4P5OE

Structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3-e2~ubiquitin-like protein-substrate intermediate trapped in action
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin-1
publication title Structure of a RING E3 Trapped in Action Reveals Ligation Mechanism for the Ubiquitin-like Protein NEDD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 197
sequence length 197
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4p5oE01
4MZJA 5TNCA 1DJGA 4AQIA 1MXLC 1S1EA 1SR6C 1KSOA 2JPTA 2M9GA 3EVVA 2JNFA 2JT3A 1YUSA 4OR9B 2JXCA 2LLUA 3ICBA 4JQ0D 2WORA 2CNPA 2PMYA 4NDCA 4XJKA 4HSZA 1DVIA 2BE4A 2I7AA 3CR5X 2K0JA 2L50A 5B8IB 2LNKA 2LAPA 1AUIB 3I5HC 1MF8B 2Y1MA 3I5FC 1SL8A 2KBMA 1SR6B 3BYAA 1UHJA 2L0PA 2MA2A 4MBEA 2BCBA 1KFUL 3O2PA 4A4CA 4DUQA 2QPTA 1GGWA 2WCEA 5KSZA 1DTLA 1QV0A 4MZLA 1IRJA 2KBIA 2KFGA 2FOTA 3OB2B 1D1OA 1XFXO 2BBMA 1K9PA 3IQQA 1G33A 1DT7B 3DVKA 1CTRA 1UHNA 3AKAA 3D0YB 4M2QA 4D1EA 3SG4A 1KFXL 2F3YA 2BE6A 1YR5A 4GGFC 4Q04A 1C7VA 3AAKA 5KTYA 1MR8A 2ZFDA 5J3XA 1NX3A 3EKJA 2LVVA 1DF0A 5JJGA 3BOWB 1X02A 4CFRA 2BKIB 1S6CA 5CPVA 1IH0A 3FIAA 1XK4C 2A4JA 1B7TY 1OMDA 3BUWB 1SCVA 3HX4A 4F0ZB 1RWYA 1IJ5A 5I2LA 2K7OA 4YGDB 3EKHA 2MLEC 1ZFSA 1Y1UA 4GGFA 2CCMA 1NIWA 1M39A 1QLSA 1TCOB 2I18A 3JVTC 3OHMB 4FTGA 4MSPA 1YVLA 1ALVA 2ZRTA 4BY4A 2LMTA 5HYDA 5D69A 1K2HA 5CSJA 1KQMC 1FF1A 1XYDA 3VRNA 1B1GA 1JBAA 1XO5A 3A8RA 1F71A 3LK0A 1IWQA 2Y5IA 3OB1B 4L9MA 2Q4UA 5I2QA 4CPVA 2Y4QA 2KGRA 3BQ3A 1YURA 1L2OB 3DVJA 4PCWA 3EVUA 1J7OA 1CM1A 1S26D 2I2RE 3BUMB 3PN7C 4MEWA 1TRFA 1NWDA 4C0KA 1SBJA 1YTZC 1KQMB 2WOSA 2L4IA 1ALWA 1LVCD 2LUCA 2LANA 3AAJA 1YUTA 4XYNA 4A4BA 1NUBA 3O4YA 1J7QA 1NX2A 1S6IA 4E68A 1CLMA 5JOLA 1EXRA 2KAYA 2GGMA 1U5IB 2JT8A 2M97A 5AANA 1SCMB 4QJ4B 4I5KA 1A75A 2M49B 5CSFA 1OZSA 2JRFA 3JTDB 3BUNB 1B9AA 1XFZO 2KI4B 3ZNIA 3DF0B 1PRWA 4I5LB 1KCYA 5ER4X 1B8CA 1F70A 3SG2A 3FWCA 1B47A 1BR1B 3LL8B 1VRKA 1LA3A 1TNPA 2PSRA 1JFKA 3PM8A 5PALA 2MLFC 2CBLA 1SL9A 1KWOB 4GPLB 1BOCA 1ODBA 1CMGA 1AHRA 2JU0A 1LXFC 3CLNA 5KU1A 3TDZA 4YI9A 4CFQA 2JTTA 3K21A 2L4HA 1XA5A 4QJ5B 2K7DA 1KQVA 3EK7A 1F55A 2KYFA 1J7PA 1QV1A 1WRZA 1GJYA 1V1GA 2AUCA 1QIWA 3OX5A 1S6JA 1H8BA 1RECA 1YRTB 1QX7A 2LP3A 4YGAA 1JUOA 1Y0VH 1AP4A 4HRHA 1TIZA 2BL0B 2ZKMX 2Q91A 1B8RA 3OP0A 4PE1A 3VROA 1UUSA 2ZNDA 1KFUS 3KEVA 2LHIA 2MHHA 2GGZA 2JQ6A 3SG7A 1S3PA 4YRUA 3BXKA 1CDLA 1AVSA 1SNLA 4XJKB 4N1GA 2F3ZA 1CB1A 2KQ6A 1G4YR 4MN0A 3WHTB 3CZTX 1UHKA 4YGEB 3PFVA 1M63B 1FW4A 4PALA 5I8NA 3A4UB 1KFXS 4WRIA 1S5GZ 1UURA 1Y6WA 4ORCB 5BPJA 1IKUA 2BKHB 2KDHA 1BLQA 1WLMA 1G8IA 1CNPA 2MBXA 2K7BA 3OX6A 3CS1A 2LUXA 3TS5B 1EH2A 3D0YA 2K2FA 2JTZA 1NCZA 3BUOB 3NSOA 1AJ4A 1QVIZ 2JNXA 3GOFA 1JFJA 3EK4A 1NP8A 2JT0A 1HQVA 1MWNA 1PVAA 1YX8A 1QX2A 3H4SE 1CLLA 3AKBA 1QS7A 3EVRA 1CDPA 1N2DA 1DMOA 3BOWA 4OKHA 3SG3A 2AAOA 3DVMA 2G2BA 2EGDA 1A29A 2MJWB 1AJ5A 1XVJA 1SW8A 3NSLA 1MXEA 4MRXA 5IBWA 1W7JB 5AFPA 3TUYB 2WCFA 3CR2A 1QTXA 1XFVO 1A2XA 1KK7Z 1L2OC 1Y1AA 4PHMA 1EG4A 2NXQA 2VRGA 1ZMZA 1TNXA 3SIBA 1SKTA 3CWGA 1MQ1A 4CLNA 1F54A 4WQ3A 5HLVA 1K90D 3F45A 4PDZA 1IGVA 2JULA 2ZNEA 5DKNA 2K2AA 2MRDA 2BECA 1TNQA 4U8DA 1QASA 1BU3A 1XK4A 1OZOA 3FWBA 2EC6B 3CR4X 4GFTA 1H4BA 1YX7A 2P6BB 2LP2A 4QJ3B 5DKRA 1FPWA 1RTP1 1SCMC 2LVIA 2G9BA 3KO0A 1BF5A 1K94A 2NCPA 1QXPA 2JZIA 2FCEA 2WC8A 3JTDC 2LCPA 3KHEA 1CMFA 1OQPA 1TTXA 1CDNA 2KI4C 1K95A 1E8AA 1CFCA 1DJXA 1DJYA 1C7WA 3SIAA 3VRQA 1K8UA 5AXIA 3WNXB 4BY5A 3TDUA 2GV5A 2OS8B 4P2YB 5AEQA 4YGBB 1KWOC 2M3WA 2PASA 3O6BA 1DGUA 4YI8A 1V1FA 2CTNA 1U5IA 3IF7A 4ZCVA 2R2IA 3WXAA 4YGCB 4TNCA 2LV7A 5I2OA 3PSRA 2LE9B 4JPZB 2M1KB 1UHHA 4HREE 2M1UA 2FCDA 1IQ3A 2QACA 3IQOA 1JF0A 1ZUZA 2JOJA 4NDDA 1QIVA 2ZN9A 1FI6A 3NSIA 1BG1A 1RK9A 1RFJA 2OTGB 1QLKA 2F33A 1YUUA 3NSKA 5HKZA 2BL0C 1M46A 2BCXA 1TOPA 1JF2A 1IJ6A 1RJVA 2KFFA 2KNEA 1KK8B 2M0RA 2V53A 3I5IB 1C07A 2E6WA 3SJSA 4MLWA 4DS7A 1RROA 1A4PA 1S5GY 2LMUA 4GBAA 4NQGA 2JWWA 4MRYA 3WHUB 1M31A 1PK0D 4PHKA 4UPGA 5G08A 1FI5A 2BBNA 3I5GB 1OMRA 1YRUB 5GQQC 2F8PA 3VRPA 5AERA 1J1DA 1OMVA 2K61A 3NXAA 1XFWO 5CSIA 2KGBC 1B4CA 3CTNA 2LVJA 1WLZA 1TN4A 2RGIA 3O78A 2M29A 1BJFA 2LLSA 3SG6A 1GQMA 2LC5A 1BMOA 4ORBB 2F2OA 2MAZA 2M7NA 5HLOA 1CKKA 1BR4B 1DJWA 1SMGA 3VGOA 2FJUB 1UWOA 2O5GA 1NYAA 2HQWA 3TS5C 4AQJA 1WY9A 1W7IB 1SL7A 2KI6D 5CSNA 1YVHA 1PVBA 1K96A 1M45A 2CT9A 4GNKB 4IL1A 5FYXA 1XFYO 2KAVA 4ETOA 2NCOA 1WDCB 2PRUA 1JC2A 3PATA 1SY9A 4GAOA 4M2PA 1KK7Y 1JSAA 3M0WA 1ZACA 4YBHB 1SPYA 4ORAB 4PHJA 1NPQA 1NSHA 2L51A 2KYCA 3TUYC 1JWDA 2B1UA 3I5HB 2KHNA 3TDIA 2COLB 4AOMA 2I94A 1F4OA 3I5FB 1QJTA 4C0JA 2PALA 4R1EA 1DF0B 2LM5A 2L98A 1NX0A 3PALA 3C1VA 4DRWA 1N65A 1WRKA 1GGZA 2M7LA 1PSRA 5HKYA 1F8HA 3MSEB 2TN4A 2AMIA 1AK8A 1PULA 3RLZA 2KFHA 4DIRA 2EC6C 2PVBA 3QRXA 1KSMA 1OE9B 2M8UA 2JXLA 4HRGA 2OPOA 2ZRSA 2HQ8A 1Y1XA 1S36A 1NX1A 2NZ0A 3DVEA 3GK2A 1J1EA 4P5OE 4PE4A 2BCAA 2E30A 2NLNA 4USLA 3LLEA 5HKWA 4WQ2A 2LHLA 2KSPA 1B8LA 1BODA 2WNDA 1DGVA 1K9UA 1CFFA 1DJIA 1MHOA 2WCBA 4OVNF 1QATA 1IQ5A 2D8NA 1N0YA 1R2UA 3CGAA 4I5NB 2OS8C 2JC2A 1CLBA 1K93D 1CDMA 2F2PA 2ISDA 1ZOTB 1BT6A 1UHIA 4N1FA 4JWQA 1OSAA 3DD4A 4I5JA 3ZWHA 2L5XB 2KAXA 3DF0A 3FS7A 2IS9A 2KI6C 3GK1A 1PALA 4FQOA 4MZKA 3HCMA 3BUXB 1NCXA 3JVTB 4DCKA 1B7TZ 3D10A 2Y1NA 3VRRA 1EJ3A 2HETA 1EG3A 4MVFA 3LCPC 3SG5A 1TCFA 5ER5A 1CM4A 1J7RA 1LA0A 2KQYA 2OTGC 1DJZA 4GUKA 4PHNA 1F4QA 3E3RA 1FBVA 3GK4X 1PSBA 1A75B 2LMVA 2LVKA 3I5IC 1KK8C 1MUXA 4N5XA 2H61C 2O60A 4ICBA 1L7ZA 2HPSA 2KOTA 2L2EA 2ZN8A 1WRLA 4OV2A 1LINA 1LKJA 3PN7B 2SCPA 3PLFB 3I5GC 1OOJA 4ZCUA 3KF9A 1UP5A 3LK1A 2EHBA 4PE0A 5F6TA 1QX5B 3KPXA 4OCIA 1Q80A 4NDBA 5D7FA 4CIDA 3TZ1A 1CFPA 1SRAA 1XFUO 4GGNA 4M2OA 1J55A 1R6PA 1TNWA 1CFDA 2CXJA 2H61A 1SK6D 5DKQA 4C0LA 1A03A 1NCYA 2H2KA 3EK8A 2DOQA 4PE7A 2K7CA 2LLTA 5K89A 1IG5A 1K9KA 3RM1A 1EL4A 2K8MB 2HF5A 1QVIY 1DJHA 1HT9A 1WDCC 1SYMA 2SASA
