA 2E30A 4CIDA 1FF1A 5FYXA 1XFXO 5IBWA 1CKKA 1IRJA 3HCMA 1IGVA 1QASA 2JXCA 3BOWA 2K7BA 4MRXA 1C7VA 1EL4A 3NSOA 4MBEA 4DCKA 4YI8A 4NDDA 1L2OC 3I5FB 5AERA 1JWDA 2R2IA 1N2DA 2HQ8A 2BCXA 4PHNA 5CSIA 2EC6B 2WNDA 5CPVA 1F8HA 1F70A 2BE4A 1CFFA 1NP8A 5AXIA 4ZCUA 3D0YB 2PVBA 1JF0A 4N1FA 1ZFSA 1SR6B 1GQMA 4MZKA 1BODA 4MEWA 1X02A 1LXFC 2EGDA 2KI4B 2KQYA 4PDZA 3TS5C 1FI6A 1WY9A 4FTGA 5GQQC 1EH2A 2AUCA 1DGVA 1PSBA 1U5IA 4PHKA 1YUUA 2ZFDA 1A2XA 1K94A 2JXLA 1K9KA 2PASA 1OMVA 5J3XA 1NUBA 3TDUA 2M7NA 2LMTA 1KQMB 3PFVA 1JFKA 1CNPA 4DRWA 4PE1A 1DJIA 2BCAA 2VRGA 2MRDA 1Q80A 2LC5A 1TCFA 1B4CA 3TDIA 1YVLA 2K0JA 2H61C 1WLMA 2KFFA 4NDCA 4YGDB 5HLVA 3C1VA 3O4YA 3DVJA 4MLWA 2OS8C 5G08A 1K93D 3EKHA 1LA3A 3F45A 1BOCA 3OX5A 2JZIA 1BR4B 1K95A 2KBMA 1JF2A 4PHJA 2KFGA 1LA0A 1LINA 1XYDA 2BKIB 2BE6A 4BY4A 1K2HA 2LUCA 1S6JA 4GPLB 4MSPA 1EG3A 4GAOA 3RLZA 5B8IB 1M46A 1OOJA 1QV0A 3EK4A 2WCBA 3I5IB 1DJXA 2I94A 3FWCA 4I5KA 3EK8A 1Y1XA 2KAVA 1DT7B 1FW4A 4I5LB 2MBXA 3CTNA 1IKUA 1OMDA 4GFTA 2FCDA 3AKAA 1KK7Z 2KHNA 1NCYA 3O2PA 1TIZA 3K21A 3KO0A 2K8MB 3PSRA 1TNQA 1IH0A 2LP2A 2GGMA 3CGAA 2M9GA 2TN4A 1SCMC 1B1GA 3SIAA 1F71A 4MRYA 1L2OB 4P2YB 4XJKB 4D1EA 2O60A 3RM1A 2JOJA 1IJ5A 1QVIY 2F8PA 1E8AA 2MLFC 5D69A 5CSNA 5AEQA 1M39A 2EHBA 2AMIA 2LLUA 2F3YA 2BL0C 2PALA 4YRUA 1UWOA 3BUNB 2KQ6A 2D8NA 2M8UA 4Q04A 1QIWA 1RROA 1OSAA 1YUSA 1J7RA 2LNKA 3HX4A 3JTDB 4FQOA 4L9MA 4CPVA 3EVRA 3I5FC 1S5GZ 4QJ4B 1S3PA 1CLLA 1K8UA 3IF7A 1IQ3A 1TNPA 2WCEA 4QJ5B 3CWGA 1A03A 1S1EA 2IS9A 3EK7A 1PVAA 2V53A 1DJYA 2Y1MA 1YX7A 2HETA 1MXEA 2KBIA 5KTYA 1J7OA 3BXKA 1B7TZ 4ZCVA 1NPQA 3E3RA 5DKRA 1DTLA 3BQ3A 1HQVA 3IQQA 3KEVA 2KYFA 1Y1UA 2ZNEA 1PALA 4R1EA 2L2EA 1KFUL 1AUIB 1BR1B 1IWQA 1XFWO 2L5XB 1DJHA 2LHIA 1CDMA 3VGOA 1C7WA 1K9PA 3DF0B 2HF5A 1NCXA 1B8LA 1QJTA 1M31A 1XVJA 1KSOA 2ISDA 3PN7B 1MUXA 2LVVA 3A8RA 2B1UA 1KFXL 4YGAA 2MLEC 1CM1A 3PATA 2LAPA 5DKQA 3KHEA 1TNXA 4BY5A 3SG6A 4M2QA 2JU0A 1SY9A 1UHIA 2CT9A 1XFYO 2OS8B
chains in the Genus database with same CATH superfamily
4JKTA 4PE0A 2L51A 3B87A 2LANA 1PVBA 3GOFA 3DVEA 1OE9B 3V2LA 1FPWA 1UUSA 1HT9A 1VRKA 1KFXS 1FBVA 3SG5A 2QEVA 3PLFB 1KK7Y 1A75A 2WCLA 1J7QA 2JTTA 2Y4QA 1SNLA 4OCIA 2CBLA 1SYMA 5DKNA 3CZTX 5HKYA 1L7ZA 1YRUB 1D1OA 1NCZA 3PN7C 1XK4C 4ORCB 1TNWA 1PRWA 1OOGA 1QX2A 2LUXA 1SRAA 2F3ZA 1ZOTB 1UURA 5PALA 2MAZA 4AQIA 2MJWB 4JPZB 4I5JA 1BU3A 5FI2A 5HKWA 3WNXB 3PM8A 1M45A 2I7AA 5BPJA 5I2OA 3I5HC 2L0PA 3CR2A 3CR4X 1W9ZA 2WOSA 3D0YA 4FQTA 3KF9A 2A4JA 3CDNA 4WRIA 5CSFA 4ORAB 4GGFC 3IVTA 3NSKA 2QACA 1KK8B 1G33A 3GK4X 3FWBA 2LVKA 1OZSA 1ALWA 3OB1B 1J55A 3BFBA 1XFVO 3VRNA 3I5HB 1MXLC 1NX2A 2QEBA 4YGBB 3SG3A 2LVJA 3IQOA 1DGUA 1LS8A 4KYNA 2H8VA 3LCPC 2LLTA 4WQ2A 5HYDA 4MVFA 3OGNA 1QLSA 2K2AA 1OQPA 2JRFA 2FCEA 2GTEA 5HKZA 5JOLA 3TDZA 5HLOA 2QPTA 2JPTA 3CZ1A 1KSMA 2M49B 2SCPA 4XYNA 4PALA 3DVMA 5JJGA 1DMOA 1TRFA 4GGNA 4U8DA 3LK1A 4E68A 4CLNA 1XA5A 4OV2A 2ZRTA 1F54A 1WRLA 2WCJA 1WDCB 1N65A 4N1GA 2KI6C 1JSAA 4A4CA 1A4PA 1XK4A 1K96A 2M0RA 1SCMB 4PT1A 2WC8A 2H2KA 1ZMZA 5I8NA 2O5GA 1Z2CB 1Y0VH 2WC6A 3OX6A 4JD9A 4QJ3B 1JFJA 1H8BA 3BJHA 4C0LA 3FS7A 5I2QA 3B88A 3NXAA 1CFDA 1KFUS 1RWYA 3DF0A 3DY9A 4AQJA 2NZ0A 1AVSA 3R72A 1MF8B 3GK2A 3FIAA 2KDHA 1DVIA 1TCOB 1B8RA 3LL8B 4JWQA 4JQ0D 3SJSA 1PSRA 2KGRA 1S26D 2LMVA 4OKHA 1Y1AA 4MZLA 2ZRSA 4DUQA 2K7OA 2LMUA 2ZN8A 1DJZA 3CZ2A 1NX1A 2H61A 2OTGC 3I5GC 3KPXA 1BF5A 2QEOA 1RK9A 3AKBA 3Q8IA 3O6BA 1SCVA 2DOQA 2PSRA 1UHHA 2CNPA 3CYZA 1UHJA 3CLNA 2LP3A 1DF0A 5D7FA 2CCMA 1IQ5A 1SMGA 1S6IA 3LK0A 4M2PA 4CFRA 1TOPA 1MHOA 1AP4A 2HQWA 1OMRA 3UNWA 3ZNIA 1J7PA 1NYAA 1CFCA 1TUZA 1S5GY 2OPOA 2JNXA 4PHMA 2JT0A 3SG7A 2M1UA 2JQ6A 1R2UA 1EG4A 1NWDA 2L98A 4IL1A 1RFJA 5AFPA 4PCWA 5KSZA 1H4BA 3FE9A 3RZSA 2JULA 2LV7A 1QLKA 1C07A 4PE7A 1QS7A 1G4YR 1TN4A 1XFZO 4YGCB 5HL1A 3VRPA 2G9BA 5D3OA 2BL0B 1DJGA 2ZKMX 5FI6A 2KLDA 1IG5A 1OZOA 1QIVA 3TUYC 1NIWA 5AANA 3TS5B 1B7TY 1MWNA 1CMGA 1SL7A 3O78A 1F4QA 1SPYA 2NCPA 1MR8A 4NQGA 1ZUZA 3BUMB 3JTDC 1A75B 4F7FA 1A29A 3D10A 3BOWB 3SIBA 1B8CA 1OW4A 2RGIA 1XFRA 3MSEB 1YURA 3OP0A 4OR9B 2K61A 2M97A 3N7HA 1F4OA 1CM4A 2JT8A 2KOTA 5K89A 5KU1A 2KNEA 4P5OE 4DS7A 2JNFA 1TWOA 3VRRA 1J1DA 1GGZA 2PQLA 2L5YA 1ALVA 2Y1NA 3L4LA 3S0BA 1UHKA 1BJFA 1SW8A 1QVIZ 2GV5A 2KFHA 3PM2A 4IJ7A 4WQ3A 3VRQA 1YVHA 4I5NB 2COLB 2BBMA 3BUXB 2LE9B 1PULA 2K2FA 3WXAA 2EC6C 1RJVA 2LLSA 3GK1A 1AHRA 1NSHA 1UHNA 2GGZA 1YRTB 2E6WA 1SK6D 2F33A 1AJ5A 2ZN9A 3R1PA 3LLEA 4AOMA 2FOTA 4ORBB 1U5IB 3TZ1A 1V1FA 2ZNDA 3TUYB 1BG1A 1UP5A 3NSIA 2KI6D 2K7DA 3I5IC 3EKJA 3VROA 1M63B 1WRKA 2KGBC 2I18A 5ER4X 1CLMA 3SG4A 2M3WA 4MZJA 2NLNA 3FE6A 1SL9A 1YTZC 1N0YA 2L4HA 3VB1A 2F2PA 2MA2A 1JUOA 2BCBA 1C3ZA 5ER5A 1GGWA 1QX5B 2NCOA 1CFPA 1QATA 1K9UA 4GBAA 1EXRA 1OOHA 1YR5A 2JWWA 1CTRA 2Q91A 3JVTB 4HRHA 1P28A 1OOFA 2Y5IA 1IIOA 1KWOB 1JBAA 5CSJA 3S0EA 1BLQA 4UPGA 1G8IA 2K7CA 3O4XA 1OOIX 2PRUA 4XJKA 2BNXA 3BFAA 5I2LA 1DELA 1CLBA 1QTXA 2JC2A 4GUKA 2M29A 