2LNKA

Solution structure of ca-bound s100a4 in complex with non-muscle myosin iia
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
101
structure length
101
Chain Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, non-muscle IIa
publication title Asymmetric Mode of Ca(2+)-S100A4 Interaction with Nonmuscle Myosin IIA Generates Nanomolar Affinity Required for Filament Remodeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
total genus 31
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lnkA00
1PRWA 2KAVA 1A29A 1KWOB 2M97A 2WOSA 3I5IC 3MSEB 4YBHB 2OS8B 3PN7B 1PSBA 1BR4B 1NX2A 2JT3A 1JFKA 2BL0C 2O5GA 1RFJA 2LLTA 2KGBC 2Y5IA 2L51A 1JC2A 2MLEC 1LKJA 4MZKA 3VRRA 1J1DA 4IL1A 1C7WA 1NUBA 1YUUA 2HETA 4N1GA 4Q04A 3I5HC 4MN0A 1ALVA 1XYDA 1YTZC 1QIVA 2I2RE 2LCPA 4OVNF 2MBXA 2M3WA 1BT6A 1IG5A 2CBLA 3BOWB 1PK0D 2G9BA 5I8NA 1MHOA 1MXLC 1OE9B 3KHEA 1AVSA 3O6BA 1VRKA 2KBIA 2KAYA 1AJ5A 1QX5B 1NWDA 2OTGC 1N0YA 1JUOA 1B9AA 2KI4B 4YGAA 1M45A 2M7NA 3F45A 3SG4A 1IQ3A 1K9PA 1FPWA 2Y4QA 1MR8A 1BODA 1AP4A 1K9KA 3D10A 2G2BA 1F70A 4MLWA 2JC2A 3FS7A 4GNKB 3BQ3A 4C0JA 1CLMA 4P5OE 1U5IA 1DJWA 2BE6A 2JPTA 4GAOA 4MVFA 1KFUS 4PALA 1JSAA 2LV7A 2BCAA 3TUYB 3HX4A 1G33A 2OPOA 2KGRA 1CM4A 2E30A 2M8UA 1GGZA 1XFYO 1CMFA 2MRDA 3IF7A 2PSRA 1BMOA 2I18A 2LP2A 1FI6A 1XK4C 2JWWA 1SL9A 1XFWO 1KSOA 2KFFA 2M29A 1CLLA 5B8IB 1UHKA 5HLOA 1PALA 1QVIY 2F3ZA 1XVJA 1QIWA 4MBEA 1LA3A 1S5GZ 1Y1UA 4JQ0D 2F2PA 2LM5A 1B7TZ 2PRUA 4WQ3A 3TZ1A 4MZJA 1QS7A 4OR9B 3OP0A 5AFPA 4HREE 1S1EA 1EH2A 5I2QA 4N5XA 1QLKA 2OS8C 2P6BB 3BOWA 1G4YR 1EG4A 2EGDA 4XYNA 3IQQA 1CNPA 4GBAA 1L7ZA 2H61A 2QPTA 4PHJA 5J3XA 1EXRA 1FBVA 1SKTA 2BL0B 1BG1A 3DVMA 1S5GY 3WHUB 5CSNA 1TNQA 4DCKA 5JJGA 1M46A 2JT0A 2LVJA 4M2QA 5KU1A 1KSMA 1TRFA 1TNPA 1F8HA 1R6PA 1DJHA 1EL4A 1Y6WA 1AJ4A 3BUOB 2LMVA 4ICBA 2H61C 2F33A 2M0RA 3SG2A 1S6JA 1V1FA 2JXCA 5AEQA 3OB2B 2L50A 2LVKA 5CSFA 3WHTB 2L4IA 4N1FA 2KOTA 2F3YA 2OTGB 2QACA 3VRQA 2CXJA 2B1UA 1UWOA 1LA0A 5AANA 4A4CA 2PASA 1DJIA 1BLQA 1DGVA 4FTGA 2L0PA 1PVBA 1CFFA 4F0ZB 5GQQC 1B8RA 1SRAA 2K7DA 1K96A 3AAKA 2K0JA 1MWNA 1NCYA 4JWQA 1F54A 1WRZA 4BY5A 3E3RA 1UURA 1K90D 2BCXA 1TNXA 1LINA 1XFVO 2Q4UA 2L5XB 2KFGA 2GV5A 4TNCA 1CFCA 1A2XA 4P2YB 3ZWHA 1YX8A 4QJ3B 5HYDA 4UPGA 2BECA 2KQ6A 4MRYA 1KQMC 3EKHA 3NSIA 2I7AA 4XJKB 1J7OA 4NDDA 4YI8A 2H2KA 2JTZA 3CZTX 2WORA 1SBJA 2ZNEA 2AAOA 2WNDA 3IQOA 2CNPA 4BY4A 3CR2A 1YUSA 1ALWA 5DKNA 1QX7A 1SR6B 1M31A 4U8DA 2LP3A 1NIWA 4GFTA 1Y0VH 3FWBA 2LUXA 1SL8A 1SPYA 4USLA 1IGVA 2JU0A 5CSJA 3WNXB 2RGIA 3ICBA 1RWYA 1KCYA 1BJFA 1KK8C 2M1UA 2O60A 5HKZA 3CR4X 3BYAA 2CTNA 1SMGA 4NDCA 4OCIA 1FI5A 4FQOA 1K2HA 1UHIA 4ORAB 1MQ1A 2GGMA 1F55A 2KI6C 1AUIB 3GK2A 3BXKA 2IS9A 1C07A 2E6WA 3O4YA 4C0LA 1CDLA 3BUXB 2KI6D 5CSIA 1TTXA 1S26D 1Y1XA 1EJ3A 3GK4X 3VGOA 1XK4A 2BBNA 4ZCUA 2ZN8A 2EC6C 3M0WA 2KSPA 3PATA 1FW4A 1OMVA 1S6IA 4CIDA 1DJYA 2L98A 1GGWA 1SK6D 4PE4A 1JF0A 4HRGA 3SIBA 1W7IB 2LVVA 4XJKA 3VROA 2WCEA 1CLBA 3I5GC 3LK0A 1DGUA 3AAJA 1WY9A 2M7LA 1X02A 2MJWB 3NSLA 1ZFSA 1K9UA 2K2FA 4GGFC 2LANA 1BR1B 2KBMA 4YRUA 3DVKA 1RK9A 2KYCA 1GQMA 1J55A 2BCBA 2F8PA 1NYAA 4I5KA 4PHMA 3PFVA 4PE1A 1MUXA 2ZRSA 1IJ6A 1KQMB 2KFHA 5ER4X 1CKKA 1IKUA 4DUQA 1QV0A 1N2DA 1UHHA 2ISDA 1CDMA 1YRTB 2A4JA 2LAPA 2K7OA 2K2AA 3C1VA 1Q80A 5DKQA 1JBAA 5FYXA 3FWCA 1KFXL 1SR6C 3VRNA 1KK7Z 1QV1A 4PHKA 2R2IA 1YURA 5G08A 2NLNA 2Y1MA 2LC5A 1B7TY 2LLSA 1UHNA 4GPLB 3DF0B 3KEVA 3EK4A 1XFUO 5I2OA 1DT7B 2Q91A 2JQ6A 1KK8B 1YUTA 1RTP1 1Y1AA 2SASA 1SW8A 2LNKA 4C0KA 1IQ5A 1KK7Y 3KO0A 2HF5A 3A4UB 1S36A 5HLVA 1MXEA 1WRLA 1DJZA 4NQGA 3EKJA 1IH0A 2SCPA 4CFRA 4OV2A 2EC6B 1WLZA 2LHIA 2JNXA 1NX3A 3PLFB 1B1GA 3PALA 4R1EA 1JFJA 1BF5A 1TOPA 3VRPA 1K94A 1BU3A 1B8CA 1UHJA 1TCOB 1QTXA 3I5GB 4WQ2A 2HQWA 1QXPA 1M39A 2JZIA 1CM1A 2M49B 3K21A 1SCMB 3BUMB 2WCFA 1J7PA 1NX0A 1IWQA 3EVRA 3JVTC 5KTYA 4M2OA 1S6CA 3OX6A 4OKHA 3CR5X 3NSKA 1KFUL 1YRUB 1HQVA 1A4PA 3CTNA 4JPZB 3BUNB 1TN4A 1YVHA 2ZNDA 2JTTA 2HPSA 1XFXO 1LVCD 2EHBA 4E68A 3DF0A 1C7VA 1A75B 5JOLA 1HT9A 2GGZA 3A8RA 2WC8A 1PULA 1TNWA 1RJVA 3DVJA 1R2UA 5AXIA 3EK7A 2BE4A 1RROA 3QRXA 1EG3A 3TDIA 4YGBB 3RLZA 4CLNA 4CPVA 1L2OC 1WDCC 1XA5A 2ZFDA 3GOFA 1LXFC 1DVIA 5HKWA 2M9GA 3CWGA 3SG6A 1OQPA 1OZOA 2F2OA 2M1KB 4M2PA 4NDBA 3D0YB 3H4SE 3NSOA 1NP8A 1UP5A 1YVLA 3LLEA 4QJ4B 1JF2A 2NXQA 2LMUA 1J7RA 3OB1B 1NCZA 3SG7A 2ZKMX 3KPXA 1A03A 1QX2A 3OX5A 1SL7A 4HRHA 1CDPA 4ORCB 1B47A 1N65A 4L9MA 3I5FC 4GGFA 2LLUA 2KYFA 1OMRA 1TCFA 3TS5B 2LE9B 4GUKA 1IRJA 1DMOA 5F6TA 1QJTA 1PVAA 1A75A 1CDNA 4A4BA 2KDHA 4AQIA 1CB1A 4I5LB 4DRWA 3LK1A 1KQVA 1SCMC 3FIAA 1QASA 4PDZA 5K89A 3JVTB 3LL8B 3SG5A 1NPQA 2COLB 2K7BA 1SCVA 1CTRA 3TDUA 1J7QA 5PALA 3O2PA 3O78A 1SYMA 2JXLA 5I2LA 4PCWA 1CMGA 3ZNIA 1JWDA 1MF8B 1NX1A 1QVIZ 1W7JB 2VRGA 2ZN9A 1PSRA 2K8MB 2K7CA 1ZMZA 2PVBA 1OSAA 4D1EA 1YX7A 1ZUZA 3AKBA 1OZSA 2KHNA 2KNEA 1ODBA 3D0YA 3GK1A 3JTDB 3RM1A 1CFDA 1SNLA 2BKHB 2AUCA 2LMTA 4AQJA 1DTLA 4YGDB 5BPJA 3NXAA 5AERA 1L2OB 1WDCB 2Y1NA 3LCPC 5D69A 1QATA 2JOJA 3PSRA 4PE0A 1DJGA 5HKYA 1K93D 4YGEB 2MA2A 1WLMA 4DS7A 2DOQA 1WRKA 3DVEA 1K8UA 4MEWA 2V53A 4PHNA 1DJXA 2FOTA 3PM8A 5IBWA 1AHRA 3AKAA 1DF0B 3SJSA 1KWOC 2MHHA 5TNCA 1M63B 2NCPA 2NCOA 3I5IB 1OMDA 4AOMA 1BOCA 3PN7C 1IJ5A 2FCDA 2JT8A 1NSHA 2TN4A 2ZRTA 3SG3A 4YI9A 1UUSA 5CPVA 4DIRA 2KAXA 2LHLA 1K95A 2K61A 3TDZA 3DD4A 3I5FB 1SY9A 2PMYA 2I94A 4I5JA 3TS5C 2WCBA 1F71A 1E8AA 3I5HB 3CLNA 1H8BA 1F4OA 4MZLA 5ER5A 2NZ0A 2HQ8A 2JNFA 2L2EA 5DKRA 2KQYA 1GJYA 1OOJA 1AK8A 5KSZA 2JULA 3BUWB 1RECA 3WXAA 2D8NA 3CGAA 2KI4C 3OHMB 3HCMA 2PALA 4PE7A 1S3PA 2AMIA 1B4CA 2BBMA 1YR5A 4MRXA 3KF9A 1B8LA 4MSPA 4YGCB 2FJUB 1TIZA 3EK8A 2CT9A 3JTDC 4ZCVA 2BKIB 2MLFC 1F4QA 4HSZA 3TUYC 4WRIA 3SIAA 1DF0A 1V1GA 3EVVA 2JRFA 3CS1A 1G8IA 4ETOA 5D7FA 1FF1A 1J1EA 1ZACA 2CCMA 1D1OA 2MAZA 1XFZO 1NCXA 2LUCA 4ORBB 1ZOTB 3EVUA 4I5NB 4CFQA 1KFXS 1U5IB 2LVIA 1CFPA 2FCEA 1XO5A 4GGNA 2L4HA 4QJ5B 1QLSA 1H4BA