chains in the Genus database with same CATH superfamily
4MZJA 1OW4A 1DJGA 5TNCA 4AQIA 1MXLC 3CZ0A 1S1EA 1SR6C 1KSOA 2JPTA 2M9GA 3EVVA 2JNFA 2JT3A 1YUSA 4OR9B 2JXCA 2LLUA 3ICBA 4JQ0D 2WORA 3FE6A 2CNPA 2PMYA 4NDCA 4XJKA 4HSZA 1DVIA 2BE4A 2I7AA 5D3OA 3CR5X 2K0JA 2L50A 5B8IB 2LNKA 2LAPA 1AUIB 3I5HC 1MF8B 2Y1MA 3D73A 3I5FC 1SL8A 2KBMA 1SR6B 3BYAA 1UHJA 2L0PA 2MA2A 4MBEA 2BCBA 1KFUL 3O2PA 4A4CA 3DY9A 2QPTA 4DUQA 2WCEA 1GGWA 5KSZA 1DTLA 1QV0A 4MZLA 1OOFA 1IRJA 2KBIA 2KFGA 2FOTA 3OB2B 1D1OA 1XFXO 2BBMA 1K9PA 3IQQA 1G33A 1DT7B 3DVKA 1CTRA 3K1EA 1UHNA 3AKAA 3D0YB 4M2QA 3O4XA 4D1EA 3SG4A 1KFXL 2F3YA 2BE6A 1YR5A 4GGFC 4Q04A 5HL1A 1C7VA 3AAKA 5KTYA 1MR8A 2ZFDA 5J3XA 4PT1A 1NX3A 3EKJA 2LVVA 1DF0A 3V2LA 5JJGA 3BOWB 1X02A 4CFRA 1C3YA 2BKIB 1S6CA 5CPVA 1IH0A 3FIAA 1XK4C 2A4JA 1B7TY 1OMDA 3BUWB 3NGVA 1SCVA 3HX4A 3R1VA 4F0ZB 1RWYA 1IJ5A 5I2LA 2KPHA 2K7OA 4YGDB 3EKHA 2MLEC 1ZFSA 3CZ2A 3UNWA 1Y1UA 4GGFA 1NIWA 1DQEA 1M39A 1QLSA 1TCOB 2CCMA 2I18A 3JVTC 3OHMB 4FTGA 4MSPA 1YVLA 1ALVA 2ZRTA 4BY4A 2LMTA 2L2CA 5HYDA 5D69A 3R1PA 1K2HA 5CSJA 1P28A 1KQMC 1FF1A 1XYDA 3VRNA 1B1GA 1JBAA 1XO5A 3A8RA 1F71A 3LK0A 1IWQA 3N7HA 2Y5IA 3OB1B 4L9MA 2Q4UA 5I2QA 4CPVA 2WCLA 2Y4QA 2KGRA 3BQ3A 1YURA 1L2OB 2FJYA 3DVJA 4PCWA 3EVUA 1J7OA 1CM1A 1S26D 2I2RE 3BUMB 1T14A 3PN7C 1TRFA 1NWDA 4MEWA 4C0KA 1SBJA 1YTZC 1KQMB 2WOSA 2L4IA 1ALWA 1LVCD 2LUCA 2LANA 3AAJA 1YUTA 4XYNA 4A4BA 1NUBA 3CZ1A 3O4YA 1J7QA 1NX2A 1S6IA 3DYEA 4E68A 1CLMA 5JOLA 3BJHA 2QEVA 1EXRA 2KAYA 3UO9A 3BFBA 2GGMA 1U5IB 2H8VA 2JT8A 2M97A 5AANA 1SCMB 4QJ4B 4I5KA 1A75A 2M49B 5CSFA 1OZSA 2JRFA 3JTDB 3BUNB 1B9AA 1XFZO 2KI4B 3ZNIA 3DF0B 1PRWA 4I5LB 1KCYA 5ER4X 1B8CA 1F70A 3SG2A 3FWCA 1B47A 1BR1B 2WCKA 3LL8B 1VRKA 3R72A 1LA3A 1TNPA 2PSRA 1JFKA 3PM8A 5PALA 2MLFC 2CBLA 1SL9A 3IVTA 1KWOB 3S0FA 4GPLB 1BOCA 1ODBA 1CMGA 2BNXA 1AHRA 2JU0A 1LXFC 3CLNA 3VB1A 5KU1A 3TDZA 4YI9A 4CFQA 1TUZA 2JTTA 3CYZA 3K21A 2L4HA 3QMEA 1XA5A 4QJ5B 2K7DA 1KQVA 3EK7A 1F55A 2KYFA 1J7PA 1QV1A 1WRZA 1GJYA 1V1GA 2AUCA 1DC1A 1QIWA 3OX5A 1S6JA 2GTEA 1RECA 1YRTB 1H8BA 1QX7A 2LP3A 4YGAA 1JUOA 1Y0VH 1AP4A 3B6XA 4HRHA 1TIZA 2BL0B 3RZSA 2ZKMX 2Q91A 1B8RA 3OP0A 4PE1A 3S0EA 3VROA 1UUSA 2ZNDA 1KFUS 3CDNA 3KEVA 2LHIA 2QDIA 2MHHA 2GGZA 2JQ6A 3SG7A 1S3PA 4YRUA 3BXKA 1CDLA 1AVSA 1SNLA 4XJKB 4N1GA 2F3ZA 1CB1A 2KQ6A 1G4YR 4MN0A 3WHTB 3R1OA 3CZTX 1UHKA 4YGEB 3PFVA 3BFAA 1M63B 1FW4A 4PALA 5I8NA 3A4UB 1IIOA 2KLEA 1KFXS 4WRIA 1S5GZ 1UURA 1Y6WA 1SSEB 4ORCB 2QEOA 5BPJA 1IKUA 2BKHB 2KDHA 1BLQA 1WLMA 1G8IA 1CNPA 2MBXA 2K7BA 3OX6A 3CS1A 2LUXA 3TS5B 1Z4HA 1EH2A 3D0YA 2K2FA 2JTZA 1NCZA 3BUOB 3NSOA 1AJ4A 1QVIZ 2JNXA 3GOFA 1JFJA 3EK4A 1NP8A 2JT0A 3PM2A 1HQVA 1MWNA 1PVAA 1YX8A 1QX2A 2JPOA 3B86A 3H4SE 1CLLA 3AKBA 1QS7A 3EVRA 1CDPA 1N2DA 1DMOA 3BOWA 4OKHA 3SG3A 2AAOA 3OGNA 3B88A 3DVMA 2G2BA 2EGDA 1A29A 2MJWB 1AJ5A 1XVJA 1SW8A 3NSLA 1MXEA 4MRXA 5IBWA 1W7JB 5AFPA 3TUYB 2WCFA 3CR2A 1QTXA 1XFVO 1A2XA 1KK7Z 1L2OC 1Y1AA 4PHMA 1EG4A 2NXQA 2VRGA 1ZMZA 1TNXA 3SIBA 1SKTA 3CWGA 1MQ1A 4CLNA 1F54A 4WQ3A 5HLVA 2K60A 1K90D 3F45A 4PDZA 1IGVA 2JULA 2ZNEA 5DKNA 2K2AA 2MRDA 2BECA 1TNQA 4U8DA 1QASA 1BU3A 1XK4A 1OZOA 2WC6A 3FWBA 2EC6B 3CR4X 4GFTA 1H4BA 1YX7A 2P6BB 2LP2A 4QJ3B 5DKRA 1FPWA 1RTP1 1SCMC 2LVIA 2G9BA 3KO0A 1BF5A 1K94A 2NCPA 1QXPA 2JZIA 2FCEA 2WC8A 3JTDC 2LCPA 3KHEA 1CMFA 1OQPA 1TTXA 3D76A 2KI4C 1CDNA 1K95A 1E8AA 1CFCA 1DJXA 1DJYA 1C7WA 3SIAA 3VRQA 1K8UA 2BAPA 5AXIA 3WNXB 4BY5A 3TDUA 1DEKA 2GV5A 2OS8B 4P2YB 1TUJA 4FQTA 2P71A 5AEQA 2PYQA 1W9ZA 4YGBB 1KWOC 2M3WA 2PASA 5FI2A 3BFHA 3O6BA 1DGUA 4YI8A 1V1FA 2CTNA 1U5IA 3IF7A 4ZCVA 2R2IA 3WXAA 4YGCB 4TNCA 2LV7A 5I2OA 3PSRA 2LE9B 4JPZB 2M1KB 3EG5B 1UHHA 4HREE 2M1UA 2FCDA 2ERBA 1IQ3A 2QACA 3D74A 3IQOA 2WCMA 1JF0A 1ZUZA 2JOJA 4NDDA 1QIVA 2ZN9A 1FI6A 2WC5A 3NSIA 5EL2A 1BG1A 1RK9A 1RFJA 3SS5A 2OTGB 1QLKA 2F33A 1YUUA 3NSKA 5HKZA 2BL0C 1M46A 4INXA 2BCXA 1TOPA 1JF2A 1IJ6A 3SS4A 1RJVA 2KFFA 2KNEA 1KK8B 2M0RA 2V53A 3I5IB 1C07A 2E6WA 3SJSA 1OOHA 4MLWA 4DS7A 1RROA 1A4PA 1S5GY 2LMUA 4GBAA 4NQGA 2JWWA 4MRYA 3WHUB 3NHTA 1M31A 1PK0D 4PHKA 4UPGA 5G08A 1FI5A 3OBVA 3L4AA 2YGUA 2BBNA 3I5GB 1OMRA 1YRUB 3L4LA 5GQQC 2F8PA 3VRPA 5AERA 1J1DA 1OMVA 2K61A 3NXAA 1XFWO 5CSIA 2KGBC 3S0AA 1B4CA 3CTNA 2LVJA 1WLZA 1TN4A 3D77A 2RGIA 3O78A 2M29A 1BJFA 2LLSA 3SG6A 1GQMA 2LC5A 1BMOA 4ORBB 2F2OA 2MAZA 2M7NA 5HLOA 1CKKA 1BR4B 1DJWA 1SMGA 3VGOA 2FJUB 1UWOA 2O5GA 1NYAA 2HQWA 3TS5C 5FI6A 1WY9A 1W7IB 1SL7A 2KI6D 5CSNA 4AQJA 1YVHA 1PVBA 1K96A 1M45A 2CT9A 4GNKB 4IL1A 5FYXA 1XFYO 5I94A 2KAVA 4ETOA 2NCOA 1WDCB 2PRUA 1JC2A 3PATA 1SY9A 4GAOA 4M2PA 1KK7Y 1JSAA 3M0WA 1ZACA 4YBHB 1SPYA 4ORAB 4PHJA 1NPQA 1NSHA 2L51A 2KYCA 3TUYC 1JWDA 2B1UA 3I5HB 2KHNA 3D75A 2COLB 3TDIA 2I94A 4AOMA 1F4OA 3I5FB 1QJTA 1GM0A 4JKTA 4C0JA 2PALA 4R1EA 1DF0B 2LM5A 2L98A 1NX0A 3B87A 3PALA 3C1VA 4DRWA 1N65A 1WRKA 1GGZA 2M7LA 1OOGA 1DELA 1PSRA 2QEHA 5HKYA 1F8HA 3MSEB 2TN4A 2AMIA 1AK8A 3PJIA 1PULA 3RLZA 2KFHA 4DIRA 2EC6C 5FI7A 1Z2CB 