3AAJA 1PK0D 4M2OA 4NDBA 1TTXA 1YUTA 1IJ6A 1KQMC 2G2BA 2LHLA 3CS1A 3SG2A 3PJIA 2PMYA 1LVCD 2KSPA 1LKJA 3ZWHA 2P6BB 2CTNA 3QRXA 4ETOA 1S36A 3BUOB 1GM0A 2KAXA 1AK8A 2MHHA 4OVNF 2WORA 2Q4UA 3BUWB 1ZACA 2FJUB 4N5XA 1RTP1 2KI4C 2F2OA 5F6TA 4C0KA 1CMFA 1KCYA 4HREE 3NSLA 4ICBA 1DJWA 4DIRA 1NX0A 1RECA 1B47A 2OTGB 3I5GB 2BKHB 4HRGA 4A4BA 1W7IB 4YGEB 1CDPA 1SKTA 3H4SE 1DEKA 3PALA 4C0JA 2M7LA 1CDNA 1XO5A 2AAOA 4GGFA 4USLA 1SL8A 2SASA 3DZTA 3DD4A 3EVVA 4TNCA 1FI5A 1CDLA 1WLZA 4GNKB 1WRZA 2CXJA 4HSZA 1QV1A 1EJ3A 2WCFA 2M1KB 3OB2B 2PYQA 2LVIA 5FI7A 2K60A 3CR5X 3WHUB 4CFQA 1QX7A 3ICBA 1KWOC 1CB1A 3NHIA 1SBJA 1DF0B 3M0WA 1ODBA 3JVTC 1SR6C 3S0GA 1B9AA 4YI9A 1F55A 1Y6WA 1SSEB 3OHMB 1NX3A 1W7JB 3DVKA 2BBNA 2BECA 2LM5A 2LCPA 1KK8C 4F0ZB 2L50A 1J1EA 1XFUO 2NXQA 4PE4A 1K90D 1C3YA 2I2RE 2KAYA 1YX8A 1WDCC 1QXPA 2JT3A 3B86A 1MQ1A 1S6CA 2L4IA 3WHTB 3EVUA 3AAKA 2HPSA 1BMOA 2L2CA 1GJYA 1BT6A 1V1GA 3BYAA 1KQVA 2JTZA 2BAPA 2KYCA 1AJ4A 2WCHA 3A4UB 4YBHB 1JC2A 1R6PA 4MN0A 5TNCA 2E30A 4CIDA 2WC5A 1FF1A 5FYXA 1XFXO 5IBWA 5DICA 1CKKA 1IRJA 3HCMA 1IGVA 3K1EA 1QASA 2JXCA 3BOWA 2K7BA 3EG5B 4MRXA 1C7VA 5EL2A 1EL4A 3NSOA 4MBEA 4INWA 4DCKA 4YI8A 4NDDA 1L2OC 3I5FB 5AERA 1JWDA 3L47A 2R2IA 2KLEA 1N2DA 2HQ8A 3B7AA 2BCXA 4PHNA 5CSIA 2EC6B 2WNDA 2YGUA 5CPVA 1F70A 2BE4A 2FJYA 1F8HA 1CFFA 1NP8A 5AXIA 4ZCUA 3D0YB 2PVBA 1JF0A 4N1FA 1ZFSA 1SR6B 1GQMA 4MZKA 1BODA 4MEWA 1X02A 1LXFC 2EGDA 2KI4B 2KQYA 2WCMA 4PDZA 3TS5C 3CZ0A 4INXA 1FI6A 1WY9A 4FTGA 5GQQC 1EH2A 3D76A 1QWVA 2AUCA 3SS3A 1U5IA 1DGVA 1PSBA 4PHKA 1YUUA 2ZFDA 3S0DA 1A2XA 1K94A 2JXLA 1K9KA 2PASA 1OMVA 5J3XA 3DYEA 1NUBA 3TDUA 2M7NA 2LMTA 1KQMB 2ERBA 1JFKA 3L4AA 3PFVA 3B6XA 1DQEA 4PE1A 3UO9A 4DRWA 1CNPA 1DJIA 2JPOA 2BCAA 2VRGA 2MRDA 1Q80A 2LC5A 1TCFA 1B4CA 3TDIA 1YVLA 2WCKA 2K0JA 3CABA 2H61C 1WLMA 2KFFA 4NDCA 4YGDB 5HLVA 3C1VA 3O4YA 3DVJA 4MLWA 2OS8C 5G08A 1K93D 3EKHA 1LA3A 3F45A 2P70A 3OX5A 1BOCA 2JZIA 1BR4B 1K95A 2KBMA 1JF2A 4PHJA 2KFGA 1LA0A 1LINA 1XYDA 2BKIB 2BE6A 4BY4A 1K2HA 2LUCA 1S6JA 4GPLB 4MSPA 1EG3A 4GAOA 3RLZA 5B8IB 1M46A 1OOJA 1QV0A 3EK4A 2WCBA 3I5IB 3D77A 3DXLA 1DJXA 2I94A 3FWCA 4I5KA 1ORGA 2QEHA 3EK8A 1Y1XA 2KAVA 1DT7B 1FW4A 4I5LB 2MBXA 3CTNA 1IKUA 1OMDA 3S0FA 4GFTA 2FCDA 3AKAA 1KK7Z 1T14A 1NCYA 2KHNA 3O2PA 1TIZA 3K21A 3KO0A 2K8MB 3PSRA 1TNQA 1IH0A 2LP2A 2GGMA 3CGAA 2M9GA 2TN4A 3FE8A 1SCMC 1B1GA 3SIAA 1F71A 4MRYA 1L2OB 4P2YB 4XJKB 4D1EA 2O60A 3RM1A 2JOJA 1IJ5A 1QVIY 2F8PA 1E8AA 2MLFC 5D69A 5CSNA 5AEQA 3R1VA 1M39A 2EHBA 2AMIA 2LLUA 2F3YA 2BL0C 2PALA 4YRUA 1UWOA 3BUNB 5I94A 2KQ6A 2D8NA 3R1OA 2M8UA 4Q04A 3SS4A 1QIWA 3OBVA 1RROA 1OSAA 1YUSA 1J7RA 2LNKA 3HX4A 3JTDB 4FQOA 4L9MA 4CPVA 3EVRA 3I5FC 1S5GZ 4QJ4B 1S3PA 1CLLA 1K8UA 3IF7A 1IQ3A 1TNPA 2WCEA 4QJ5B 3CWGA 1A03A 1S1EA 2IS9A 3EK7A 1PVAA 2V53A 3D74A 3NGVA 1DC1A 1DJYA 2Y1MA 2P71A 1Z4HA 4OZDA 1YX7A 3S0AA 2HETA 3SS5A 1MXEA 2KBIA 5KTYA 1J7OA 3BXKA 1B7TZ 4ZCVA 3BFHA 1NPQA 3E3RA 5DKRA 1DTLA 3BQ3A 1HQVA 3IQQA 3KEVA 2KYFA 1Y1UA 2ZNEA 1PALA 3D73A 1TUJA 3D75A 3NHTA 2L2EA 1KFUL 4R1EA 1AUIB 1BR1B 1IWQA 1XFWO 2L5XB 1DJHA 2LHIA 1CDMA 3VGOA 1C7WA 1K9PA 3DF0B 1NCXA 1B8LA 1QJTA 2HF5A 1M31A 1XVJA 1KSOA 2ISDA 3PN7B 1MUXA 2LVVA 2QDIA 3A8RA 2B1UA 1KFXL 2KPHA 3D78A 2MLEC 1CM1A 3PATA 4YGAA 2LAPA 5DKQA 3KHEA 3QMEA 1TNXA 4BY5A 3SG6A 4M2QA 2JU0A 1SY9A 1UHIA 2CT9A 1XFYO 2OS8B
chains in the Genus database with same CATH topology
4PE0A 2L51A 2LANA 1PVBA 3GOFA 3DVEA 1OE9B 1FPWA 1UUSA 1HT9A 1VRKA 1KFXS 1FBVA 3SG5A 3PLFB 1KK7Y 1A75A 1J7QA 2JTTA 2Y4QA 1SNLA 4OCIA 2CBLA 1SYMA 5DKNA 3CZTX 5HKYA 1L7ZA 1YRUB 1D1OA 1NCZA 3PN7C 1XK4C 4ORCB 1PRWA 1TNWA 1QX2A 2LUXA 1SRAA 2F3ZA 1ZOTB 1UURA 5PALA 2MAZA 4AQIA 2MJWB 4JPZB 4I5JA 1BU3A 3WNXB 5HKWA 3PM8A 1M45A 2I7AA 5BPJA 5I2OA 3I5HC 2L0PA 3CR2A 3CR4X 2WOSA 3D0YA 3KF9A 2A4JA 4WRIA 5CSFA 4ORAB 4GGFC 3NSKA 2QACA 1KK8B 1G33A 3GK4X 3FWBA 2LVKA 1OZSA 1ALWA 3OB1B 1J55A 1XFVO 3VRNA 3I5HB 1MXLC 1NX2A 4YGBB 3SG3A 2LVJA 3IQOA 1DGUA 3LCPC 2LLTA 4WQ2A 5HYDA 4MVFA 1QLSA 2K2AA 1OQPA 2JRFA 2FCEA 5HKZA 5JOLA 3TDZA 5HLOA 2QPTA 2JPTA 1KSMA 2M49B 2SCPA 4XYNA 4PALA 3DVMA 5JJGA 1DMOA 1TRFA 4GGNA 4U8DA 3LK1A 4E68A 4CLNA 1XA5A 4OV2A 2ZRTA 1F54A 1WRLA 1WDCB 1N65A 4N1GA 2KI6C 1JSAA 4A4CA 1A4PA 1XK4A 1K96A 2M0RA 1SCMB 2WC8A 2H2KA 1ZMZA 5I8NA 2O5GA 1Y0VH 4QJ3B 3OX6A 1JFJA 1H8BA 4C0LA 3FS7A 5I2QA 3NXAA 1CFDA 1KFUS 1RWYA 3DF0A 4AQJA 2NZ0A 1AVSA 1MF8B 3GK2A 3FIAA 2KDHA 1DVIA 1TCOB 1B8RA 3LL8B 4JWQA 4JQ0D 3SJSA 1PSRA 2KGRA 1S26D 2LMVA 4OKHA 1Y1AA 4MZLA 2ZRSA 4DUQA 2K7OA 2LMUA 2ZN8A 1DJZA 1NX1A 2H61A 2OTGC 3I5GC 3KPXA 1BF5A 1RK9A 3AKBA 3O6BA 1SCVA 2DOQA 2PSRA 1UHHA 2CNPA 1UHJA 3CLNA 2LP3A 1DF0A 5D7FA 2CCMA 1IQ5A 1SMGA 1S6IA 3LK0A 4M2PA 4CFRA 1TOPA 1MHOA 1AP4A 2HQWA 1OMRA 3ZNIA 1J7PA 1NYAA 1CFCA 1S5GY 2OPOA 2JNXA 4PHMA 2JT0A 3SG7A 2M1UA 2JQ6A 1R2UA 1EG4A 1NWDA 2L98A 4IL1A 1RFJA 5AFPA 4PCWA 5KSZA 1H4BA 2JULA 2LV7A 1QLKA 1C07A 4PE7A 1QS7A 1G4YR 1TN4A 