chains in the Genus database with same CATH superfamily
1PRWA 2KAVA 1A29A 1KWOB 2M97A 2WOSA 3I5IC 3MSEB 4YBHB 3DZTA 3Q8IA 2OS8B 3D75A 3PN7B 1PSBA 1BR4B 1NX2A 2JT3A 1JFKA 2BL0C 2O5GA 1RFJA 2LLTA 2KGBC 2Y5IA 2L51A 1JC2A 2K60A 2MLEC 3UNWA 1DC1A 1LKJA 4MZKA 3VRRA 1J1DA 3NHTA 4IL1A 1C7WA 1NUBA 1YUUA 2HETA 4N1GA 4Q04A 3I5HC 4MN0A 1ALVA 1XYDA 1YTZC 1QIVA 3L4AA 2I2RE 2LCPA 4OVNF 2MBXA 2M3WA 1BT6A 1IG5A 2CBLA 3BOWB 2JPOA 1PK0D 2G9BA 5I8NA 1MHOA 1MXLC 1OE9B 3KHEA 1AVSA 3FE9A 3O6BA 1VRKA 2KBIA 2KAYA 1AJ5A 1QX5B 1NWDA 2OTGC 1N0YA 1JUOA 1B9AA 2KI4B 4YGAA 1M45A 2M7NA 3F45A 3SG4A 3V2LA 1IQ3A 1K9PA 1DQEA 1FPWA 4F7FA 2Y4QA 3S0AA 1MR8A 1BODA 1AP4A 1K9KA 3D10A 2G2BA 1F70A 4MLWA 2JC2A 3FS7A 4GNKB 3BQ3A 4C0JA 1CLMA 4P5OE 1U5IA 3B86A 1DJWA 2BE6A 2JPTA 4GAOA 4MVFA 1KFUS 1QWVA 4PALA 1JSAA 2LV7A 2BCAA 3TUYB 1SSEB 3HX4A 3DY9A 1G33A 2OPOA 2KGRA 1CM4A 2E30A 2M8UA 1GGZA 1XFYO 3NGVA 2MRDA 1CMFA 3IF7A 2PSRA 1BMOA 2I18A 2LP2A 1FI6A 1XK4C 2JWWA 1SL9A 1XFWO 1KSOA 2KFFA 2M29A 1CLLA 3RZSA 5B8IB 1UHKA 3L47A 1PALA 1QVIY 5HLOA 3CZ2A 2F3ZA 1XVJA 1QIWA 4MBEA 2H8VA 1LA3A 1ORGA 1S5GZ 1Y1UA 4JQ0D 2F2PA 2LM5A 1B7TZ 2PRUA 4WQ3A 3B7AA 5FI2A 3TZ1A 4MZJA 1QS7A 4OR9B 3BJHA 3OP0A 5AFPA 4HREE 1S1EA 1EH2A 5I2QA 4N5XA 3B87A 1QLKA 2OS8C 2P6BB 3BOWA 1G4YR 2QEBA 1EG4A 2EGDA 4XYNA 3IQQA 1CNPA 4GBAA 1L7ZA 2H61A 2QPTA 4PHJA 5J3XA 2QDIA 1EXRA 1FBVA 1SKTA 2BL0B 1BG1A 3DVMA 1S5GY 3WHUB 5CSNA 1TNQA 4DCKA 5JJGA 1M46A 2JT0A 2LVJA 4M2QA 3OGNA 5KU1A 1KSMA 1TRFA 1TNPA 1DELA 1F8HA 1R6PA 1DJHA 1EL4A 1Y6WA 1AJ4A 3BUOB 2LMVA 4ICBA 2H61C 2F33A 2M0RA 3SG2A 1S6JA 1V1FA 2JXCA 5AEQA 1Z4HA 2L50A 2LVKA 3OB2B 5CSFA 3WHTB 3S0GA 2L4IA 4N1FA 2KOTA 2F3YA 2OTGB 2QACA 3VRQA 2CXJA 2B1UA 1UWOA 1LA0A 5AANA 4A4CA 2PASA 1DJIA 1BLQA 1DGVA 4FTGA 2L0PA 1PVBA 1CFFA 4F0ZB 5GQQC 1B8RA 1SRAA 2K7DA 1K96A 3CABA 3AAKA 2K0JA 1MWNA 1NCYA 4JWQA 1F54A 1WRZA 4BY5A 3E3RA 1UURA 1K90D 2BCXA 1TNXA 3FE8A 1LINA 1XFVO 2Q4UA 2L5XB 2KFGA 2GV5A 4TNCA 1CFCA 1A2XA 4P2YB 3ZWHA 3R1OA 1YX8A 1TUZA 4QJ3B 5HYDA 2WC6A 4UPGA 2BECA 2KQ6A 4MRYA 1KQMC 3SS3A 3EKHA 3NSIA 2I7AA 4XJKB 1J7OA 4NDDA 4YI8A 2H2KA 2JTZA 3CZTX 2WORA 3D78A 1SBJA 2WCJA 2ZNEA 2AAOA 2WNDA 3IQOA 2CNPA 4BY4A 3CR2A 1YUSA 1ALWA 3D73A 3S0DA 5DKNA 1QX7A 1SR6B 1M31A 4U8DA 2LP3A 1NIWA 4GFTA 1Y0VH 3FWBA 2LUXA 1SL8A 1SPYA 4USLA 1IGVA 2JU0A 5CSJA 3BFAA 2BAPA 3WNXB 2RGIA 2P70A 3ICBA 1RWYA 1KCYA 1BJFA 1KK8C 2M1UA 2O60A 5HKZA 3CR4X 3BYAA 2CTNA 1SMGA 4NDCA 4OCIA 1FI5A 4FQOA 1K2HA 1UHIA 4ORAB 1MQ1A 2GGMA 1F55A 1GM0A 2KI6C 1AUIB 3GK2A 3BXKA 1OOGA 2IS9A 2E6WA 1C07A 3O4YA 4C0LA 2PQLA 2KLDA 1CDLA 3BUXB 4JKTA 2KI6D 5CSIA 1TTXA 1S26D 1Y1XA 1EJ3A 3GK4X 2KPHA 3VGOA 3S0BA 1XK4A 2BBNA 4ZCUA 3D77A 1XFRA 2ZN8A 2EC6C 3M0WA 2KSPA 3PATA 1FW4A 1OMVA 1S6IA 4OZDA 4CIDA 1DJYA 2L98A 1GGWA 1SK6D 4PE4A 1JF0A 4HRGA 3SIBA 1W7IB 2LVVA 4XJKA 3VROA 2WCEA 1CLBA 3I5GC 3LK0A 1DGUA 3AAJA 1WY9A 2M7LA 1X02A 2MJWB 3NSLA 1ZFSA 3D74A 1K9UA 2K2FA 3N7HA 4GGFC 2LANA 1BR1B 2KBMA 2WCLA 4YRUA 1LS8A 3DVKA 1RK9A 2KYCA 1GQMA 1J55A 2BCBA 2F8PA 1NYAA 4I5KA 4PHMA 3PFVA 4PE1A 1MUXA 2ZRSA 3NHIA 2GTEA 1IJ6A 1KQMB 2KFHA 1DEKA 5ER4X 1IKUA 1CKKA 4DUQA 1QV0A 1N2DA 1UHHA 2ISDA 1CDMA 3K1EA 1YRTB 2A4JA 2LAPA 2K7OA 2K2AA 3C1VA 1Q80A 3CDNA 5DKQA 1JBAA 5FYXA 3FWCA 1KFXL 1OW4A 1SR6C 3VRNA 4FQTA 1KK7Z 1QV1A 4PHKA 2R2IA 1YURA 5EL2A 5G08A 2NLNA 2Y1MA 2LC5A 1B7TY 2LLSA 1UHNA 4GPLB 3DF0B 3KEVA 3EK4A 1XFUO 5I2OA 1OOIX 1DT7B 3L4LA 2Q91A 2JQ6A 1KK8B 1YUTA 1RTP1 1Y1AA 2SASA 1SW8A 2LNKA 1T14A 4C0KA 1IQ5A 1KK7Y 5D3OA 3KO0A 2HF5A 3A4UB 1S36A 3D76A 5HLVA 1Z2CB 1MXEA 1WRLA 1DJZA 3DXLA 4NQGA 3EKJA 1IH0A 2SCPA 4CFRA 4OV2A 2EC6B 1WLZA 2LHIA 2JNXA 1NX3A 3PLFB 1B1GA 3PALA 4R1EA 1JFJA 1BF5A 1TOPA 3VRPA 1K94A 1BU3A 1B8CA 1UHJA 5DICA 1TCOB 1QTXA 3I5GB 4WQ2A 2HQWA 1QXPA 2WC5A 1M39A 2JZIA 1CM1A 2M49B 3K21A 1SCMB 3BUMB 2WCFA 1J7PA 2FJYA 1NX0A 1IWQA 3EVRA 3JVTC 5KTYA 4M2OA 1S6CA 3OX6A 4OKHA 3CR5X 3NSKA 1KFUL 1YRUB 1HQVA 1A4PA 3CTNA 4JPZB 3BUNB 1TN4A 1YVHA 2ZNDA 2JTTA 2HPSA 1XFXO 1LVCD 1TUJA 2EHBA 4E68A 3DF0A 3R72A 1C7VA 1A75B 5JOLA 1HT9A 2GGZA 3A8RA 3FE6A 2WC8A 1PULA 1TNWA 1RJVA 3DVJA 1R2UA 5AXIA 3EK7A 2PYQA 1RROA 2BE4A 3QRXA 1EG3A 3TDIA 3BFHA 4YGBB 3RLZA 4CLNA 4CPVA 1L2OC 1WDCC 1XA5A 2ZFDA 3GOFA 4INWA 3R1VA 3PJIA 1LXFC 3S0FA 1DVIA 5HKWA 3EG5B 2M9GA 3CWGA 3SG6A 1OQPA 1OZOA 2F2OA 2M1KB 4M2PA 3OBVA 4NDBA 3D0YB 3H4SE 3CZ1A 1NP8A 1UP5A 1YVLA 3LLEA 3NSOA 4QJ4B 1JF2A 2NXQA 2LMUA 1J7RA 3OB1B 3VB1A 1NCZA 4JD9A 3SG7A 1C3ZA 2ZKMX 3KPXA 1A03A 1QX2A 3OX5A 1SL7A 4HRHA 1CDPA 4ORCB 1B47A 1N65A 4L9MA 3I5FC 4GGFA 2LLUA 2KYFA 1OMRA 1TCFA 3TS5B 2LE9B 4GUKA 1IRJA 1DMOA 5F6TA 1QJTA 1PVAA 3B6XA 1A75A 1CDNA 2WCKA 4A4BA 2KDHA 4AQIA 1CB1A 4I5LB 4DRWA 3LK1A 3S0EA 1KQVA 1SCMC 3FIAA 1QASA 4PDZA 5K89A 2WCHA 3JVTB 3LL8B 3SG5A 1NPQA 2COLB 2K7BA 2QEHA 1SCVA 1CTRA 2L2CA 1OOFA 3TDUA 1J7QA 5PALA 3O2PA 3O78A 1SYMA 2JXLA 5I2LA 4PCWA 5I94A 1CMGA 3ZNIA 1JWDA 1MF8B 1NX1A 1QVIZ 