2B1UA

Solution structure of calmodulin-like skin protein c terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'ARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin-like protein 5
publication title A Structural and Dynamic Characterization of the EF-Hand Protein CLSP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 17
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2b1uA00
3TS5C 2B1UA 3I5HC 4DCKA 3OX6A 1PRWA 2FCDA 1YUTA 4GBAA 2JT0A 1AJ4A 1ZUZA 4GAOA 3LK0A 3I5HB 3I5IB 3NSOA 2KNEA 1PVBA 1DJGA 3TDUA 2M1KB 1DJYA 2PMYA 1LA0A 2WORA 4Q04A 4DRWA 4YGCB 3OP0A 3BUXB 1OE9B 3KHEA 2LUXA 5I2QA 2M3WA 1G33A 2SASA 2K0JA 2WCBA 3JTDC 2LNKA 1QX7A 4L9MA 4GGFA 1DGUA 1F54A 1K9KA 1YRUB 1M45A 4MZKA 3AAKA 1S6JA 2KDHA 1S1EA 3LLEA 3BUNB 1M39A 2LVIA 1BG1A 1Y1XA 4GUKA 2PRUA 1CB1A 2KYCA 4PHKA 4GNKB 1TOPA 1DMOA 2I94A 4P2YB 2K2AA 1CM4A 1XVJA 1CDPA 1F4OA 4TNCA 1SCVA 4YGBB 1SK6D 5J3XA 2HQ8A 1U5IA 3C1VA 3PSRA 2A4JA 1LA3A 2R2IA 5IBWA 5AERA 3SG7A 1W7IB 4MN0A 2KQYA 2OPOA 3ZWHA 2BBMA 3LL8B 1GQMA 1KK8C 5D7FA 3CR4X 4NDDA 2F2OA 1BODA 3D0YA 3KEVA 5ER4X 5K89A 3PALA 5KU1A 3KO0A 3A4UB 1AVSA 2LMUA 2M8UA 1CTRA 2KI4C 1XFUO 4MRXA 3MSEB 3NSIA 1OMRA 2QPTA 2EC6B 1RJVA 2KSPA 1M63B 2LP3A 3OHMB 1NCXA 4I5JA 4M2QA 1H8BA 1SR6B 1KCYA 1U5IB 1JFJA 1WDCC 3WHUB 2JXLA 4C0LA 1GGZA 1NCZA 2G9BA 2JWWA 1J55A 1XFYO 4PCWA 1S36A 1SL9A 2NCOA 3OB2B 4JWQA 1IGVA 4GPLB 3O6BA 1K8UA 3D0YB 1CMGA 1TNQA 4N1FA 3PN7C 2JC2A 1IJ6A 2LE9B 1UWOA 2NXQA 4R1EA 2L4HA 2ZRTA 2BBNA 2MAZA 2JXCA 2LANA 2MRDA 2LVVA 5D69A 3VROA 1LVCD 1IQ5A 4M2PA 1YTZC 1NYAA 1KFUL 3GK4X 3SG6A 1SY9A 1N0YA 1LINA 2KAVA 1K9UA 1MQ1A 2KYFA 2L50A 4DUQA 1IKUA 4HSZA 1RTP1 5DKRA 2H2KA 1C7VA 1B7TZ 1YR5A 2LLSA 2BCXA 2OS8B 4MZLA 3SG2A 2IS9A 3BXKA 1XFVO 3SG5A 1RFJA 3TDIA 2TN4A 3TDZA 1K9PA 1KFXL 1SMGA 2JULA 4PHMA 1A75A 1V1GA 1FPWA 3M0WA 2F8PA 3SG3A 1L2OB 1PK0D 1W7JB 2LV7A 5AFPA 1CKKA 1TNXA 1KSMA 1B7TY 2JRFA 2JTTA 1J7OA 4JPZB 2KAXA 1MWNA 5JOLA 1EL4A 1TN4A 1F70A 3AKBA 1OQPA 2JT8A 4ZCVA 5CSJA 1SYMA 4BY5A 2CT9A 3PFVA 4PE1A 