1XFZO 4YGCB 3VRPA 2G9BA 2BL0B 1DJGA 2ZKMX 1IG5A 1OZOA 1QIVA 3TUYC 1NIWA 5AANA 3TS5B 1B7TY 1MWNA 1CMGA 1SL7A 3O78A 1F4QA 1SPYA 2NCPA 1MR8A 4NQGA 1ZUZA 3BUMB 3JTDC 1A75B 1A29A 3D10A 3BOWB 3SIBA 1B8CA 2RGIA 3MSEB 1YURA 3OP0A 4OR9B 2K61A 2M97A 1F4OA 1CM4A 2JT8A 2KOTA 5K89A 5KU1A 2KNEA 4P5OE 4DS7A 2JNFA 3VRRA 1J1DA 1GGZA 1ALVA 2Y1NA 1UHKA 1BJFA 1SW8A 1QVIZ 2GV5A 2KFHA 4WQ3A 3VRQA 1YVHA 4I5NB 2COLB 2BBMA 3BUXB 2LE9B 1PULA 2K2FA 3WXAA 2EC6C 1RJVA 2LLSA 3GK1A 1AHRA 1NSHA 1UHNA 2GGZA 1YRTB 2E6WA 1SK6D 2F33A 1AJ5A 2ZN9A 3LLEA 4AOMA 2FOTA 4ORBB 1U5IB 3TZ1A 1V1FA 2ZNDA 3TUYB 1BG1A 1UP5A 3NSIA 2KI6D 2K7DA 3I5IC 3EKJA 3VROA 1M63B 1WRKA 2KGBC 2I18A 5ER4X 1CLMA 3SG4A 2M3WA 4MZJA 2NLNA 1SL9A 1YTZC 1N0YA 2L4HA 2F2PA 2MA2A 1JUOA 2BCBA 5ER5A 1GGWA 1QX5B 2NCOA 1CFPA 1QATA 1K9UA 4GBAA 1EXRA 2JWWA 1YR5A 2Q91A 1CTRA 3JVTB 4HRHA 2Y5IA 1KWOB 1JBAA 5CSJA 1BLQA 4UPGA 1G8IA 2K7CA 2PRUA 4XJKA 5I2LA 1CLBA 1QTXA 2JC2A 4GUKA 2M29A 3AAJA 1PK0D 4M2OA 4NDBA 1TTXA 1YUTA 1IJ6A 1KQMC 2G2BA 2LHLA 3CS1A 3SG2A 2PMYA 1LVCD 2KSPA 1LKJA 3ZWHA 2P6BB 2CTNA 3QRXA 4ETOA 1S36A 3BUOB 2KAXA 1AK8A 2MHHA 4OVNF 2WORA 2Q4UA 3BUWB 1ZACA 2FJUB 4N5XA 1RTP1 2KI4C 2F2OA 5F6TA 4C0KA 1CMFA 1KCYA 4HREE 3NSLA 4ICBA 1DJWA 4DIRA 1NX0A 1RECA 1B47A 2OTGB 3I5GB 2BKHB 4HRGA 4A4BA 1W7IB 4YGEB 1CDPA 1SKTA 3H4SE 4C0JA 3PALA 1CDNA 2M7LA 1XO5A 2AAOA 4GGFA 4USLA 1SL8A 2SASA 3DD4A 3EVVA 4TNCA 1FI5A 1CDLA 1WLZA 4GNKB 1WRZA 2CXJA 4HSZA 1QV1A 1EJ3A 2WCFA 2M1KB 3OB2B 2LVIA 4CFQA 3CR5X 3WHUB 1CB1A 1QX7A 3ICBA 1KWOC 1SBJA 1DF0B 3M0WA 1ODBA 3JVTC 1SR6C 1B9AA 4YI9A 1F55A 1Y6WA 3OHMB 1NX3A 1W7JB 3DVKA 2BBNA 2BECA 2LM5A 2LCPA 1KK8C 4F0ZB 2L50A 1J1EA 1XFUO 2NXQA 4PE4A 1K90D 2I2RE 2KAYA 1YX8A 1WDCC 1QXPA 2JT3A 1MQ1A 1S6CA 2L4IA 3WHTB 3EVUA 3AAKA 2HPSA 1BMOA 3BYAA 1GJYA 1BT6A 1V1GA 1KQVA 2JTZA 2KYCA 3A4UB 1AJ4A 4YBHB 1JC2A 1R6PA 4MN0A 5TNCA 2E30A 4CIDA 1FF1A 5FYXA 1XFXO 5IBWA 1CKKA 1IRJA 3HCMA 1IGVA 1QASA 2JXCA 3BOWA 2K7BA 4MRXA 1C7VA 1EL4A 3NSOA 4MBEA 4DCKA 4YI8A 4NDDA 1L2OC 3I5FB 5AERA 1JWDA 2R2IA 1N2DA 2HQ8A 2BCXA 4PHNA 5CSIA 2EC6B 2WNDA 5CPVA 1F8HA 1F70A 2BE4A 1CFFA 1NP8A 5AXIA 4ZCUA 3D0YB 2PVBA 1JF0A 4N1FA 1ZFSA 1SR6B 1GQMA 4MZKA 1BODA 4MEWA 1X02A 1LXFC 2EGDA 2KI4B 2KQYA 4PDZA 3TS5C 1FI6A 1WY9A 4FTGA 5GQQC 1EH2A 2AUCA 1DGVA 1PSBA 1U5IA 4PHKA 1YUUA 2ZFDA 1A2XA 1K94A 2JXLA 1K9KA 2PASA 1OMVA 5J3XA 1NUBA 3TDUA 2M7NA 2LMTA 1KQMB 3PFVA 1JFKA 1CNPA 4DRWA 4PE1A 1DJIA 2BCAA 2VRGA 2MRDA 1Q80A 2LC5A 1TCFA 1B4CA 3TDIA 1YVLA 2K0JA 2H61C 1WLMA 2KFFA 4NDCA 4YGDB 5HLVA 3C1VA 3O4YA 3DVJA 4MLWA 2OS8C 5G08A 1K93D 3EKHA 1LA3A 3F45A 1BOCA 3OX5A 2JZIA 1BR4B 1K95A 2KBMA 1JF2A 4PHJA 2KFGA 1LA0A 1LINA 1XYDA 2BKIB 2BE6A 4BY4A 1K2HA 2LUCA 1S6JA 4GPLB 4MSPA 1EG3A 4GAOA 3RLZA 5B8IB 1M46A 1OOJA 1QV0A 3EK4A 2WCBA 3I5IB 1DJXA 2I94A 3FWCA 4I5KA 3EK8A 1Y1XA 2KAVA 1DT7B 1FW4A 4I5LB 2MBXA 3CTNA 1IKUA 1OMDA 4GFTA 2FCDA 3AKAA 1KK7Z 2KHNA 1NCYA 3O2PA 1TIZA 3K21A 3KO0A 2K8MB 3PSRA 1TNQA 1IH0A 2LP2A 2GGMA 3CGAA 2M9GA 2TN4A 1SCMC 1B1GA 3SIAA 1F71A 4MRYA 1L2OB 4P2YB 4XJKB 4D1EA 2O60A 3RM1A 2JOJA 1IJ5A 1QVIY 2F8PA 1E8AA 2MLFC 5D69A 5CSNA 5AEQA 1M39A 2EHBA 2AMIA 2LLUA 2F3YA 2BL0C 2PALA 4YRUA 1UWOA 3BUNB 2KQ6A 2D8NA 2M8UA 4Q04A 1QIWA 1RROA 1OSAA 1YUSA 1J7RA 2LNKA 3HX4A 3JTDB 4FQOA 4L9MA 4CPVA 3EVRA 3I5FC 1S5GZ 4QJ4B 1S3PA 1CLLA 1K8UA 3IF7A 1IQ3A 1TNPA 2WCEA 4QJ5B 3CWGA 1A03A 1S1EA 2IS9A 3EK7A 1PVAA 2V53A 1DJYA 2Y1MA 1YX7A 2HETA 1MXEA 2KBIA 5KTYA 1J7OA 3BXKA 1B7TZ 4ZCVA 1NPQA 3E3RA 5DKRA 1DTLA 3BQ3A 1HQVA 3IQQA 3KEVA 2KYFA 1Y1UA 2ZNEA 1PALA 4R1EA 2L2EA 1KFUL 1AUIB 1BR1B 1IWQA 1XFWO 2L5XB 1DJHA 2LHIA 1CDMA 3VGOA 1C7WA 1K9PA 3DF0B 2HF5A 1NCXA 1B8LA 1QJTA 1M31A 1XVJA 1KSOA 2ISDA 3PN7B 1MUXA 2LVVA 3A8RA 2B1UA 1KFXL 4YGAA 2MLEC 1CM1A 3PATA 2LAPA 5DKQA 3KHEA 1TNXA 4BY5A 3SG6A 4M2QA 2JU0A 1SY9A 1UHIA 2CT9A 1XFYO 2OS8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE0 A;  2L51 A;  2LAN A;  1PVB A;  3GOF A;  3DVE A;  1OE9 B;  1FPW A;  1UUS A;  1HT9 A;  1VRK A;  1KFX S;  1FBV A;  3SG5 A;  3PLF B;  1KK7 Y;  1A75 A;  1J7Q A;  2JTT A;  2Y4Q A;  1SNL A;  4OCI A;  2CBL A;  1SYM A;  5DKN A;  3CZT X;  5HKY A;  1L7Z A;  1YRU B;  1D1O A;  1NCZ A;  3PN7 C;  1XK4 C;  4ORC B;  1PRW A;  1TNW A;  1QX2 A;  2LUX A;  1SRA A;  2F3Z A;  1ZOT B;  1UUR A;  5PAL A;  2MAZ A;  4AQI A;  2MJW B;  4JPZ B;  4I5J A;  1BU3 A;  3WNX B;  5HKW A;  3PM8 A;  1M45 A;  2I7A A;  5BPJ A;  5I2O A;  3I5H C;  2L0P A;  3CR2 A;  3CR4 X;  2WOS A;  3D0Y A;  3KF9 A;  2A4J A;  4WRI A;  5CSF A;  4ORA B;  4GGF C;  3NSK A;  2QAC A;  1KK8 B;  1G33 A;  3GK4 X;  3FWB A;  2LVK A;  1OZS A;  1ALW A;  3OB1 B;  1J55 A;  1XFV O;  3VRN A;  3I5H B;  1MXL C;  1NX2 A;  4YGB B;  3SG3 A;  2LVJ A;  3IQO A;  1DGU A;  3LCP C;  2LLT A;  4WQ2 A;  5HYD A;  4MVF A;  1QLS A;  2K2A A;  1OQP A;  2JRF A;  2FCE A;  5HKZ A;  5JOL A;  3TDZ A;  5HLO A;  2QPT A;  2JPT A;  1KSM A;  2M49 B;  2SCP A;  