1W7JB 2VRGA 2ZN9A 1PSRA 2K8MB 2K7CA 1ZMZA 2PVBA 1OSAA 4D1EA 1YX7A 1ZUZA 3AKBA 1OZSA 2KHNA 2KNEA 1ODBA 3D0YA 3GK1A 3JTDB 3RM1A 1CFDA 1SNLA 2BKHB 2AUCA 1P28A 2LMTA 3QMEA 4AQJA 1DTLA 4YGDB 5BPJA 3NXAA 5AERA 1L2OB 1WDCB 2Y1NA 3LCPC 5D69A 1QATA 2KLEA 5HL1A 2JOJA 3PSRA 4PE0A 1DJGA 5HKYA 3SS5A 1K93D 4YGEB 2MA2A 1WLMA 4DS7A 2DOQA 1WRKA 3DVEA 1K8UA 4MEWA 2V53A 3SS4A 4PHNA 1DJXA 2FOTA 3PM8A 5IBWA 1AHRA 3AKAA 1DF0B 1OOHA 3SJSA 1KWOC 2MHHA 5TNCA 4KYNA 1C3YA 1M63B 1W9ZA 2BNXA 2NCOA 2NCPA 1OMDA 3I5IB 4AOMA 1BOCA 3PN7C 1IJ5A 2FCDA 2JT8A 1NSHA 2TN4A 2ZRTA 3SG3A 4YI9A 1UUSA 5CPVA 4DIRA 2KAXA 2LHLA 1K95A 2K61A 3TDZA 3DD4A 3I5FB 1SY9A 3O4XA 2PMYA 2I94A 4I5JA 3TS5C 2WCBA 2QEVA 3R1PA 1F71A 1E8AA 3CZ0A 3CLNA 3I5HB 1F4OA 1H8BA 4MZLA 5ER5A 2NZ0A 2HQ8A 2JNFA 2L2EA 5DKRA 2KQYA 1GJYA 1OOJA 1AK8A 3UO9A 2JULA 5KSZA 3BUWB 1RECA 3WXAA 2D8NA 5FI6A 3CGAA 2KI4C 3OHMB 2QEOA 3PM2A 3HCMA 2PALA 4PE7A 1S3PA 2P71A 2AMIA 1B4CA 1IIOA 2BBMA 1YR5A 4MRXA 3KF9A 1B8LA 4MSPA 1TWOA 2WCMA 4IJ7A 4YGCB 3DYEA 4PT1A 2FJUB 1TIZA 3BFBA 2CT9A 3EK8A 3JTDC 4ZCVA 2BKIB 2MLFC 1F4QA 4HSZA 3B88A 3TUYC 4WRIA 3SIAA 1DF0A 1V1GA 3EVVA 2L5YA 5FI7A 2JRFA 2ERBA 3CS1A 1G8IA 4ETOA 5D7FA 1FF1A 1J1EA 1ZACA 2CCMA 1D1OA 2MAZA 2YGUA 1XFZO 4INXA 1NCXA 2LUCA 4ORBB 1ZOTB 3EVUA 4I5NB 4CFQA 1KFXS 1U5IB 2LVIA 1CFPA 2FCEA 3CYZA 1XO5A 4GGNA 2L4HA 3IVTA 4QJ5B 1QLSA 1H4BA
chains in the Genus database with same CATH topology
1PRWA 2KAVA 1A29A 1KWOB 2M97A 2WOSA 3I5IC 3MSEB 4YBHB 2OS8B 3PN7B 1PSBA 1BR4B 1NX2A 2JT3A 1JFKA 2BL0C 2O5GA 1RFJA 2LLTA 2KGBC 2Y5IA 2L51A 1JC2A 2MLEC 1LKJA 4MZKA 3VRRA 1J1DA 4IL1A 1C7WA 1NUBA 1YUUA 2HETA 4N1GA 4Q04A 3I5HC 4MN0A 1ALVA 1XYDA 1YTZC 1QIVA 2I2RE 2LCPA 4OVNF 2MBXA 2M3WA 1BT6A 1IG5A 2CBLA 3BOWB 1PK0D 2G9BA 5I8NA 1MHOA 1MXLC 1OE9B 3KHEA 1AVSA 3O6BA 1VRKA 2KBIA 2KAYA 1AJ5A 1QX5B 1NWDA 2OTGC 1N0YA 1JUOA 1B9AA 2KI4B 4YGAA 1M45A 2M7NA 3F45A 3SG4A 1IQ3A 1K9PA 1FPWA 2Y4QA 1MR8A 1BODA 1AP4A 1K9KA 3D10A 2G2BA 1F70A 4MLWA 2JC2A 3FS7A 4GNKB 3BQ3A 4C0JA 1CLMA 4P5OE 1U5IA 1DJWA 2BE6A 2JPTA 4GAOA 4MVFA 1KFUS 4PALA 1JSAA 2LV7A 2BCAA 3TUYB 3HX4A 1G33A 2OPOA 2KGRA 1CM4A 2E30A 2M8UA 1GGZA 1XFYO 1CMFA 2MRDA 3IF7A 2PSRA 1BMOA 2I18A 2LP2A 1FI6A 1XK4C 2JWWA 1SL9A 1XFWO 1KSOA 2KFFA 2M29A 1CLLA 5B8IB 1UHKA 5HLOA 1PALA 1QVIY 2F3ZA 1XVJA 1QIWA 4MBEA 1LA3A 1S5GZ 1Y1UA 4JQ0D 2F2PA 2LM5A 1B7TZ 2PRUA 4WQ3A 3TZ1A 4MZJA 1QS7A 4OR9B 3OP0A 5AFPA 4HREE 1S1EA 1EH2A 5I2QA 4N5XA 1QLKA 2OS8C 2P6BB 3BOWA 1G4YR 1EG4A 2EGDA 4XYNA 3IQQA 1CNPA 4GBAA 1L7ZA 2H61A 2QPTA 4PHJA 5J3XA 1EXRA 1FBVA 1SKTA 2BL0B 1BG1A 3DVMA 1S5GY 3WHUB 5CSNA 1TNQA 4DCKA 5JJGA 1M46A 2JT0A 2LVJA 4M2QA 5KU1A 1KSMA 1TRFA 1TNPA 1F8HA 1R6PA 1DJHA 1EL4A 1Y6WA 1AJ4A 3BUOB 2LMVA 4ICBA 2H61C 2F33A 2M0RA 3SG2A 1S6JA 1V1FA 2JXCA 5AEQA 3OB2B 2L50A 2LVKA 5CSFA 3WHTB 2L4IA 4N1FA 2KOTA 2F3YA 2OTGB 2QACA 3VRQA 2CXJA 2B1UA 1UWOA 1LA0A 5AANA 4A4CA 2PASA 1DJIA 1BLQA 1DGVA 4FTGA 2L0PA 1PVBA 1CFFA 4F0ZB 5GQQC 1B8RA 1SRAA 2K7DA 1K96A 3AAKA 2K0JA 1MWNA 1NCYA 4JWQA 1F54A 1WRZA 4BY5A 3E3RA 1UURA 1K90D 2BCXA 1TNXA 1LINA 1XFVO 2Q4UA 2L5XB 2KFGA 2GV5A 4TNCA 1CFCA 1A2XA 4P2YB 3ZWHA 1YX8A 4QJ3B 5HYDA 4UPGA 2BECA 2KQ6A 4MRYA 1KQMC 3EKHA 3NSIA 2I7AA 4XJKB 1J7OA 4NDDA 4YI8A 2H2KA 2JTZA 3CZTX 2WORA 1SBJA 2ZNEA 2AAOA 2WNDA 3IQOA 2CNPA 4BY4A 3CR2A 1YUSA 1ALWA 5DKNA 1QX7A 1SR6B 1M31A 4U8DA 2LP3A 1NIWA 4GFTA 1Y0VH 3FWBA 2LUXA 1SL8A 1SPYA 4USLA 1IGVA 2JU0A 5CSJA 3WNXB 2RGIA 3ICBA 1RWYA 1KCYA 1BJFA 1KK8C 2M1UA 2O60A 5HKZA 3CR4X 3BYAA 2CTNA 1SMGA 4NDCA 4OCIA 1FI5A 4FQOA 1K2HA 1UHIA 4ORAB 1MQ1A 2GGMA 1F55A 2KI6C 1AUIB 3GK2A 3BXKA 2IS9A 1C07A 2E6WA 3O4YA 4C0LA 1CDLA 3BUXB 2KI6D 5CSIA 1TTXA 1S26D 1Y1XA 1EJ3A 3GK4X 3VGOA 1XK4A 2BBNA 4ZCUA 2ZN8A 2EC6C 3M0WA 2KSPA 3PATA 1FW4A 1OMVA 1S6IA 4CIDA 1DJYA 2L98A 1GGWA 1SK6D 4PE4A 1JF0A 4HRGA 3SIBA 1W7IB 2LVVA 4XJKA 3VROA 2WCEA 1CLBA 3I5GC 3LK0A 1DGUA 3AAJA 1WY9A 2M7LA 1X02A 2MJWB 3NSLA 1ZFSA 1K9UA 2K2FA 4GGFC 2LANA 1BR1B 2KBMA 4YRUA 3DVKA 1RK9A 2KYCA 1GQMA 1J55A 2BCBA 2F8PA 1NYAA 4I5KA 4PHMA 3PFVA 4PE1A 1MUXA 2ZRSA 1IJ6A 1KQMB 2KFHA 5ER4X 1CKKA 1IKUA 4DUQA 1QV0A 1N2DA 1UHHA 2ISDA 1CDMA 1YRTB 2A4JA 2LAPA 2K7OA 2K2AA 3C1VA 1Q80A 5DKQA 1JBAA 5FYXA 3FWCA 1KFXL 1SR6C 3VRNA 1KK7Z 1QV1A 4PHKA 2R2IA 1YURA 5G08A 2NLNA 2Y1MA 2LC5A 1B7TY 2LLSA 1UHNA 4GPLB 3DF0B 3KEVA 3EK4A 1XFUO 5I2OA 1DT7B 2Q91A 2JQ6A 1KK8B 1YUTA 1RTP1 1Y1AA 2SASA 1SW8A 2LNKA 4C0KA 1IQ5A 1KK7Y 3KO0A 2HF5A 3A4UB 1S36A 5HLVA 1MXEA 1WRLA 1DJZA 4NQGA 3EKJA 1IH0A 2SCPA 4CFRA 4OV2A 2EC6B 1WLZA 2LHIA 2JNXA 1NX3A 3PLFB 1B1GA 3PALA 4R1EA 1JFJA 1BF5A 1TOPA 3VRPA 1K94A 1BU3A 1B8CA 1UHJA 1TCOB 1QTXA 3I5GB 4WQ2A 2HQWA 1QXPA 1M39A 2JZIA 1CM1A 2M49B 3K21A 1SCMB 3BUMB 2WCFA 1J7PA 1NX0A 1IWQA 3EVRA 3JVTC 5KTYA 4M2OA 1S6CA 3OX6A 4OKHA 3CR5X 3NSKA 1KFUL 1YRUB 1HQVA 1A4PA 3CTNA 4JPZB 3BUNB 1TN4A 1YVHA 2ZNDA 2JTTA 2HPSA 1XFXO 1LVCD 2EHBA 4E68A 3DF0A 1C7VA 1A75B 5JOLA 1HT9A 2GGZA 3A8RA 2WC8A 1PULA 1TNWA 1RJVA 3DVJA 1R2UA 5AXIA 3EK7A 2BE4A 1RROA 3QRXA 1EG3A 3TDIA 4YGBB 3RLZA 4CLNA 4CPVA 1L2OC 1WDCC 1XA5A 2ZFDA 3GOFA 1LXFC 1DVIA 5HKWA 2M9GA 3CWGA 3SG6A 1OQPA 1OZOA 2F2OA 2M1KB 4M2PA 4NDBA 3D0YB 3H4SE 3NSOA 1NP8A 1UP5A 1YVLA 3LLEA 4QJ4B 1JF2A 2NXQA 2LMUA 1J7RA 3OB1B 1NCZA 3SG7A 2ZKMX 3KPXA 1A03A 1QX2A 3OX5A 1SL7A 4HRHA 1CDPA 4ORCB 1B47A 1N65A 4L9MA 3I5FC 4GGFA 2LLUA 2KYFA 1OMRA 1TCFA 3TS5B 2LE9B 4GUKA 1IRJA 1DMOA 5F6TA 1QJTA 1PVAA 1A75A 1CDNA 