2PVBA 3QRXA 1KSMA 1OE9B 2M8UA 1C3ZA 2JXLA 4HRGA 2OPOA 3NHIA 2ZRSA 2HQ8A 1Y1XA 1S36A 1NX1A 1ORGA 2NZ0A 3S0BA 3DVEA 3GK2A 1QWVA 1J1EA 4P5OE 3S0DA 4PE4A 2BCAA 2E30A 2NLNA 4USLA 3LLEA 5HKWA 4WQ2A 2LHLA 2KSPA 1B8LA 1BODA 2WNDA 1DGVA 1K9UA 1CFFA 1DJIA 1MHOA 2WCBA 4OVNF 1QATA 1IQ5A 5DICA 2D8NA 1N0YA 1R2UA 3CGAA 4I5NB 2OS8C 2JC2A 4F7FA 1CLBA 4OZDA 1K93D 3Q8IA 1CDMA 2WCJA 2F2PA 2ISDA 1TWOA 2PQLA 1ZOTB 2P70A 1BT6A 1UHIA 4N1FA 4JWQA 1OSAA 3DD4A 3DZTA 4I5JA 3ZWHA 2L5XB 2KAXA 3DF0A 3FS7A 2IS9A 3D78A 2KI6C 3GK1A 1PALA 4FQOA 4MZKA 3HCMA 3BUXB 1XFRA 1NCXA 3JVTB 4DCKA 2QEBA 1B7TZ 3D10A 2Y1NA 3VRRA 1EJ3A 2HETA 1EG3A 4MVFA 3LCPC 3SG5A 1TCFA 3FE9A 5ER5A 1CM4A 1J7RA 1LA0A 2KQYA 2OTGC 1DJZA 4GUKA 4PHNA 1F4QA 3CABA 1FBVA 1LS8A 1PSBA 3E3RA 1A75B 3GK4X 2LMVA 2LVKA 3I5IC 1KK8C 1MUXA 4N5XA 2H61C 2O60A 3DXLA 4ICBA 1L7ZA 4INWA 2HPSA 3B7AA 2KOTA 2L2EA 2ZN8A 1WRLA 4OV2A 1LINA 1OOIX 1LKJA 3PN7B 2SCPA 3FE8A 3PLFB 3S0GA 2WCHA 1OOJA 3I5GC 4ZCUA 3KF9A 1UP5A 3LK1A 3SS3A 2EHBA 4IJ7A 4PE0A 5F6TA 1QX5B 3KPXA 4OCIA 1Q80A 4NDBA 4JD9A 5D7FA 3TZ1A 4CIDA 1CFPA 1SRAA 1XFUO 4GGNA 4M2OA 1J55A 1R6PA 1TNWA 4KYNA 1CFDA 2CXJA 3L47A 2H61A 1SK6D 5DKQA 4C0LA 1A03A 2L5YA 1NCYA 2H2KA 3EK8A 2DOQA 4PE7A 2K7CA 2LLTA 2KLDA 1IG5A 1K9KA 3RM1A 1EL4A 5K89A 2K8MB 2HF5A 1QVIY 1DJHA 1HT9A 1WDCC 1SYMA 2SASA
chains in the Genus database with same CATH topology
4MZJA 5TNCA 1DJGA 4AQIA 1MXLC 1S1EA 1SR6C 1KSOA 2JPTA 2M9GA 3EVVA 2JNFA 2JT3A 1YUSA 4OR9B 2JXCA 2LLUA 3ICBA 4JQ0D 2WORA 2CNPA 2PMYA 4NDCA 4XJKA 4HSZA 1DVIA 2BE4A 2I7AA 3CR5X 2K0JA 2L50A 5B8IB 2LNKA 2LAPA 1AUIB 3I5HC 1MF8B 2Y1MA 3I5FC 1SL8A 2KBMA 1SR6B 3BYAA 1UHJA 2L0PA 2MA2A 4MBEA 2BCBA 1KFUL 3O2PA 4A4CA 4DUQA 2QPTA 1GGWA 2WCEA 5KSZA 1DTLA 1QV0A 4MZLA 1IRJA 2KBIA 2KFGA 2FOTA 3OB2B 1D1OA 1XFXO 2BBMA 1K9PA 3IQQA 1G33A 1DT7B 3DVKA 1CTRA 1UHNA 3AKAA 3D0YB 4M2QA 4D1EA 3SG4A 1KFXL 2F3YA 2BE6A 1YR5A 4GGFC 4Q04A 1C7VA 3AAKA 5KTYA 1MR8A 2ZFDA 5J3XA 1NX3A 3EKJA 2LVVA 1DF0A 5JJGA 3BOWB 1X02A 4CFRA 2BKIB 1S6CA 5CPVA 1IH0A 3FIAA 1XK4C 2A4JA 1B7TY 1OMDA 3BUWB 1SCVA 3HX4A 4F0ZB 1RWYA 1IJ5A 5I2LA 2K7OA 4YGDB 3EKHA 2MLEC 1ZFSA 1Y1UA 4GGFA 2CCMA 1NIWA 1M39A 1QLSA 1TCOB 2I18A 3JVTC 3OHMB 4FTGA 4MSPA 1YVLA 1ALVA 2ZRTA 4BY4A 2LMTA 5HYDA 5D69A 1K2HA 5CSJA 1KQMC 1FF1A 1XYDA 3VRNA 1B1GA 1JBAA 1XO5A 3A8RA 1F71A 3LK0A 1IWQA 2Y5IA 3OB1B 4L9MA 2Q4UA 5I2QA 4CPVA 2Y4QA 2KGRA 3BQ3A 1YURA 1L2OB 3DVJA 4PCWA 3EVUA 1J7OA 1CM1A 1S26D 2I2RE 3BUMB 3PN7C 4MEWA 1TRFA 1NWDA 4C0KA 1SBJA 1YTZC 1KQMB 2WOSA 2L4IA 1ALWA 1LVCD 2LUCA 2LANA 3AAJA 1YUTA 4XYNA 4A4BA 1NUBA 3O4YA 1J7QA 1NX2A 1S6IA 4E68A 1CLMA 5JOLA 1EXRA 2KAYA 2GGMA 1U5IB 2JT8A 2M97A 5AANA 1SCMB 4QJ4B 4I5KA 1A75A 2M49B 5CSFA 1OZSA 2JRFA 3JTDB 3BUNB 1B9AA 1XFZO 2KI4B 3ZNIA 3DF0B 1PRWA 4I5LB 1KCYA 5ER4X 1B8CA 1F70A 3SG2A 3FWCA 1B47A 1BR1B 3LL8B 1VRKA 1LA3A 1TNPA 2PSRA 1JFKA 3PM8A 5PALA 2MLFC 2CBLA 1SL9A 1KWOB 4GPLB 1BOCA 1ODBA 1CMGA 1AHRA 2JU0A 1LXFC 3CLNA 5KU1A 3TDZA 4YI9A 4CFQA 2JTTA 3K21A 2L4HA 1XA5A 4QJ5B 2K7DA 1KQVA 3EK7A 1F55A 2KYFA 1J7PA 1QV1A 1WRZA 1GJYA 1V1GA 2AUCA 1QIWA 3OX5A 1S6JA 1H8BA 1RECA 1YRTB 1QX7A 2LP3A 4YGAA 1JUOA 1Y0VH 1AP4A 4HRHA 1TIZA 2BL0B 2ZKMX 2Q91A 1B8RA 3OP0A 4PE1A 3VROA 1UUSA 2ZNDA 1KFUS 3KEVA 2LHIA 2MHHA 2GGZA 2JQ6A 3SG7A 1S3PA 4YRUA 3BXKA 1CDLA 1AVSA 1SNLA 4XJKB 4N1GA 2F3ZA 1CB1A 2KQ6A 1G4YR 4MN0A 3WHTB 3CZTX 1UHKA 4YGEB 3PFVA 1M63B 1FW4A 4PALA 5I8NA 3A4UB 1KFXS 4WRIA 1S5GZ 1UURA 1Y6WA 4ORCB 5BPJA 1IKUA 2BKHB 2KDHA 1BLQA 1WLMA 1G8IA 1CNPA 2MBXA 2K7BA 3OX6A 3CS1A 2LUXA 3TS5B 1EH2A 3D0YA 2K2FA 2JTZA 1NCZA 3BUOB 3NSOA 1AJ4A 1QVIZ 2JNXA 3GOFA 1JFJA 3EK4A 1NP8A 2JT0A 1HQVA 1MWNA 1PVAA 1YX8A 1QX2A 3H4SE 1CLLA 3AKBA 1QS7A 3EVRA 1CDPA 1N2DA 1DMOA 3BOWA 4OKHA 3SG3A 2AAOA 3DVMA 2G2BA 2EGDA 1A29A 2MJWB 1AJ5A 1XVJA 1SW8A 3NSLA 1MXEA 4MRXA 5IBWA 1W7JB 5AFPA 3TUYB 2WCFA 3CR2A 1QTXA 1XFVO 1A2XA 1KK7Z 1L2OC 1Y1AA 4PHMA 1EG4A 2NXQA 2VRGA 1ZMZA 1TNXA 3SIBA 1SKTA 3CWGA 1MQ1A 4CLNA 1F54A 4WQ3A 5HLVA 1K90D 3F45A 4PDZA 1IGVA 2JULA 2ZNEA 5DKNA 2K2AA 2MRDA 2BECA 1TNQA 4U8DA 1QASA 1BU3A 1XK4A 1OZOA 3FWBA 2EC6B 3CR4X 4GFTA 1H4BA 1YX7A 2P6BB 2LP2A 4QJ3B 5DKRA 1FPWA 1RTP1 1SCMC 2LVIA 2G9BA 3KO0A 1BF5A 1K94A 2NCPA 1QXPA 2JZIA 2FCEA 2WC8A 3JTDC 2LCPA 3KHEA 1CMFA 1OQPA 1TTXA 1CDNA 2KI4C 1K95A 1E8AA 1CFCA 1DJXA 1DJYA 1C7WA 3SIAA 3VRQA 1K8UA 5AXIA 3WNXB 4BY5A 3TDUA 2GV5A 2OS8B 4P2YB 5AEQA 4YGBB 1KWOC 2M3WA 2PASA 3O6BA 1DGUA 4YI8A 1V1FA 2CTNA 1U5IA 3IF7A 4ZCVA 2R2IA 3WXAA 4YGCB 4TNCA 2LV7A 5I2OA 3PSRA 2LE9B 4JPZB 2M1KB 1UHHA 4HREE 2M1UA 2FCDA 1IQ3A 2QACA 3IQOA 1JF0A 1ZUZA 2JOJA 4NDDA 1QIVA 2ZN9A 1FI6A 3NSIA 1BG1A 1RK9A 1RFJA 2OTGB 1QLKA 2F33A 1YUUA 3NSKA 5HKZA 2BL0C 1M46A 2BCXA 1TOPA 1JF2A 1IJ6A 1RJVA 2KFFA 2KNEA 1KK8B 2M0RA 2V53A 3I5IB 1C07A 2E6WA 3SJSA 4MLWA 4DS7A 1RROA 1A4PA 1S5GY 2LMUA 4GBAA 4NQGA 2JWWA 4MRYA 3WHUB 1M31A 1PK0D 4PHKA 4UPGA 5G08A 1FI5A 2BBNA 3I5GB 1OMRA 1YRUB 5GQQC 2F8PA 3VRPA 5AERA 1J1DA 1OMVA 2K61A 3NXAA 1XFWO 5CSIA 2KGBC 1B4CA 3CTNA 2LVJA 1WLZA 1TN4A 2RGIA 3O78A 2M29A 1BJFA 2LLSA 3SG6A 1GQMA 2LC5A 1BMOA 4ORBB 2F2OA 2MAZA 2M7NA 5HLOA 1CKKA 1BR4B 1DJWA 1SMGA 3VGOA 2FJUB 1UWOA 2O5GA 1NYAA 2HQWA 3TS5C 4AQJA 1WY9A 1W7IB 1SL7A 2KI6D 5CSNA 1YVHA 1PVBA 1K96A 1M45A 2CT9A 4GNKB 4IL1A 5FYXA 1XFYO 2KAVA 4ETOA 2NCOA 1WDCB 2PRUA 1JC2A 3PATA 1SY9A 4GAOA 4M2PA 1KK7Y 1JSAA 3M0WA 1ZACA 4YBHB 1SPYA 4ORAB 4PHJA 1NPQA 1NSHA 2L51A 2KYCA 