4XYN A;  4PAL A;  3DVM A;  5JJG A;  1DMO A;  1TRF A;  4GGN A;  4U8D A;  3LK1 A;  4E68 A;  4CLN A;  1XA5 A;  4OV2 A;  2ZRT A;  1F54 A;  1WRL A;  1WDC B;  1N65 A;  4N1G A;  2KI6 C;  1JSA A;  4A4C A;  1A4P A;  1XK4 A;  1K96 A;  2M0R A;  1SCM B;  2WC8 A;  2H2K A;  1ZMZ A;  5I8N A;  2O5G A;  1Y0V H;  4QJ3 B;  3OX6 A;  1JFJ A;  1H8B A;  4C0L A;  3FS7 A;  5I2Q A;  3NXA A;  1CFD A;  1KFU S;  1RWY A;  3DF0 A;  4AQJ A;  2NZ0 A;  1AVS A;  1MF8 B;  3GK2 A;  3FIA A;  2KDH A;  1DVI A;  1TCO B;  1B8R A;  3LL8 B;  4JWQ A;  4JQ0 D;  3SJS A;  1PSR A;  2KGR A;  1S26 D;  2LMV A;  4OKH A;  1Y1A A;  4MZL A;  2ZRS A;  4DUQ A;  2K7O A;  2LMU A;  2ZN8 A;  1DJZ A;  1NX1 A;  2H61 A;  2OTG C;  3I5G C;  3KPX A;  1BF5 A;  1RK9 A;  3AKB A;  3O6B A;  1SCV A;  2DOQ A;  2PSR A;  1UHH A;  2CNP A;  1UHJ A;  3CLN A;  2LP3 A;  1DF0 A;  5D7F A;  2CCM A;  1IQ5 A;  1SMG A;  1S6I A;  3LK0 A;  4M2P A;  4CFR A;  1TOP A;  1MHO A;  1AP4 A;  2HQW A;  1OMR A;  3ZNI A;  1J7P A;  1NYA A;  1CFC A;  1S5G Y;  2OPO A;  2JNX A;  4PHM A;  2JT0 A;  3SG7 A;  2M1U A;  2JQ6 A;  1R2U A;  1EG4 A;  1NWD A;  2L98 A;  4IL1 A;  1RFJ A;  5AFP A;  4PCW A;  5KSZ A;  1H4B A;  2JUL A;  2LV7 A;  1QLK A;  1C07 A;  4PE7 A;  1QS7 A;  1G4Y R;  1TN4 A;  1XFZ O;  4YGC B;  3VRP A;  2G9B A;  2BL0 B;  1DJG A;  2ZKM X;  1IG5 A;  1OZO A;  1QIV A;  3TUY C;  1NIW A;  5AAN A;  3TS5 B;  1B7T Y;  1MWN A;  1CMG A;  1SL7 A;  3O78 A;  1F4Q A;  1SPY A;  2NCP A;  1MR8 A;  4NQG A;  1ZUZ A;  3BUM B;  3JTD C;  1A75 B;  1A29 A;  3D10 A;  3BOW B;  3SIB A;  1B8C A;  2RGI A;  3MSE B;  1YUR A;  3OP0 A;  4OR9 B;  2K61 A;  2M97 A;  1F4O A;  1CM4 A;  2JT8 A;  2KOT A;  5K89 A;  5KU1 A;  2KNE A;  4P5O E;  4DS7 A;  2JNF A;  3VRR A;  1J1D A;  1GGZ A;  1ALV A;  2Y1N A;  1UHK A;  1BJF A;  1SW8 A;  1QVI Z;  2GV5 A;  2KFH A;  4WQ3 A;  3VRQ A;  1YVH A;  4I5N B;  2COL B;  2BBM A;  3BUX B;  2LE9 B;  1PUL A;  2K2F A;  3WXA A;  2EC6 C;  1RJV A;  2LLS A;  3GK1 A;  1AHR A;  1NSH A;  1UHN A;  2GGZ A;  1YRT B;  2E6W A;  1SK6 D;  2F33 A;  1AJ5 A;  2ZN9 A;  3LLE A;  4AOM A;  2FOT A;  4ORB B;  1U5I B;  3TZ1 A;  1V1F A;  2ZND A;  3TUY B;  1BG1 A;  1UP5 A;  3NSI A;  2KI6 D;  2K7D A;  3I5I C;  3EKJ A;  3VRO A;  1M63 B;  1WRK A;  2KGB C;  2I18 A;  5ER4 X;  1CLM A;  3SG4 A;  2M3W A;  4MZJ A;  2NLN A;  1SL9 A;  1YTZ C;  1N0Y A;  2L4H A;  2F2P A;  2MA2 A;  1JUO A;  2BCB A;  5ER5 A;  1GGW A;  1QX5 B;  2NCO A;  1CFP A;  1QAT A;  1K9U A;  4GBA A;  1EXR A;  2JWW A;  1YR5 A;  2Q91 A;  1CTR A;  3JVT B;  4HRH A;  2Y5I A;  1KWO B;  1JBA A;  5CSJ A;  1BLQ A;  4UPG A;  1G8I A;  2K7C A;  2PRU A;  4XJK A;  5I2L A;  1CLB A;  1QTX A;  2JC2 A;  4GUK A;  2M29 A;  3AAJ A;  1PK0 D;  4M2O A;  4NDB A;  1TTX A;  1YUT A;  1IJ6 A;  1KQM C;  2G2B A;  2LHL A;  3CS1 A;  3SG2 A;  2PMY A;  1LVC D;  2KSP A;  1LKJ A;  3ZWH A;  2P6B B;  2CTN A;  3QRX A;  4ETO A;  1S36 A;  3BUO B;  2KAX A;  1AK8 A;  2MHH A;  4OVN F;  2WOR A;  2Q4U A;  3BUW B;  1ZAC A;  2FJU B;  4N5X A;  1RTP 1;  2KI4 C;  2F2O A;  5F6T A;  4C0K A;  1CMF A;  1KCY A;  4HRE E;  3NSL A;  4ICB A;  1DJW A;  4DIR A;  1NX0 A;  1REC A;  1B47 A;  2OTG B;  3I5G B;  2BKH B;  4HRG A;  4A4B A;  1W7I B;  4YGE B;  1CDP A;  1SKT A;  3H4S E;  4C0J A;  3PAL A;  1CDN A;  2M7L A;  1XO5 A;  2AAO A;  4GGF A;  4USL A;  1SL8 A;  2SAS A;  3DD4 A;  3EVV A;  4TNC A;  1FI5 A;  1CDL A;  1WLZ A;  4GNK B;  1WRZ A;  2CXJ A;  4HSZ A;  1QV1 A;  1EJ3 A;  2WCF A;  2M1K B;  3OB2 B;  2LVI A;  4CFQ A;  3CR5 X;  3WHU B;  1CB1 A;  1QX7 A;  3ICB A;  1KWO C;  1SBJ A;  1DF0 B;  3M0W A;  1ODB A;  3JVT C;  1SR6 C;  1B9A A;  4YI9 A;  1F55 A;  1Y6W A;  3OHM B;  1NX3 A;  1W7J B;  3DVK A;  2BBN A;  2BEC A;  2LM5 A;  2LCP A;  1KK8 C;  4F0Z B;  2L50 A;  1J1E A;  1XFU O;  2NXQ A;  4PE4 A;  1K90 D;  2I2R E;  2KAY A;  1YX8 A;  1WDC C;  1QXP A;  2JT3 A;  1MQ1 A;  1S6C A;  2L4I A;  3WHT B;  3EVU A;  3AAK A;  2HPS A;  1BMO A;  3BYA A;  1GJY A;  1BT6 A;  1V1G A;  1KQV A;  2JTZ A;  2KYC A;  3A4U B;  1AJ4 A;  4YBH B;  1JC2 A;  1R6P A;  4MN0 A;  5TNC A;  2E30 A;  4CID A;  1FF1 A;  5FYX A;  1XFX O;  5IBW A;  1CKK A;  1IRJ A;  3HCM A;  1IGV A;  1QAS A;  2JXC A;  3BOW A;  2K7B A;  4MRX A;  1C7V A;  1EL4 A;  3NSO A;  4MBE A;  4DCK A;  4YI8 A;  4NDD A;  1L2O C;  3I5F B;  5AER A;  1JWD A;  2R2I A;  1N2D A;  2HQ8 A;  2BCX A;  4PHN A;  5CSI A;  2EC6 B;  2WND A;  5CPV A;  1F8H A;  1F70 A;  2BE4 A;  1CFF A;  1NP8 A;  5AXI A;  4ZCU A;  3D0Y B;  2PVB A;  1JF0 A;  4N1F A;  1ZFS A;  1SR6 B;  1GQM A;  4MZK A;  1BOD A;  4MEW A;  1X02 A;  1LXF C;  2EGD A;  2KI4 B;  2KQY A;  4PDZ A;  3TS5 C;  1FI6 A;  1WY9 A;  4FTG A;  5GQQ C;  1EH2 A;  2AUC A;  1DGV A;  1PSB A;  1U5I A;  4PHK A;  1YUU A;  2ZFD A;  1A2X A;  1K94 A;  2JXL A;  1K9K A;  2PAS A;  1OMV A;  5J3X A;  1NUB A;  3TDU A;  2M7N A;  2LMT A;  1KQM B;  3PFV A;  1JFK A;  1CNP A;  4DRW A;  4PE1 A;  1DJI