2LNKA

Solution structure of ca-bound s100a4 in complex with non-muscle myosin iia
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
101
structure length
101
Chain Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, non-muscle IIa
publication title Asymmetric Mode of Ca(2+)-S100A4 Interaction with Nonmuscle Myosin IIA Generates Nanomolar Affinity Required for Filament Remodeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
total genus 31
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lnkA00
1UHKA 1J1DA 1EG3A 1MUXA 1K8UA 1IRJA 2K8MB 2MAZA 2BE6A 3BUNB 4PHJA 1K94A 2EC6B 3NSLA 1CFFA 4GGFA 2JT8A 2MRDA 2HPSA 1A03A 1KWOC 5ER5A 2K7BA 1DJGA 1JFKA 1F4OA 1K93D 1RROA 1NX3A 5GQQC 3ZNIA 2JC2A 1WLMA 2F8PA 4DRWA 1S36A 5G08A 5AERA 4PE7A 2P6BB 1CB1A 1NPQA 1AP4A 3OB1B 2A4JA 2HQ8A 2FJUB 1R2UA 1KWOB 3SG4A 1SL7A 2CBLA 5AEQA 1RWYA 1TCFA 2F2OA 4JWQA 1F8HA 3NSIA 4M2PA 1J7OA 1K9KA 2M7LA 2Y1MA 2KBIA 1YTZC 1DJZA 1LA3A 4PHMA 3BUMB 1OMRA 2ISDA 2HETA 1ZACA 1KSOA 2KI6D 3BOWA 2O5GA 4MVFA 2QACA 3ZWHA 1U5IB 3HCMA 1B1GA 1UP5A 1K2HA 1B4CA 4OVNF 1UHHA 2O60A 3D0YB 1BR4B 2KQ6A 2CXJA 4WRIA 1IG5A 1F70A 3KF9A 1QIWA 1CLBA 1S5GZ 3SG6A 4C0JA 1QLSA 1F71A 2MLEC 3DF0B 4QJ5B 1UHIA 2KGRA 1MHOA 1LVCD 1QV0A 1QVIZ 1S5GY 2D8NA 2L98A 1BT6A 1K90D 1Y1XA 1N0YA 2NCOA 3BUWB 3KPXA 1X02A 2NCPA 4GNKB 1J7RA 2BCAA 2PRUA 1CLMA 4HREE 4XJKA 1NX2A 3H4SE 1PVBA 1A29A 5CSIA 1QJTA 1TNQA 5HLVA 2M7NA 1SCMC 4QJ4B 1QATA 4OCIA 3E3RA 5CSFA 1W7IB 1CLLA 1XK4A 3DVKA 2LCPA 1DGVA 2WCFA 4DS7A 2K2AA 3FWCA 1KQMC 2VRGA 2F3ZA 2KHNA 2LM5A 4YGAA 3PATA 2JPTA 5CSNA 4ETOA 5KSZA 3SIAA 2FCDA 2QPTA 2Y5IA 4N5XA 3TZ1A 5I2OA 3OX5A 1JBAA 2BKIB 2WC8A 4MZLA 1UHNA 1SCMB 1EG4A 3FWBA 1LA0A 3SG3A 1C07A 1FI6A 2I2RE 1TNXA 1CDNA 2MA2A 1GQMA 1FW4A 2HF5A 2WCBA 1KQMB 3VRPA 1GGZA 2KAVA 1WLZA 2M9GA 4USLA 2H2KA 4PDZA 1QASA 1CDMA 2AUCA 2HQWA 2L0PA 3VGOA 4GPLB 1J7PA 1SPYA 1KSMA 1XFYO 4BY5A 3GK4X 3SG5A 1XK4C 1EH2A 4YI9A 3LL8B 1N65A 5D7FA 3RM1A 2E6WA 3LLEA 2OTGC 2PVBA 1Y1UA 3NSOA 3O6BA 2GGMA 4I5JA 2JXCA 3CR5X 2LAPA 4MRXA 1UHJA 4N1GA 4XJKB 2MLFC 4FTGA 5F6TA 1OMVA 2LVIA 1B8CA 3PN7C 1CM1A 2COLB 4MSPA 1TIZA 2AAOA 2LANA 3D0YA 1SBJA 3OHMB 2KBMA 3TDUA 2JTTA 1H8BA 1S26D 1QTXA 2M97A 2OTGB 1YX8A 4M2OA 5FYXA 5BPJA 4CFRA 1IKUA 3DF0A 2LP3A 1JFJA 1FBVA 1IQ5A 2FOTA 2ZN9A 3VROA 1TTXA 1YRUB 2V53A 5I8NA 2NZ0A 3PN7B 3O2PA 1CDPA 2BECA 1RTP1 2LVJA 4I5LB 1TRFA 1IWQA 1YVLA 3I5GC 2E30A 2PMYA 1KFXS 1JUOA 3BQ3A 1SW8A 1NX1A 2JXLA 5AANA 1KK7Z 3LCPC 4C0KA 1Y1AA 1M46A 2GGZA 1IJ6A 1BOCA 2I18A 2JRFA 2KAYA 4YI8A 3KEVA 3AKAA 1KK7Y 1OZSA 1DJHA 1XA5A 3PM8A 2OPOA 1LINA 2F3YA 1IGVA 2LLSA 3CGAA 4MZJA 3I5GB 4DCKA 1ALVA 1XVJA 1XFZO 5HYDA 2LLUA 1OZOA 2KFGA 1OE9B 2M1UA 5CPVA 1F54A 3GK2A 1L2OC 2ZN8A 4OR9B 1KFUS 4HRHA 1UURA 1H4BA 2ZNEA 1YR5A 2L5XB 2BKHB 4HRGA 1FF1A 1K9PA 1AJ5A 1F4QA 2ZRSA 4PE4A 1RECA 2K61A 1YRTB 3OP0A 4BY4A 1TN4A 5HKYA 1QX2A 2NLNA 5JJGA 3CR2A 1DMOA 1CFPA 1NSHA 2K7OA 5PALA 3EVUA 3KO0A 1DTLA 1BLQA 1SMGA 3I5FC 1OQPA 2LV7A 3DVMA 1QV1A 3IQQA 1W7JB 2DOQA 2JU0A 2JQ6A 2TN4A 4OV2A 4XYNA 1CKKA 1L2OB 1XFUO 1MXEA 4AQIA 2CT9A 4ZCUA 3EVRA 3CZTX 1AVSA 1EJ3A 2LP2A 4R1EA 5KTYA 1DF0A 1QVIY 1JF2A 2JNXA 3GK1A 4GBAA 5HLOA 1PSBA 3BYAA 4OKHA 2BL0C 3I5FB 1BU3A 1YUSA 5HKWA 2NXQA 3PSRA 1ZOTB 3D10A 2LVKA 2L50A 1MF8B 3LK1A 4HSZA 2KQYA 5DKRA 2R2IA 1B8RA 2PALA 2L51A 2MJWB 3A8RA 3BXKA 1MWNA 3WNXB 1JSAA 2EHBA 2KOTA 2M49B 3SG2A 3SG7A 1QS7A 1ZFSA 1S6IA 1M45A 1SYMA 2BL0B 3SJSA 1J7QA 2KI6C 1TNPA 5I2QA 1TOPA 2CCMA 5AFPA 1VRKA 4PHNA 1SY9A 1LKJA 1CFCA 2M3WA 1B47A 5DKQA 4CLNA 2ZNDA 3PLFB 2Y4QA 1PK0D 1G4YR 1DVIA 4Q04A 1BMOA 1IJ5A 4YGEB 4DUQA 5AXIA 1SKTA 4I5KA 2AMIA 3EKHA 1MQ1A 3M0WA 5K89A 1K96A 4C0LA 3PFVA 3JTDC 2LUCA 3SIBA 2JT0A 1QLKA 1YUTA 2BCXA 5IBWA 1WRZA 2KDHA 3F45A 2K2FA 1SR6C 4ORBB 2ZRTA 1YX7A 2FCEA 2G9BA 3IQOA 4YGCB 1DF0B 2LVVA 1AJ4A 1CMGA 3TUYC 1SRAA 4CIDA 4AQJA 2MBXA 1QX5B 1QXPA 1RK9A 3GOFA 4MRYA 3FS7A 3JTDB 5ER4X 3WHTB 3DD4A 1E8AA 1GJYA 1K9UA 1D1OA 3CTNA 4NDDA 2K0JA 1QX7A 1J1EA 1PSRA 2ZKMX 1CTRA 4GUKA 3VRNA 3CWGA 3VRRA 1SR6B 1C7VA 1CMFA 4L9MA 1CDLA 1MXLC 2KYFA 2MHHA 2WORA 1ZMZA 2JTZA 2WCEA 2B1UA 4A4BA 1SL8A 3A4UB 3TUYB 2BCBA 2K7DA 1S1EA 2BE4A 1DGUA 1M63B 2PASA 4YGBB 1GGWA 2Y1NA 4ICBA 2LHLA 1XO5A 2JNFA 1V1FA 3JVTC 2LNKA 1NIWA 1S6CA 3BUXB 3I5HC 1F55A 4PHKA 2CNPA 1ZUZA 1DJWA 1N2DA 1UUSA 4NQGA 1KCYA 3EKJA 4FQOA 1A2XA 3TS5C 2F33A 1CNPA 3OX6A 4PCWA 1WRLA 2KYCA 1B9AA 4U8DA 1MR8A 1B7TZ 4QJ3B 2ZFDA 3JVTB 2KSPA 1OMDA 3I5HB 2K7CA 1G33A 2KI4C 4F0ZB 3EK4A 1B7TY 5J3XA 1A4PA 3LK0A 1HT9A 1XFVO 2RGIA 1B8LA 1SK6D 3ICBA 3BUOB 1J55A 3DVJA 4M2QA 1CFDA 4N1FA 5HKZA 3TS5B 4ZCVA 4A4CA 1RJVA 1XYDA 1DJYA 2G2BA 3EK7A 1G8IA 2F2PA 1V1GA 1SCVA 5KU1A 1A75B 1UWOA 2JZIA 1WRKA 4GAOA 2LMUA 2KI4B 2LMVA 3MSEB 1XFXO 2WNDA 3AKBA 1ODBA 4E68A 1FI5A 4GGFC 2LMTA 3WXAA 5DKNA 1PULA 2M0RA 3EK8A 4I5NB 1EXRA 2I94A 3EVVA 1BODA 2BBMA 1BG1A 2SASA 2H61A 1NWDA 2JT3A 4WQ2A 2CTNA 3WHUB 1ALWA 2M1KB 4JPZB 4PE0A 1NCYA 2L2EA 1NYAA 5I2LA 1LXFC 2KFFA 4UPGA 1PRWA 2PSRA 3AAKA 1K95A 2KAXA 1S3PA 2JWWA 1EL4A 1L7ZA 4P5OE 1KQVA 4MEWA 1NCZA 1Y0VH 4P2YB 1WY9A 3OB2B 4MLWA 4MN0A 4CFQA 1DJIA 4TNCA 2M8UA 2SCPA 3K21A 3RLZA 2LE9B 2BBNA 1CM4A 3TDZA 1KFXL 1TCOB 3VRQA 3PALA 1DJXA 3NXAA 2JOJA 2LLTA 1FPWA 1SNLA 1IQ3A 1S6JA 3HX4A 2Q91A 2LHIA 1KK8C 2I7AA 5CSJA 3QRXA 2EGDA 1OOJA 3DVEA 3O4YA 2H61C 1M39A 1XFWO 1YVHA 5D69A 1JF0A 1BR1B 4CPVA 1NX0A 3KHEA 3O78A 2KGBC 4ORCB 1AUIB 2LUXA 1JC2A 2OS8C 3I5IC 2IS9A 1NUBA 1IH0A 2L4HA 1YUUA 1BF5A 3CS1A 4MBEA 4IL1A 4MZKA 4PE1A 3BOWB 3CLNA 3C1VA 1HQVA 1BJFA 4JQ0D 1KFUL 1KK8B 1C7WA 4YRUA 2M29A 2Q4UA 1DT7B 2WOSA 5B8IB 1YURA 3NSKA 5JOLA 4AOMA 2GV5A 4PALA 1NP8A 1JWDA 1NCXA 4NDCA 1PALA 1R6PA 1WDCC 5TNCA 2OS8B 1M31A 3I5IB 1A75A 1AHRA 3TDIA 4D1EA 2LC5A 3IF7A 4WQ3A 2KNEA 1SL9A 3CR4X 4YGDB 2EC6C 1QIVA 1Y6WA 2JULA 2L4IA 1RFJA 1AK8A 4GFTA 2KFHA 1Q80A 4DIRA 1PVAA 1U5IA 1OSAA 3AAJA 4ORAB 4NDBA 3FIAA 4GGNA 4YBHB 1WDCB 1TNWA