2L2EA 2L98A 2LLUA 3FWBA 2MBXA 2O5GA 2ZNEA 2WCEA 2LHLA 1G8IA 1B47A 1CLMA 1UHKA 4I5KA 2KFHA 2CBLA 3DVKA 1AK8A 3I5IC 2MLFC 1S5GZ 2L5XB 1TTXA 1MF8B 2ZFDA 2LHIA 1CMFA 2F33A 1NPQA 1RECA 5GQQC 2KHNA 3VRRA 1XK4C 3I5GC 1QATA 5HYDA 2MHHA 4GGNA 2BKIB 2L0PA 1KQMB 2NZ0A 1A03A 2JNXA 2Q91A 3JVTC 4N5XA 3I5GB 3CTNA 3HX4A 1R6PA 1CLBA 1F71A 3NSKA 1K90D 1FBVA 1S5GY 5PALA 3JVTB 3EK4A 1CFFA 3OX5A 2M97A 3CLNA 2K7OA 3OB1B 4CFRA 3BYAA 3SIAA 1BJFA 1UHIA 1PSBA 1RWYA 1YUUA 2CXJA 4ORCB 1NCYA 2WC8A 5AEQA 2ZNDA 3SIBA 4D1EA 4YRUA 2AAOA 1XYDA 1TCFA 2Y1MA 1CFDA 1B8CA 1Q80A 3IQQA 1Y6WA 3EK7A 1F4QA 3BOWA 4GGFC 2WCFA 1FI6A 1J7PA 1PSRA 5I2OA 1L7ZA 4A4BA 1S26D 3ZNIA 1XFZO 2NLNA 3BUMB 2DOQA 1G4YR 1QTXA 3DD4A 1DVIA 1X02A 1JF0A 2I2RE 2RGIA 1UP5A 3I5FC 2EC6C 2GGZA 4QJ5B 1K95A 2HF5A 1QX5B 1SW8A 1F55A 1LXFC 3I5FB 1SR6C 1YX8A 2M7NA 3ICBA 2GV5A 1FI5A 5KSZA 2LVKA 2NCPA 1J7QA 5F6TA 1Y0VH 2WNDA 2ZN8A 3BOWB 2JNFA 1OZSA 2BE4A 2Y4QA 2O60A 1N65A 3DF0A 2OTGC 1QASA 1QV1A 3BUWB 4YI8A 1YX7A 1FW4A 3AAJA 4PE4A 2KBIA 4E68A 1H4BA 3IQOA 1IRJA 1WLMA 2OTGB 3SJSA 2M9GA 1SL7A 4C0KA 1IWQA 2H61A 3FIAA 2L4IA 1SBJA 4XYNA 2M7LA 3BQ3A 1NP8A 1EXRA 2KGRA 3AKAA 4MZJA 4AOMA 4DIRA 1B1GA 4MSPA 1MUXA 3DVMA 1WRLA 4HRHA 1A4PA 1YVHA 2OS8C 5CSNA 5BPJA 4PE0A 2F3ZA 3DF0B 1DGVA 2BL0C 2QACA 5AANA 2FJUB 2FOTA 1ZMZA 4AQIA 2Y5IA 4ICBA 1L2OC 2BL0B 4F0ZB 1ALWA 4YI9A 1NX0A 1ODBA 1KQVA 1KFUS 1UHNA 1TCOB 1YRTB 1IQ3A 2E6WA 1XFWO 2JPTA 1DF0A 1BU3A 2BCAA 1KSOA 1A2XA 1GJYA 2FCEA 2HETA 3PLFB 2JTZA 4ZCUA 4OCIA 2COLB 4OV2A 1YURA 3GK1A 1JC2A 5I8NA 1B4CA 1QIVA 1KFXS 1BMOA 1EG3A 1LKJA 1V1FA 3EKHA 1JBAA 1EJ3A 1DTLA 2LM5A 3CGAA 1TIZA 1QLKA 3WHTB 3IF7A 1M31A 4PALA 1JF2A 1K96A 1QLSA 4HREE 1F8HA 4XJKA 1A75B 3VGOA 1IG5A 1B9AA 2LAPA 1C7WA 3SG4A 1NX3A 2CCMA 1K93D 1KQMC 1TRFA 4ORBB 4MBEA 5DKNA 2D8NA 1NX2A 3D10A 3TZ1A 3KPXA 2K61A 1OOJA 1OMDA 1K94A 1DJXA 2LMTA 1S3PA 4OKHA 4QJ3B 1ZACA 3GK2A 3QRXA 5HKZA 4GFTA 1SCMC 1PVAA 1HT9A 2LP2A 3FWCA 3TUYC 2Y1NA 3EVRA 1CM1A 1MR8A 1OMVA 1J1DA 5KTYA 1WRKA 4WRIA 2SCPA 2K8MB 1NX1A 2BCBA 1SCMB 