3TUYC 1JWDA 2B1UA 3I5HB 2KHNA 3TDIA 2COLB 4AOMA 2I94A 1F4OA 3I5FB 1QJTA 4C0JA 2PALA 4R1EA 1DF0B 2LM5A 2L98A 1NX0A 3PALA 3C1VA 4DRWA 1N65A 1WRKA 1GGZA 2M7LA 1PSRA 5HKYA 1F8HA 3MSEB 2TN4A 2AMIA 1AK8A 1PULA 3RLZA 2KFHA 4DIRA 2EC6C 2PVBA 3QRXA 1KSMA 1OE9B 2M8UA 2JXLA 4HRGA 2OPOA 2ZRSA 2HQ8A 1Y1XA 1S36A 1NX1A 2NZ0A 3DVEA 3GK2A 1J1EA 4P5OE 4PE4A 2BCAA 2E30A 2NLNA 4USLA 3LLEA 5HKWA 4WQ2A 2LHLA 2KSPA 1B8LA 1BODA 2WNDA 1DGVA 1K9UA 1CFFA 1DJIA 1MHOA 2WCBA 4OVNF 1QATA 1IQ5A 2D8NA 1N0YA 1R2UA 3CGAA 4I5NB 2OS8C 2JC2A 1CLBA 1K93D 1CDMA 2F2PA 2ISDA 1ZOTB 1BT6A 1UHIA 4N1FA 4JWQA 1OSAA 3DD4A 4I5JA 3ZWHA 2L5XB 2KAXA 3DF0A 3FS7A 2IS9A 2KI6C 3GK1A 1PALA 4FQOA 4MZKA 3HCMA 3BUXB 1NCXA 3JVTB 4DCKA 1B7TZ 3D10A 2Y1NA 3VRRA 1EJ3A 2HETA 1EG3A 4MVFA 3LCPC 3SG5A 1TCFA 5ER5A 1CM4A 1J7RA 1LA0A 2KQYA 2OTGC 1DJZA 4GUKA 4PHNA 1F4QA 3E3RA 1FBVA 3GK4X 1PSBA 1A75B 2LMVA 2LVKA 3I5IC 1KK8C 1MUXA 4N5XA 2H61C 2O60A 4ICBA 1L7ZA 2HPSA 2KOTA 2L2EA 2ZN8A 1WRLA 4OV2A 1LINA 1LKJA 3PN7B 2SCPA 3PLFB 3I5GC 1OOJA 4ZCUA 3KF9A 1UP5A 3LK1A 2EHBA 4PE0A 5F6TA 1QX5B 3KPXA 4OCIA 1Q80A 4NDBA 5D7FA 4CIDA 3TZ1A 1CFPA 1SRAA 1XFUO 4GGNA 4M2OA 1J55A 1R6PA 1TNWA 1CFDA 2CXJA 2H61A 1SK6D 5DKQA 4C0LA 1A03A 1NCYA 2H2KA 3EK8A 2DOQA 4PE7A 2K7CA 2LLTA 5K89A 1IG5A 1K9KA 3RM1A 1EL4A 2K8MB 2HF5A 1QVIY 1DJHA 1HT9A 1WDCC 1SYMA 2SASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZJ A;  5TNC A;  1DJG A;  4AQI A;  1MXL C;  1S1E A;  1SR6 C;  1KSO A;  2JPT A;  2M9G A;  3EVV A;  2JNF A;  2JT3 A;  1YUS A;  4OR9 B;  2JXC A;  2LLU A;  3ICB A;  4JQ0 D;  2WOR A;  2CNP A;  2PMY A;  4NDC A;  4XJK A;  4HSZ A;  1DVI A;  2BE4 A;  2I7A A;  3CR5 X;  2K0J A;  2L50 A;  5B8I B;  2LNK A;  2LAP A;  1AUI B;  3I5H C;  1MF8 B;  2Y1M A;  3I5F C;  1SL8 A;  2KBM A;  1SR6 B;  3BYA A;  1UHJ A;  2L0P A;  2MA2 A;  4MBE A;  2BCB A;  1KFU L;  3O2P A;  4A4C A;  4DUQ A;  2QPT A;  1GGW A;  2WCE A;  5KSZ A;  1DTL A;  1QV0 A;  4MZL A;  1IRJ A;  2KBI A;  2KFG A;  2FOT A;  3OB2 B;  1D1O A;  1XFX O;  2BBM A;  1K9P A;  3IQQ A;  1G33 A;  1DT7 B;  3DVK A;  1CTR A;  1UHN A;  3AKA A;  3D0Y B;  4M2Q A;  4D1E A;  3SG4 A;  1KFX L;  2F3Y A;  2BE6 A;  1YR5 A;  4GGF C;  4Q04 A;  1C7V A;  3AAK A;  5KTY A;  1MR8 A;  2ZFD A;  5J3X A;  1NX3 A;  3EKJ A;  2LVV A;  1DF0 A;  5JJG A;  3BOW B;  1X02 A;  4CFR A;  2BKI B;  1S6C A;  5CPV A;  1IH0 A;  3FIA A;  1XK4 C;  2A4J A;  1B7T Y;  1OMD A;  3BUW B;  1SCV A;  3HX4 A;  4F0Z B;  1RWY A;  1IJ5 A;  5I2L A;  2K7O A;  4YGD B;  3EKH A;  2MLE C;  1ZFS A;  1Y1U A;  4GGF A;  2CCM A;  1NIW A;  1M39 A;  1QLS A;  1TCO B;  2I18 A;  3JVT C;  3OHM B;  4FTG A;  4MSP A;  1YVL A;  1ALV A;  2ZRT A;  4BY4 A;  2LMT A;  5HYD A;  5D69 A;  1K2H A;  5CSJ A;  1KQM C;  1FF1 A;  1XYD A;  3VRN A;  1B1G A;  1JBA A;  1XO5 A;  3A8R A;  1F71 A;  3LK0 A;  1IWQ A;  2Y5I A;  3OB1 B;  4L9M A;  2Q4U A;  5I2Q A;  4CPV A;  2Y4Q A;  2KGR A;  3BQ3 A;  1YUR A;  1L2O B;  3DVJ A;  4PCW A;  3EVU A;  1J7O A;  1CM1 A;  1S26 D;  2I2R E;  3BUM B;  3PN7 C;  4MEW A;  1TRF A;  1NWD A;  4C0K A;  1SBJ A;  1YTZ C;  1KQM B;  2WOS A;  2L4I A;  1ALW A;  1LVC D;  2LUC A;  2LAN A;  3AAJ A;  1YUT A;  4XYN A;  4A4B A;  1NUB A;  3O4Y A;  1J7Q A;  1NX2 A;  1S6I A;  4E68 A;  1CLM A;  5JOL A;  1EXR A;  2KAY A;  2GGM A;  1U5I B;  2JT8 A;  2M97 A;  5AAN A;  1SCM B;  4QJ4 B;  4I5K A;  1A75 A;  2M49 B;  5CSF A;  1OZS A;  2JRF A;  3JTD B;  3BUN B;  1B9A A;  1XFZ O;  2KI4 B;  3ZNI A;  3DF0 B;  1PRW A;  4I5L B;  1KCY A;  5ER4 X;  1B8C A;  1F70 A;  3SG2 A;  3FWC A;  1B47 A;  1BR1 B;  3LL8 B;  1VRK A;  1LA3 A;  1TNP A;  2PSR A;  1JFK A;  3PM8 A;  5PAL A;  2MLF C;  2CBL A;  1SL9 A;  1KWO B;  4GPL B;  1BOC A;  1ODB A;  1CMG A;  1AHR A;  2JU0 A;  1LXF C;  3CLN A;  5KU1 A;  3TDZ A;  4YI9 A;  4CFQ A;  2JTT A;  3K21 A;  2L4H A;  1XA5 A;  4QJ5 B;  2K7D A;  1KQV A;  3EK7 A;  1F55 A;  2KYF A;  1J7P A;  1QV1 A;  1WRZ A;  1GJY A;  1V1G A;  2AUC A;  1QIW A;  3OX5 A;  1S6J A;  1H8B A;  1REC A;  1YRT B;  1QX7 A;  2LP3 A;  4YGA A;  1JUO A;  1Y0V H;  1AP4 A;  4HRH A;  1TIZ A;  2BL0 B;  2ZKM X;  2Q91 A;  1B8R A;  3OP0 A;  4PE1 A;  3VRO A;  1UUS A;  2ZND A;  1KFU S;  3KEV A;  2LHI A;  2MHH A;  2GGZ A;  2JQ6 A;  3SG7 A;  1S3P A;  4YRU A;  3BXK A;  1CDL A;  1AVS A;  1SNL A;  4XJK B;  4N1G A;  2F3Z A;  1CB1 A;  2KQ6 A;  1G4Y R;  4MN0 A;  3WHT B;  3CZT X;  1UHK A;  4YGE B;  3PFV A;  1M63 B;  1FW4 A;  4PAL A;  5I8N A;  3A4U B;  1KFX S;  4WRI A;  1S5G Z;  1UUR A;  1Y6W A;  4ORC B;  5BPJ A;  1IKU A;  2BKH B;  2KDH A;  1BLQ A;  1WLM A;  1G8I A;  1CNP A;  2MBX A;  2K7B A;  3OX6 A;  3CS1 A;  2LUX A;  3TS5 B;  1EH2 A;  3D0Y A;  2K2F A;  2JTZ A;  1NCZ A;  3BUO B;  3NSO A;  1AJ4 A;  1QVI Z;  2JNX A;  3GOF A;  1JFJ A;  3EK4 A;  1NP8 A;  2JT0 A;  1HQV A;  1MWN A;  1PVA A;  1YX8 A;  1QX2 A;  3H4S E;  1CLL A;  3AKB A;  1QS7 A;  3EVR A;  1CDP A;  1N2D A;  1DMO A;  3BOW A;  4OKH A;  3SG3 A;  2AAO A;  3DVM A;  2G2B A;  2EGD A;  1A29 A;  2MJW B;  1AJ5 A;  1XVJ A;  1SW8 A;  3NSL A;  1MXE A;  4MRX A;  5IBW A;  1W7J B;  5AFP A;  3TUY B;  2WCF A;  3CR2 A;  1QTX A;  1XFV O;  1A2X A;  1KK7 Z;  1L2O C;  1Y1A A;  4PHM A;  1EG4 A;  2NXQ A;  2VRG A;  1ZMZ A;  1TNX A;  3SIB A;  1SKT A;  3CWG A;  1MQ1 A;  4CLN A;  1F54 A;  4WQ3 A;  5HLV A;  1K90 D;  3F45 A;  4PDZ A;  1IGV A;  2JUL A;  2ZNE A;  5DKN A;  2K2A A;  2MRD A;  2BEC A;  1TNQ A;  