chains in the Genus database with same CATH superfamily
1UHKA 1J1DA 1EG3A 2ERBA 1MUXA 1K8UA 1IRJA 2K8MB 2MAZA 2BE6A 3BUNB 4PHJA 1K94A 2EC6B 3NSLA 1TUZA 1CFFA 4GGFA 2JT8A 2MRDA 2HPSA 1A03A 1DEKA 1KWOC 5ER5A 2K7BA 1DJGA 1JFKA 1F4OA 1K93D 1RROA 1NX3A 3D76A 5GQQC 2JC2A 3ZNIA 1WLMA 2F8PA 2BAPA 2P71A 3BFBA 4DRWA 1S36A 5G08A 5AERA 4PE7A 3O4XA 2P6BB 1CB1A 1NPQA 1AP4A 2QEHA 3OB1B 2A4JA 2HQ8A 3SS4A 2FJUB 1R2UA 3EG5B 1KWOB 3SG4A 1SL7A 2CBLA 5AEQA 1RWYA 1TCFA 2F2OA 4JWQA 1F8HA 3NSIA 4M2PA 1J7OA 1K9KA 2M7LA 2Y1MA 2KBIA 1YTZC 1DJZA 1LA3A 4PHMA 3BUMB 2WC6A 1OMRA 2ISDA 1W9ZA 2HETA 1ORGA 1ZACA 1KSOA 2KI6D 3BOWA 2O5GA 4MVFA 2QACA 3ZWHA 1U5IB 3HCMA 4IJ7A 1B1GA 1UP5A 1K2HA 1B4CA 2WC5A 4OVNF 2JPOA 1UHHA 2O60A 3D0YB 1BR4B 2KQ6A 2CXJA 4WRIA 1IG5A 1F70A 3B6XA 3KF9A 1OOGA 1QIWA 1CLBA 1S5GZ 3S0EA 3DZTA 3SG6A 4FQTA 3DXLA 4C0JA 1QLSA 1F71A 2MLEC 3DF0B 4QJ5B 1UHIA 2KGRA 1MHOA 1LVCD 1QV0A 1QVIZ 3N7HA 1S5GY 2D8NA 2L98A 1BT6A 1K90D 4JKTA 1Y1XA 1N0YA 2NCOA 3BUWB 3KPXA 1X02A 2NCPA 4GNKB 1J7RA 2BCAA 2PRUA 1CLMA 4HREE 4XJKA 1NX2A 3H4SE 1PVBA 1A29A 5CSIA 1QJTA 1TNQA 5HLVA 3FE8A 2M7NA 1SCMC 4QJ4B 3FE9A 1QATA 4OCIA 3DY9A 3E3RA 5CSFA 1W7IB 1CLLA 1XK4A 5DICA 3DVKA 2LCPA 1DGVA 5HL1A 3L4LA 2WCFA 4DS7A 2K2AA 3FWCA 1KQMC 2VRGA 2F3ZA 2KHNA 2LM5A 4YGAA 3PATA 2JPTA 5CSNA 4ETOA 5KSZA 3SIAA 2FCDA 2QPTA 2Y5IA 4N5XA 3TZ1A 5I2OA 1LS8A 2QEVA 3OX5A 1JBAA 2BKIB 2WC8A 4MZLA 1UHNA 1SCMB 1EG4A 3FWBA 1LA0A 3SG3A 1C07A 1FI6A 2I2RE 3BFHA 1TNXA 1CDNA 2MA2A 1GQMA 1FW4A 2HF5A 2WCBA 1KQMB 3K1EA 3SS5A 3VRPA 3UNWA 2K60A 3BFAA 1GGZA 2KAVA 1WLZA 2M9GA 4USLA 2H2KA 4PDZA 3S0BA 1QASA 1CDMA 2AUCA 2HQWA 2L0PA 3VGOA 4GPLB 1J7PA 1SPYA 1KSMA 3UO9A 1XFYO 4BY5A 3GK4X 3SG5A 1XK4C 1EH2A 4YI9A 3LL8B 1N65A 5D7FA 3RM1A 2E6WA 3LLEA 2OTGC 2PVBA 1Y1UA 3NSOA 3O6BA 2GGMA 3D73A 2JXCA 2P70A 4I5JA 3CR5X 2WCLA 1GM0A 2LAPA 4MRXA 1UHJA 4N1GA 4XJKB 2MLFC 1OOHA 4FTGA 5F6TA 1OMVA 1TUJA 2LVIA 2QDIA 1B8CA 3PN7C 1CM1A 2COLB 4MSPA 1TIZA 2AAOA 2LANA 3D0YA 1SBJA 3OHMB 2KBMA 1OW4A 3TDUA 2JTTA 1H8BA 1S26D 1QTXA 2M97A 3D78A 2OTGB 1YX8A 1DQEA 4M2OA 5FYXA 5BPJA 4CFRA 1IKUA 3DF0A 2LP3A 1JFJA 1FBVA 1IQ5A 2FOTA 2ZN9A 3VROA 2FJYA 1TTXA 3CZ0A 1YRUB 2V53A 5I8NA 2NZ0A 3PN7B 3O2PA 1SSEB 1CDPA 2BECA 1RTP1 2LVJA 4I5LB 1TRFA 1IWQA 1YVLA 3I5GC 2E30A 2PMYA 4PT1A 1KFXS 1JUOA 3BQ3A 1SW8A 4KYNA 1NX1A 2JXLA 1OOIX 5AANA 1KK7Z 1XFRA 3LCPC 4C0KA 1Y1AA 1M46A 2GGZA 1IJ6A 1BOCA 2I18A 2JRFA 2KAYA 4YI8A 3KEVA 3AKAA 1KK7Y 1OZSA 4INXA 1DJHA 1XA5A 3PM8A 2OPOA 1LINA 2F3YA 3D74A 1IGVA 2LLSA 3CGAA 4MZJA 3I5GB 4DCKA 1ALVA 1XVJA 1XFZO 5HYDA 2LLUA 1OZOA 3S0FA 2KFGA 1OE9B 2M1UA 5CPVA 1F54A 3GK2A 1L2OC 2ZN8A 4OR9B 1KFUS 4HRHA 1UURA 1H4BA 2ZNEA 1YR5A 2L5XB 2BKHB 3CABA 4HRGA 1FF1A 2H8VA 1K9PA 1AJ5A 1F4QA 2ZRSA 4PE4A 1RECA 2K61A 1YRTB 3OP0A 4BY4A 1TN4A 5HKYA 1QX2A 2NLNA 5JJGA 3CR2A 1DMOA 3S0AA 3B86A 3QMEA 1CFPA 1NSHA 2K7OA 5PALA 3EVUA 3KO0A 1DTLA 1BLQA 1SMGA 3I5FC 1OQPA 2LV7A 3DVMA 1QV1A 3IQQA 3NHTA 1W7JB 2DOQA 2JU0A 2JQ6A 2TN4A 4OV2A 4XYNA 1CKKA 1L2OB 1XFUO 1MXEA 4AQIA 2CT9A 4ZCUA 3EVRA 3CZTX 1AVSA 3CDNA 1EJ3A 2LP2A 4R1EA 5FI7A 5KTYA 1DF0A 1QVIY 3IVTA 1JF2A 2JNXA 3GK1A 4GBAA 5HLOA 1PSBA 3BYAA 4OKHA 2BL0C 3I5FB 2QEOA 1BU3A 1YUSA 5HKWA 1Z2CB 3D77A 2NXQA 1P28A 1ZOTB 3PSRA 3BJHA 3D10A 2LVKA 2L50A 1MF8B 3LK1A 4HSZA 2BNXA 2KQYA 5DKRA 2R2IA 1B8RA 2PALA 1TWOA 2L51A 2MJWB 3A8RA 3BXKA 1MWNA 3WNXB 1JSAA 2EHBA 2KOTA 2M49B 3SG2A 3SG7A 1QS7A 1ZFSA 1S6IA 1M45A 1SYMA 2BL0B 3SJSA 1J7QA 2KI6C 1TNPA 5I2QA 1TOPA 3R72A 2CCMA 5AFPA 1VRKA 4PHNA 1SY9A 3VB1A 1LKJA 1CFCA 2M3WA 1B47A 5DKQA 4CLNA 2ZNDA 3PLFB 2Y4QA 1PK0D 1G4YR 1DVIA 3CYZA 4Q04A 1BMOA 2KLDA 3CZ2A 1IJ5A 3B7AA 4YGEB 3D75A 5AXIA 3R1OA 4DUQA 1SKTA 4I5KA 2AMIA 3EKHA 1MQ1A 3M0WA 5K89A 1K96A 3NHIA 4C0LA 3PFVA 5EL2A 3JTDC 2LUCA 3SIBA 2JT0A 1QLKA 1YUTA 2BCXA 5IBWA 1WRZA 2KDHA 3F45A 2K2FA 1SR6C 4ORBB 2ZRTA 1YX7A 2FCEA 2G9BA 2WCMA 3IQOA 4YGCB 1DF0B 2LVVA 2PYQA 1AJ4A 3VRNA 1CMGA 3TUYC 1SRAA 4CIDA 4AQJA 2MBXA 1QX5B 1QXPA 1RK9A 3GOFA 4MRYA 3FS7A 3JTDB 5ER4X 3WHTB 3DD4A 1E8AA 1GJYA 1K9UA 1D1OA 3CTNA 4NDDA 2K0JA 1QX7A 1J1EA 1PSRA 2KLEA 1CTRA 2ZKMX 4GUKA 3CWGA 5D3OA 1SR6B 3VRRA 5I94A 4L9MA 1CDLA 1MXLC 2KYFA 2MHHA 2WORA 1ZMZA 2JTZA 2WCEA 2B1UA 4A4BA 1SL8A 3A4UB 3TUYB 2BCBA 2K7DA 4OZDA 1S1EA 5FI2A 3DYEA 2BE4A 1DGUA 1M63B 2PASA 4YGBB 1GGWA 1QWVA 2Y1NA 4ICBA 2LHLA 1XO5A 3FE6A 2JNFA 1V1FA 3JVTC 2QEBA 2LNKA 1NIWA 1S6CA 3BUXB 3I5HC 1F55A 4PHKA 1DELA 1OOFA 2CNPA 1ZUZA 1DJWA 1N2DA 1UUSA 4NQGA 1KCYA 3EKJA 4FQOA 1A2XA 3TS5C 3V2LA 2F33A 1CNPA 3OX6A 4PCWA 1WRLA 2KYCA 1B9AA 4U8DA 1MR8A 1B7TZ 4QJ3B 4JD9A 2ZFDA 3JVTB 2KSPA 1OMDA 3I5HB 2K7CA 1G33A 2KI4C 4F0ZB 3EK4A 1B7TY 5J3XA 1A4PA 3LK0A 2PQLA 1HT9A 1XFVO 2RGIA 1B8LA 1SK6D 3ICBA 3BUOB 1DC1A 1J55A 3DVJA 4M2QA 1CFDA 4N1FA 5HKZA 3TS5B 4ZCVA 4A4CA 1RJVA 1XYDA 3B88A 3NGVA 1DJYA 2G2BA 3EK7A 1G8IA 2F2PA 3PM2A 1V1GA 1SCVA 5KU1A 2KPHA 1A75B 1UWOA 2L5YA 3PJIA 3Q8IA 2JZIA 1WRKA 