2ZRSA 4C0JA 5HKYA 1DJIA 1D1OA 1C07A 3CR5X 2JU0A 3TUYB 3PM8A 2KI6D 4XJKB 4CFQA 2P6BB 3F45A 3TS5B 1GGWA 2JZIA 1A29A 1OZOA 2M29A 1WY9A 5B8IB 2K7CA 3CWGA 5DKQA 1YUSA 1DT7B 1KK7Z 1DJZA 2I7AA 4CIDA 1ZFSA 2K7BA 1MHOA 1XFXO 2JQ6A 4CPVA 1TNPA 4MVFA 2VRGA 3EKJA 4PHNA 1WRZA 3GOFA 2PVBA 3DVJA 3JTDB 3EVUA 4DS7A 4IL1A 2KFFA 1CDLA 5CSIA 1KK7Y 4WQ3A 4PDZA 1SPYA 2HQWA 1NIWA 1QJTA 3VRPA 4MRYA 1IJ5A 1AJ5A 3FS7A 1NWDA 1S6CA 3NSLA 1CDMA 2BE6A 3NXAA 1AUIB 3WNXB 2LVJA 2M1UA 1Y1UA 4I5NB 1CFCA 3HCMA 3A8RA 1QIWA 3KF9A 2LC5A 3RM1A 3PATA 3LK1A 2LMVA 4ORAB 1SRAA 3DVEA 4JQ0D 2KGBC 1J7RA 2CNPA 2E30A 1CDNA 3BUOB 2JOJA 4U8DA 1BF5A 2Q4UA 1E8AA 1JSAA 1J1EA 1AHRA 1UHJA 4FTGA 2PSRA 1IH0A 1KK8B 2KFGA 2LCPA 4I5LB 4FQOA 1BT6A 4QJ4B 1BOCA 2KQ6A 1DJWA 4YGAA 1PALA 1JFKA 1JWDA 1NSHA 1RROA 1ALVA 2BKHB 1MXEA 1CFPA 2KI4B 2MLEC 5HKWA 2EGDA 3LCPC 3VRNA 1S6IA 1B8RA 5AXIA 1HQVA 1R2UA 2AMIA 2F2PA 2EHBA 1WLZA 4PHJA 4OR9B 4CLNA 4NDCA 5HLVA 4AQJA 2BECA 2MA2A 4WQ2A 1XA5A 3H4SE 3VRQA 1WDCB 4M2OA 1UURA 1PULA 1SL8A 2ZKMX 5CPVA 2H61C 5TNCA 1NUBA 2M0RA 3CR2A 4UPGA 4YGDB 4A4CA 1DJHA 1VRKA 4BY4A 3PN7B 5ER5A 1JUOA 1BLQA 1B8LA 1UUSA 1YVLA 4YBHB 2LLTA 1BR4B 1QVIZ 1AP4A 3EVVA 1SKTA 4MLWA 5I2LA 4NDBA 1UHHA 4PE7A 4MEWA 1N2DA 2MJWB 3WXAA 1QX2A 3O2PA 1XO5A 2ISDA 1EG4A 5CSFA 4ETOA 1SNLA 1CNPA 2KAYA 1KWOC 1TNWA 3O78A 2AUCA 2K7DA 4P5OE 1QVIY 2M49B 2PASA 1EH2A 2WOSA 2V53A 5JJGA 5FYXA 1Y1AA 1KWOB 2KBMA 1MXLC 3O4YA 2JT3A 1OSAA 4YGEB 1QXPA 5G08A 2L51A 2HPSA 2CTNA 3CZTX 4N1GA 1QS7A 5HLOA 2LUCA 2G2BA 2I18A 4HRGA 1QV0A 1DF0B 1RK9A 3CS1A 3E3RA 1BR1B 2F3YA 4OVNF 1XK4A 3K21A 2K2FA 2PALA 2GGMA 3RLZA 3EK8A 4USLA 1K2HA 1FF1A 2KOTA 1M46A 2KI6C 2ZN9A 4NQGA 1CLLA 1ZOTB
chains in the Genus database with same CATH superfamily