4U8D A;  1QAS A;  1BU3 A;  1XK4 A;  1OZO A;  3FWB A;  2EC6 B;  3CR4 X;  4GFT A;  1H4B A;  1YX7 A;  2P6B B;  2LP2 A;  4QJ3 B;  5DKR A;  1FPW A;  1RTP 1;  1SCM C;  2LVI A;  2G9B A;  3KO0 A;  1BF5 A;  1K94 A;  2NCP A;  1QXP A;  2JZI A;  2FCE A;  2WC8 A;  3JTD C;  2LCP A;  3KHE A;  1CMF A;  1OQP A;  1TTX A;  1CDN A;  2KI4 C;  1K95 A;  1E8A A;  1CFC A;  1DJX A;  1DJY A;  1C7W A;  3SIA A;  3VRQ A;  1K8U A;  5AXI A;  3WNX B;  4BY5 A;  3TDU A;  2GV5 A;  2OS8 B;  4P2Y B;  5AEQ A;  4YGB B;  1KWO C;  2M3W A;  2PAS A;  3O6B A;  1DGU A;  4YI8 A;  1V1F A;  2CTN A;  1U5I A;  3IF7 A;  4ZCV A;  2R2I A;  3WXA A;  4YGC B;  4TNC A;  2LV7 A;  5I2O A;  3PSR A;  2LE9 B;  4JPZ B;  2M1K B;  1UHH A;  4HRE E;  2M1U A;  2FCD A;  1IQ3 A;  2QAC A;  3IQO A;  1JF0 A;  1ZUZ A;  2JOJ A;  4NDD A;  1QIV A;  2ZN9 A;  1FI6 A;  3NSI A;  1BG1 A;  1RK9 A;  1RFJ A;  2OTG B;  1QLK A;  2F33 A;  1YUU A;  3NSK A;  5HKZ A;  2BL0 C;  1M46 A;  2BCX A;  1TOP A;  1JF2 A;  1IJ6 A;  1RJV A;  2KFF A;  2KNE A;  1KK8 B;  2M0R A;  2V53 A;  3I5I B;  1C07 A;  2E6W A;  3SJS A;  4MLW A;  4DS7 A;  1RRO A;  1A4P A;  1S5G Y;  2LMU A;  4GBA A;  4NQG A;  2JWW A;  4MRY A;  3WHU B;  1M31 A;  1PK0 D;  4PHK A;  4UPG A;  5G08 A;  1FI5 A;  2BBN A;  3I5G B;  1OMR A;  1YRU B;  5GQQ C;  2F8P A;  3VRP A;  5AER A;  1J1D A;  1OMV A;  2K61 A;  3NXA A;  1XFW O;  5CSI A;  2KGB C;  1B4C A;  3CTN A;  2LVJ A;  1WLZ A;  1TN4 A;  2RGI A;  3O78 A;  2M29 A;  1BJF A;  2LLS A;  3SG6 A;  1GQM A;  2LC5 A;  1BMO A;  4ORB B;  2F2O A;  2MAZ A;  2M7N A;  5HLO A;  1CKK A;  1BR4 B;  1DJW A;  1SMG A;  3VGO A;  2FJU B;  1UWO A;  2O5G A;  1NYA A;  2HQW A;  3TS5 C;  4AQJ A;  1WY9 A;  1W7I B;  1SL7 A;  2KI6 D;  5CSN A;  1YVH A;  1PVB A;  1K96 A;  1M45 A;  2CT9 A;  4GNK B;  4IL1 A;  5FYX A;  1XFY O;  2KAV A;  4ETO A;  2NCO A;  1WDC B;  2PRU A;  1JC2 A;  3PAT A;  1SY9 A;  4GAO A;  4M2P A;  1KK7 Y;  1JSA A;  3M0W A;  1ZAC A;  4YBH B;  1SPY A;  4ORA B;  4PHJ A;  1NPQ A;  1NSH A;  2L51 A;  2KYC A;  3TUY C;  1JWD A;  2B1U A;  3I5H B;  2KHN A;  3TDI A;  2COL B;  4AOM A;  2I94 A;  1F4O A;  3I5F B;  1QJT A;  4C0J A;  2PAL A;  4R1E A;  1DF0 B;  2LM5 A;  2L98 A;  1NX0 A;  3PAL A;  3C1V A;  4DRW A;  1N65 A;  1WRK A;  1GGZ A;  2M7L A;  1PSR A;  5HKY A;  1F8H A;  3MSE B;  2TN4 A;  2AMI A;  1AK8 A;  1PUL A;  3RLZ A;  2KFH A;  4DIR A;  2EC6 C;  2PVB A;  3QRX A;  1KSM A;  1OE9 B;  2M8U A;  2JXL A;  4HRG A;  2OPO A;  2ZRS A;  2HQ8 A;  1Y1X A;  1S36 A;  1NX1 A;  2NZ0 A;  3DVE A;  3GK2 A;  1J1E A;  4P5O E;  4PE4 A;  2BCA A;  2E30 A;  2NLN A;  4USL A;  3LLE A;  5HKW A;  4WQ2 A;  2LHL A;  2KSP A;  1B8L A;  1BOD A;  2WND A;  1DGV A;  1K9U A;  1CFF A;  1DJI A;  1MHO A;  2WCB A;  4OVN F;  1QAT A;  1IQ5 A;  2D8N A;  1N0Y A;  1R2U A;  3CGA A;  4I5N B;  2OS8 C;  2JC2 A;  1CLB A;  1K93 D;  1CDM A;  2F2P A;  2ISD A;  1ZOT B;  1BT6 A;  1UHI A;  4N1F A;  4JWQ A;  1OSA A;  3DD4 A;  4I5J A;  3ZWH A;  2L5X B;  2KAX A;  3DF0 A;  3FS7 A;  2IS9 A;  2KI6 C;  3GK1 A;  1PAL A;  4FQO A;  4MZK A;  3HCM A;  3BUX B;  1NCX A;  3JVT B;  4DCK A;  1B7T Z;  3D10 A;  2Y1N A;  3VRR A;  1EJ3 A;  2HET A;  1EG3 A;  4MVF A;  3LCP C;  3SG5 A;  1TCF A;  5ER5 A;  1CM4 A;  1J7R A;  1LA0 A;  2KQY A;  2OTG C;  1DJZ A;  4GUK A;  4PHN A;  1F4Q A;  3E3R A;  1FBV A;  3GK4 X;  1PSB A;  1A75 B;  2LMV A;  2LVK A;  3I5I C;  1KK8 C;  1MUX A;  4N5X A;  2H61 C;  2O60 A;  4ICB A;  1L7Z A;  2HPS A;  2KOT A;  2L2E A;  2ZN8 A;  1WRL A;  4OV2 A;  1LIN A;  1LKJ A;  3PN7 B;  2SCP A;  3PLF B;  3I5G C;  1OOJ A;  4ZCU A;  3KF9 A;  1UP5 A;  3LK1 A;  2EHB A;  4PE0 A;  5F6T A;  1QX5 B;  3KPX A;  4OCI A;  1Q80 A;  4NDB A;  5D7F A;  4CID A;  3TZ1 A;  1CFP A;  1SRA A;  1XFU O;  4GGN A;  4M2O A;  1J55 A;  1R6P A;  1TNW A;  1CFD A;  2CXJ A;  2H61 A;  1SK6 D;  5DKQ A;  4C0L A;  1A03 A;  1NCY A;  2H2K A;  3EK8 A;  2DOQ A;  4PE7 A;  2K7C A;  2LLT A;  5K89 A;  1IG5 A;  1K9K A;  3RM1 A;  1EL4 A;  2K8M B;  2HF5 A;  1QVI Y;  1DJH A;  1HT9 A;  1WDC C;  1SYM A;  2SAS A; 
#chains in the Genus database with same CATH topology
 4MZJ A;  1OW4 A;  1DJG A;  5TNC A;  4AQI A;  1MXL C;  3CZ0 A;  1S1E A;  1SR6 C;  1KSO A;  2JPT A;  2M9G A;  3EVV A;  2JNF A;  2JT3 A;  1YUS A;  4OR9 B;  2JXC A;  2LLU A;  3ICB A;  4JQ0 D;  2WOR A;  3FE6 A;  2CNP A;  2PMY A;  4NDC A;  4XJK A;  4HSZ A;  1DVI A;  2BE4 A;  2I7A A;  5D3O A;  3CR5 X;  2K0J A;  2L50 A;  5B8I B;  2LNK A;  2LAP A;  1AUI B;  3I5H C;  1MF8 B;  2Y1M A;  3D73 A;  3I5F C;  1SL8 A;  2KBM A;  1SR6 B;  3BYA A;  1UHJ A;  2L0P A;  2MA2 A;  4MBE A;  2BCB A;  1KFU L;  3O2P A;  4A4C A;  3DY9 A;  2QPT A;  4DUQ A;  2WCE A;  1GGW A;  5KSZ A;  1DTL A;  1QV0 A;  4MZL A;  1OOF A;  1IRJ A;  2KBI A;  2KFG A;  2FOT A;  3OB2 B;  1D1O A;  1XFX O;  2BBM A;  1K9P A;  3IQQ A;  1G33 A;  1DT7 B;  3DVK A;  1CTR A;  3K1E A;  1UHN A;  3AKA A;  3D0Y B;  4M2Q A;  3O4X A;  4D1E A;  3SG4 A;  1KFX L;  2F3Y A;  2BE6 A;  1YR5 A;  4GGF C;  4Q04 A;  5HL1 A;  1C7V A;  3AAK A;  5KTY A;  1MR8 A;  2ZFD A;  5J3X A;  4PT1 A;  1NX3 A;  3EKJ A;  2LVV A;  1DF0 A;  3V2L A;  5JJG A;  3BOW B;  1X02 A;  4CFR A;  1C3Y A;  2BKI B;  1S6C A;  5CPV A;  1IH0 A;  3FIA A;  1XK4 C;  2A4J A;  1B7T Y;  1OMD A;  3BUW B;  3NGV A;  1SCV A;  3HX4 A;  3R1V A;  4F0Z B;  1RWY A;  1IJ5 A;  5I2L A;  2KPH A;  2K7O A;  4YGD B;  3EKH A;  2MLE C;  1ZFS A;  3CZ2 A;  