1C7VA 4GAOA 4INWA 2LMUA 2KI4B 2GTEA 2LMVA 3MSEB 1XFXO 2WNDA 3AKBA 3RZSA 1ODBA 4E68A 1FI5A 3L4AA 2LMTA 4GGFC 3WXAA 5DKNA 1PULA 2M0RA 3EK8A 4I5NB 1EXRA 2I94A 3EVVA 1BODA 2BBMA 1BG1A 1Z4HA 2SASA 2H61A 1NWDA 2JT3A 4WQ2A 2CTNA 3WHUB 1ALWA 2M1KB 4JPZB 4PE0A 1NCYA 2L2EA 1NYAA 5I2LA 1LXFC 2KFFA 4UPGA 2YGUA 1PRWA 2PSRA 3AAKA 3OBVA 1K95A 2KAXA 1S3PA 3L47A 2JWWA 1EL4A 1L7ZA 4P5OE 1KQVA 4MEWA 1NCZA 1Y0VH 4P2YB 1WY9A 3OB2B 4MLWA 4MN0A 4CFQA 1DJIA 4TNCA 2M8UA 2SCPA 3K21A 3RLZA 1C3YA 2LE9B 2BBNA 1CM4A 3TDZA 1KFXL 1TCOB 3VRQA 3PALA 1DJXA 3NXAA 2JOJA 2LLTA 1FPWA 1SNLA 1IQ3A 1S6JA 3HX4A 2Q91A 2LHIA 1KK8C 2I7AA 5CSJA 3QRXA 2EGDA 1OOJA 3DVEA 3O4YA 2H61C 1M39A 1XFWO 1YVHA 3S0DA 5D69A 1JF0A 1BR1B 4CPVA 2L2CA 1NX0A 3KHEA 3O78A 2KGBC 4ORCB 1AUIB 2LUXA 1JC2A 2OS8C 3I5IC 2IS9A 1NUBA 3CZ1A 1IH0A 2L4HA 1YUUA 1BF5A 3CS1A 4MBEA 4IL1A 3B87A 1T14A 4MZKA 4PE1A 3BOWB 3S0GA 3CLNA 3C1VA 1HQVA 1BJFA 4JQ0D 1KFUL 1KK8B 1C7WA 4YRUA 2M29A 1C3ZA 2Q4UA 3OGNA 2WOSA 5B8IB 1DT7B 1YURA 3NSKA 5JOLA 4AOMA 2GV5A 4PALA 3R1PA 2WCHA 1NP8A 1JWDA 1NCXA 4NDCA 1PALA 1R6PA 1WDCC 5TNCA 2OS8B 1M31A 3I5IB 1A75A 1AHRA 3TDIA 4D1EA 2LC5A 3IF7A 4WQ3A 1IIOA 2KNEA 1SL9A 3CR4X 4YGDB 2EC6C 1QIVA 1Y6WA 2JULA 2L4IA 2WCKA 1RFJA 1AK8A 4GFTA 2KFHA 1Q80A 4DIRA 3R1VA 1PVAA 1U5IA 1OSAA 3AAJA 4F7FA 2WCJA 4ORAB 4NDBA 3SS3A 3FIAA 4GGNA 5FI6A 4YBHB 1CMFA 1WDCB 1TNWA
chains in the Genus database with same CATH topology
1UHKA 1J1DA 1EG3A 1MUXA 1K8UA 1IRJA 2K8MB 2MAZA 2BE6A 3BUNB 4PHJA 1K94A 2EC6B 3NSLA 1CFFA 4GGFA 2JT8A 2MRDA 2HPSA 1A03A 1KWOC 5ER5A 2K7BA 1DJGA 1JFKA 1F4OA 1K93D 1RROA 1NX3A 5GQQC 3ZNIA 2JC2A 1WLMA 2F8PA 4DRWA 1S36A 5G08A 5AERA 4PE7A 2P6BB 1CB1A 1NPQA 1AP4A 3OB1B 2A4JA 2HQ8A 2FJUB 1R2UA 1KWOB 3SG4A 1SL7A 2CBLA 5AEQA 1RWYA 1TCFA 2F2OA 4JWQA 1F8HA 3NSIA 4M2PA 1J7OA 1K9KA 2M7LA 2Y1MA 2KBIA 1YTZC 1DJZA 1LA3A 4PHMA 3BUMB 1OMRA 2ISDA 2HETA 1ZACA 1KSOA 2KI6D 3BOWA 2O5GA 4MVFA 2QACA 3ZWHA 1U5IB 3HCMA 1B1GA 1UP5A 1K2HA 1B4CA 4OVNF 1UHHA 2O60A 3D0YB 1BR4B 2KQ6A 2CXJA 4WRIA 1IG5A 1F70A 3KF9A 1QIWA 1CLBA 1S5GZ 3SG6A 4C0JA 1QLSA 1F71A 2MLEC 3DF0B 4QJ5B 1UHIA 2KGRA 1MHOA 1LVCD 1QV0A 1QVIZ 1S5GY 2D8NA 2L98A 1BT6A 1K90D 1Y1XA 1N0YA 2NCOA 3BUWB 3KPXA 1X02A 2NCPA 4GNKB 1J7RA 2BCAA 2PRUA 1CLMA 4HREE 4XJKA 1NX2A 3H4SE 1PVBA 1A29A 5CSIA 1QJTA 1TNQA 5HLVA 2M7NA 1SCMC 4QJ4B 1QATA 4OCIA 3E3RA 5CSFA 1W7IB 1CLLA 1XK4A 3DVKA 2LCPA 1DGVA 2WCFA 4DS7A 2K2AA 3FWCA 1KQMC 2VRGA 2F3ZA 2KHNA 2LM5A 4YGAA 3PATA 2JPTA 5CSNA 4ETOA 5KSZA 3SIAA 2FCDA 2QPTA 2Y5IA 4N5XA 3TZ1A 5I2OA 3OX5A 1JBAA 2BKIB 2WC8A 4MZLA 1UHNA 1SCMB 1EG4A 3FWBA 1LA0A 3SG3A 1C07A 1FI6A 2I2RE 1TNXA 1CDNA 2MA2A 1GQMA 1FW4A 2HF5A 2WCBA 1KQMB 3VRPA 1GGZA 2KAVA 1WLZA 2M9GA 4USLA 2H2KA 4PDZA 1QASA 1CDMA 2AUCA 2HQWA 2L0PA 3VGOA 4GPLB 1J7PA 1SPYA 1KSMA 1XFYO 4BY5A 3GK4X 3SG5A 1XK4C 1EH2A 4YI9A 3LL8B 1N65A 5D7FA 3RM1A 2E6WA 3LLEA 2OTGC 2PVBA 1Y1UA 3NSOA 3O6BA 2GGMA 4I5JA 2JXCA 3CR5X 2LAPA 4MRXA 1UHJA 4N1GA 4XJKB 2MLFC 4FTGA 5F6TA 1OMVA 2LVIA 1B8CA 3PN7C 1CM1A 2COLB 4MSPA 1TIZA 2AAOA 2LANA 3D0YA 1SBJA 3OHMB 2KBMA 3TDUA 2JTTA 1H8BA 1S26D 1QTXA 2M97A 2OTGB 1YX8A 4M2OA 5FYXA 5BPJA 4CFRA 1IKUA 3DF0A 2LP3A 1JFJA 1FBVA 1IQ5A 2FOTA 2ZN9A 3VROA 1TTXA 1YRUB 2V53A 5I8NA 2NZ0A 3PN7B 3O2PA 1CDPA 2BECA 1RTP1 2LVJA 4I5LB 1TRFA 1IWQA 1YVLA 3I5GC 2E30A 2PMYA 1KFXS 1JUOA 3BQ3A 1SW8A 1NX1A 2JXLA 5AANA 1KK7Z 3LCPC 4C0KA 1Y1AA 1M46A 2GGZA 1IJ6A 1BOCA 2I18A 2JRFA 2KAYA 4YI8A 3KEVA 3AKAA 1KK7Y 1OZSA 1DJHA 1XA5A 3PM8A 2OPOA 1LINA 2F3YA 1IGVA 2LLSA 3CGAA 4MZJA 3I5GB 4DCKA 1ALVA 1XVJA 1XFZO 5HYDA 2LLUA 1OZOA 2KFGA 1OE9B 2M1UA 5CPVA 1F54A 3GK2A 1L2OC 2ZN8A 4OR9B 1KFUS 4HRHA 1UURA 1H4BA 2ZNEA 1YR5A 2L5XB 2BKHB 4HRGA 1FF1A 1K9PA 1AJ5A 1F4QA 2ZRSA 4PE4A 1RECA 2K61A 1YRTB 3OP0A 4BY4A 1TN4A 5HKYA 1QX2A 2NLNA 5JJGA 3CR2A 1DMOA 1CFPA 1NSHA 2K7OA 5PALA 3EVUA 3KO0A 1DTLA 1BLQA 1SMGA 3I5FC 1OQPA 2LV7A 3DVMA 1QV1A 3IQQA 1W7JB 2DOQA 2JU0A 2JQ6A 2TN4A 4OV2A 4XYNA 1CKKA 1L2OB 1XFUO 1MXEA 4AQIA 2CT9A 4ZCUA 3EVRA 3CZTX 1AVSA 1EJ3A 2LP2A 4R1EA 5KTYA 1DF0A 1QVIY 1JF2A 2JNXA 3GK1A 4GBAA 5HLOA 1PSBA 3BYAA 4OKHA 2BL0C 3I5FB 1BU3A 1YUSA 5HKWA 2NXQA 3PSRA 1ZOTB 3D10A 2LVKA 2L50A 1MF8B 3LK1A 4HSZA 2KQYA 5DKRA 2R2IA 1B8RA 2PALA 2L51A 2MJWB 3A8RA 3BXKA 1MWNA 3WNXB 1JSAA 2EHBA 2KOTA 2M49B 3SG2A 3SG7A 1QS7A 1ZFSA 1S6IA 1M45A 1SYMA 2BL0B 3SJSA 1J7QA 2KI6C 1TNPA 5I2QA 1TOPA 2CCMA 5AFPA 1VRKA 4PHNA 1SY9A 1LKJA 1CFCA 2M3WA 1B47A 5DKQA 4CLNA 2ZNDA 3PLFB 2Y4QA 1PK0D 1G4YR 1DVIA 4Q04A 1BMOA 1IJ5A 4YGEB 4DUQA 5AXIA 1SKTA 4I5KA 2AMIA 3EKHA 1MQ1A 3M0WA 5K89A 1K96A 4C0LA 3PFVA 3JTDC 2LUCA 3SIBA 2JT0A 1QLKA 1YUTA 2BCXA 5IBWA 1WRZA 2KDHA 3F45A 2K2FA 1SR6C 4ORBB 2ZRTA 1YX7A 2FCEA 2G9BA 3IQOA 4YGCB 1DF0B 2LVVA 1AJ4A 1CMGA 3TUYC 1SRAA 4CIDA 4AQJA 2MBXA 1QX5B 1QXPA 1RK9A 3GOFA 4MRYA 3FS7A 3JTDB 5ER4X 3WHTB 3DD4A 1E8AA 1GJYA 1K9UA 1D1OA 3CTNA 4NDDA 2K0JA 1QX7A 1J1EA 1PSRA 2ZKMX 1CTRA 4GUKA 3VRNA 3CWGA 3VRRA 1SR6B 1C7VA 1CMFA 4L9MA 1CDLA 1MXLC 2KYFA 2MHHA 2WORA 1ZMZA 2JTZA 2WCEA 2B1UA 4A4BA 1SL8A 3A4UB 3TUYB 2BCBA 2K7DA 1S1EA 2BE4A 1DGUA 1M63B 2PASA 4YGBB 1GGWA 2Y1NA 4ICBA 2LHLA 1XO5A 2JNFA 1V1FA 3JVTC 2LNKA 1NIWA 1S6CA 3BUXB 3I5HC 1F55A 4PHKA 2CNPA 1ZUZA 1DJWA 1N2DA 1UUSA 4NQGA 1KCYA 3EKJA 4FQOA 1A2XA 3TS5C 2F33A 1CNPA 3OX6A 4PCWA 1WRLA 2KYCA 1B9AA 4U8DA 1MR8A 1B7TZ 4QJ3B 2ZFDA 3JVTB 2KSPA 1OMDA 3I5HB 2K7CA 1G33A 2KI4C 4F0ZB 3EK4A 1B7TY 5J3XA 1A4PA 3LK0A 1HT9A 