4A4BA 2KDHA 4AQIA 1CB1A 4I5LB 4DRWA 3LK1A 1KQVA 1SCMC 3FIAA 1QASA 4PDZA 5K89A 3JVTB 3LL8B 3SG5A 1NPQA 2COLB 2K7BA 1SCVA 1CTRA 3TDUA 1J7QA 5PALA 3O2PA 3O78A 1SYMA 2JXLA 5I2LA 4PCWA 1CMGA 3ZNIA 1JWDA 1MF8B 1NX1A 1QVIZ 1W7JB 2VRGA 2ZN9A 1PSRA 2K8MB 2K7CA 1ZMZA 2PVBA 1OSAA 4D1EA 1YX7A 1ZUZA 3AKBA 1OZSA 2KHNA 2KNEA 1ODBA 3D0YA 3GK1A 3JTDB 3RM1A 1CFDA 1SNLA 2BKHB 2AUCA 2LMTA 4AQJA 1DTLA 4YGDB 5BPJA 3NXAA 5AERA 1L2OB 1WDCB 2Y1NA 3LCPC 5D69A 1QATA 2JOJA 3PSRA 4PE0A 1DJGA 5HKYA 1K93D 4YGEB 2MA2A 1WLMA 4DS7A 2DOQA 1WRKA 3DVEA 1K8UA 4MEWA 2V53A 4PHNA 1DJXA 2FOTA 3PM8A 5IBWA 1AHRA 3AKAA 1DF0B 3SJSA 1KWOC 2MHHA 5TNCA 1M63B 2NCPA 2NCOA 3I5IB 1OMDA 4AOMA 1BOCA 3PN7C 1IJ5A 2FCDA 2JT8A 1NSHA 2TN4A 2ZRTA 3SG3A 4YI9A 1UUSA 5CPVA 4DIRA 2KAXA 2LHLA 1K95A 2K61A 3TDZA 3DD4A 3I5FB 1SY9A 2PMYA 2I94A 4I5JA 3TS5C 2WCBA 1F71A 1E8AA 3I5HB 3CLNA 1H8BA 1F4OA 4MZLA 5ER5A 2NZ0A 2HQ8A 2JNFA 2L2EA 5DKRA 2KQYA 1GJYA 1OOJA 1AK8A 5KSZA 2JULA 3BUWB 1RECA 3WXAA 2D8NA 3CGAA 2KI4C 3OHMB 3HCMA 2PALA 4PE7A 1S3PA 2AMIA 1B4CA 2BBMA 1YR5A 4MRXA 3KF9A 1B8LA 4MSPA 4YGCB 2FJUB 1TIZA 3EK8A 2CT9A 3JTDC 4ZCVA 2BKIB 2MLFC 1F4QA 4HSZA 3TUYC 4WRIA 3SIAA 1DF0A 1V1GA 3EVVA 2JRFA 3CS1A 1G8IA 4ETOA 5D7FA 1FF1A 1J1EA 1ZACA 2CCMA 1D1OA 2MAZA 1XFZO 1NCXA 2LUCA 4ORBB 1ZOTB 3EVUA 4I5NB 4CFQA 1KFXS 1U5IB 2LVIA 1CFPA 2FCEA 1XO5A 4GGNA 2L4HA 4QJ5B 1QLSA 1H4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRW A;  2KAV A;  1A29 A;  1KWO B;  2M97 A;  2WOS A;  3I5I C;  3MSE B;  4YBH B;  2OS8 B;  3PN7 B;  1PSB A;  1BR4 B;  1NX2 A;  2JT3 A;  1JFK A;  2BL0 C;  2O5G A;  1RFJ A;  2LLT A;  2KGB C;  2Y5I A;  2L51 A;  1JC2 A;  2MLE C;  1LKJ A;  4MZK A;  3VRR A;  1J1D A;  4IL1 A;  1C7W A;  1NUB A;  1YUU A;  2HET A;  4N1G A;  4Q04 A;  3I5H C;  4MN0 A;  1ALV A;  1XYD A;  1YTZ C;  1QIV A;  2I2R E;  2LCP A;  4OVN F;  2MBX A;  2M3W A;  1BT6 A;  1IG5 A;  2CBL A;  3BOW B;  1PK0 D;  2G9B A;  5I8N A;  1MHO A;  1MXL C;  1OE9 B;  3KHE A;  1AVS A;  3O6B A;  1VRK A;  2KBI A;  2KAY A;  1AJ5 A;  1QX5 B;  1NWD A;  2OTG C;  1N0Y A;  1JUO A;  1B9A A;  2KI4 B;  4YGA A;  1M45 A;  2M7N A;  3F45 A;  3SG4 A;  1IQ3 A;  1K9P A;  1FPW A;  2Y4Q A;  1MR8 A;  1BOD A;  1AP4 A;  1K9K A;  3D10 A;  2G2B A;  1F70 A;  4MLW A;  2JC2 A;  3FS7 A;  4GNK B;  3BQ3 A;  4C0J A;  1CLM A;  4P5O E;  1U5I A;  1DJW A;  2BE6 A;  2JPT A;  4GAO A;  4MVF A;  1KFU S;  4PAL A;  1JSA A;  2LV7 A;  2BCA A;  3TUY B;  3HX4 A;  1G33 A;  2OPO A;  2KGR A;  1CM4 A;  2E30 A;  2M8U A;  1GGZ A;  1XFY O;  1CMF A;  2MRD A;  3IF7 A;  2PSR A;  1BMO A;  2I18 A;  2LP2 A;  1FI6 A;  1XK4 C;  2JWW A;  1SL9 A;  1XFW O;  1KSO A;  2KFF A;  2M29 A;  1CLL A;  5B8I B;  1UHK A;  5HLO A;  1PAL A;  1QVI Y;  2F3Z A;  1XVJ A;  1QIW A;  4MBE A;  1LA3 A;  1S5G Z;  1Y1U A;  4JQ0 D;  2F2P A;  2LM5 A;  1B7T Z;  2PRU A;  4WQ3 A;  3TZ1 A;  4MZJ A;  1QS7 A;  4OR9 B;  3OP0 A;  5AFP A;  4HRE E;  1S1E A;  1EH2 A;  5I2Q A;  4N5X A;  1QLK A;  2OS8 C;  2P6B B;  3BOW A;  1G4Y R;  1EG4 A;  2EGD A;  4XYN A;  3IQQ A;  1CNP A;  4GBA A;  1L7Z A;  2H61 A;  2QPT A;  4PHJ A;  5J3X A;  1EXR A;  1FBV A;  1SKT A;  2BL0 B;  1BG1 A;  3DVM A;  1S5G Y;  3WHU B;  5CSN A;  1TNQ A;  4DCK A;  5JJG A;  1M46 A;  2JT0 A;  2LVJ A;  4M2Q A;  5KU1 A;  1KSM A;  1TRF A;  1TNP A;  1F8H A;  1R6P A;  1DJH A;  1EL4 A;  1Y6W A;  1AJ4 A;  3BUO B;  2LMV A;  4ICB A;  2H61 C;  2F33 A;  2M0R A;  3SG2 A;  1S6J A;  1V1F A;  2JXC A;  5AEQ A;  3OB2 B;  2L50 A;  2LVK A;  5CSF A;  3WHT B;  2L4I A;  4N1F A;  2KOT A;  2F3Y A;  2OTG B;  2QAC A;  3VRQ A;  2CXJ A;  2B1U A;  1UWO A;  1LA0 A;  5AAN A;  4A4C A;  2PAS A;  1DJI A;  1BLQ A;  1DGV A;  4FTG A;  2L0P A;  1PVB A;  1CFF A;  4F0Z B;  5GQQ C;  1B8R A;  1SRA A;  2K7D A;  1K96 A;  3AAK A;  2K0J A;  1MWN A;  1NCY A;  4JWQ A;  1F54 A;  1WRZ A;  4BY5 A;  3E3R A;  1UUR A;  1K90 D;  2BCX A;  1TNX A;  1LIN A;  1XFV O;  2Q4U A;  2L5X B;  2KFG A;  2GV5 A;  4TNC A;  1CFC A;  1A2X A;  4P2Y B;  3ZWH A;  1YX8 A;  4QJ3 B;  5HYD A;  4UPG A;  2BEC A;  2KQ6 A;  4MRY A;  1KQM C;  3EKH A;  3NSI A;  2I7A A;  4XJK B;  1J7O A;  4NDD A;  4YI8 A;  2H2K A;  2JTZ A;  3CZT X;  2WOR A;  1SBJ A;  2ZNE A;  2AAO A;  2WND A;  3IQO A;  2CNP A;  4BY4 A;  3CR2 A;  1YUS A;  1ALW A;  5DKN A;  1QX7 A;  1SR6 B;  1M31 A;  4U8D A;  2LP3 A;  1NIW A;  4GFT A;  1Y0V H;  3FWB A;  2LUX A;  1SL8 A;  1SPY A;  4USL A;  1IGV A;  2JU0 A;  5CSJ A;  3WNX B;  2RGI A;  3ICB A;  1RWY A;  1KCY A;  1BJF A;  1KK8 C;  2M1U A;  2O60 A;  5HKZ A;  3CR4 X;  3BYA A;  2CTN A;  1SMG A;  4NDC A;  4OCI A;  1FI5 A;  4FQO A;  1K2H A;  1UHI A;  4ORA B;  1MQ1 A;  2GGM A;  1F55 A;  2KI6 C;  1AUI B;  3GK2 A;  3BXK A;  2IS9 A;  1C07 A;  2E6W A;  3O4Y A;  4C0L A;  1CDL A;  3BUX B;  2KI6 D;  5CSI A;  1TTX A;  1S26 D;  1Y1X A;  1EJ3 A;  3GK4 X;  3VGO A;  1XK4 A;  2BBN A;  4ZCU A;  2ZN8 A;  2EC6 C;  3M0W A;  2KSP A;  3PAT A;  1FW4 A;  1OMV A;  1S6I A;  4CID A;  1DJY A;  2L98 A;  1GGW A;  1SK6 D;  4PE4 A;  1JF0 A;  4HRG A;  3SIB A;  1W7I B;  2LVV A;  4XJK A;  3VRO A;  2WCE A;  1CLB A;  3I5G C;  3LK0 A;  1DGU A;  3AAJ A;  1WY9 A;  2M7L A;  1X02 A;  2MJW B;  3NSL A;  1ZFS A;  1K9U A;  2K2F A;  4GGF C;  2LAN A;  1BR1 B;  2KBM A;  4YRU A;  3DVK A;  1RK9 A;  2KYC A;  1GQM A;  1J55 A;  2BCB A;  2F8P A;  1NYA A;  4I5K A;  4PHM A;  3PFV A;  4PE1 A;  1MUX A;  2ZRS A;  1IJ6 A;  1KQM B;  2KFH A;  