3UNW A;  1Y1U A;  4GGF A;  1NIW A;  1DQE A;  1M39 A;  1QLS A;  1TCO B;  2CCM A;  2I18 A;  3JVT C;  3OHM B;  4FTG A;  4MSP A;  1YVL A;  1ALV A;  2ZRT A;  4BY4 A;  2LMT A;  2L2C A;  5HYD A;  5D69 A;  3R1P A;  1K2H A;  5CSJ A;  1P28 A;  1KQM C;  1FF1 A;  1XYD A;  3VRN A;  1B1G A;  1JBA A;  1XO5 A;  3A8R A;  1F71 A;  3LK0 A;  1IWQ A;  3N7H A;  2Y5I A;  3OB1 B;  4L9M A;  2Q4U A;  5I2Q A;  4CPV A;  2WCL A;  2Y4Q A;  2KGR A;  3BQ3 A;  1YUR A;  1L2O B;  2FJY A;  3DVJ A;  4PCW A;  3EVU A;  1J7O A;  1CM1 A;  1S26 D;  2I2R E;  3BUM B;  1T14 A;  3PN7 C;  1TRF A;  1NWD A;  4MEW A;  4C0K A;  1SBJ A;  1YTZ C;  1KQM B;  2WOS A;  2L4I A;  1ALW A;  1LVC D;  2LUC A;  2LAN A;  3AAJ A;  1YUT A;  4XYN A;  4A4B A;  1NUB A;  3CZ1 A;  3O4Y A;  1J7Q A;  1NX2 A;  1S6I A;  3DYE A;  4E68 A;  1CLM A;  5JOL A;  3BJH A;  2QEV A;  1EXR A;  2KAY A;  3UO9 A;  3BFB A;  2GGM A;  1U5I B;  2H8V A;  2JT8 A;  2M97 A;  5AAN A;  1SCM B;  4QJ4 B;  4I5K A;  1A75 A;  2M49 B;  5CSF A;  1OZS A;  2JRF A;  3JTD B;  3BUN B;  1B9A A;  1XFZ O;  2KI4 B;  3ZNI A;  3DF0 B;  1PRW A;  4I5L B;  1KCY A;  5ER4 X;  1B8C A;  1F70 A;  3SG2 A;  3FWC A;  1B47 A;  1BR1 B;  2WCK A;  3LL8 B;  1VRK A;  3R72 A;  1LA3 A;  1TNP A;  2PSR A;  1JFK A;  3PM8 A;  5PAL A;  2MLF C;  2CBL A;  1SL9 A;  3IVT A;  1KWO B;  3S0F A;  4GPL B;  1BOC A;  1ODB A;  1CMG A;  2BNX A;  1AHR A;  2JU0 A;  1LXF C;  3CLN A;  3VB1 A;  5KU1 A;  3TDZ A;  4YI9 A;  4CFQ A;  1TUZ A;  2JTT A;  3CYZ A;  3K21 A;  2L4H A;  3QME A;  1XA5 A;  4QJ5 B;  2K7D A;  1KQV A;  3EK7 A;  1F55 A;  2KYF A;  1J7P A;  1QV1 A;  1WRZ A;  1GJY A;  1V1G A;  2AUC A;  1DC1 A;  1QIW A;  3OX5 A;  1S6J A;  2GTE A;  1REC A;  1YRT B;  1H8B A;  1QX7 A;  2LP3 A;  4YGA A;  1JUO A;  1Y0V H;  1AP4 A;  3B6X A;  4HRH A;  1TIZ A;  2BL0 B;  3RZS A;  2ZKM X;  2Q91 A;  1B8R A;  3OP0 A;  4PE1 A;  3S0E A;  3VRO A;  1UUS A;  2ZND A;  1KFU S;  3CDN A;  3KEV A;  2LHI A;  2QDI A;  2MHH A;  2GGZ A;  2JQ6 A;  3SG7 A;  1S3P A;  4YRU A;  3BXK A;  1CDL A;  1AVS A;  1SNL A;  4XJK B;  4N1G A;  2F3Z A;  1CB1 A;  2KQ6 A;  1G4Y R;  4MN0 A;  3WHT B;  3R1O A;  3CZT X;  1UHK A;  4YGE B;  3PFV A;  3BFA A;  1M63 B;  1FW4 A;  4PAL A;  5I8N A;  3A4U B;  1IIO A;  2KLE A;  1KFX S;  4WRI A;  1S5G Z;  1UUR A;  1Y6W A;  1SSE B;  4ORC B;  2QEO A;  5BPJ A;  1IKU A;  2BKH B;  2KDH A;  1BLQ A;  1WLM A;  1G8I A;  1CNP A;  2MBX A;  2K7B A;  3OX6 A;  3CS1 A;  2LUX A;  3TS5 B;  1Z4H A;  1EH2 A;  3D0Y A;  2K2F A;  2JTZ A;  1NCZ A;  3BUO B;  3NSO A;  1AJ4 A;  1QVI Z;  2JNX A;  3GOF A;  1JFJ A;  3EK4 A;  1NP8 A;  2JT0 A;  3PM2 A;  1HQV A;  1MWN A;  1PVA A;  1YX8 A;  1QX2 A;  2JPO A;  3B86 A;  3H4S E;  1CLL A;  3AKB A;  1QS7 A;  3EVR A;  1CDP A;  1N2D A;  1DMO A;  3BOW A;  4OKH A;  3SG3 A;  2AAO A;  3OGN A;  3B88 A;  3DVM A;  2G2B A;  2EGD A;  1A29 A;  2MJW B;  1AJ5 A;  1XVJ A;  1SW8 A;  3NSL A;  1MXE A;  4MRX A;  5IBW A;  1W7J B;  5AFP A;  3TUY B;  2WCF A;  3CR2 A;  1QTX A;  1XFV O;  1A2X A;  1KK7 Z;  1L2O C;  1Y1A A;  4PHM A;  1EG4 A;  2NXQ A;  2VRG A;  1ZMZ A;  1TNX A;  3SIB A;  1SKT A;  3CWG A;  1MQ1 A;  4CLN A;  1F54 A;  4WQ3 A;  5HLV A;  2K60 A;  1K90 D;  3F45 A;  4PDZ A;  1IGV A;  2JUL A;  2ZNE A;  5DKN A;  2K2A A;  2MRD A;  2BEC A;  1TNQ A;  4U8D A;  1QAS A;  1BU3 A;  1XK4 A;  1OZO A;  2WC6 A;  3FWB A;  2EC6 B;  3CR4 X;  4GFT A;  1H4B A;  1YX7 A;  2P6B B;  2LP2 A;  4QJ3 B;  5DKR A;  1FPW A;  1RTP 1;  1SCM C;  2LVI A;  2G9B A;  3KO0 A;  1BF5 A;  1K94 A;  2NCP A;  1QXP A;  2JZI A;  2FCE A;  2WC8 A;  3JTD C;  2LCP A;  3KHE A;  1CMF A;  1OQP A;  1TTX A;  3D76 A;  2KI4 C;  1CDN A;  1K95 A;  1E8A A;  1CFC A;  1DJX A;  1DJY A;  1C7W A;  3SIA A;  3VRQ A;  1K8U A;  2BAP A;  5AXI A;  3WNX B;  4BY5 A;  3TDU A;  1DEK A;  2GV5 A;  2OS8 B;  4P2Y B;  1TUJ A;  4FQT A;  2P71 A;  5AEQ A;  2PYQ A;  1W9Z A;  4YGB B;  1KWO C;  2M3W A;  2PAS A;  5FI2 A;  3BFH A;  3O6B A;  1DGU A;  4YI8 A;  1V1F A;  2CTN A;  1U5I A;  3IF7 A;  4ZCV A;  2R2I A;  3WXA A;  4YGC B;  4TNC A;  2LV7 A;  5I2O A;  3PSR A;  2LE9 B;  4JPZ B;  2M1K B;  3EG5 B;  1UHH A;  4HRE E;  2M1U A;  2FCD A;  2ERB A;  1IQ3 A;  2QAC A;  3D74 A;  3IQO A;  2WCM A;  1JF0 A;  1ZUZ A;  2JOJ A;  4NDD A;  1QIV A;  2ZN9 A;  1FI6 A;  2WC5 A;  3NSI A;  5EL2 A;  1BG1 A;  1RK9 A;  1RFJ A;  3SS5 A;  2OTG B;  1QLK A;  2F33 A;  1YUU A;  3NSK A;  5HKZ A;  2BL0 C;  1M46 A;  4INX A;  2BCX A;  1TOP A;  1JF2 A;  1IJ6 A;  3SS4 A;  1RJV A;  2KFF A;  2KNE A;  1KK8 B;  2M0R A;  2V53 A;  3I5I B;  1C07 A;  2E6W A;  3SJS A;  1OOH A;  4MLW A;  4DS7 A;  1RRO A;  1A4P A;  1S5G Y;  2LMU A;  4GBA A;  4NQG A;  2JWW A;  4MRY A;  3WHU B;  3NHT A;  1M31 A;  1PK0 D;  4PHK A;  4UPG A;  5G08 A;  1FI5 A;  3OBV A;  3L4A A;  2YGU A;  2BBN A;  3I5G B;  1OMR A;  1YRU B;  3L4L A;  5GQQ C;  2F8P A;  3VRP A;  5AER A;  1J1D A;  1OMV A;  2K61 A;  3NXA A;  1XFW O;  5CSI A;  2KGB C;  3S0A A;  1B4C A;  3CTN A;  2LVJ A;  1WLZ A;  1TN4 A;  3D77 A;  2RGI A;  3O78 A;  2M29 A;  1BJF A;  2LLS A;  3SG6 A;  1GQM A;  2LC5 A;  1BMO A;  4ORB B;  2F2O A;  2MAZ A;  2M7N A;  5HLO A;  1CKK A;  1BR4 B;  1DJW A;  1SMG A;  3VGO A;  2FJU B;  1UWO A;  2O5G A;  1NYA A;  2HQW A;  3TS5 C;  5FI6 A;  1WY9 A;  1W7I B;  1SL7 A;  2KI6 D;  5CSN A;  4AQJ A;  1YVH A;  1PVB A;  1K96 A;  1M45 A;  2CT9 A;  4GNK B;  4IL1 A;  5FYX A;  1XFY O;  5I94 A;  2KAV A;  