1XFVO 2RGIA 1B8LA 1SK6D 3ICBA 3BUOB 1J55A 3DVJA 4M2QA 1CFDA 4N1FA 5HKZA 3TS5B 4ZCVA 4A4CA 1RJVA 1XYDA 1DJYA 2G2BA 3EK7A 1G8IA 2F2PA 1V1GA 1SCVA 5KU1A 1A75B 1UWOA 2JZIA 1WRKA 4GAOA 2LMUA 2KI4B 2LMVA 3MSEB 1XFXO 2WNDA 3AKBA 1ODBA 4E68A 1FI5A 4GGFC 2LMTA 3WXAA 5DKNA 1PULA 2M0RA 3EK8A 4I5NB 1EXRA 2I94A 3EVVA 1BODA 2BBMA 1BG1A 2SASA 2H61A 1NWDA 2JT3A 4WQ2A 2CTNA 3WHUB 1ALWA 2M1KB 4JPZB 4PE0A 1NCYA 2L2EA 1NYAA 5I2LA 1LXFC 2KFFA 4UPGA 1PRWA 2PSRA 3AAKA 1K95A 2KAXA 1S3PA 2JWWA 1EL4A 1L7ZA 4P5OE 1KQVA 4MEWA 1NCZA 1Y0VH 4P2YB 1WY9A 3OB2B 4MLWA 4MN0A 4CFQA 1DJIA 4TNCA 2M8UA 2SCPA 3K21A 3RLZA 2LE9B 2BBNA 1CM4A 3TDZA 1KFXL 1TCOB 3VRQA 3PALA 1DJXA 3NXAA 2JOJA 2LLTA 1FPWA 1SNLA 1IQ3A 1S6JA 3HX4A 2Q91A 2LHIA 1KK8C 2I7AA 5CSJA 3QRXA 2EGDA 1OOJA 3DVEA 3O4YA 2H61C 1M39A 1XFWO 1YVHA 5D69A 1JF0A 1BR1B 4CPVA 1NX0A 3KHEA 3O78A 2KGBC 4ORCB 1AUIB 2LUXA 1JC2A 2OS8C 3I5IC 2IS9A 1NUBA 1IH0A 2L4HA 1YUUA 1BF5A 3CS1A 4MBEA 4IL1A 4MZKA 4PE1A 3BOWB 3CLNA 3C1VA 1HQVA 1BJFA 4JQ0D 1KFUL 1KK8B 1C7WA 4YRUA 2M29A 2Q4UA 1DT7B 2WOSA 5B8IB 1YURA 3NSKA 5JOLA 4AOMA 2GV5A 4PALA 1NP8A 1JWDA 1NCXA 4NDCA 1PALA 1R6PA 1WDCC 5TNCA 2OS8B 1M31A 3I5IB 1A75A 1AHRA 3TDIA 4D1EA 2LC5A 3IF7A 4WQ3A 2KNEA 1SL9A 3CR4X 4YGDB 2EC6C 1QIVA 1Y6WA 2JULA 2L4IA 1RFJA 1AK8A 4GFTA 2KFHA 1Q80A 4DIRA 1PVAA 1U5IA 1OSAA 3AAJA 4ORAB 4NDBA 3FIAA 4GGNA 4YBHB 1WDCB 1TNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHK A;  1J1D A;  1EG3 A;  1MUX A;  1K8U A;  1IRJ A;  2K8M B;  2MAZ A;  2BE6 A;  3BUN B;  4PHJ A;  1K94 A;  2EC6 B;  3NSL A;  1CFF A;  4GGF A;  2JT8 A;  2MRD A;  2HPS A;  1A03 A;  1KWO C;  5ER5 A;  2K7B A;  1DJG A;  1JFK A;  1F4O A;  1K93 D;  1RRO A;  1NX3 A;  5GQQ C;  3ZNI A;  2JC2 A;  1WLM A;  2F8P A;  4DRW A;  1S36 A;  5G08 A;  5AER A;  4PE7 A;  2P6B B;  1CB1 A;  1NPQ A;  1AP4 A;  3OB1 B;  2A4J A;  2HQ8 A;  2FJU B;  1R2U A;  1KWO B;  3SG4 A;  1SL7 A;  2CBL A;  5AEQ A;  1RWY A;  1TCF A;  2F2O A;  4JWQ A;  1F8H A;  3NSI A;  4M2P A;  1J7O A;  1K9K A;  2M7L A;  2Y1M A;  2KBI A;  1YTZ C;  1DJZ A;  1LA3 A;  4PHM A;  3BUM B;  1OMR A;  2ISD A;  2HET A;  1ZAC A;  1KSO A;  2KI6 D;  3BOW A;  2O5G A;  4MVF A;  2QAC A;  3ZWH A;  1U5I B;  3HCM A;  1B1G A;  1UP5 A;  1K2H A;  1B4C A;  4OVN F;  1UHH A;  2O60 A;  3D0Y B;  1BR4 B;  2KQ6 A;  2CXJ A;  4WRI A;  1IG5 A;  1F70 A;  3KF9 A;  1QIW A;  1CLB A;  1S5G Z;  3SG6 A;  4C0J A;  1QLS A;  1F71 A;  2MLE C;  3DF0 B;  4QJ5 B;  1UHI A;  2KGR A;  1MHO A;  1LVC D;  1QV0 A;  1QVI Z;  1S5G Y;  2D8N A;  2L98 A;  1BT6 A;  1K90 D;  1Y1X A;  1N0Y A;  2NCO A;  3BUW B;  3KPX A;  1X02 A;  2NCP A;  4GNK B;  1J7R A;  2BCA A;  2PRU A;  1CLM A;  4HRE E;  4XJK A;  1NX2 A;  3H4S E;  1PVB A;  1A29 A;  5CSI A;  1QJT A;  1TNQ A;  5HLV A;  2M7N A;  1SCM C;  4QJ4 B;  1QAT A;  4OCI A;  3E3R A;  5CSF A;  1W7I B;  1CLL A;  1XK4 A;  3DVK A;  2LCP A;  1DGV A;  2WCF A;  4DS7 A;  2K2A A;  3FWC A;  1KQM C;  2VRG A;  2F3Z A;  2KHN A;  2LM5 A;  4YGA A;  3PAT A;  2JPT A;  5CSN A;  4ETO A;  5KSZ A;  3SIA A;  2FCD A;  2QPT A;  2Y5I A;  4N5X A;  3TZ1 A;  5I2O A;  3OX5 A;  1JBA A;  2BKI B;  2WC8 A;  4MZL A;  1UHN A;  1SCM B;  1EG4 A;  3FWB A;  1LA0 A;  3SG3 A;  1C07 A;  1FI6 A;  2I2R E;  1TNX A;  1CDN A;  2MA2 A;  1GQM A;  1FW4 A;  2HF5 A;  2WCB A;  1KQM B;  3VRP A;  1GGZ A;  2KAV A;  1WLZ A;  2M9G A;  4USL A;  2H2K A;  4PDZ A;  1QAS A;  1CDM A;  2AUC A;  2HQW A;  2L0P A;  3VGO A;  4GPL B;  1J7P A;  1SPY A;  1KSM A;  1XFY O;  4BY5 A;  3GK4 X;  3SG5 A;  1XK4 C;  1EH2 A;  4YI9 A;  3LL8 B;  1N65 A;  5D7F A;  3RM1 A;  2E6W A;  3LLE A;  2OTG C;  2PVB A;  1Y1U A;  3NSO A;  3O6B A;  2GGM A;  4I5J A;  2JXC A;  3CR5 X;  2LAP A;  4MRX A;  1UHJ A;  4N1G A;  4XJK B;  2MLF C;  4FTG A;  5F6T A;  1OMV A;  2LVI A;  1B8C A;  3PN7 C;  1CM1 A;  2COL B;  4MSP A;  1TIZ A;  2AAO A;  2LAN A;  3D0Y A;  1SBJ A;  3OHM B;  2KBM A;  3TDU A;  2JTT A;  1H8B A;  1S26 D;  1QTX A;  2M97 A;  2OTG B;  1YX8 A;  4M2O A;  5FYX A;  5BPJ A;  4CFR A;  1IKU A;  3DF0 A;  2LP3 A;  1JFJ A;  1FBV A;  1IQ5 A;  2FOT A;  2ZN9 A;  3VRO A;  1TTX A;  1YRU B;  2V53 A;  5I8N A;  2NZ0 A;  3PN7 B;  3O2P A;  1CDP A;  2BEC A;  1RTP 1;  2LVJ A;  4I5L B;  1TRF A;  1IWQ A;  1YVL A;  3I5G C;  2E30 A;  2PMY A;  1KFX S;  1JUO A;  3BQ3 A;  1SW8 A;  1NX1 A;  2JXL A;  5AAN A;  1KK7 Z;  3LCP C;  4C0K A;  1Y1A A;  1M46 A;  2GGZ A;  1IJ6 A;  1BOC A;  2I18 A;  2JRF A;  2KAY A;  4YI8 A;  3KEV A;  3AKA A;  1KK7 Y;  1OZS A;  1DJH A;  1XA5 A;  3PM8 A;  2OPO A;  1LIN A;  2F3Y A;  1IGV A;  2LLS A;  3CGA A;  4MZJ A;  3I5G B;  4DCK A;  1ALV A;  1XVJ A;  1XFZ O;  5HYD A;  2LLU A;  1OZO A;  2KFG A;  1OE9 B;  2M1U A;  5CPV A;  1F54 A;  3GK2 A;  1L2O C;  2ZN8 A;  4OR9 B;  1KFU S;  4HRH A;  1UUR A;  1H4B A;  2ZNE A;  1YR5 A;  2L5X B;  2BKH B;  4HRG A;  1FF1 A;  1K9P A;  1AJ5 A;  1F4Q A;  2ZRS A;  4PE4 A;  1REC A;  2K61 A;  1YRT B;  3OP0 A;  4BY4 A;  1TN4 A;  5HKY A;  1QX2 A;  2NLN A;  5JJG A;  3CR2 A;  1DMO A;  1CFP A;  1NSH A;  2K7O A;  5PAL A;  3EVU A;  3KO0 A;  1DTL A;  1BLQ A;  1SMG A;  3I5F C;  1OQP A;  2LV7 A;  3DVM A;  1QV1 A;  3IQQ A;  1W7J B;  2DOQ A;  2JU0 A;  2JQ6 A;  2TN4 A;  4OV2 A;  4XYN A;  1CKK A;  1L2O B;  1XFU O;  1MXE A;  4AQI A;  2CT9 A;  4ZCU A;  3EVR A;  3CZT X;  1AVS A;  1EJ3 A;  2LP2 A;  4R1E A;  5KTY A;  1DF0 A;  1QVI Y;  1JF2 A;  2JNX A;  3GK1 A;  4GBA A;  5HLO A;  