5ER4 X;  1CKK A;  1IKU A;  4DUQ A;  1QV0 A;  1N2D A;  1UHH A;  2ISD A;  1CDM A;  1YRT B;  2A4J A;  2LAP A;  2K7O A;  2K2A A;  3C1V A;  1Q80 A;  5DKQ A;  1JBA A;  5FYX A;  3FWC A;  1KFX L;  1SR6 C;  3VRN A;  1KK7 Z;  1QV1 A;  4PHK A;  2R2I A;  1YUR A;  5G08 A;  2NLN A;  2Y1M A;  2LC5 A;  1B7T Y;  2LLS A;  1UHN A;  4GPL B;  3DF0 B;  3KEV A;  3EK4 A;  1XFU O;  5I2O A;  1DT7 B;  2Q91 A;  2JQ6 A;  1KK8 B;  1YUT A;  1RTP 1;  1Y1A A;  2SAS A;  1SW8 A;  2LNK A;  4C0K A;  1IQ5 A;  1KK7 Y;  3KO0 A;  2HF5 A;  3A4U B;  1S36 A;  5HLV A;  1MXE A;  1WRL A;  1DJZ A;  4NQG A;  3EKJ A;  1IH0 A;  2SCP A;  4CFR A;  4OV2 A;  2EC6 B;  1WLZ A;  2LHI A;  2JNX A;  1NX3 A;  3PLF B;  1B1G A;  3PAL A;  4R1E A;  1JFJ A;  1BF5 A;  1TOP A;  3VRP A;  1K94 A;  1BU3 A;  1B8C A;  1UHJ A;  1TCO B;  1QTX A;  3I5G B;  4WQ2 A;  2HQW A;  1QXP A;  1M39 A;  2JZI A;  1CM1 A;  2M49 B;  3K21 A;  1SCM B;  3BUM B;  2WCF A;  1J7P A;  1NX0 A;  1IWQ A;  3EVR A;  3JVT C;  5KTY A;  4M2O A;  1S6C A;  3OX6 A;  4OKH A;  3CR5 X;  3NSK A;  1KFU L;  1YRU B;  1HQV A;  1A4P A;  3CTN A;  4JPZ B;  3BUN B;  1TN4 A;  1YVH A;  2ZND A;  2JTT A;  2HPS A;  1XFX O;  1LVC D;  2EHB A;  4E68 A;  3DF0 A;  1C7V A;  1A75 B;  5JOL A;  1HT9 A;  2GGZ A;  3A8R A;  2WC8 A;  1PUL A;  1TNW A;  1RJV A;  3DVJ A;  1R2U A;  5AXI A;  3EK7 A;  2BE4 A;  1RRO A;  3QRX A;  1EG3 A;  3TDI A;  4YGB B;  3RLZ A;  4CLN A;  4CPV A;  1L2O C;  1WDC C;  1XA5 A;  2ZFD A;  3GOF A;  1LXF C;  1DVI A;  5HKW A;  2M9G A;  3CWG A;  3SG6 A;  1OQP A;  1OZO A;  2F2O A;  2M1K B;  4M2P A;  4NDB A;  3D0Y B;  3H4S E;  3NSO A;  1NP8 A;  1UP5 A;  1YVL A;  3LLE A;  4QJ4 B;  1JF2 A;  2NXQ A;  2LMU A;  1J7R A;  3OB1 B;  1NCZ A;  3SG7 A;  2ZKM X;  3KPX A;  1A03 A;  1QX2 A;  3OX5 A;  1SL7 A;  4HRH A;  1CDP A;  4ORC B;  1B47 A;  1N65 A;  4L9M A;  3I5F C;  4GGF A;  2LLU A;  2KYF A;  1OMR A;  1TCF A;  3TS5 B;  2LE9 B;  4GUK A;  1IRJ A;  1DMO A;  5F6T A;  1QJT A;  1PVA A;  1A75 A;  1CDN A;  4A4B A;  2KDH A;  4AQI A;  1CB1 A;  4I5L B;  4DRW A;  3LK1 A;  1KQV A;  1SCM C;  3FIA A;  1QAS A;  4PDZ A;  5K89 A;  3JVT B;  3LL8 B;  3SG5 A;  1NPQ A;  2COL B;  2K7B A;  1SCV A;  1CTR A;  3TDU A;  1J7Q A;  5PAL A;  3O2P A;  3O78 A;  1SYM A;  2JXL A;  5I2L A;  4PCW A;  1CMG A;  3ZNI A;  1JWD A;  1MF8 B;  1NX1 A;  1QVI Z;  1W7J B;  2VRG A;  2ZN9 A;  1PSR A;  2K8M B;  2K7C A;  1ZMZ A;  2PVB A;  1OSA A;  4D1E A;  1YX7 A;  1ZUZ A;  3AKB A;  1OZS A;  2KHN A;  2KNE A;  1ODB A;  3D0Y A;  3GK1 A;  3JTD B;  3RM1 A;  1CFD A;  1SNL A;  2BKH B;  2AUC A;  2LMT A;  4AQJ A;  1DTL A;  4YGD B;  5BPJ A;  3NXA A;  5AER A;  1L2O B;  1WDC B;  2Y1N A;  3LCP C;  5D69 A;  1QAT A;  2JOJ A;  3PSR A;  4PE0 A;  1DJG A;  5HKY A;  1K93 D;  4YGE B;  2MA2 A;  1WLM A;  4DS7 A;  2DOQ A;  1WRK A;  3DVE A;  1K8U A;  4MEW A;  2V53 A;  4PHN A;  1DJX A;  2FOT A;  3PM8 A;  5IBW A;  1AHR A;  3AKA A;  1DF0 B;  3SJS A;  1KWO C;  2MHH A;  5TNC A;  1M63 B;  2NCP A;  2NCO A;  3I5I B;  1OMD A;  4AOM A;  1BOC A;  3PN7 C;  1IJ5 A;  2FCD A;  2JT8 A;  1NSH A;  2TN4 A;  2ZRT A;  3SG3 A;  4YI9 A;  1UUS A;  5CPV A;  4DIR A;  2KAX A;  2LHL A;  1K95 A;  2K61 A;  3TDZ A;  3DD4 A;  3I5F B;  1SY9 A;  2PMY A;  2I94 A;  4I5J A;  3TS5 C;  2WCB A;  1F71 A;  1E8A A;  3I5H B;  3CLN A;  1H8B A;  1F4O A;  4MZL A;  5ER5 A;  2NZ0 A;  2HQ8 A;  2JNF A;  2L2E A;  5DKR A;  2KQY A;  1GJY A;  1OOJ A;  1AK8 A;  5KSZ A;  2JUL A;  3BUW B;  1REC A;  3WXA A;  2D8N A;  3CGA A;  2KI4 C;  3OHM B;  3HCM A;  2PAL A;  4PE7 A;  1S3P A;  2AMI A;  1B4C A;  2BBM A;  1YR5 A;  4MRX A;  3KF9 A;  1B8L A;  4MSP A;  4YGC B;  2FJU B;  1TIZ A;  3EK8 A;  2CT9 A;  3JTD C;  4ZCV A;  2BKI B;  2MLF C;  1F4Q A;  4HSZ A;  3TUY C;  4WRI A;  3SIA A;  1DF0 A;  1V1G A;  3EVV A;  2JRF A;  3CS1 A;  1G8I A;  4ETO A;  5D7F A;  1FF1 A;  1J1E A;  1ZAC A;  2CCM A;  1D1O A;  2MAZ A;  1XFZ O;  1NCX A;  2LUC A;  4ORB B;  1ZOT B;  3EVU A;  4I5N B;  4CFQ A;  1KFX S;  1U5I B;  2LVI A;  1CFP A;  2FCE A;  1XO5 A;  4GGN A;  2L4H A;  4QJ5 B;  1QLS A;  1H4B A; 
#chains in the Genus database with same CATH topology
 1PRW A;  2KAV A;  1A29 A;  1KWO B;  2M97 A;  2WOS A;  3I5I C;  3MSE B;  4YBH B;  3DZT A;  3Q8I A;  2OS8 B;  3D75 A;  3PN7 B;  1PSB A;  1BR4 B;  1NX2 A;  2JT3 A;  1JFK A;  2BL0 C;  2O5G A;  1RFJ A;  2LLT A;  2KGB C;  2Y5I A;  2L51 A;  1JC2 A;  2K60 A;  2MLE C;  3UNW A;  1DC1 A;  1LKJ A;  4MZK A;  3VRR A;  1J1D A;  3NHT A;  4IL1 A;  1C7W A;  1NUB A;  1YUU A;  2HET A;  4N1G A;  4Q04 A;  3I5H C;  4MN0 A;  1ALV A;  1XYD A;  1YTZ C;  1QIV A;  3L4A A;  2I2R E;  2LCP A;  4OVN F;  2MBX A;  2M3W A;  1BT6 A;  1IG5 A;  2CBL A;  3BOW B;  2JPO A;  1PK0 D;  2G9B A;  5I8N A;  1MHO A;  1MXL C;  1OE9 B;  3KHE A;  1AVS A;  3FE9 A;  3O6B A;  1VRK A;  2KBI A;  2KAY A;  1AJ5 A;  1QX5 B;  1NWD A;  2OTG C;  1N0Y A;  1JUO A;  1B9A A;  2KI4 B;  4YGA A;  1M45 A;  2M7N A;  3F45 A;  3SG4 A;  3V2L A;  1IQ3 A;  1K9P A;  1DQE A;  1FPW A;  4F7F A;  2Y4Q A;  3S0A A;  1MR8 A;  1BOD A;  1AP4 A;  1K9K A;  3D10 A;  2G2B A;  1F70 A;  4MLW A;  2JC2 A;  3FS7 A;  4GNK B;  3BQ3 A;  4C0J A;  1CLM A;  4P5O E;  1U5I A;  3B86 A;  1DJW A;  2BE6 A;  2JPT A;  4GAO A;  4MVF A;  1KFU S;  1QWV A;  4PAL A;  1JSA A;  2LV7 A;  2BCA A;  3TUY B;  1SSE B;  3HX4 A;  3DY9 A;  1G33 A;  2OPO A;  2KGR A;  1CM4 A;  2E30 A;  2M8U A;  1GGZ A;  1XFY O;  3NGV