A;  2BCA A;  2VRG A;  2MRD A;  1Q80 A;  2LC5 A;  1TCF A;  1B4C A;  3TDI A;  1YVL A;  2K0J A;  2H61 C;  1WLM A;  2KFF A;  4NDC A;  4YGD B;  5HLV A;  3C1V A;  3O4Y A;  3DVJ A;  4MLW A;  2OS8 C;  5G08 A;  1K93 D;  3EKH A;  1LA3 A;  3F45 A;  1BOC A;  3OX5 A;  2JZI A;  1BR4 B;  1K95 A;  2KBM A;  1JF2 A;  4PHJ A;  2KFG A;  1LA0 A;  1LIN A;  1XYD A;  2BKI B;  2BE6 A;  4BY4 A;  1K2H A;  2LUC A;  1S6J A;  4GPL B;  4MSP A;  1EG3 A;  4GAO A;  3RLZ A;  5B8I B;  1M46 A;  1OOJ A;  1QV0 A;  3EK4 A;  2WCB A;  3I5I B;  1DJX A;  2I94 A;  3FWC A;  4I5K A;  3EK8 A;  1Y1X A;  2KAV A;  1DT7 B;  1FW4 A;  4I5L B;  2MBX A;  3CTN A;  1IKU A;  1OMD A;  4GFT A;  2FCD A;  3AKA A;  1KK7 Z;  2KHN A;  1NCY A;  3O2P A;  1TIZ A;  3K21 A;  3KO0 A;  2K8M B;  3PSR A;  1TNQ A;  1IH0 A;  2LP2 A;  2GGM A;  3CGA A;  2M9G A;  2TN4 A;  1SCM C;  1B1G A;  3SIA A;  1F71 A;  4MRY A;  1L2O B;  4P2Y B;  4XJK B;  4D1E A;  2O60 A;  3RM1 A;  2JOJ A;  1IJ5 A;  1QVI Y;  2F8P A;  1E8A A;  2MLF C;  5D69 A;  5CSN A;  5AEQ A;  1M39 A;  2EHB A;  2AMI A;  2LLU A;  2F3Y A;  2BL0 C;  2PAL A;  4YRU A;  1UWO A;  3BUN B;  2KQ6 A;  2D8N A;  2M8U A;  4Q04 A;  1QIW A;  1RRO A;  1OSA A;  1YUS A;  1J7R A;  2LNK A;  3HX4 A;  3JTD B;  4FQO A;  4L9M A;  4CPV A;  3EVR A;  3I5F C;  1S5G Z;  4QJ4 B;  1S3P A;  1CLL A;  1K8U A;  3IF7 A;  1IQ3 A;  1TNP A;  2WCE A;  4QJ5 B;  3CWG A;  1A03 A;  1S1E A;  2IS9 A;  3EK7 A;  1PVA A;  2V53 A;  1DJY A;  2Y1M A;  1YX7 A;  2HET A;  1MXE A;  2KBI A;  5KTY A;  1J7O A;  3BXK A;  1B7T Z;  4ZCV A;  1NPQ A;  3E3R A;  5DKR A;  1DTL A;  3BQ3 A;  1HQV A;  3IQQ A;  3KEV A;  2KYF A;  1Y1U A;  2ZNE A;  1PAL A;  4R1E A;  2L2E A;  1KFU L;  1AUI B;  1BR1 B;  1IWQ A;  1XFW O;  2L5X B;  1DJH A;  2LHI A;  1CDM A;  3VGO A;  1C7W A;  1K9P A;  3DF0 B;  2HF5 A;  1NCX A;  1B8L A;  1QJT A;  1M31 A;  1XVJ A;  1KSO A;  2ISD A;  3PN7 B;  1MUX A;  2LVV A;  3A8R A;  2B1U A;  1KFX L;  4YGA A;  2MLE C;  1CM1 A;  3PAT A;  2LAP A;  5DKQ A;  3KHE A;  1TNX A;  4BY5 A;  3SG6 A;  4M2Q A;  2JU0 A;  1SY9 A;  1UHI A;  2CT9 A;  1XFY O;  2OS8 B; 
#chains in the Genus database with same CATH topology
 4JKT A;  4PE0 A;  2L51 A;  3B87 A;  2LAN A;  1PVB A;  3GOF A;  3DVE A;  1OE9 B;  3V2L A;  1FPW A;  1UUS A;  1HT9 A;  1VRK A;  1KFX S;  1FBV A;  3SG5 A;  2QEV A;  3PLF B;  1KK7 Y;  1A75 A;  2WCL A;  1J7Q A;  2JTT A;  2Y4Q A;  1SNL A;  4OCI A;  2CBL A;  1SYM A;  5DKN A;  3CZT X;  5HKY A;  1L7Z A;  1YRU B;  1D1O A;  1NCZ A;  3PN7 C;  1XK4 C;  4ORC B;  1TNW A;  1PRW A;  1OOG A;  1QX2 A;  2LUX A;  1SRA A;  2F3Z A;  1ZOT B;  1UUR A;  5PAL A;  2MAZ A;  4AQI A;  2MJW B;  4JPZ B;  4I5J A;  1BU3 A;  5FI2 A;  5HKW A;  3WNX B;  3PM8 A;  1M45 A;  2I7A A;  5BPJ A;  5I2O A;  3I5H C;  2L0P A;  3CR2 A;  3CR4 X;  1W9Z A;  2WOS A;  3D0Y A;  4FQT A;  3KF9 A;  2A4J A;  3CDN A;  4WRI A;  5CSF A;  4ORA B;  4GGF C;  3IVT A;  3NSK A;  2QAC A;  1KK8 B;  1G33 A;  3GK4 X;  3FWB A;  2LVK A;  1OZS A;  1ALW A;  3OB1 B;  1J55 A;  3BFB A;  1XFV O;  3VRN A;  3I5H B;  1MXL C;  1NX2 A;  2QEB A;  4YGB B;  3SG3 A;  2LVJ A;  3IQO A;  1DGU A;  1LS8 A;  4KYN A;  2H8V A;  3LCP C;  2LLT A;  4WQ2 A;  5HYD A;  4MVF A;  3OGN A;  1QLS A;  2K2A A;  1OQP A;  2JRF A;  2FCE A;  2GTE A;  5HKZ A;  5JOL A;  3TDZ A;  5HLO A;  2QPT A;  2JPT A;  3CZ1 A;  1KSM A;  2M49 B;  2SCP A;  4XYN A;  4PAL A;  3DVM A;  5JJG A;  1DMO A;  1TRF A;  4GGN A;  4U8D A;  3LK1 A;  4E68 A;  4CLN A;  1XA5 A;  4OV2 A;  2ZRT A;  1F54 A;  1WRL A;  2WCJ A;  1WDC B;  1N65 A;  4N1G A;  2KI6 C;  1JSA A;  4A4C A;  1A4P A;  1XK4 A;  1K96 A;  2M0R A;  1SCM B;  4PT1 A;  2WC8 A;  2H2K A;  1ZMZ A;  5I8N A;  2O5G A;  1Z2C B;  1Y0V H;  2WC6 A;  3OX6 A;  4JD9 A;  4QJ3 B;  1JFJ A;  1H8B A;  3BJH A;  4C0L A;  3FS7 A;  5I2Q A;  3B88 A;  3NXA A;  1CFD A;  1KFU S;  1RWY A;  3DF0 A;  3DY9 A;  4AQJ A;  2NZ0 A;  1AVS A;  3R72 A;  1MF8 B;  3GK2 A;  3FIA A;  2KDH A;  1DVI A;  1TCO B;  1B8R A;  3LL8 B;  4JWQ A;  4JQ0 D;  3SJS A;  1PSR A;  2KGR A;  1S26 D;  2LMV A;  4OKH A;  1Y1A A;  4MZL A;  2ZRS A;  4DUQ A;  2K7O A;  2LMU A;  2ZN8 A;  1DJZ A;  3CZ2 A;  1NX1 A;  2H61 A;  2OTG C;  3I5G C;  3KPX A;  1BF5 A;  2QEO A;  1RK9 A;  3AKB A;  3Q8I A;  3O6B A;  1SCV A;  2DOQ A;  2PSR A;  1UHH A;  2CNP A;  3CYZ A;  1UHJ A;  3CLN A;  2LP3 A;  1DF0 A;  5D7F A;  2CCM A;  1IQ5 A;  1SMG A;  1S6I A;  3LK0 A;  4M2P A;  4CFR A;  1TOP A;  1MHO A;  1AP4 A;  2HQW A;  1OMR A;  3UNW A;  3ZNI A;  1J7P A;  1NYA A;  1CFC A;  1TUZ A;  1S5G Y;  2OPO A;  2JNX A;  4PHM A;  2JT0 A;  3SG7 A;  2M1U A;  2JQ6 A;  1R2U A;  1EG4 A;  1NWD A;  2L98 A;  4IL1 A;  1RFJ A;  5AFP A;  4PCW A;  5KSZ A;  1H4B A;  3FE9 A;  3RZS A;  2JUL A;  2LV7 A;  1QLK A;  1C07 A;  4PE7 A;  1QS7 A;  1G4Y R;  1TN4 A;  1XFZ O;  4YGC B;  5HL1 A;  3VRP A;  2G9B A;  5D3O A;  2BL0 B;  1DJG A;  2ZKM X;  5FI6 A;  2KLD A;  1IG5 A;  1OZO A;  1QIV