1PSB A;  3BYA A;  4OKH A;  2BL0 C;  3I5F B;  1BU3 A;  1YUS A;  5HKW A;  2NXQ A;  3PSR A;  1ZOT B;  3D10 A;  2LVK A;  2L50 A;  1MF8 B;  3LK1 A;  4HSZ A;  2KQY A;  5DKR A;  2R2I A;  1B8R A;  2PAL A;  2L51 A;  2MJW B;  3A8R A;  3BXK A;  1MWN A;  3WNX B;  1JSA A;  2EHB A;  2KOT A;  2M49 B;  3SG2 A;  3SG7 A;  1QS7 A;  1ZFS A;  1S6I A;  1M45 A;  1SYM A;  2BL0 B;  3SJS A;  1J7Q A;  2KI6 C;  1TNP A;  5I2Q A;  1TOP A;  2CCM A;  5AFP A;  1VRK A;  4PHN A;  1SY9 A;  1LKJ A;  1CFC A;  2M3W A;  1B47 A;  5DKQ A;  4CLN A;  2ZND A;  3PLF B;  2Y4Q A;  1PK0 D;  1G4Y R;  1DVI A;  4Q04 A;  1BMO A;  1IJ5 A;  4YGE B;  4DUQ A;  5AXI A;  1SKT A;  4I5K A;  2AMI A;  3EKH A;  1MQ1 A;  3M0W A;  5K89 A;  1K96 A;  4C0L A;  3PFV A;  3JTD C;  2LUC A;  3SIB A;  2JT0 A;  1QLK A;  1YUT A;  2BCX A;  5IBW A;  1WRZ A;  2KDH A;  3F45 A;  2K2F A;  1SR6 C;  4ORB B;  2ZRT A;  1YX7 A;  2FCE A;  2G9B A;  3IQO A;  4YGC B;  1DF0 B;  2LVV A;  1AJ4 A;  1CMG A;  3TUY C;  1SRA A;  4CID A;  4AQJ A;  2MBX A;  1QX5 B;  1QXP A;  1RK9 A;  3GOF A;  4MRY A;  3FS7 A;  3JTD B;  5ER4 X;  3WHT B;  3DD4 A;  1E8A A;  1GJY A;  1K9U A;  1D1O A;  3CTN A;  4NDD A;  2K0J A;  1QX7 A;  1J1E A;  1PSR A;  2ZKM X;  1CTR A;  4GUK A;  3VRN A;  3CWG A;  3VRR A;  1SR6 B;  1C7V A;  1CMF A;  4L9M A;  1CDL A;  1MXL C;  2KYF A;  2MHH A;  2WOR A;  1ZMZ A;  2JTZ A;  2WCE A;  2B1U A;  4A4B A;  1SL8 A;  3A4U B;  3TUY B;  2BCB A;  2K7D A;  1S1E A;  2BE4 A;  1DGU A;  1M63 B;  2PAS A;  4YGB B;  1GGW A;  2Y1N A;  4ICB A;  2LHL A;  1XO5 A;  2JNF A;  1V1F A;  3JVT C;  2LNK A;  1NIW A;  1S6C A;  3BUX B;  3I5H C;  1F55 A;  4PHK A;  2CNP A;  1ZUZ A;  1DJW A;  1N2D A;  1UUS A;  4NQG A;  1KCY A;  3EKJ A;  4FQO A;  1A2X A;  3TS5 C;  2F33 A;  1CNP A;  3OX6 A;  4PCW A;  1WRL A;  2KYC A;  1B9A A;  4U8D A;  1MR8 A;  1B7T Z;  4QJ3 B;  2ZFD A;  3JVT B;  2KSP A;  1OMD A;  3I5H B;  2K7C A;  1G33 A;  2KI4 C;  4F0Z B;  3EK4 A;  1B7T Y;  5J3X A;  1A4P A;  3LK0 A;  1HT9 A;  1XFV O;  2RGI A;  1B8L A;  1SK6 D;  3ICB A;  3BUO B;  1J55 A;  3DVJ A;  4M2Q A;  1CFD A;  4N1F A;  5HKZ A;  3TS5 B;  4ZCV A;  4A4C A;  1RJV A;  1XYD A;  1DJY A;  2G2B A;  3EK7 A;  1G8I A;  2F2P A;  1V1G A;  1SCV A;  5KU1 A;  1A75 B;  1UWO A;  2JZI A;  1WRK A;  4GAO A;  2LMU A;  2KI4 B;  2LMV A;  3MSE B;  1XFX O;  2WND A;  3AKB A;  1ODB A;  4E68 A;  1FI5 A;  4GGF C;  2LMT A;  3WXA A;  5DKN A;  1PUL A;  2M0R A;  3EK8 A;  4I5N B;  1EXR A;  2I94 A;  3EVV A;  1BOD A;  2BBM A;  1BG1 A;  2SAS A;  2H61 A;  1NWD A;  2JT3 A;  4WQ2 A;  2CTN A;  3WHU B;  1ALW A;  2M1K B;  4JPZ B;  4PE0 A;  1NCY A;  2L2E A;  1NYA A;  5I2L A;  1LXF C;  2KFF A;  4UPG A;  1PRW A;  2PSR A;  3AAK A;  1K95 A;  2KAX A;  1S3P A;  2JWW A;  1EL4 A;  1L7Z A;  4P5O E;  1KQV A;  4MEW A;  1NCZ A;  1Y0V H;  4P2Y B;  1WY9 A;  3OB2 B;  4MLW A;  4MN0 A;  4CFQ A;  1DJI A;  4TNC A;  2M8U A;  2SCP A;  3K21 A;  3RLZ A;  2LE9 B;  2BBN A;  1CM4 A;  3TDZ A;  1KFX L;  1TCO B;  3VRQ A;  3PAL A;  1DJX A;  3NXA A;  2JOJ A;  2LLT A;  1FPW A;  1SNL A;  1IQ3 A;  1S6J A;  3HX4 A;  2Q91 A;  2LHI A;  1KK8 C;  2I7A A;  5CSJ A;  3QRX A;  2EGD A;  1OOJ A;  3DVE A;  3O4Y A;  2H61 C;  1M39 A;  1XFW O;  1YVH A;  5D69 A;  1JF0 A;  1BR1 B;  4CPV A;  1NX0 A;  3KHE A;  3O78 A;  2KGB C;  4ORC B;  1AUI B;  2LUX A;  1JC2 A;  2OS8 C;  3I5I C;  2IS9 A;  1NUB A;  1IH0 A;  2L4H A;  1YUU A;  1BF5 A;  3CS1 A;  4MBE A;  4IL1 A;  4MZK A;  4PE1 A;  3BOW B;  3CLN A;  3C1V A;  1HQV A;  1BJF A;  4JQ0 D;  1KFU L;  1KK8 B;  1C7W A;  4YRU A;  2M29 A;  2Q4U A;  1DT7 B;  2WOS A;  5B8I B;  1YUR A;  3NSK A;  5JOL A;  4AOM A;  2GV5 A;  4PAL A;  1NP8 A;  1JWD A;  1NCX A;  4NDC A;  1PAL A;  1R6P A;  1WDC C;  5TNC A;  2OS8 B;  1M31 A;  3I5I B;  1A75 A;  1AHR A;  3TDI A;  4D1E A;  2LC5 A;  3IF7 A;  4WQ3 A;  2KNE A;  1SL9 A;  3CR4 X;  4YGD B;  2EC6 C;  1QIV A;  1Y6W A;  2JUL A;  2L4I A;  1RFJ A;  1AK8 A;  4GFT A;  2KFH A;  1Q80 A;  4DIR A;  1PVA A;  1U5I A;  1OSA A;  3AAJ A;  4ORA B;  4NDB A;  3FIA A;  4GGN A;  4YBH B;  1WDC B;  1TNW A; 
#chains in the Genus database with same CATH topology
 1UHK A;  1J1D A;  1EG3 A;  2ERB A;  1MUX A;  1K8U A;  1IRJ A;  2K8M B;  2MAZ A;  2BE6 A;  3BUN B;  4PHJ A;  1K94 A;  2EC6 B;  3NSL A;  1TUZ A;  1CFF A;  4GGF A;  2JT8 A;  2MRD A;  2HPS A;  1A03 A;  1DEK A;  1KWO C;  5ER5 A;  2K7B A;  1DJG A;  1JFK A;  1F4O A;  1K93 D;  1RRO A;  1NX3 A;  3D76 A;  5GQQ C;  2JC2 A;  3ZNI A;  1WLM A;  2F8P A;  2BAP A;  2P71 A;  3BFB A;  4DRW A;  1S36 A;  5G08 A;  5AER A;  4PE7 A;  3O4X A;  2P6B B;  1CB1 A;  1NPQ A;  1AP4 A;  2QEH A;  3OB1 B;  2A4J A;  2HQ8 A;  3SS4 A;  2FJU B;  1R2U A;  3EG5 B;  1KWO B;  3SG4 A;  1SL7 A;  2CBL A;  5AEQ A;  1RWY A;  1TCF A;  2F2O A;  4JWQ A;  1F8H A;  3NSI A;  4M2P A;  1J7O A;  1K9K A;  2M7L A;  2Y1M A;  2KBI A;  1YTZ C;  1DJZ A;  1LA3 A;  4PHM A;  3BUM B;  2WC6 A;  1OMR A;  2ISD A;  1W9Z A;  2HET A;  1ORG A;  1ZAC A;  1KSO A;  2KI6 D;  3BOW A;  2O5G A;  4MVF A;  2QAC A;  3ZWH A;  1U5I B;  3HCM A;  4IJ7 A;  1B1G A;  1UP5 A;  1K2H A;  1B4C A;  2WC5 A;  4OVN F;  2JPO A;  1UHH A;  2O60 A;  3D0Y B;  1BR4 B;  2KQ6 A;  2CXJ A;  4WRI A;  1IG5 A;  1F70 A;  3B6X A;  3KF9 A;  1OOG A;  1QIW A;  1CLB A;  1S5G Z;  3S0E A;  3DZT A;  3SG6 A;  4FQT A;  3DXL A;  4C0J A;  1QLS A;  1F71 A;  2MLE C;  3DF0 B;  4QJ5 B;  1UHI A;  2KGR A;  1MHO A;  1LVC