4ETO A;  2NCO A;  1WDC B;  2PRU A;  1JC2 A;  3PAT A;  1SY9 A;  4GAO A;  4M2P A;  1KK7 Y;  1JSA A;  3M0W A;  1ZAC A;  4YBH B;  1SPY A;  4ORA B;  4PHJ A;  1NPQ A;  1NSH A;  2L51 A;  2KYC A;  3TUY C;  1JWD A;  2B1U A;  3I5H B;  2KHN A;  3D75 A;  2COL B;  3TDI A;  2I94 A;  4AOM A;  1F4O A;  3I5F B;  1QJT A;  1GM0 A;  4JKT A;  4C0J A;  2PAL A;  4R1E A;  1DF0 B;  2LM5 A;  2L98 A;  1NX0 A;  3B87 A;  3PAL A;  3C1V A;  4DRW A;  1N65 A;  1WRK A;  1GGZ A;  2M7L A;  1OOG A;  1DEL A;  1PSR A;  2QEH A;  5HKY A;  1F8H A;  3MSE B;  2TN4 A;  2AMI A;  1AK8 A;  3PJI A;  1PUL A;  3RLZ A;  2KFH A;  4DIR A;  2EC6 C;  5FI7 A;  1Z2C B;  2PVB A;  3QRX A;  1KSM A;  1OE9 B;  2M8U A;  1C3Z A;  2JXL A;  4HRG A;  2OPO A;  3NHI A;  2ZRS A;  2HQ8 A;  1Y1X A;  1S36 A;  1NX1 A;  1ORG A;  2NZ0 A;  3S0B A;  3DVE A;  3GK2 A;  1QWV A;  1J1E A;  4P5O E;  3S0D A;  4PE4 A;  2BCA A;  2E30 A;  2NLN A;  4USL A;  3LLE A;  5HKW A;  4WQ2 A;  2LHL A;  2KSP A;  1B8L A;  1BOD A;  2WND A;  1DGV A;  1K9U A;  1CFF A;  1DJI A;  1MHO A;  2WCB A;  4OVN F;  1QAT A;  1IQ5 A;  5DIC A;  2D8N A;  1N0Y A;  1R2U A;  3CGA A;  4I5N B;  2OS8 C;  2JC2 A;  4F7F A;  1CLB A;  4OZD A;  1K93 D;  3Q8I A;  1CDM A;  2WCJ A;  2F2P A;  2ISD A;  1TWO A;  2PQL A;  1ZOT B;  2P70 A;  1BT6 A;  1UHI A;  4N1F A;  4JWQ A;  1OSA A;  3DD4 A;  3DZT A;  4I5J A;  3ZWH A;  2L5X B;  2KAX A;  3DF0 A;  3FS7 A;  2IS9 A;  3D78 A;  2KI6 C;  3GK1 A;  1PAL A;  4FQO A;  4MZK A;  3HCM A;  3BUX B;  1XFR A;  1NCX A;  3JVT B;  4DCK A;  2QEB A;  1B7T Z;  3D10 A;  2Y1N A;  3VRR A;  1EJ3 A;  2HET A;  1EG3 A;  4MVF A;  3LCP C;  3SG5 A;  1TCF A;  3FE9 A;  5ER5 A;  1CM4 A;  1J7R A;  1LA0 A;  2KQY A;  2OTG C;  1DJZ A;  4GUK A;  4PHN A;  1F4Q A;  3CAB A;  1FBV A;  1LS8 A;  1PSB A;  3E3R A;  1A75 B;  3GK4 X;  2LMV A;  2LVK A;  3I5I C;  1KK8 C;  1MUX A;  4N5X A;  2H61 C;  2O60 A;  3DXL A;  4ICB A;  1L7Z A;  4INW A;  2HPS A;  3B7A A;  2KOT A;  2L2E A;  2ZN8 A;  1WRL A;  4OV2 A;  1LIN A;  1OOI X;  1LKJ A;  3PN7 B;  2SCP A;  3FE8 A;  3PLF B;  3S0G A;  2WCH A;  1OOJ A;  3I5G C;  4ZCU A;  3KF9 A;  1UP5 A;  3LK1 A;  3SS3 A;  2EHB A;  4IJ7 A;  4PE0 A;  5F6T A;  1QX5 B;  3KPX A;  4OCI A;  1Q80 A;  4NDB A;  4JD9 A;  5D7F A;  3TZ1 A;  4CID A;  1CFP A;  1SRA A;  1XFU O;  4GGN A;  4M2O A;  1J55 A;  1R6P A;  1TNW A;  4KYN A;  1CFD A;  2CXJ A;  3L47 A;  2H61 A;  1SK6 D;  5DKQ A;  4C0L A;  1A03 A;  2L5Y A;  1NCY A;  2H2K A;  3EK8 A;  2DOQ A;  4PE7 A;  2K7C A;  2LLT A;  2KLD A;  1IG5 A;  1K9K A;  3RM1 A;  1EL4 A;  5K89 A;  2K8M B;  2HF5 A;  1QVI Y;  1DJH A;  1HT9 A;  1WDC C;  1SYM A;  2SAS A; 
#chains in the Genus database with same CATH homology
 4MZJ A;  5TNC A;  1DJG A;  4AQI A;  1MXL C;  1S1E A;  1SR6 C;  1KSO A;  2JPT A;  2M9G A;  3EVV A;  2JNF A;  2JT3 A;  1YUS A;  4OR9 B;  2JXC A;  2LLU A;  3ICB A;  4JQ0 D;  2WOR A;  2CNP A;  2PMY A;  4NDC A;  4XJK A;  4HSZ A;  1DVI A;  2BE4 A;  2I7A A;  3CR5 X;  2K0J A;  2L50 A;  5B8I B;  2LNK A;  2LAP A;  1AUI B;  3I5H C;  1MF8 B;  2Y1M A;  3I5F C;  1SL8 A;  2KBM A;  1SR6 B;  3BYA A;  1UHJ A;  2L0P A;  2MA2 A;  4MBE A;  2BCB A;  1KFU L;  3O2P A;  4A4C A;  4DUQ A;  2QPT A;  1GGW A;  2WCE A;  5KSZ A;  1DTL A;  1QV0 A;  4MZL A;  1IRJ A;  2KBI A;  2KFG A;  2FOT A;  3OB2 B;  1D1O A;  1XFX O;  2BBM A;  1K9P A;  3IQQ A;  1G33 A;  1DT7 B;  3DVK A;  1CTR A;  1UHN A;  3AKA A;  3D0Y B;  4M2Q A;  4D1E A;  3SG4 A;  1KFX L;  2F3Y A;  2BE6 A;  1YR5 A;  4GGF C;  4Q04 A;  1C7V A;  3AAK A;  5KTY A;  1MR8 A;  2ZFD A;  5J3X A;  1NX3 A;  3EKJ A;  2LVV A;  1DF0 A;  5JJG A;  3BOW B;  1X02 A;  4CFR A;  2BKI B;  1S6C A;  5CPV A;  1IH0 A;  3FIA A;  1XK4 C;  2A4J A;  1B7T Y;  1OMD A;  3BUW B;  1SCV A;  3HX4 A;  4F0Z B;  1RWY A;  1IJ5 A;  5I2L A;  2K7O A;  4YGD B;  3EKH A;  2MLE C;  1ZFS A;  1Y1U A;  4GGF A;  2CCM A;  1NIW A;  1M39 A;  1QLS A;  1TCO B;  2I18 A;  3JVT C;  3OHM B;  4FTG A;  4MSP A;  1YVL A;  1ALV A;  2ZRT A;  4BY4 A;  2LMT A;  5HYD A;  5D69 A;  1K2H A;  5CSJ A;  1KQM C;  1FF1 A;  1XYD A;  3VRN A;  1B1G A;  1JBA A;  1XO5 A;  3A8R A;  1F71 A;  3LK0 A;  1IWQ A;  2Y5I A;  3OB1 B;  4L9M A;  2Q4U A;  5I2Q A;  4CPV A;  2Y4Q A;  2KGR A;  3BQ3 A;  1YUR A;  1L2O B;  3DVJ A;  4PCW A;  3EVU A;  1J7O A;  1CM1 A;  1S26 D;  2I2R E;  3BUM B;  3PN7 C;  4MEW A;  1TRF A;  1NWD A;  4C0K A;  1SBJ A;  1YTZ C;  1KQM B;  2WOS A;  2L4I A;  1ALW A;  1LVC D;  2LUC A;  2LAN A;  3AAJ A;  1YUT A;  4XYN A;  4A4B A;  1NUB A;  3O4Y A;  1J7Q A;  1NX2 A;  1S6I A;  4E68 A;  1CLM A;  5JOL A;  1EXR A;  2KAY A;  2GGM A;  1U5I B;  2JT8 A;  2M97 A;  5AAN A;  1SCM B;  4QJ4 B;  4I5K A;  1A75 A;  2M49 B;  5CSF A;  1OZS A;  2JRF A;  3JTD B;  3BUN B;  1B9A A;  1XFZ O;  2KI4 B;  3ZNI A;  3DF0 B;  1PRW A;  4I5L B;  1KCY A;  5ER4 X;  1B8C A;  1F70 A;  3SG2 A;  3FWC A;  1B47 A;  1BR1 B;  3LL8 B;  1VRK A;  1LA3 A;  1TNP A;  2PSR A;  1JFK A;  3PM8 A;  5PAL A;  2MLF C;  2CBL A;  1SL9 A;  1KWO B;  4GPL B;  1BOC A;  1ODB A;  1CMG A;  1AHR A;  2JU0 A;  1LXF C;  3CLN A;  5KU1 A;  3TDZ A;  4YI9 A;  4CFQ A;  2JTT A;  3K21 A;  2L4H A;  1XA5 A;  4QJ5 B;  2K7D A;  1KQV A;  3EK7 A;  1F55 A;  2KYF A;  1J7P A;  1QV1 A;  1WRZ A;  1GJY A;  1V1G A;  2AUC A;  1QIW A;  3OX5 A;  1S6J A;  1H8B A;  1REC A;  1YRT B;  1QX7 A;  2LP3 A;  4YGA A;  1JUO A;  1Y0V H;  1AP4 A;  4HRH A;  1TIZ A;  2BL0 B;  2ZKM