A;  2MRD A;  1CMF A;  3IF7 A;  2PSR A;  1BMO A;  2I18 A;  2LP2 A;  1FI6 A;  1XK4 C;  2JWW A;  1SL9 A;  1XFW O;  1KSO A;  2KFF A;  2M29 A;  1CLL A;  3RZS A;  5B8I B;  1UHK A;  3L47 A;  1PAL A;  1QVI Y;  5HLO A;  3CZ2 A;  2F3Z A;  1XVJ A;  1QIW A;  4MBE A;  2H8V A;  1LA3 A;  1ORG A;  1S5G Z;  1Y1U A;  4JQ0 D;  2F2P A;  2LM5 A;  1B7T Z;  2PRU A;  4WQ3 A;  3B7A A;  5FI2 A;  3TZ1 A;  4MZJ A;  1QS7 A;  4OR9 B;  3BJH A;  3OP0 A;  5AFP A;  4HRE E;  1S1E A;  1EH2 A;  5I2Q A;  4N5X A;  3B87 A;  1QLK A;  2OS8 C;  2P6B B;  3BOW A;  1G4Y R;  2QEB A;  1EG4 A;  2EGD A;  4XYN A;  3IQQ A;  1CNP A;  4GBA A;  1L7Z A;  2H61 A;  2QPT A;  4PHJ A;  5J3X A;  2QDI A;  1EXR A;  1FBV A;  1SKT A;  2BL0 B;  1BG1 A;  3DVM A;  1S5G Y;  3WHU B;  5CSN A;  1TNQ A;  4DCK A;  5JJG A;  1M46 A;  2JT0 A;  2LVJ A;  4M2Q A;  3OGN A;  5KU1 A;  1KSM A;  1TRF A;  1TNP A;  1DEL A;  1F8H A;  1R6P A;  1DJH A;  1EL4 A;  1Y6W A;  1AJ4 A;  3BUO B;  2LMV A;  4ICB A;  2H61 C;  2F33 A;  2M0R A;  3SG2 A;  1S6J A;  1V1F A;  2JXC A;  5AEQ A;  1Z4H A;  2L50 A;  2LVK A;  3OB2 B;  5CSF A;  3WHT B;  3S0G A;  2L4I A;  4N1F A;  2KOT A;  2F3Y A;  2OTG B;  2QAC A;  3VRQ A;  2CXJ A;  2B1U A;  1UWO A;  1LA0 A;  5AAN A;  4A4C A;  2PAS A;  1DJI A;  1BLQ A;  1DGV A;  4FTG A;  2L0P A;  1PVB A;  1CFF A;  4F0Z B;  5GQQ C;  1B8R A;  1SRA A;  2K7D A;  1K96 A;  3CAB A;  3AAK A;  2K0J A;  1MWN A;  1NCY A;  4JWQ A;  1F54 A;  1WRZ A;  4BY5 A;  3E3R A;  1UUR A;  1K90 D;  2BCX A;  1TNX A;  3FE8 A;  1LIN A;  1XFV O;  2Q4U A;  2L5X B;  2KFG A;  2GV5 A;  4TNC A;  1CFC A;  1A2X A;  4P2Y B;  3ZWH A;  3R1O A;  1YX8 A;  1TUZ A;  4QJ3 B;  5HYD A;  2WC6 A;  4UPG A;  2BEC A;  2KQ6 A;  4MRY A;  1KQM C;  3SS3 A;  3EKH A;  3NSI A;  2I7A A;  4XJK B;  1J7O A;  4NDD A;  4YI8 A;  2H2K A;  2JTZ A;  3CZT X;  2WOR A;  3D78 A;  1SBJ A;  2WCJ A;  2ZNE A;  2AAO A;  2WND A;  3IQO A;  2CNP A;  4BY4 A;  3CR2 A;  1YUS A;  1ALW A;  3D73 A;  3S0D A;  5DKN A;  1QX7 A;  1SR6 B;  1M31 A;  4U8D A;  2LP3 A;  1NIW A;  4GFT A;  1Y0V H;  3FWB A;  2LUX A;  1SL8 A;  1SPY A;  4USL A;  1IGV A;  2JU0 A;  5CSJ A;  3BFA A;  2BAP A;  3WNX B;  2RGI A;  2P70 A;  3ICB A;  1RWY A;  1KCY A;  1BJF A;  1KK8 C;  2M1U A;  2O60 A;  5HKZ A;  3CR4 X;  3BYA A;  2CTN A;  1SMG A;  4NDC A;  4OCI A;  1FI5 A;  4FQO A;  1K2H A;  1UHI A;  4ORA B;  1MQ1 A;  2GGM A;  1F55 A;  1GM0 A;  2KI6 C;  1AUI B;  3GK2 A;  3BXK A;  1OOG A;  2IS9 A;  2E6W A;  1C07 A;  3O4Y A;  4C0L A;  2PQL A;  2KLD A;  1CDL A;  3BUX B;  4JKT A;  2KI6 D;  5CSI A;  1TTX A;  1S26 D;  1Y1X A;  1EJ3 A;  3GK4 X;  2KPH A;  3VGO A;  3S0B A;  1XK4 A;  2BBN A;  4ZCU A;  3D77 A;  1XFR A;  2ZN8 A;  2EC6 C;  3M0W A;  2KSP A;  3PAT A;  1FW4 A;  1OMV A;  1S6I A;  4OZD A;  4CID A;  1DJY A;  2L98 A;  1GGW A;  1SK6 D;  4PE4 A;  1JF0 A;  4HRG A;  3SIB A;  1W7I B;  2LVV A;  4XJK A;  3VRO A;  2WCE A;  1CLB A;  3I5G C;  3LK0 A;  1DGU A;  3AAJ A;  1WY9 A;  2M7L A;  1X02 A;  2MJW B;  3NSL A;  1ZFS A;  3D74 A;  1K9U A;  2K2F A;  3N7H A;  4GGF C;  2LAN A;  1BR1 B;  2KBM A;  2WCL A;  4YRU A;  1LS8 A;  3DVK A;  1RK9 A;  2KYC A;  1GQM A;  1J55 A;  2BCB A;  2F8P A;  1NYA A;  4I5K A;  4PHM A;  3PFV A;  4PE1 A;  1MUX A;  2ZRS A;  3NHI A;  2GTE A;  1IJ6 A;  1KQM B;  2KFH A;  1DEK A;  5ER4 X;  1IKU A;  1CKK A;  4DUQ A;  1QV0 A;  1N2D A;  1UHH A;  2ISD A;  1CDM A;  3K1E A;  1YRT B;  2A4J A;  2LAP A;  2K7O A;  2K2A A;  3C1V A;  1Q80 A;  3CDN A;  5DKQ A;  1JBA A;  5FYX A;  3FWC A;  1KFX L;  1OW4 A;  1SR6 C;  3VRN A;  4FQT A;  1KK7 Z;  1QV1 A;  4PHK A;  2R2I A;  1YUR A;  5EL2 A;  5G08 A;  2NLN A;  2Y1M A;  2LC5 A;  1B7T Y;  2LLS A;  1UHN A;  4GPL B;  3DF0 B;  3KEV A;  3EK4 A;  1XFU O;  5I2O A;  1OOI X;  1DT7 B;  3L4L A;  2Q91 A;  2JQ6 A;  1KK8 B;  1YUT A;  1RTP 1;  1Y1A A;  2SAS A;  1SW8 A;  2LNK A;  1T14 A;  4C0K A;  1IQ5 A;  1KK7 Y;  5D3O A;  3KO0 A;  2HF5 A;  3A4U B;  1S36 A;  3D76 A;  5HLV A;  1Z2C B;  1MXE A;  1WRL A;  1DJZ A;  3DXL A;  4NQG A;  3EKJ A;  1IH0 A;  2SCP A;  4CFR A;  4OV2 A;  2EC6 B;  1WLZ A;  2LHI A;  2JNX A;  1NX3 A;  3PLF B;  1B1G A;  3PAL A;  4R1E A;  1JFJ A;  1BF5 A;  1TOP A;  3VRP A;  1K94 A;  1BU3 A;  1B8C A;  1UHJ A;  5DIC A;  1TCO B;  1QTX A;  3I5G B;  4WQ2 A;  2HQW A;  1QXP A;  2WC5 A;  1M39 A;  2JZI A;  1CM1 A;  2M49 B;  3K21 A;  1SCM B;  3BUM B;  2WCF A;  1J7P A;  2FJY A;  1NX0 A;  1IWQ A;  3EVR A;  3JVT C;  5KTY A;  4M2O A;  1S6C A;  3OX6 A;  4OKH A;  3CR5 X;  3NSK A;  1KFU L;  1YRU B;  1HQV A;  1A4P A;  3CTN A;  4JPZ B;  3BUN B;  1TN4 A;  1YVH A;  2ZND A;  2JTT A;  2HPS A;  1XFX O;  1LVC D;  1TUJ A;  2EHB A;  4E68 A;  3DF0 A;  3R72 A;  1C7V A;  1A75 B;  5JOL A;  1HT9 A;  2GGZ A;  3A8R A;  3FE6 A;  2WC8 A;  1PUL A;  1TNW A;  1RJV A;  3DVJ A;  1R2U A;  5AXI A;  3EK7 A;  2PYQ A;  1RRO A;  2BE4 A;  3QRX A;  1EG3 A;  3TDI A;  3BFH A;  4YGB B;  3RLZ A;  4CLN A;  4CPV A;  1L2O C;  1WDC C;  1XA5 A;  2ZFD A;  3GOF A;  4INW A;  3R1V A;  3PJI A;  1LXF C;  3S0F A;  1DVI A;  5HKW A;  3EG5 B;  2M9G A;  3CWG A;  3SG6 A;  1OQP A;  1OZO A;  2F2O A;  2M1K B;  4M2P A;  3OBV A;  4NDB A;  3D0Y B;  3H4S E;  3CZ1 A;  1NP8 A;  1UP5 A;  1YVL A;  3LLE A;  3NSO A;  4QJ4 B;  1JF2 A;  2NXQ A;  2LMU A;  1J7R A;  3OB1 B;  3VB1 A;  1NCZ A;  4JD9 A;  3SG7 A;  1C3Z A;  2ZKM X;  3KPX A;  1A03 A;  1QX2 A;  3OX5 A;  1SL7 A;  4HRH A;  1CDP A;  4ORC B;  1B47 