D;  1QV0 A;  1QVI Z;  3N7H A;  1S5G Y;  2D8N A;  2L98 A;  1BT6 A;  1K90 D;  4JKT A;  1Y1X A;  1N0Y A;  2NCO A;  3BUW B;  3KPX A;  1X02 A;  2NCP A;  4GNK B;  1J7R A;  2BCA A;  2PRU A;  1CLM A;  4HRE E;  4XJK A;  1NX2 A;  3H4S E;  1PVB A;  1A29 A;  5CSI A;  1QJT A;  1TNQ A;  5HLV A;  3FE8 A;  2M7N A;  1SCM C;  4QJ4 B;  3FE9 A;  1QAT A;  4OCI A;  3DY9 A;  3E3R A;  5CSF A;  1W7I B;  1CLL A;  1XK4 A;  5DIC A;  3DVK A;  2LCP A;  1DGV A;  5HL1 A;  3L4L A;  2WCF A;  4DS7 A;  2K2A A;  3FWC A;  1KQM C;  2VRG A;  2F3Z A;  2KHN A;  2LM5 A;  4YGA A;  3PAT A;  2JPT A;  5CSN A;  4ETO A;  5KSZ A;  3SIA A;  2FCD A;  2QPT A;  2Y5I A;  4N5X A;  3TZ1 A;  5I2O A;  1LS8 A;  2QEV A;  3OX5 A;  1JBA A;  2BKI B;  2WC8 A;  4MZL A;  1UHN A;  1SCM B;  1EG4 A;  3FWB A;  1LA0 A;  3SG3 A;  1C07 A;  1FI6 A;  2I2R E;  3BFH A;  1TNX A;  1CDN A;  2MA2 A;  1GQM A;  1FW4 A;  2HF5 A;  2WCB A;  1KQM B;  3K1E A;  3SS5 A;  3VRP A;  3UNW A;  2K60 A;  3BFA A;  1GGZ A;  2KAV A;  1WLZ A;  2M9G A;  4USL A;  2H2K A;  4PDZ A;  3S0B A;  1QAS A;  1CDM A;  2AUC A;  2HQW A;  2L0P A;  3VGO A;  4GPL B;  1J7P A;  1SPY A;  1KSM A;  3UO9 A;  1XFY O;  4BY5 A;  3GK4 X;  3SG5 A;  1XK4 C;  1EH2 A;  4YI9 A;  3LL8 B;  1N65 A;  5D7F A;  3RM1 A;  2E6W A;  3LLE A;  2OTG C;  2PVB A;  1Y1U A;  3NSO A;  3O6B A;  2GGM A;  3D73 A;  2JXC A;  2P70 A;  4I5J A;  3CR5 X;  2WCL A;  1GM0 A;  2LAP A;  4MRX A;  1UHJ A;  4N1G A;  4XJK B;  2MLF C;  1OOH A;  4FTG A;  5F6T A;  1OMV A;  1TUJ A;  2LVI A;  2QDI A;  1B8C A;  3PN7 C;  1CM1 A;  2COL B;  4MSP A;  1TIZ A;  2AAO A;  2LAN A;  3D0Y A;  1SBJ A;  3OHM B;  2KBM A;  1OW4 A;  3TDU A;  2JTT A;  1H8B A;  1S26 D;  1QTX A;  2M97 A;  3D78 A;  2OTG B;  1YX8 A;  1DQE A;  4M2O A;  5FYX A;  5BPJ A;  4CFR A;  1IKU A;  3DF0 A;  2LP3 A;  1JFJ A;  1FBV A;  1IQ5 A;  2FOT A;  2ZN9 A;  3VRO A;  2FJY A;  1TTX A;  3CZ0 A;  1YRU B;  2V53 A;  5I8N A;  2NZ0 A;  3PN7 B;  3O2P A;  1SSE B;  1CDP A;  2BEC A;  1RTP 1;  2LVJ A;  4I5L B;  1TRF A;  1IWQ A;  1YVL A;  3I5G C;  2E30 A;  2PMY A;  4PT1 A;  1KFX S;  1JUO A;  3BQ3 A;  1SW8 A;  4KYN A;  1NX1 A;  2JXL A;  1OOI X;  5AAN A;  1KK7 Z;  1XFR A;  3LCP C;  4C0K A;  1Y1A A;  1M46 A;  2GGZ A;  1IJ6 A;  1BOC A;  2I18 A;  2JRF A;  2KAY A;  4YI8 A;  3KEV A;  3AKA A;  1KK7 Y;  1OZS A;  4INX A;  1DJH A;  1XA5 A;  3PM8 A;  2OPO A;  1LIN A;  2F3Y A;  3D74 A;  1IGV A;  2LLS A;  3CGA A;  4MZJ A;  3I5G B;  4DCK A;  1ALV A;  1XVJ A;  1XFZ O;  5HYD A;  2LLU A;  1OZO A;  3S0F A;  2KFG A;  1OE9 B;  2M1U A;  5CPV A;  1F54 A;  3GK2 A;  1L2O C;  2ZN8 A;  4OR9 B;  1KFU S;  4HRH A;  1UUR A;  1H4B A;  2ZNE A;  1YR5 A;  2L5X B;  2BKH B;  3CAB A;  4HRG A;  1FF1 A;  2H8V A;  1K9P A;  1AJ5 A;  1F4Q A;  2ZRS A;  4PE4 A;  1REC A;  2K61 A;  1YRT B;  3OP0 A;  4BY4 A;  1TN4 A;  5HKY A;  1QX2 A;  2NLN A;  5JJG A;  3CR2 A;  1DMO A;  3S0A A;  3B86 A;  3QME A;  1CFP A;  1NSH A;  2K7O A;  5PAL A;  3EVU A;  3KO0 A;  1DTL A;  1BLQ A;  1SMG A;  3I5F C;  1OQP A;  2LV7 A;  3DVM A;  1QV1 A;  3IQQ A;  3NHT A;  1W7J B;  2DOQ A;  2JU0 A;  2JQ6 A;  2TN4 A;  4OV2 A;  4XYN A;  1CKK A;  1L2O B;  1XFU O;  1MXE A;  4AQI A;  2CT9 A;  4ZCU A;  3EVR A;  3CZT X;  1AVS A;  3CDN A;  1EJ3 A;  2LP2 A;  4R1E A;  5FI7 A;  5KTY A;  1DF0 A;  1QVI Y;  3IVT A;  1JF2 A;  2JNX A;  3GK1 A;  4GBA A;  5HLO A;  1PSB A;  3BYA A;  4OKH A;  2BL0 C;  3I5F B;  2QEO A;  1BU3 A;  1YUS A;  5HKW A;  1Z2C B;  3D77 A;  2NXQ A;  1P28 A;  1ZOT B;  3PSR A;  3BJH A;  3D10 A;  2LVK A;  2L50 A;  1MF8 B;  3LK1 A;  4HSZ A;  2BNX A;  2KQY A;  5DKR A;  2R2I A;  1B8R A;  2PAL A;  1TWO A;  2L51 A;  2MJW B;  3A8R A;  3BXK A;  1MWN A;  3WNX B;  1JSA A;  2EHB A;  2KOT A;  2M49 B;  3SG2 A;  3SG7 A;  1QS7 A;  1ZFS A;  1S6I A;  1M45 A;  1SYM A;  2BL0 B;  3SJS A;  1J7Q A;  2KI6 C;  1TNP A;  5I2Q A;  1TOP A;  3R72 A;  2CCM A;  5AFP A;  1VRK A;  4PHN A;  1SY9 A;  3VB1 A;  1LKJ A;  1CFC A;  2M3W A;  1B47 A;  5DKQ A;  4CLN A;  2ZND A;  3PLF B;  2Y4Q A;  1PK0 D;  1G4Y R;  1DVI A;  3CYZ A;  4Q04 A;  1BMO A;  2KLD A;  3CZ2 A;  1IJ5 A;  3B7A A;  4YGE B;  3D75 A;  5AXI A;  3R1O A;  4DUQ A;  1SKT A;  4I5K A;  2AMI A;  3EKH A;  1MQ1 A;  3M0W A;  5K89 A;  1K96 A;  3NHI A;  4C0L A;  3PFV A;  5EL2 A;  3JTD C;  2LUC A;  3SIB A;  2JT0 A;  1QLK A;  1YUT A;  2BCX A;  5IBW A;  1WRZ A;  2KDH A;  3F45 A;  2K2F A;  1SR6 C;  4ORB B;  2ZRT A;  1YX7 A;  2FCE A;  2G9B A;  2WCM A;  3IQO A;  4YGC B;  1DF0 B;  2LVV A;  2PYQ A;  1AJ4 A;  3VRN A;  1CMG A;  3TUY C;  1SRA A;  4CID A;  4AQJ A;  2MBX A;  1QX5 B;  1QXP A;  1RK9 A;  3GOF A;  4MRY A;  3FS7 A;  3JTD B;  5ER4 X;  3WHT B;  3DD4 A;  1E8A A;  1GJY A;  1K9U A;  1D1O A;  3CTN A;  4NDD A;  2K0J A;  1QX7 A;  1J1E A;  1PSR A;  2KLE A;  1CTR A;  2ZKM X;  4GUK A;  3CWG A;  5D3O A;  1SR6 B;  3VRR A;  5I94 A;  4L9M A;  1CDL A;  1MXL C;  2KYF A;  2MHH A;  2WOR A;  1ZMZ A;  2JTZ A;  2WCE A;  2B1U A;  4A4B A;  1SL8 A;  3A4U B;  3TUY B;  2BCB A;  2K7D A;  4OZD A;  1S1E A;  5FI2 A;  3DYE A;  2BE4 A;  1DGU A;  1M63 B;  2PAS A;  4YGB B;  1GGW A;  1QWV A;  2Y1N A;  4ICB A;  2LHL A;  1XO5 A;  3FE6 A;  2JNF A;  1V1F A;  3JVT C;  2QEB A;  2LNK A;  1NIW A;  1S6C A;  3BUX B;  3I5H C;  1F55 A;  4PHK A;  1DEL A;  1OOF A;  2CNP A;  1ZUZ A;  1DJW A;  1N2D A;  1UUS A;  4NQG A;  1KCY A;  3EKJ A;  4FQO A;  1A2X A;  3TS5 C;  3V2L A;  2F33 A;  1CNP A;  3OX6 