X;  2Q91 A;  1B8R A;  3OP0 A;  4PE1 A;  3VRO A;  1UUS A;  2ZND A;  1KFU S;  3KEV A;  2LHI A;  2MHH A;  2GGZ A;  2JQ6 A;  3SG7 A;  1S3P A;  4YRU A;  3BXK A;  1CDL A;  1AVS A;  1SNL A;  4XJK B;  4N1G A;  2F3Z A;  1CB1 A;  2KQ6 A;  1G4Y R;  4MN0 A;  3WHT B;  3CZT X;  1UHK A;  4YGE B;  3PFV A;  1M63 B;  1FW4 A;  4PAL A;  5I8N A;  3A4U B;  1KFX S;  4WRI A;  1S5G Z;  1UUR A;  1Y6W A;  4ORC B;  5BPJ A;  1IKU A;  2BKH B;  2KDH A;  1BLQ A;  1WLM A;  1G8I A;  1CNP A;  2MBX A;  2K7B A;  3OX6 A;  3CS1 A;  2LUX A;  3TS5 B;  1EH2 A;  3D0Y A;  2K2F A;  2JTZ A;  1NCZ A;  3BUO B;  3NSO A;  1AJ4 A;  1QVI Z;  2JNX A;  3GOF A;  1JFJ A;  3EK4 A;  1NP8 A;  2JT0 A;  1HQV A;  1MWN A;  1PVA A;  1YX8 A;  1QX2 A;  3H4S E;  1CLL A;  3AKB A;  1QS7 A;  3EVR A;  1CDP A;  1N2D A;  1DMO A;  3BOW A;  4OKH A;  3SG3 A;  2AAO A;  3DVM A;  2G2B A;  2EGD A;  1A29 A;  2MJW B;  1AJ5 A;  1XVJ A;  1SW8 A;  3NSL A;  1MXE A;  4MRX A;  5IBW A;  1W7J B;  5AFP A;  3TUY B;  2WCF A;  3CR2 A;  1QTX A;  1XFV O;  1A2X A;  1KK7 Z;  1L2O C;  1Y1A A;  4PHM A;  1EG4 A;  2NXQ A;  2VRG A;  1ZMZ A;  1TNX A;  3SIB A;  1SKT A;  3CWG A;  1MQ1 A;  4CLN A;  1F54 A;  4WQ3 A;  5HLV A;  1K90 D;  3F45 A;  4PDZ A;  1IGV A;  2JUL A;  2ZNE A;  5DKN A;  2K2A A;  2MRD A;  2BEC A;  1TNQ A;  4U8D A;  1QAS A;  1BU3 A;  1XK4 A;  1OZO A;  3FWB A;  2EC6 B;  3CR4 X;  4GFT A;  1H4B A;  1YX7 A;  2P6B B;  2LP2 A;  4QJ3 B;  5DKR A;  1FPW A;  1RTP 1;  1SCM C;  2LVI A;  2G9B A;  3KO0 A;  1BF5 A;  1K94 A;  2NCP A;  1QXP A;  2JZI A;  2FCE A;  2WC8 A;  3JTD C;  2LCP A;  3KHE A;  1CMF A;  1OQP A;  1TTX A;  1CDN A;  2KI4 C;  1K95 A;  1E8A A;  1CFC A;  1DJX A;  1DJY A;  1C7W A;  3SIA A;  3VRQ A;  1K8U A;  5AXI A;  3WNX B;  4BY5 A;  3TDU A;  2GV5 A;  2OS8 B;  4P2Y B;  5AEQ A;  4YGB B;  1KWO C;  2M3W A;  2PAS A;  3O6B A;  1DGU A;  4YI8 A;  1V1F A;  2CTN A;  1U5I A;  3IF7 A;  4ZCV A;  2R2I A;  3WXA A;  4YGC B;  4TNC A;  2LV7 A;  5I2O A;  3PSR A;  2LE9 B;  4JPZ B;  2M1K B;  1UHH A;  4HRE E;  2M1U A;  2FCD A;  1IQ3 A;  2QAC A;  3IQO A;  1JF0 A;  1ZUZ A;  2JOJ A;  4NDD A;  1QIV A;  2ZN9 A;  1FI6 A;  3NSI A;  1BG1 A;  1RK9 A;  1RFJ A;  2OTG B;  1QLK A;  2F33 A;  1YUU A;  3NSK A;  5HKZ A;  2BL0 C;  1M46 A;  2BCX A;  1TOP A;  1JF2 A;  1IJ6 A;  1RJV A;  2KFF A;  2KNE A;  1KK8 B;  2M0R A;  2V53 A;  3I5I B;  1C07 A;  2E6W A;  3SJS A;  4MLW A;  4DS7 A;  1RRO A;  1A4P A;  1S5G Y;  2LMU A;  4GBA A;  4NQG A;  2JWW A;  4MRY A;  3WHU B;  1M31 A;  1PK0 D;  4PHK A;  4UPG A;  5G08 A;  1FI5 A;  2BBN A;  3I5G B;  1OMR A;  1YRU B;  5GQQ C;  2F8P A;  3VRP A;  5AER A;  1J1D A;  1OMV A;  2K61 A;  3NXA A;  1XFW O;  5CSI A;  2KGB C;  1B4C A;  3CTN A;  2LVJ A;  1WLZ A;  1TN4 A;  2RGI A;  3O78 A;  2M29 A;  1BJF A;  2LLS A;  3SG6 A;  1GQM A;  2LC5 A;  1BMO A;  4ORB B;  2F2O A;  2MAZ A;  2M7N A;  5HLO A;  1CKK A;  1BR4 B;  1DJW A;  1SMG A;  3VGO A;  2FJU B;  1UWO A;  2O5G A;  1NYA A;  2HQW A;  3TS5 C;  4AQJ A;  1WY9 A;  1W7I B;  1SL7 A;  2KI6 D;  5CSN A;  1YVH A;  1PVB A;  1K96 A;  1M45 A;  2CT9 A;  4GNK B;  4IL1 A;  5FYX A;  1XFY O;  2KAV A;  4ETO A;  2NCO A;  1WDC B;  2PRU A;  1JC2 A;  3PAT A;  1SY9 A;  4GAO A;  4M2P A;  1KK7 Y;  1JSA A;  3M0W A;  1ZAC A;  4YBH B;  1SPY A;  4ORA B;  4PHJ A;  1NPQ A;  1NSH A;  2L51 A;  2KYC A;  3TUY C;  1JWD A;  2B1U A;  3I5H B;  2KHN A;  3TDI A;  2COL B;  4AOM A;  2I94 A;  1F4O A;  3I5F B;  1QJT A;  4C0J A;  2PAL A;  4R1E A;  1DF0 B;  2LM5 A;  2L98 A;  1NX0 A;  3PAL A;  3C1V A;  4DRW A;  1N65 A;  1WRK A;  1GGZ A;  2M7L A;  1PSR A;  5HKY A;  1F8H A;  3MSE B;  2TN4 A;  2AMI A;  1AK8 A;  1PUL A;  3RLZ A;  2KFH A;  4DIR A;  2EC6 C;  2PVB A;  3QRX A;  1KSM A;  1OE9 B;  2M8U A;  2JXL A;  4HRG A;  2OPO A;  2ZRS A;  2HQ8 A;  1Y1X A;  1S36 A;  1NX1 A;  2NZ0 A;  3DVE A;  3GK2 A;  1J1E A;  4P5O E;  4PE4 A;  2BCA A;  2E30 A;  2NLN A;  4USL A;  3LLE A;  5HKW A;  4WQ2 A;  2LHL A;  2KSP A;  1B8L A;  1BOD A;  2WND A;  1DGV A;  1K9U A;  1CFF A;  1DJI A;  1MHO A;  2WCB A;  4OVN F;  1QAT A;  1IQ5 A;  2D8N A;  1N0Y A;  1R2U A;  3CGA A;  4I5N B;  2OS8 C;  2JC2 A;  1CLB A;  1K93 D;  1CDM A;  2F2P A;  2ISD A;  1ZOT B;  1BT6 A;  1UHI A;  4N1F A;  4JWQ A;  1OSA A;  3DD4 A;  4I5J A;  3ZWH A;  2L5X B;  2KAX A;  3DF0 A;  3FS7 A;  2IS9 A;  2KI6 C;  3GK1 A;  1PAL A;  4FQO A;  4MZK A;  3HCM A;  3BUX B;  1NCX A;  3JVT B;  4DCK A;  1B7T Z;  3D10 A;  2Y1N A;  3VRR A;  1EJ3 A;  2HET A;  1EG3 A;  4MVF A;  3LCP C;  3SG5 A;  1TCF A;  5ER5 A;  1CM4 A;  1J7R A;  1LA0 A;  2KQY A;  2OTG C;  1DJZ A;  4GUK A;  4PHN A;  1F4Q A;  3E3R A;  1FBV A;  3GK4 X;  1PSB A;  1A75 B;  2LMV A;  2LVK A;  3I5I C;  1KK8 C;  1MUX A;  4N5X A;  2H61 C;  2O60 A;  4ICB A;  1L7Z A;  2HPS A;  2KOT A;  2L2E A;  2ZN8 A;  1WRL A;  4OV2 A;  1LIN A;  1LKJ A;  3PN7 B;  2SCP A;  3PLF B;  3I5G C;  1OOJ A;  4ZCU A;  3KF9 A;  1UP5 A;  3LK1 A;  2EHB A;  4PE0 A;  5F6T A;  1QX5 B;  3KPX A;  4OCI A;  1Q80 A;  4NDB A;  5D7F A;  4CID A;  3TZ1 A;  1CFP A;  1SRA A;  1XFU O;  4GGN A;  4M2O A;  1J55 A;  1R6P A;  1TNW A;  1CFD A;  2CXJ A;  2H61 A;  1SK6 D;  5DKQ A;  4C0L A;  1A03 A;  1NCY A;  2H2K A;  3EK8 A;  2DOQ A;  4PE7 A;  2K7C A;  2LLT A;  5K89 A;  1IG5 A;  1K9K A;  3RM1 A;  1EL4 A;  2K8M B;  2HF5 A;  1QVI Y;  1DJH A;  1HT9 A;  1WDC C;  1SYM A;  2SAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...