A;  1N65 A;  4L9M A;  3I5F C;  4GGF A;  2LLU A;  2KYF A;  1OMR A;  1TCF A;  3TS5 B;  2LE9 B;  4GUK A;  1IRJ A;  1DMO A;  5F6T A;  1QJT A;  1PVA A;  3B6X A;  1A75 A;  1CDN A;  2WCK A;  4A4B A;  2KDH A;  4AQI A;  1CB1 A;  4I5L B;  4DRW A;  3LK1 A;  3S0E A;  1KQV A;  1SCM C;  3FIA A;  1QAS A;  4PDZ A;  5K89 A;  2WCH A;  3JVT B;  3LL8 B;  3SG5 A;  1NPQ A;  2COL B;  2K7B A;  2QEH A;  1SCV A;  1CTR A;  2L2C A;  1OOF A;  3TDU A;  1J7Q A;  5PAL A;  3O2P A;  3O78 A;  1SYM A;  2JXL A;  5I2L A;  4PCW A;  5I94 A;  1CMG A;  3ZNI A;  1JWD A;  1MF8 B;  1NX1 A;  1QVI Z;  1W7J B;  2VRG A;  2ZN9 A;  1PSR A;  2K8M B;  2K7C A;  1ZMZ A;  2PVB A;  1OSA A;  4D1E A;  1YX7 A;  1ZUZ A;  3AKB A;  1OZS A;  2KHN A;  2KNE A;  1ODB A;  3D0Y A;  3GK1 A;  3JTD B;  3RM1 A;  1CFD A;  1SNL A;  2BKH B;  2AUC A;  1P28 A;  2LMT A;  3QME A;  4AQJ A;  1DTL A;  4YGD B;  5BPJ A;  3NXA A;  5AER A;  1L2O B;  1WDC B;  2Y1N A;  3LCP C;  5D69 A;  1QAT A;  2KLE A;  5HL1 A;  2JOJ A;  3PSR A;  4PE0 A;  1DJG A;  5HKY A;  3SS5 A;  1K93 D;  4YGE B;  2MA2 A;  1WLM A;  4DS7 A;  2DOQ A;  1WRK A;  3DVE A;  1K8U A;  4MEW A;  2V53 A;  3SS4 A;  4PHN A;  1DJX A;  2FOT A;  3PM8 A;  5IBW A;  1AHR A;  3AKA A;  1DF0 B;  1OOH A;  3SJS A;  1KWO C;  2MHH A;  5TNC A;  4KYN A;  1C3Y A;  1M63 B;  1W9Z A;  2BNX A;  2NCO A;  2NCP A;  1OMD A;  3I5I B;  4AOM A;  1BOC A;  3PN7 C;  1IJ5 A;  2FCD A;  2JT8 A;  1NSH A;  2TN4 A;  2ZRT A;  3SG3 A;  4YI9 A;  1UUS A;  5CPV A;  4DIR A;  2KAX A;  2LHL A;  1K95 A;  2K61 A;  3TDZ A;  3DD4 A;  3I5F B;  1SY9 A;  3O4X A;  2PMY A;  2I94 A;  4I5J A;  3TS5 C;  2WCB A;  2QEV A;  3R1P A;  1F71 A;  1E8A A;  3CZ0 A;  3CLN A;  3I5H B;  1F4O A;  1H8B A;  4MZL A;  5ER5 A;  2NZ0 A;  2HQ8 A;  2JNF A;  2L2E A;  5DKR A;  2KQY A;  1GJY A;  1OOJ A;  1AK8 A;  3UO9 A;  2JUL A;  5KSZ A;  3BUW B;  1REC A;  3WXA A;  2D8N A;  5FI6 A;  3CGA A;  2KI4 C;  3OHM B;  2QEO A;  3PM2 A;  3HCM A;  2PAL A;  4PE7 A;  1S3P A;  2P71 A;  2AMI A;  1B4C A;  1IIO A;  2BBM A;  1YR5 A;  4MRX A;  3KF9 A;  1B8L A;  4MSP A;  1TWO A;  2WCM A;  4IJ7 A;  4YGC B;  3DYE A;  4PT1 A;  2FJU B;  1TIZ A;  3BFB A;  2CT9 A;  3EK8 A;  3JTD C;  4ZCV A;  2BKI B;  2MLF C;  1F4Q A;  4HSZ A;  3B88 A;  3TUY C;  4WRI A;  3SIA A;  1DF0 A;  1V1G A;  3EVV A;  2L5Y A;  5FI7 A;  2JRF A;  2ERB A;  3CS1 A;  1G8I A;  4ETO A;  5D7F A;  1FF1 A;  1J1E A;  1ZAC A;  2CCM A;  1D1O A;  2MAZ A;  2YGU A;  1XFZ O;  4INX A;  1NCX A;  2LUC A;  4ORB B;  1ZOT B;  3EVU A;  4I5N B;  4CFQ A;  1KFX S;  1U5I B;  2LVI A;  1CFP A;  2FCE A;  3CYZ A;  1XO5 A;  4GGN A;  2L4H A;  3IVT A;  4QJ5 B;  1QLS A;  1H4B A; 
#chains in the Genus database with same CATH homology
 1PRW A;  2KAV A;  1A29 A;  1KWO B;  2M97 A;  2WOS A;  3I5I C;  3MSE B;  4YBH B;  2OS8 B;  3PN7 B;  1PSB A;  1BR4 B;  1NX2 A;  2JT3 A;  1JFK A;  2BL0 C;  2O5G A;  1RFJ A;  2LLT A;  2KGB C;  2Y5I A;  2L51 A;  1JC2 A;  2MLE C;  1LKJ A;  4MZK A;  3VRR A;  1J1D A;  4IL1 A;  1C7W A;  1NUB A;  1YUU A;  2HET A;  4N1G A;  4Q04 A;  3I5H C;  4MN0 A;  1ALV A;  1XYD A;  1YTZ C;  1QIV A;  2I2R E;  2LCP A;  4OVN F;  2MBX A;  2M3W A;  1BT6 A;  1IG5 A;  2CBL A;  3BOW B;  1PK0 D;  2G9B A;  5I8N A;  1MHO A;  1MXL C;  1OE9 B;  3KHE A;  1AVS A;  3O6B A;  1VRK A;  2KBI A;  2KAY A;  1AJ5 A;  1QX5 B;  1NWD A;  2OTG C;  1N0Y A;  1JUO A;  1B9A A;  2KI4 B;  4YGA A;  1M45 A;  2M7N A;  3F45 A;  3SG4 A;  1IQ3 A;  1K9P A;  1FPW A;  2Y4Q A;  1MR8 A;  1BOD A;  1AP4 A;  1K9K A;  3D10 A;  2G2B A;  1F70 A;  4MLW A;  2JC2 A;  3FS7 A;  4GNK B;  3BQ3 A;  4C0J A;  1CLM A;  4P5O E;  1U5I A;  1DJW A;  2BE6 A;  2JPT A;  4GAO A;  4MVF A;  1KFU S;  4PAL A;  1JSA A;  2LV7 A;  2BCA A;  3TUY B;  3HX4 A;  1G33 A;  2OPO A;  2KGR A;  1CM4 A;  2E30 A;  2M8U A;  1GGZ A;  1XFY O;  1CMF A;  2MRD A;  3IF7 A;  2PSR A;  1BMO A;  2I18 A;  2LP2 A;  1FI6 A;  1XK4 C;  2JWW A;  1SL9 A;  1XFW O;  1KSO A;  2KFF A;  2M29 A;  1CLL A;  5B8I B;  1UHK A;  5HLO A;  1PAL A;  1QVI Y;  2F3Z A;  1XVJ A;  1QIW A;  4MBE A;  1LA3 A;  1S5G Z;  1Y1U A;  4JQ0 D;  2F2P A;  2LM5 A;  1B7T Z;  2PRU A;  4WQ3 A;  3TZ1 A;  4MZJ A;  1QS7 A;  4OR9 B;  3OP0 A;  5AFP A;  4HRE E;  1S1E A;  1EH2 A;  5I2Q A;  4N5X A;  1QLK A;  2OS8 C;  2P6B B;  3BOW A;  1G4Y R;  1EG4 A;  2EGD A;  4XYN A;  3IQQ A;  1CNP A;  4GBA A;  1L7Z A;  2H61 A;  2QPT A;  4PHJ A;  5J3X A;  1EXR A;  1FBV A;  1SKT A;  2BL0 B;  1BG1 A;  3DVM A;  1S5G Y;  3WHU B;  5CSN A;  1TNQ A;  4DCK A;  5JJG A;  1M46 A;  2JT0 A;  2LVJ A;  4M2Q A;  5KU1 A;  1KSM A;  1TRF A;  1TNP A;  1F8H A;  1R6P A;  1DJH A;  1EL4 A;  1Y6W A;  1AJ4 A;  3BUO B;  2LMV A;  4ICB A;  2H61 C;  2F33 A;  2M0R A;  3SG2 A;  1S6J A;  1V1F A;  2JXC A;  5AEQ A;  3OB2 B;  2L50 A;  2LVK A;  5CSF A;  3WHT B;  2L4I A;  4N1F A;  2KOT A;  2F3Y A;  2OTG B;  2QAC A;  3VRQ A;  2CXJ A;  2B1U A;  1UWO A;  1LA0 A;  5AAN A;  4A4C A;  2PAS A;  1DJI A;  1BLQ A;  1DGV A;  4FTG A;  2L0P A;  1PVB A;  1CFF A;  4F0Z B;  5GQQ C;  1B8R A;  1SRA A;  2K7D A;  1K96 A;  3AAK A;  2K0J A;  1MWN A;  1NCY A;  4JWQ A;  1F54 A;  1WRZ A;  4BY5 A;  3E3R A;  1UUR A;  1K90 D;  2BCX A;  1TNX A;  1LIN A;  1XFV O;  2Q4U A;  2L5X B;  2KFG A;  2GV5 A;  4TNC A;  1CFC A;  1A2X A;  4P2Y B;  3ZWH A;  1YX8 A;  4QJ3 B;  5HYD A;  4UPG A;  2BEC A;  2KQ6 A;  4MRY A;  1KQM C;  3EKH A;  3NSI A;  2I7A A;  4XJK B;  1J7O A;  4NDD A;  