A;  4PCW A;  1WRL A;  2KYC A;  1B9A A;  4U8D A;  1MR8 A;  1B7T Z;  4QJ3 B;  4JD9 A;  2ZFD A;  3JVT B;  2KSP A;  1OMD A;  3I5H B;  2K7C A;  1G33 A;  2KI4 C;  4F0Z B;  3EK4 A;  1B7T Y;  5J3X A;  1A4P A;  3LK0 A;  2PQL A;  1HT9 A;  1XFV O;  2RGI A;  1B8L A;  1SK6 D;  3ICB A;  3BUO B;  1DC1 A;  1J55 A;  3DVJ A;  4M2Q A;  1CFD A;  4N1F A;  5HKZ A;  3TS5 B;  4ZCV A;  4A4C A;  1RJV A;  1XYD A;  3B88 A;  3NGV A;  1DJY A;  2G2B A;  3EK7 A;  1G8I A;  2F2P A;  3PM2 A;  1V1G A;  1SCV A;  5KU1 A;  2KPH A;  1A75 B;  1UWO A;  2L5Y A;  3PJI A;  3Q8I A;  2JZI A;  1WRK A;  1C7V A;  4GAO A;  4INW A;  2LMU A;  2KI4 B;  2GTE A;  2LMV A;  3MSE B;  1XFX O;  2WND A;  3AKB A;  3RZS A;  1ODB A;  4E68 A;  1FI5 A;  3L4A A;  2LMT A;  4GGF C;  3WXA A;  5DKN A;  1PUL A;  2M0R A;  3EK8 A;  4I5N B;  1EXR A;  2I94 A;  3EVV A;  1BOD A;  2BBM A;  1BG1 A;  1Z4H A;  2SAS A;  2H61 A;  1NWD A;  2JT3 A;  4WQ2 A;  2CTN A;  3WHU B;  1ALW A;  2M1K B;  4JPZ B;  4PE0 A;  1NCY A;  2L2E A;  1NYA A;  5I2L A;  1LXF C;  2KFF A;  4UPG A;  2YGU A;  1PRW A;  2PSR A;  3AAK A;  3OBV A;  1K95 A;  2KAX A;  1S3P A;  3L47 A;  2JWW A;  1EL4 A;  1L7Z A;  4P5O E;  1KQV A;  4MEW A;  1NCZ A;  1Y0V H;  4P2Y B;  1WY9 A;  3OB2 B;  4MLW A;  4MN0 A;  4CFQ A;  1DJI A;  4TNC A;  2M8U A;  2SCP A;  3K21 A;  3RLZ A;  1C3Y A;  2LE9 B;  2BBN A;  1CM4 A;  3TDZ A;  1KFX L;  1TCO B;  3VRQ A;  3PAL A;  1DJX A;  3NXA A;  2JOJ A;  2LLT A;  1FPW A;  1SNL A;  1IQ3 A;  1S6J A;  3HX4 A;  2Q91 A;  2LHI A;  1KK8 C;  2I7A A;  5CSJ A;  3QRX A;  2EGD A;  1OOJ A;  3DVE A;  3O4Y A;  2H61 C;  1M39 A;  1XFW O;  1YVH A;  3S0D A;  5D69 A;  1JF0 A;  1BR1 B;  4CPV A;  2L2C A;  1NX0 A;  3KHE A;  3O78 A;  2KGB C;  4ORC B;  1AUI B;  2LUX A;  1JC2 A;  2OS8 C;  3I5I C;  2IS9 A;  1NUB A;  3CZ1 A;  1IH0 A;  2L4H A;  1YUU A;  1BF5 A;  3CS1 A;  4MBE A;  4IL1 A;  3B87 A;  1T14 A;  4MZK A;  4PE1 A;  3BOW B;  3S0G A;  3CLN A;  3C1V A;  1HQV A;  1BJF A;  4JQ0 D;  1KFU L;  1KK8 B;  1C7W A;  4YRU A;  2M29 A;  1C3Z A;  2Q4U A;  3OGN A;  2WOS A;  5B8I B;  1DT7 B;  1YUR A;  3NSK A;  5JOL A;  4AOM A;  2GV5 A;  4PAL A;  3R1P A;  2WCH A;  1NP8 A;  1JWD A;  1NCX A;  4NDC A;  1PAL A;  1R6P A;  1WDC C;  5TNC A;  2OS8 B;  1M31 A;  3I5I B;  1A75 A;  1AHR A;  3TDI A;  4D1E A;  2LC5 A;  3IF7 A;  4WQ3 A;  1IIO A;  2KNE A;  1SL9 A;  3CR4 X;  4YGD B;  2EC6 C;  1QIV A;  1Y6W A;  2JUL A;  2L4I A;  2WCK A;  1RFJ A;  1AK8 A;  4GFT A;  2KFH A;  1Q80 A;  4DIR A;  3R1V A;  1PVA A;  1U5I A;  1OSA A;  3AAJ A;  4F7F A;  2WCJ A;  4ORA B;  4NDB A;  3SS3 A;  3FIA A;  4GGN A;  5FI6 A;  4YBH B;  1CMF A;  1WDC B;  1TNW A; 
#chains in the Genus database with same CATH homology
 1UHK A;  1J1D A;  1EG3 A;  1MUX A;  1K8U A;  1IRJ A;  2K8M B;  2MAZ A;  2BE6 A;  3BUN B;  4PHJ A;  1K94 A;  2EC6 B;  3NSL A;  1CFF A;  4GGF A;  2JT8 A;  2MRD A;  2HPS A;  1A03 A;  1KWO C;  5ER5 A;  2K7B A;  1DJG A;  1JFK A;  1F4O A;  1K93 D;  1RRO A;  1NX3 A;  5GQQ C;  3ZNI A;  2JC2 A;  1WLM A;  2F8P A;  4DRW A;  1S36 A;  5G08 A;  5AER A;  4PE7 A;  2P6B B;  1CB1 A;  1NPQ A;  1AP4 A;  3OB1 B;  2A4J A;  2HQ8 A;  2FJU B;  1R2U A;  1KWO B;  3SG4 A;  1SL7 A;  2CBL A;  5AEQ A;  1RWY A;  1TCF A;  2F2O A;  4JWQ A;  1F8H A;  3NSI A;  4M2P A;  1J7O A;  1K9K A;  2M7L A;  2Y1M A;  2KBI A;  1YTZ C;  1DJZ A;  1LA3 A;  4PHM A;  3BUM B;  1OMR A;  2ISD A;  2HET A;  1ZAC A;  1KSO A;  2KI6 D;  3BOW A;  2O5G A;  4MVF A;  2QAC A;  3ZWH A;  1U5I B;  3HCM A;  1B1G A;  1UP5 A;  1K2H A;  1B4C A;  4OVN F;  1UHH A;  2O60 A;  3D0Y B;  1BR4 B;  2KQ6 A;  2CXJ A;  4WRI A;  1IG5 A;  1F70 A;  3KF9 A;  1QIW A;  1CLB A;  1S5G Z;  3SG6 A;  4C0J A;  1QLS A;  1F71 A;  2MLE C;  3DF0 B;  4QJ5 B;  1UHI A;  2KGR A;  1MHO A;  1LVC D;  1QV0 A;  1QVI Z;  1S5G Y;  2D8N A;  2L98 A;  1BT6 A;  1K90 D;  1Y1X A;  1N0Y A;  2NCO A;  3BUW B;  3KPX A;  1X02 A;  2NCP A;  4GNK B;  1J7R A;  2BCA A;  2PRU A;  1CLM A;  4HRE E;  4XJK A;  1NX2 A;  3H4S E;  1PVB A;  1A29 A;  5CSI A;  1QJT A;  1TNQ A;  5HLV A;  2M7N A;  1SCM C;  4QJ4 B;  1QAT A;  4OCI A;  3E3R A;  5CSF A;  1W7I B;  1CLL A;  1XK4 A;  3DVK A;  2LCP A;  1DGV A;  2WCF A;  4DS7 A;  2K2A A;  3FWC A;  1KQM C;  2VRG A;  2F3Z A;  2KHN A;  2LM5 A;  4YGA A;  3PAT A;  2JPT A;  5CSN A;  4ETO A;  5KSZ A;  3SIA A;  2FCD A;  2QPT A;  2Y5I A;  4N5X A;  3TZ1 A;  5I2O A;  3OX5 A;  1JBA A;  2BKI B;  2WC8 A;  4MZL A;  1UHN A;  1SCM B;  1EG4 A;  3FWB A;  1LA0 A;  3SG3 A;  1C07 A;  1FI6 A;  2I2R E;  1TNX A;  1CDN A;  2MA2 A;  1GQM A;  1FW4 A;  2HF5 A;  2WCB A;  1KQM B;  3VRP A;  1GGZ A;  2KAV A;  1WLZ A;  2M9G A;  4USL A;  2H2K A;  4PDZ A;  1QAS A;  1CDM A;  2AUC A;  2HQW A;  2L0P A;  3VGO A;  4GPL B;  1J7P A;  1SPY A;  1KSM A;  1XFY O;  4BY5 A;  3GK4 X;  3SG5 A;  1XK4 C;  1EH2 A;  4YI9 A;  3LL8 B;  1N65 A;  5D7F A;  3RM1 A;  2E6W A;  3LLE A;  2OTG C;  2PVB A;  1Y1U A;  3NSO A;  3O6B A;  2GGM A;  4I5J A;  2JXC A;  3CR5 X;  2LAP A;  4MRX A;  1UHJ A;  4N1G A;  4XJK B;  2MLF C;  4FTG A;  5F6T A;  1OMV A;  2LVI A;  1B8C A;  3PN7 C;  1CM1 A;  2COL B;  4MSP A;  1TIZ A;  2AAO A;  2LAN A;  3D0Y A;  1SBJ A;  3OHM B;  2KBM A;  3TDU A;  2JTT A;  1H8B A;  1S26 D;  1QTX A;  2M97 A;  2OTG B;  1YX8 A;  4M2O A;  5FYX A;  5BPJ A;  4CFR A;  1IKU A;  3DF0 A;  2LP3 A;  1JFJ A;  1FBV A;  1IQ5 A;  2FOT A;  2ZN9 A;  3VRO A;  1TTX A;  1YRU B;  2V53 A;  