A;  3TUY C;  1NIW A;  5AAN A;  3TS5 B;  1B7T Y;  1MWN A;  1CMG A;  1SL7 A;  3O78 A;  1F4Q A;  1SPY A;  2NCP A;  1MR8 A;  4NQG A;  1ZUZ A;  3BUM B;  3JTD C;  1A75 B;  4F7F A;  1A29 A;  3D10 A;  3BOW B;  3SIB A;  1B8C A;  1OW4 A;  2RGI A;  1XFR A;  3MSE B;  1YUR A;  3OP0 A;  4OR9 B;  2K61 A;  2M97 A;  3N7H A;  1F4O A;  1CM4 A;  2JT8 A;  2KOT A;  5K89 A;  5KU1 A;  2KNE A;  4P5O E;  4DS7 A;  2JNF A;  1TWO A;  3VRR A;  1J1D A;  1GGZ A;  2PQL A;  2L5Y A;  1ALV A;  2Y1N A;  3L4L A;  3S0B A;  1UHK A;  1BJF A;  1SW8 A;  1QVI Z;  2GV5 A;  2KFH A;  3PM2 A;  4IJ7 A;  4WQ3 A;  3VRQ A;  1YVH A;  4I5N B;  2COL B;  2BBM A;  3BUX B;  2LE9 B;  1PUL A;  2K2F A;  3WXA A;  2EC6 C;  1RJV A;  2LLS A;  3GK1 A;  1AHR A;  1NSH A;  1UHN A;  2GGZ A;  1YRT B;  2E6W A;  1SK6 D;  2F33 A;  1AJ5 A;  2ZN9 A;  3R1P A;  3LLE A;  4AOM A;  2FOT A;  4ORB B;  1U5I B;  3TZ1 A;  1V1F A;  2ZND A;  3TUY B;  1BG1 A;  1UP5 A;  3NSI A;  2KI6 D;  2K7D A;  3I5I C;  3EKJ A;  3VRO A;  1M63 B;  1WRK A;  2KGB C;  2I18 A;  5ER4 X;  1CLM A;  3SG4 A;  2M3W A;  4MZJ A;  2NLN A;  3FE6 A;  1SL9 A;  1YTZ C;  1N0Y A;  2L4H A;  3VB1 A;  2F2P A;  2MA2 A;  1JUO A;  2BCB A;  1C3Z A;  5ER5 A;  1GGW A;  1QX5 B;  2NCO A;  1CFP A;  1QAT A;  1K9U A;  4GBA A;  1EXR A;  1OOH A;  1YR5 A;  2JWW A;  1CTR A;  2Q91 A;  3JVT B;  4HRH A;  1P28 A;  1OOF A;  2Y5I A;  1IIO A;  1KWO B;  1JBA A;  5CSJ A;  3S0E A;  1BLQ A;  4UPG A;  1G8I A;  2K7C A;  3O4X A;  1OOI X;  2PRU A;  4XJK A;  2BNX A;  3BFA A;  5I2L A;  1DEL A;  1CLB A;  1QTX A;  2JC2 A;  4GUK A;  2M29 A;  3AAJ A;  1PK0 D;  4M2O A;  4NDB A;  1TTX A;  1YUT A;  1IJ6 A;  1KQM C;  2G2B A;  2LHL A;  3CS1 A;  3SG2 A;  3PJI A;  2PMY A;  1LVC D;  2KSP A;  1LKJ A;  3ZWH A;  2P6B B;  2CTN A;  3QRX A;  4ETO A;  1S36 A;  3BUO B;  1GM0 A;  2KAX A;  1AK8 A;  2MHH A;  4OVN F;  2WOR A;  2Q4U A;  3BUW B;  1ZAC A;  2FJU B;  4N5X A;  1RTP 1;  2KI4 C;  2F2O A;  5F6T A;  4C0K A;  1CMF A;  1KCY A;  4HRE E;  3NSL A;  4ICB A;  1DJW A;  4DIR A;  1NX0 A;  1REC A;  1B47 A;  2OTG B;  3I5G B;  2BKH B;  4HRG A;  4A4B A;  1W7I B;  4YGE B;  1CDP A;  1SKT A;  3H4S E;  1DEK A;  3PAL A;  4C0J A;  2M7L A;  1CDN A;  1XO5 A;  2AAO A;  4GGF A;  4USL A;  1SL8 A;  2SAS A;  3DZT A;  3DD4 A;  3EVV A;  4TNC A;  1FI5 A;  1CDL A;  1WLZ A;  4GNK B;  1WRZ A;  2CXJ A;  4HSZ A;  1QV1 A;  1EJ3 A;  2WCF A;  2M1K B;  3OB2 B;  2PYQ A;  2LVI A;  5FI7 A;  2K60 A;  3CR5 X;  3WHU B;  4CFQ A;  1QX7 A;  3ICB A;  1KWO C;  1CB1 A;  3NHI A;  1SBJ A;  1DF0 B;  3M0W A;  1ODB A;  3JVT C;  1SR6 C;  3S0G A;  1B9A A;  4YI9 A;  1F55 A;  1Y6W A;  1SSE B;  3OHM B;  1NX3 A;  1W7J B;  3DVK A;  2BBN A;  2BEC A;  2LM5 A;  2LCP A;  1KK8 C;  4F0Z B;  2L50 A;  1J1E A;  1XFU O;  2NXQ A;  4PE4 A;  1K90 D;  1C3Y A;  2I2R E;  2KAY A;  1YX8 A;  1WDC C;  1QXP A;  2JT3 A;  3B86 A;  1MQ1 A;  1S6C A;  2L4I A;  3WHT B;  3EVU A;  3AAK A;  2HPS A;  1BMO A;  2L2C A;  1GJY A;  1BT6 A;  1V1G A;  3BYA A;  1KQV A;  2JTZ A;  2BAP A;  2KYC A;  1AJ4 A;  2WCH A;  3A4U B;  4YBH B;  1JC2 A;  1R6P A;  4MN0 A;  5TNC A;  2E30 A;  4CID A;  2WC5 A;  1FF1 A;  5FYX A;  1XFX O;  5IBW A;  5DIC A;  1CKK A;  1IRJ A;  3HCM A;  1IGV A;  3K1E A;  1QAS A;  2JXC A;  3BOW A;  2K7B A;  3EG5 B;  4MRX A;  1C7V A;  5EL2 A;  1EL4 A;  3NSO A;  4MBE A;  4INW A;  4DCK A;  4YI8 A;  4NDD A;  1L2O C;  3I5F B;  5AER A;  1JWD A;  3L47 A;  2R2I A;  2KLE A;  1N2D A;  2HQ8 A;  3B7A A;  2BCX A;  4PHN A;  5CSI A;  2EC6 B;  2WND A;  2YGU A;  5CPV A;  1F70 A;  2BE4 A;  2FJY A;  1F8H A;  1CFF A;  1NP8 A;  5AXI A;  4ZCU A;  3D0Y B;  2PVB A;  1JF0 A;  4N1F A;  1ZFS A;  1SR6 B;  1GQM A;  4MZK A;  1BOD A;  4MEW A;  1X02 A;  1LXF C;  2EGD A;  2KI4 B;  2KQY A;  2WCM A;  4PDZ A;  3TS5 C;  3CZ0 A;  4INX A;  1FI6 A;  1WY9 A;  4FTG A;  5GQQ C;  1EH2 A;  3D76 A;  1QWV A;  2AUC A;  3SS3 A;  1U5I A;  1DGV A;  1PSB A;  4PHK A;  1YUU A;  2ZFD A;  3S0D A;  1A2X A;  1K94 A;  2JXL A;  1K9K A;  2PAS A;  1OMV A;  5J3X A;  3DYE A;  1NUB A;  3TDU A;  2M7N A;  2LMT A;  1KQM B;  2ERB A;  1JFK A;  3L4A A;  3PFV A;  3B6X A;  1DQE A;  4PE1 A;  3UO9 A;  4DRW A;  1CNP A;  1DJI A;  2JPO A;  2BCA A;  2VRG A;  2MRD A;  1Q80 A;  2LC5 A;  1TCF A;  1B4C A;  3TDI A;  1YVL A;  2WCK A;  2K0J A;  3CAB A;  2H61 C;  1WLM A;  2KFF A;  4NDC A;  4YGD B;  5HLV A;  3C1V A;  3O4Y A;  3DVJ A;  4MLW A;  2OS8 C;  5G08 A;  1K93 D;  3EKH A;  1LA3 A;  3F45 A;  2P70 A;  3OX5 A;  1BOC A;  2JZI A;  1BR4 B;  1K95 A;  2KBM A;  1JF2 A;  4PHJ A;  2KFG A;  1LA0 A;  1LIN A;  1XYD A;  2BKI B;  2BE6 A;  4BY4 A;  1K2H A;  2LUC A;  1S6J A;  4GPL B;  4MSP A;  1EG3 A;  4GAO A;  3RLZ A;  5B8I B;  1M46 A;  1OOJ A;  1QV0 A;  3EK4 A;  2WCB A;  3I5I B;  3D77 A;  3DXL A;  1DJX A;  2I94 A;  3FWC A;  4I5K A;  1ORG A;  2QEH A;  3EK8 A;  1Y1X A;  2KAV A;  1DT7 B;  1FW4 A;  4I5L B;  2MBX A;  3CTN A;  1IKU A;  1OMD A;  