4YI8 A;  2H2K A;  2JTZ A;  3CZT X;  2WOR A;  1SBJ A;  2ZNE A;  2AAO A;  2WND A;  3IQO A;  2CNP A;  4BY4 A;  3CR2 A;  1YUS A;  1ALW A;  5DKN A;  1QX7 A;  1SR6 B;  1M31 A;  4U8D A;  2LP3 A;  1NIW A;  4GFT A;  1Y0V H;  3FWB A;  2LUX A;  1SL8 A;  1SPY A;  4USL A;  1IGV A;  2JU0 A;  5CSJ A;  3WNX B;  2RGI A;  3ICB A;  1RWY A;  1KCY A;  1BJF A;  1KK8 C;  2M1U A;  2O60 A;  5HKZ A;  3CR4 X;  3BYA A;  2CTN A;  1SMG A;  4NDC A;  4OCI A;  1FI5 A;  4FQO A;  1K2H A;  1UHI A;  4ORA B;  1MQ1 A;  2GGM A;  1F55 A;  2KI6 C;  1AUI B;  3GK2 A;  3BXK A;  2IS9 A;  1C07 A;  2E6W A;  3O4Y A;  4C0L A;  1CDL A;  3BUX B;  2KI6 D;  5CSI A;  1TTX A;  1S26 D;  1Y1X A;  1EJ3 A;  3GK4 X;  3VGO A;  1XK4 A;  2BBN A;  4ZCU A;  2ZN8 A;  2EC6 C;  3M0W A;  2KSP A;  3PAT A;  1FW4 A;  1OMV A;  1S6I A;  4CID A;  1DJY A;  2L98 A;  1GGW A;  1SK6 D;  4PE4 A;  1JF0 A;  4HRG A;  3SIB A;  1W7I B;  2LVV A;  4XJK A;  3VRO A;  2WCE A;  1CLB A;  3I5G C;  3LK0 A;  1DGU A;  3AAJ A;  1WY9 A;  2M7L A;  1X02 A;  2MJW B;  3NSL A;  1ZFS A;  1K9U A;  2K2F A;  4GGF C;  2LAN A;  1BR1 B;  2KBM A;  4YRU A;  3DVK A;  1RK9 A;  2KYC A;  1GQM A;  1J55 A;  2BCB A;  2F8P A;  1NYA A;  4I5K A;  4PHM A;  3PFV A;  4PE1 A;  1MUX A;  2ZRS A;  1IJ6 A;  1KQM B;  2KFH A;  5ER4 X;  1CKK A;  1IKU A;  4DUQ A;  1QV0 A;  1N2D A;  1UHH A;  2ISD A;  1CDM A;  1YRT B;  2A4J A;  2LAP A;  2K7O A;  2K2A A;  3C1V A;  1Q80 A;  5DKQ A;  1JBA A;  5FYX A;  3FWC A;  1KFX L;  1SR6 C;  3VRN A;  1KK7 Z;  1QV1 A;  4PHK A;  2R2I A;  1YUR A;  5G08 A;  2NLN A;  2Y1M A;  2LC5 A;  1B7T Y;  2LLS A;  1UHN A;  4GPL B;  3DF0 B;  3KEV A;  3EK4 A;  1XFU O;  5I2O A;  1DT7 B;  2Q91 A;  2JQ6 A;  1KK8 B;  1YUT A;  1RTP 1;  1Y1A A;  2SAS A;  1SW8 A;  2LNK A;  4C0K A;  1IQ5 A;  1KK7 Y;  3KO0 A;  2HF5 A;  3A4U B;  1S36 A;  5HLV A;  1MXE A;  1WRL A;  1DJZ A;  4NQG A;  3EKJ A;  1IH0 A;  2SCP A;  4CFR A;  4OV2 A;  2EC6 B;  1WLZ A;  2LHI A;  2JNX A;  1NX3 A;  3PLF B;  1B1G A;  3PAL A;  4R1E A;  1JFJ A;  1BF5 A;  1TOP A;  3VRP A;  1K94 A;  1BU3 A;  1B8C A;  1UHJ A;  1TCO B;  1QTX A;  3I5G B;  4WQ2 A;  2HQW A;  1QXP A;  1M39 A;  2JZI A;  1CM1 A;  2M49 B;  3K21 A;  1SCM B;  3BUM B;  2WCF A;  1J7P A;  1NX0 A;  1IWQ A;  3EVR A;  3JVT C;  5KTY A;  4M2O A;  1S6C A;  3OX6 A;  4OKH A;  3CR5 X;  3NSK A;  1KFU L;  1YRU B;  1HQV A;  1A4P A;  3CTN A;  4JPZ B;  3BUN B;  1TN4 A;  1YVH A;  2ZND A;  2JTT A;  2HPS A;  1XFX O;  1LVC D;  2EHB A;  4E68 A;  3DF0 A;  1C7V A;  1A75 B;  5JOL A;  1HT9 A;  2GGZ A;  3A8R A;  2WC8 A;  1PUL A;  1TNW A;  1RJV A;  3DVJ A;  1R2U A;  5AXI A;  3EK7 A;  2BE4 A;  1RRO A;  3QRX A;  1EG3 A;  3TDI A;  4YGB B;  3RLZ A;  4CLN A;  4CPV A;  1L2O C;  1WDC C;  1XA5 A;  2ZFD A;  3GOF A;  1LXF C;  1DVI A;  5HKW A;  2M9G A;  3CWG A;  3SG6 A;  1OQP A;  1OZO A;  2F2O A;  2M1K B;  4M2P A;  4NDB A;  3D0Y B;  3H4S E;  3NSO A;  1NP8 A;  1UP5 A;  1YVL A;  3LLE A;  4QJ4 B;  1JF2 A;  2NXQ A;  2LMU A;  1J7R A;  3OB1 B;  1NCZ A;  3SG7 A;  2ZKM X;  3KPX A;  1A03 A;  1QX2 A;  3OX5 A;  1SL7 A;  4HRH A;  1CDP A;  4ORC B;  1B47 A;  1N65 A;  4L9M A;  3I5F C;  4GGF A;  2LLU A;  2KYF A;  1OMR A;  1TCF A;  3TS5 B;  2LE9 B;  4GUK A;  1IRJ A;  1DMO A;  5F6T A;  1QJT A;  1PVA A;  1A75 A;  1CDN A;  4A4B A;  2KDH A;  4AQI A;  1CB1 A;  4I5L B;  4DRW A;  3LK1 A;  1KQV A;  1SCM C;  3FIA A;  1QAS A;  4PDZ A;  5K89 A;  3JVT B;  3LL8 B;  3SG5 A;  1NPQ A;  2COL B;  2K7B A;  1SCV A;  1CTR A;  3TDU A;  1J7Q A;  5PAL A;  3O2P A;  3O78 A;  1SYM A;  2JXL A;  5I2L A;  4PCW A;  1CMG A;  3ZNI A;  1JWD A;  1MF8 B;  1NX1 A;  1QVI Z;  1W7J B;  2VRG A;  2ZN9 A;  1PSR A;  2K8M B;  2K7C A;  1ZMZ A;  2PVB A;  1OSA A;  4D1E A;  1YX7 A;  1ZUZ A;  3AKB A;  1OZS A;  2KHN A;  2KNE A;  1ODB A;  3D0Y A;  3GK1 A;  3JTD B;  3RM1 A;  1CFD A;  1SNL A;  2BKH B;  2AUC A;  2LMT A;  4AQJ A;  1DTL A;  4YGD B;  5BPJ A;  3NXA A;  5AER A;  1L2O B;  1WDC B;  2Y1N A;  3LCP C;  5D69 A;  1QAT A;  2JOJ A;  3PSR A;  4PE0 A;  1DJG A;  5HKY A;  1K93 D;  4YGE B;  2MA2 A;  1WLM A;  4DS7 A;  2DOQ A;  1WRK A;  3DVE A;  1K8U A;  4MEW A;  2V53 A;  4PHN A;  1DJX A;  2FOT A;  3PM8 A;  5IBW A;  1AHR A;  3AKA A;  1DF0 B;  3SJS A;  1KWO C;  2MHH A;  5TNC A;  1M63 B;  2NCP A;  2NCO A;  3I5I B;  1OMD A;  4AOM A;  1BOC A;  3PN7 C;  1IJ5 A;  2FCD A;  2JT8 A;  1NSH A;  2TN4 A;  2ZRT A;  3SG3 A;  4YI9 A;  1UUS A;  5CPV A;  4DIR A;  2KAX A;  2LHL A;  1K95 A;  2K61 A;  3TDZ A;  3DD4 A;  3I5F B;  1SY9 A;  2PMY A;  2I94 A;  4I5J A;  3TS5 C;  2WCB A;  1F71 A;  1E8A A;  3I5H B;  3CLN A;  1H8B A;  1F4O A;  4MZL A;  5ER5 A;  2NZ0 A;  2HQ8 A;  2JNF A;  2L2E A;  5DKR A;  2KQY A;  1GJY A;  1OOJ A;  1AK8 A;  5KSZ A;  2JUL A;  3BUW B;  1REC A;  3WXA A;  2D8N A;  3CGA A;  2KI4 C;  3OHM B;  3HCM A;  2PAL A;  4PE7 A;  1S3P A;  2AMI A;  1B4C A;  2BBM A;  1YR5 A;  4MRX A;  3KF9 A;  1B8L A;  4MSP A;  4YGC B;  2FJU B;  1TIZ A;  3EK8 A;  2CT9 A;  3JTD C;  4ZCV A;  2BKI B;  2MLF C;  1F4Q A;  4HSZ A;  3TUY C;  4WRI A;  3SIA A;  1DF0 A;  1V1G A;  3EVV A;  2JRF A;  3CS1 A;  1G8I A;  4ETO A;  5D7F A;  1FF1 A;  1J1E A;  1ZAC A;  2CCM A;  1D1O A;  2MAZ A;  1XFZ O;  1NCX A;  2LUC A;  4ORB B;  1ZOT B;  3EVU A;  4I5N B;  4CFQ A;  1KFX S;  1U5I B;  2LVI A;  1CFP A;  2FCE A;  1XO5 A;  4GGN A;  2L4H A;  4QJ5 B;  1QLS A;  1H4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...