5I8N A;  2NZ0 A;  3PN7 B;  3O2P A;  1CDP A;  2BEC A;  1RTP 1;  2LVJ A;  4I5L B;  1TRF A;  1IWQ A;  1YVL A;  3I5G C;  2E30 A;  2PMY A;  1KFX S;  1JUO A;  3BQ3 A;  1SW8 A;  1NX1 A;  2JXL A;  5AAN A;  1KK7 Z;  3LCP C;  4C0K A;  1Y1A A;  1M46 A;  2GGZ A;  1IJ6 A;  1BOC A;  2I18 A;  2JRF A;  2KAY A;  4YI8 A;  3KEV A;  3AKA A;  1KK7 Y;  1OZS A;  1DJH A;  1XA5 A;  3PM8 A;  2OPO A;  1LIN A;  2F3Y A;  1IGV A;  2LLS A;  3CGA A;  4MZJ A;  3I5G B;  4DCK A;  1ALV A;  1XVJ A;  1XFZ O;  5HYD A;  2LLU A;  1OZO A;  2KFG A;  1OE9 B;  2M1U A;  5CPV A;  1F54 A;  3GK2 A;  1L2O C;  2ZN8 A;  4OR9 B;  1KFU S;  4HRH A;  1UUR A;  1H4B A;  2ZNE A;  1YR5 A;  2L5X B;  2BKH B;  4HRG A;  1FF1 A;  1K9P A;  1AJ5 A;  1F4Q A;  2ZRS A;  4PE4 A;  1REC A;  2K61 A;  1YRT B;  3OP0 A;  4BY4 A;  1TN4 A;  5HKY A;  1QX2 A;  2NLN A;  5JJG A;  3CR2 A;  1DMO A;  1CFP A;  1NSH A;  2K7O A;  5PAL A;  3EVU A;  3KO0 A;  1DTL A;  1BLQ A;  1SMG A;  3I5F C;  1OQP A;  2LV7 A;  3DVM A;  1QV1 A;  3IQQ A;  1W7J B;  2DOQ A;  2JU0 A;  2JQ6 A;  2TN4 A;  4OV2 A;  4XYN A;  1CKK A;  1L2O B;  1XFU O;  1MXE A;  4AQI A;  2CT9 A;  4ZCU A;  3EVR A;  3CZT X;  1AVS A;  1EJ3 A;  2LP2 A;  4R1E A;  5KTY A;  1DF0 A;  1QVI Y;  1JF2 A;  2JNX A;  3GK1 A;  4GBA A;  5HLO A;  1PSB A;  3BYA A;  4OKH A;  2BL0 C;  3I5F B;  1BU3 A;  1YUS A;  5HKW A;  2NXQ A;  3PSR A;  1ZOT B;  3D10 A;  2LVK A;  2L50 A;  1MF8 B;  3LK1 A;  4HSZ A;  2KQY A;  5DKR A;  2R2I A;  1B8R A;  2PAL A;  2L51 A;  2MJW B;  3A8R A;  3BXK A;  1MWN A;  3WNX B;  1JSA A;  2EHB A;  2KOT A;  2M49 B;  3SG2 A;  3SG7 A;  1QS7 A;  1ZFS A;  1S6I A;  1M45 A;  1SYM A;  2BL0 B;  3SJS A;  1J7Q A;  2KI6 C;  1TNP A;  5I2Q A;  1TOP A;  2CCM A;  5AFP A;  1VRK A;  4PHN A;  1SY9 A;  1LKJ A;  1CFC A;  2M3W A;  1B47 A;  5DKQ A;  4CLN A;  2ZND A;  3PLF B;  2Y4Q A;  1PK0 D;  1G4Y R;  1DVI A;  4Q04 A;  1BMO A;  1IJ5 A;  4YGE B;  4DUQ A;  5AXI A;  1SKT A;  4I5K A;  2AMI A;  3EKH A;  1MQ1 A;  3M0W A;  5K89 A;  1K96 A;  4C0L A;  3PFV A;  3JTD C;  2LUC A;  3SIB A;  2JT0 A;  1QLK A;  1YUT A;  2BCX A;  5IBW A;  1WRZ A;  2KDH A;  3F45 A;  2K2F A;  1SR6 C;  4ORB B;  2ZRT A;  1YX7 A;  2FCE A;  2G9B A;  3IQO A;  4YGC B;  1DF0 B;  2LVV A;  1AJ4 A;  1CMG A;  3TUY C;  1SRA A;  4CID A;  4AQJ A;  2MBX A;  1QX5 B;  1QXP A;  1RK9 A;  3GOF A;  4MRY A;  3FS7 A;  3JTD B;  5ER4 X;  3WHT B;  3DD4 A;  1E8A A;  1GJY A;  1K9U A;  1D1O A;  3CTN A;  4NDD A;  2K0J A;  1QX7 A;  1J1E A;  1PSR A;  2ZKM X;  1CTR A;  4GUK A;  3VRN A;  3CWG A;  3VRR A;  1SR6 B;  1C7V A;  1CMF A;  4L9M A;  1CDL A;  1MXL C;  2KYF A;  2MHH A;  2WOR A;  1ZMZ A;  2JTZ A;  2WCE A;  2B1U A;  4A4B A;  1SL8 A;  3A4U B;  3TUY B;  2BCB A;  2K7D A;  1S1E A;  2BE4 A;  1DGU A;  1M63 B;  2PAS A;  4YGB B;  1GGW A;  2Y1N A;  4ICB A;  2LHL A;  1XO5 A;  2JNF A;  1V1F A;  3JVT C;  2LNK A;  1NIW A;  1S6C A;  3BUX B;  3I5H C;  1F55 A;  4PHK A;  2CNP A;  1ZUZ A;  1DJW A;  1N2D A;  1UUS A;  4NQG A;  1KCY A;  3EKJ A;  4FQO A;  1A2X A;  3TS5 C;  2F33 A;  1CNP A;  3OX6 A;  4PCW A;  1WRL A;  2KYC A;  1B9A A;  4U8D A;  1MR8 A;  1B7T Z;  4QJ3 B;  2ZFD A;  3JVT B;  2KSP A;  1OMD A;  3I5H B;  2K7C A;  1G33 A;  2KI4 C;  4F0Z B;  3EK4 A;  1B7T Y;  5J3X A;  1A4P A;  3LK0 A;  1HT9 A;  1XFV O;  2RGI A;  1B8L A;  1SK6 D;  3ICB A;  3BUO B;  1J55 A;  3DVJ A;  4M2Q A;  1CFD A;  4N1F A;  5HKZ A;  3TS5 B;  4ZCV A;  4A4C A;  1RJV A;  1XYD A;  1DJY A;  2G2B A;  3EK7 A;  1G8I A;  2F2P A;  1V1G A;  1SCV A;  5KU1 A;  1A75 B;  1UWO A;  2JZI A;  1WRK A;  4GAO A;  2LMU A;  2KI4 B;  2LMV A;  3MSE B;  1XFX O;  2WND A;  3AKB A;  1ODB A;  4E68 A;  1FI5 A;  4GGF C;  2LMT A;  3WXA A;  5DKN A;  1PUL A;  2M0R A;  3EK8 A;  4I5N B;  1EXR A;  2I94 A;  3EVV A;  1BOD A;  2BBM A;  1BG1 A;  2SAS A;  2H61 A;  1NWD A;  2JT3 A;  4WQ2 A;  2CTN A;  3WHU B;  1ALW A;  2M1K B;  4JPZ B;  4PE0 A;  1NCY A;  2L2E A;  1NYA A;  5I2L A;  1LXF C;  2KFF A;  4UPG A;  1PRW A;  2PSR A;  3AAK A;  1K95 A;  2KAX A;  1S3P A;  2JWW A;  1EL4 A;  1L7Z A;  4P5O E;  1KQV A;  4MEW A;  1NCZ A;  1Y0V H;  4P2Y B;  1WY9 A;  3OB2 B;  4MLW A;  4MN0 A;  4CFQ A;  1DJI A;  4TNC A;  2M8U A;  2SCP A;  3K21 A;  3RLZ A;  2LE9 B;  2BBN A;  1CM4 A;  3TDZ A;  1KFX L;  1TCO B;  3VRQ A;  3PAL A;  1DJX A;  3NXA A;  2JOJ A;  2LLT A;  1FPW A;  1SNL A;  1IQ3 A;  1S6J A;  3HX4 A;  2Q91 A;  2LHI A;  1KK8 C;  2I7A A;  5CSJ A;  3QRX A;  2EGD A;  1OOJ A;  3DVE A;  3O4Y A;  2H61 C;  1M39 A;  1XFW O;  1YVH A;  5D69 A;  1JF0 A;  1BR1 B;  4CPV A;  1NX0 A;  3KHE A;  3O78 A;  2KGB C;  4ORC B;  1AUI B;  2LUX A;  1JC2 A;  2OS8 C;  3I5I C;  2IS9 A;  1NUB A;  1IH0 A;  2L4H A;  1YUU A;  1BF5 A;  3CS1 A;  4MBE A;  4IL1 A;  4MZK A;  4PE1 A;  3BOW B;  3CLN A;  3C1V A;  1HQV A;  1BJF A;  4JQ0 D;  1KFU L;  1KK8 B;  1C7W A;  4YRU A;  2M29 A;  2Q4U A;  1DT7 B;  2WOS A;  5B8I B;  1YUR A;  3NSK A;  5JOL A;  4AOM A;  2GV5 A;  4PAL A;  1NP8 A;  1JWD A;  1NCX A;  4NDC A;  1PAL A;  1R6P A;  1WDC C;  5TNC A;  2OS8 B;  1M31 A;  3I5I B;  1A75 A;  1AHR A;  3TDI A;  4D1E A;  2LC5 A;  3IF7 A;  4WQ3 A;  2KNE A;  1SL9 A;  3CR4 X;  4YGD B;  2EC6 C;  1QIV A;  1Y6W A;  2JUL A;  2L4I A;  1RFJ A;  1AK8 A;  4GFT A;  2KFH A;  1Q80 A;  4DIR A;  1PVA A;  1U5I A;  1OSA A;  3AAJ A;  4ORA B;  4NDB A;  3FIA A;  4GGN A;  4YBH B;  1WDC B;  1TNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...