3S0F A;  4GFT A;  2FCD A;  3AKA A;  1KK7 Z;  1T14 A;  1NCY A;  2KHN A;  3O2P A;  1TIZ A;  3K21 A;  3KO0 A;  2K8M B;  3PSR A;  1TNQ A;  1IH0 A;  2LP2 A;  2GGM A;  3CGA A;  2M9G A;  2TN4 A;  3FE8 A;  1SCM C;  1B1G A;  3SIA A;  1F71 A;  4MRY A;  1L2O B;  4P2Y B;  4XJK B;  4D1E A;  2O60 A;  3RM1 A;  2JOJ A;  1IJ5 A;  1QVI Y;  2F8P A;  1E8A A;  2MLF C;  5D69 A;  5CSN A;  5AEQ A;  3R1V A;  1M39 A;  2EHB A;  2AMI A;  2LLU A;  2F3Y A;  2BL0 C;  2PAL A;  4YRU A;  1UWO A;  3BUN B;  5I94 A;  2KQ6 A;  2D8N A;  3R1O A;  2M8U A;  4Q04 A;  3SS4 A;  1QIW A;  3OBV A;  1RRO A;  1OSA A;  1YUS A;  1J7R A;  2LNK A;  3HX4 A;  3JTD B;  4FQO A;  4L9M A;  4CPV A;  3EVR A;  3I5F C;  1S5G Z;  4QJ4 B;  1S3P A;  1CLL A;  1K8U A;  3IF7 A;  1IQ3 A;  1TNP A;  2WCE A;  4QJ5 B;  3CWG A;  1A03 A;  1S1E A;  2IS9 A;  3EK7 A;  1PVA A;  2V53 A;  3D74 A;  3NGV A;  1DC1 A;  1DJY A;  2Y1M A;  2P71 A;  1Z4H A;  4OZD A;  1YX7 A;  3S0A A;  2HET A;  3SS5 A;  1MXE A;  2KBI A;  5KTY A;  1J7O A;  3BXK A;  1B7T Z;  4ZCV A;  3BFH A;  1NPQ A;  3E3R A;  5DKR A;  1DTL A;  3BQ3 A;  1HQV A;  3IQQ A;  3KEV A;  2KYF A;  1Y1U A;  2ZNE A;  1PAL A;  3D73 A;  1TUJ A;  3D75 A;  3NHT A;  2L2E A;  1KFU L;  4R1E A;  1AUI B;  1BR1 B;  1IWQ A;  1XFW O;  2L5X B;  1DJH A;  2LHI A;  1CDM A;  3VGO A;  1C7W A;  1K9P A;  3DF0 B;  1NCX A;  1B8L A;  1QJT A;  2HF5 A;  1M31 A;  1XVJ A;  1KSO A;  2ISD A;  3PN7 B;  1MUX A;  2LVV A;  2QDI A;  3A8R A;  2B1U A;  1KFX L;  2KPH A;  3D78 A;  2MLE C;  1CM1 A;  3PAT A;  4YGA A;  2LAP A;  5DKQ A;  3KHE A;  3QME A;  1TNX A;  4BY5 A;  3SG6 A;  4M2Q A;  2JU0 A;  1SY9 A;  1UHI A;  2CT9 A;  1XFY O;  2OS8 B; 
#chains in the Genus database with same CATH homology
 4PE0 A;  2L51 A;  2LAN A;  1PVB A;  3GOF A;  3DVE A;  1OE9 B;  1FPW A;  1UUS A;  1HT9 A;  1VRK A;  1KFX S;  1FBV A;  3SG5 A;  3PLF B;  1KK7 Y;  1A75 A;  1J7Q A;  2JTT A;  2Y4Q A;  1SNL A;  4OCI A;  2CBL A;  1SYM A;  5DKN A;  3CZT X;  5HKY A;  1L7Z A;  1YRU B;  1D1O A;  1NCZ A;  3PN7 C;  1XK4 C;  4ORC B;  1PRW A;  1TNW A;  1QX2 A;  2LUX A;  1SRA A;  2F3Z A;  1ZOT B;  1UUR A;  5PAL A;  2MAZ A;  4AQI A;  2MJW B;  4JPZ B;  4I5J A;  1BU3 A;  3WNX B;  5HKW A;  3PM8 A;  1M45 A;  2I7A A;  5BPJ A;  5I2O A;  3I5H C;  2L0P A;  3CR2 A;  3CR4 X;  2WOS A;  3D0Y A;  3KF9 A;  2A4J A;  4WRI A;  5CSF A;  4ORA B;  4GGF C;  3NSK A;  2QAC A;  1KK8 B;  1G33 A;  3GK4 X;  3FWB A;  2LVK A;  1OZS A;  1ALW A;  3OB1 B;  1J55 A;  1XFV O;  3VRN A;  3I5H B;  1MXL C;  1NX2 A;  4YGB B;  3SG3 A;  2LVJ A;  3IQO A;  1DGU A;  3LCP C;  2LLT A;  4WQ2 A;  5HYD A;  4MVF A;  1QLS A;  2K2A A;  1OQP A;  2JRF A;  2FCE A;  5HKZ A;  5JOL A;  3TDZ A;  5HLO A;  2QPT A;  2JPT A;  1KSM A;  2M49 B;  2SCP A;  4XYN A;  4PAL A;  3DVM A;  5JJG A;  1DMO A;  1TRF A;  4GGN A;  4U8D A;  3LK1 A;  4E68 A;  4CLN A;  1XA5 A;  4OV2 A;  2ZRT A;  1F54 A;  1WRL A;  1WDC B;  1N65 A;  4N1G A;  2KI6 C;  1JSA A;  4A4C A;  1A4P A;  1XK4 A;  1K96 A;  2M0R A;  1SCM B;  2WC8 A;  2H2K A;  1ZMZ A;  5I8N A;  2O5G A;  1Y0V H;  4QJ3 B;  3OX6 A;  1JFJ A;  1H8B A;  4C0L A;  3FS7 A;  5I2Q A;  3NXA A;  1CFD A;  1KFU S;  1RWY A;  3DF0 A;  4AQJ A;  2NZ0 A;  1AVS A;  1MF8 B;  3GK2 A;  3FIA A;  2KDH A;  1DVI A;  1TCO B;  1B8R A;  3LL8 B;  4JWQ A;  4JQ0 D;  3SJS A;  1PSR A;  2KGR A;  1S26 D;  2LMV A;  4OKH A;  1Y1A A;  4MZL A;  2ZRS A;  4DUQ A;  2K7O A;  2LMU A;  2ZN8 A;  1DJZ A;  1NX1 A;  2H61 A;  2OTG C;  3I5G C;  3KPX A;  1BF5 A;  1RK9 A;  3AKB A;  3O6B A;  1SCV A;  2DOQ A;  2PSR A;  1UHH A;  2CNP A;  1UHJ A;  3CLN A;  2LP3 A;  1DF0 A;  5D7F A;  2CCM A;  1IQ5 A;  1SMG A;  1S6I A;  3LK0 A;  4M2P A;  4CFR A;  1TOP A;  1MHO A;  1AP4 A;  2HQW A;  1OMR A;  3ZNI A;  1J7P A;  1NYA A;  1CFC A;  1S5G Y;  2OPO A;  2JNX A;  4PHM A;  2JT0 A;  3SG7 A;  2M1U A;  2JQ6 A;  1R2U A;  1EG4 A;  1NWD A;  2L98 A;  4IL1 A;  1RFJ A;  5AFP A;  4PCW A;  5KSZ A;  1H4B A;  2JUL A;  2LV7 A;  1QLK A;  1C07 A;  4PE7 A;  1QS7 A;  1G4Y R;  1TN4 A;  1XFZ O;  4YGC B;  3VRP A;  2G9B A;  2BL0 B;  1DJG A;  2ZKM X;  1IG5 A;  1OZO A;  1QIV A;  3TUY C;  1NIW A;  5AAN A;  3TS5 B;  1B7T Y;  1MWN A;  1CMG A;  1SL7 A;  3O78 A;  1F4Q A;  1SPY A;  2NCP A;  1MR8 A;  4NQG A;  1ZUZ A;  3BUM B;  3JTD C;  1A75 B;  1A29 A;  3D10 A;  3BOW B;  3SIB A;  1B8C A;  2RGI A;  3MSE B;  1YUR A;  3OP0 A;  4OR9 B;  2K61 A;  2M97 A;  1F4O A;  1CM4 A;  2JT8 A;  2KOT A;  5K89 A;  5KU1 A;  2KNE A;  4P5O E;  4DS7 A;  2JNF A;  3VRR A;  1J1D A;  1GGZ A;  1ALV A;  2Y1N A;  1UHK A;  1BJF A;  1SW8 A;  1QVI Z;  2GV5 A;  2KFH A;  4WQ3 A;  3VRQ A;  1YVH A;  4I5N B;  2COL B;  2BBM A;  3BUX B;  2LE9 B;  1PUL A;  2K2F A;  3WXA A;  2EC6 C;  1RJV A;  2LLS A;  3GK1 A;  1AHR A;  1NSH A;  1UHN A;  2GGZ A;  1YRT B;  2E6W A;  1SK6 D;  2F33 A;  1AJ5 A;  2ZN9 A;  3LLE A;  4AOM A;  2FOT A;  4ORB B;  1U5I B;  3TZ1 A;  1V1F A;  2ZND A;  3TUY B;  1BG1 A;  1UP5 A;  3NSI A;  2KI6 D;  2K7D A;  3I5I C;  3EKJ A;  3VRO A;  1M63 B;  1WRK A;  2KGB C;  2I18 A;  5ER4 X;  1CLM A;  3SG4 A;  2M3W A;  4MZJ A;  2NLN A;  1SL9 A;  1YTZ C;  1N0Y A;  2L4H A;  2F2P A;  2MA2 A;  1JUO A;  2BCB A;  5ER5 A;  1GGW A;  1QX5 B;  2NCO A;  1CFP A;  1QAT A;  1K9U A;  4GBA A;  1EXR A;  2JWW A;  1YR5 A;  2Q91 A;  1CTR A;  3JVT B;  4HRH A;  2Y5I A;  1KWO B;  1JBA A;  5CSJ A;  1BLQ A;  4UPG A;  1G8I A;  2K7C A;  2PRU A;  4XJK A;  5I2L A;  1CLB A;  1QTX A;  2JC2 A;  4GUK A;  2M29 A;  3AAJ A;  1PK0 D;  4M2O A;  4NDB A;  1TTX A;  1YUT A;  1IJ6 A;  1KQM C;  2G2B A;  2LHL A;  3CS1 A;  3SG2 A;  2PMY A;  1LVC D;  2KSP A;  1LKJ A;  3ZWH A;  2P6B B;  2CTN A;  3QRX A;  4ETO A;  1S36 A;  3BUO B;  2KAX A;  1AK8 A;  2MHH A;  4OVN F;  2WOR A;  2Q4U A;  3BUW B;  1ZAC A;  2FJU B;  4N5X A;  1RTP 1;  2KI4 C;  2F2O A;  5F6T A;  4C0K A;  1CMF A;  1KCY A;  4HRE E;  3NSL A;  4ICB A;  1DJW A;  4DIR A;  1NX0 A;  1REC A;  1B47 A;  2OTG B;  3I5G B;  2BKH B;  4HRG A;  4A4B A;  1W7I B;  4YGE B;  1CDP A;  1SKT A;  3H4S E;  4C0J A;  3PAL A;  1CDN A;  2M7L A;  1XO5 A;  2AAO A;  4GGF A;  4USL A;  1SL8 A;  2SAS A;  3DD4 A;  3EVV A;  4TNC A;  1FI5 A;  1CDL A;  1WLZ A;  4GNK B;  1WRZ A;  2CXJ A;  4HSZ A;  1QV1 A;  1EJ3 A;  2WCF A;  2M1K B;  3OB2 B;  2LVI A;  4CFQ A;  3CR5 X;  3WHU B;  1CB1 A;  1QX7 A;  3ICB A;  1KWO C;  1SBJ A;  1DF0 B;  3M0W A;  1ODB A;  3JVT C;  1SR6 C;  1B9A A;  4YI9 A;  1F55 A;  1Y6W A;  3OHM B;  1NX3 A;  1W7J B;  3DVK A;  2BBN A;  2BEC A;  2LM5 A;  2LCP A;  1KK8 C;  4F0Z B;  2L50 A;  1J1E A;  1XFU O;  2NXQ A;  4PE4 A;  1K90 D;  2I2R E;  2KAY A;  1YX8 A;  1WDC C;  1QXP A;  2JT3 A;  1MQ1 A;  1S6C A;  2L4I A;  3WHT B;  3EVU A;  3AAK A;  2HPS A;  1BMO A;  3BYA A;  1GJY A;  1BT6 A;  1V1G A;  1KQV A;  2JTZ A;  2KYC A;  3A4U B;  1AJ4 A;  4YBH B;  1JC2 A;  1R6P A;  4MN0 A;  5TNC A;  2E30 A;  4CID A;  1FF1 A;  5FYX A;  1XFX O;  5IBW A;  1CKK A;  1IRJ A;  3HCM A;  1IGV A;  1QAS A;  2JXC A;  3BOW A;  2K7B A;  4MRX A;  1C7V A;  1EL4 A;  3NSO A;  4MBE A;  4DCK A;  4YI8 A;  4NDD A;  1L2O C;  3I5F B;  5AER A;  1JWD A;  2R2I A;  1N2D A;  2HQ8 A;  2BCX A;  4PHN A;  5CSI A;  2EC6 B;  2WND A;  5CPV A;  1F8H A;  1F70 A;  2BE4 A;  1CFF A;  1NP8 A;  5AXI A;  4ZCU A;  3D0Y B;  2PVB A;  1JF0 A;  4N1F A;  1ZFS A;  1SR6 B;  1GQM A;  4MZK A;  1BOD A;  4MEW A;  1X02 A;  1LXF C;  2EGD A;  2KI4 B;  2KQY A;  4PDZ A;  3TS5 C;  1FI6 A;  1WY9 A;  4FTG A;  5GQQ C;  1EH2 A;  2AUC A;  1DGV A;  1PSB A;  1U5I A;  4PHK A;  1YUU A;  2ZFD A;  1A2X A;  1K94 A;  2JXL A;  1K9K A;  2PAS A;  1OMV A;  5J3X A;  1NUB A;  3TDU A;  2M7N A;  2LMT A;  1KQM B;  3PFV A;  1JFK A;  1CNP A;  4DRW A;  4PE1 A;  1DJI A;  2BCA A;  2VRG A;  2MRD A;  1Q80 A;  2LC5 A;  1TCF A;  1B4C A;  3TDI A;  1YVL A;  2K0J A;  2H61 C;  1WLM A;  2KFF A;  4NDC A;  4YGD B;  5HLV A;  3C1V A;  3O4Y A;  3DVJ A;  4MLW A;  2OS8 C;  5G08 A;  1K93 D;  3EKH A;  1LA3 A;  3F45 A;  1BOC A;  3OX5 A;  2JZI A;  1BR4 B;  1K95 A;  2KBM A;  1JF2 A;  4PHJ A;  2KFG A;  1LA0 A;  1LIN A;  1XYD A;  2BKI B;  2BE6 A;  4BY4 A;  1K2H A;  2LUC A;  1S6J A;  4GPL B;  4MSP A;  1EG3 A;  4GAO A;  3RLZ A;  5B8I B;  1M46 A;  1OOJ A;  1QV0 A;  3EK4 A;  2WCB A;  3I5I B;  1DJX A;  2I94 A;  3FWC A;  4I5K A;  3EK8 A;  1Y1X A;  2KAV A;  1DT7 B;  1FW4 A;  4I5L B;  2MBX A;  3CTN A;  1IKU A;  1OMD A;  4GFT A;  2FCD A;  3AKA A;  1KK7 Z;  2KHN A;  1NCY A;  3O2P A;  1TIZ A;  3K21 A;  3KO0 A;  2K8M B;  3PSR A;  1TNQ A;  1IH0 A;  2LP2 A;  2GGM A;  3CGA A;  2M9G A;  2TN4 A;  1SCM C;  1B1G A;  3SIA A;  1F71 A;  4MRY A;  1L2O B;  4P2Y B;  4XJK B;  4D1E A;  2O60 A;  3RM1 A;  2JOJ A;  1IJ5 A;  1QVI Y;  2F8P A;  1E8A A;  2MLF C;  5D69 A;  5CSN A;  5AEQ A;  1M39 A;  2EHB A;  2AMI A;  2LLU A;  2F3Y A;  2BL0 C;  2PAL A;  4YRU A;  1UWO A;  3BUN B;  2KQ6 A;  2D8N A;  2M8U A;  4Q04 A;  1QIW A;  1RRO A;  1OSA A;  1YUS A;  1J7R A;  2LNK A;  3HX4 A;  3JTD B;  4FQO A;  4L9M A;  4CPV A;  3EVR A;  3I5F C;  1S5G Z;  4QJ4 B;  1S3P A;  1CLL A;  1K8U A;  3IF7 A;  1IQ3 A;  1TNP A;  2WCE A;  4QJ5 B;  3CWG A;  1A03 A;  1S1E A;  2IS9 A;  3EK7 A;  1PVA A;  2V53 A;  1DJY A;  2Y1M A;  1YX7 A;  2HET A;  1MXE A;  2KBI A;  5KTY A;  1J7O A;  3BXK A;  1B7T Z;  4ZCV A;  1NPQ A;  3E3R A;  5DKR A;  1DTL A;  3BQ3 A;  1HQV A;  3IQQ A;  3KEV A;  2KYF A;  1Y1U A;  2ZNE A;  1PAL A;  4R1E A;  2L2E A;  1KFU L;  1AUI B;  1BR1 B;  1IWQ A;  1XFW O;  2L5X B;  1DJH A;  2LHI A;  1CDM A;  3VGO A;  1C7W A;  1K9P A;  3DF0 B;  2HF5 A;  1NCX A;  1B8L A;  1QJT A;  1M31 A;  1XVJ A;  1KSO A;  2ISD A;  3PN7 B;  1MUX A;  2LVV A;  3A8R A;  2B1U A;  1KFX L;  4YGA A;  2MLE C;  1CM1 A;  3PAT A;  2LAP A;  5DKQ A;  3KHE A;  1TNX A;  4BY5 A;  3SG6 A;  4M2Q A;  2JU0 A;  1SY9 A;  1UHI A;  2CT9 A;  1XFY O;  2OS8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...