3TS5C 2B1UA 3I5HC 4DCKA 3OX6A 1PRWA 2FCDA 1YUTA 4GBAA 2JT0A 2WCHA 1AJ4A 1ZUZA 4GAOA 3LK0A 3I5HB 3I5IB 3NSOA 2KNEA 1PVBA 1DJGA 2JPOA 3TDUA 2M1KB 1DJYA 2PMYA 1LA0A 2WORA 4Q04A 4DRWA 4YGCB 2KPHA 3OP0A 3BUXB 1OE9B 1P28A 2LUXA 3KHEA 5I2QA 2FJYA 2M3WA 1G33A 3FE9A 2SASA 3PM2A 2K0JA 2WCBA 3JTDC 2LNKA 1QX7A 4L9MA 4GGFA 1DGUA 5I94A 1F54A 1K9KA 1YRUB 1M45A 4MZKA 3AAKA 1S6JA 5DICA 3D74A 2KDHA 3CABA 1S1EA 3LLEA 3BUNB 1M39A 2LVIA 1BG1A 1Y1XA 4GUKA 2PRUA 1CB1A 2KYCA 3NHTA 4PHKA 4GNKB 1TOPA 1DMOA 2I94A 2L2CA 4P2YB 2K2AA 2BAPA 1CM4A 1XVJA 1CDPA 1F4OA 2BNXA 1SCVA 4TNCA 4YGBB 1SK6D 3R1OA 5J3XA 2HQ8A 1U5IA 3C1VA 3PSRA 2A4JA 1LA3A 2R2IA 3UNWA 5AERA 5IBWA 3SG7A 1DEKA 1W7IB 4MN0A 2KQYA 2OPOA 3ZWHA 2BBMA 3LL8B 1GQMA 1KK8C 5D7FA 3CR4X 4NDDA 2F2OA 2GTEA 1BODA 3D0YA 3KEVA 3D75A 5ER4X 3D78A 5K89A 3PALA 5KU1A 3KO0A 3A4UB 3DYEA 3BJHA 1AVSA 2LMUA 2M8UA 1CTRA 2KI4C 1XFUO 4MRXA 3MSEB 3NSIA 1OMRA 2QPTA 2EC6B 1RJVA 2KSPA 2P71A 1M63B 2LP3A 3OHMB 1NCXA 4I5JA 4M2QA 1H8BA 1SR6B 1KCYA 1U5IB 1JFJA 1WDCC 3WHUB 2JXLA 4C0LA 1GGZA 1NCZA 4F7FA 2G9BA 2JWWA 1J55A 1XFYO 4PCWA 1S36A 1SL9A 2NCOA 3OB2B 4JWQA 1IGVA 4GPLB 3O6BA 1K8UA 3D0YB 1CMGA 1TNQA 4N1FA 3PN7C 2JC2A 1IJ6A 2LE9B 1UWOA 2NXQA 4R1EA 2L4HA 2ZRTA 2BBNA 2MAZA 2JXCA 2LANA 2MRDA 2LVVA 5D69A 3VROA 1LVCD 1IQ5A 4M2PA 1YTZC 1NYAA 1KFUL 3GK4X 3SG6A 1SY9A 1N0YA 1LINA 2KAVA 1K9UA 1MQ1A 2KYFA 2L50A 2P70A 4DUQA 1IKUA 4HSZA 1RTP1 3DZTA 5DKRA 1W9ZA 2H2KA 1C7VA 1B7TZ 1YR5A 2LLSA 2BCXA 2OS8B 4MZLA 3SG2A 2IS9A 3BXKA 1XFVO 3SG5A 1RFJA 3TDIA 2TN4A 3TDZA 1K9PA 1KFXL 1SMGA 2JULA 4PHMA 1A75A 1V1GA 1FPWA 3M0WA 2F8PA 3SS3A 3SG3A 1L2OB 1PK0D 1W7JB 2LV7A 5AFPA 1CKKA 1TNXA 1KSMA 1B7TY 2ERBA 2JRFA 2JTTA 1J7OA 3FE8A 4JPZB 2KAXA 1MWNA 5JOLA 1EL4A 1TN4A 1TUJA 1F70A 3AKBA 1OQPA 2JT8A 4ZCVA 5CSJA 1SYMA 4BY5A 2CT9A 3PFVA 4PE1A 2L2EA 2L98A 2LLUA 3FWBA 2MBXA 2O5GA 2ZNEA 2WCEA 2LHLA 1G8IA 1B47A 1CLMA 1UHKA 4I5KA 2KFHA 2CBLA 3DVKA 1AK8A 3CYZA 3I5IC 2MLFC 1S5GZ 2L5XB 1TTXA 1MF8B 2ZFDA 2LHIA 3S0FA 2F33A 1NPQA 1RECA 5GQQC 1CMFA 2KHNA 3VRRA 1XK4C 3EG5B 3I5GC 1QATA 5HYDA 2MHHA 4GGNA 2BKIB 2L0PA 1KQMB 2NZ0A 1A03A 2JNXA 2Q91A 3JVTC 5D3OA 1T14A 4N5XA 3R1PA 2WCMA 3I5GB 3CTNA 3HX4A 1R6PA 1CLBA 1F71A 3NSKA 1K90D 1FBVA 1S5GY 5PALA 3JVTB 3EK4A 1CFFA 3OX5A 2M97A 3B6XA 1TWOA 2K7OA 3CLNA 3OB1B 4CFRA 3Q8IA 2L5YA 3BYAA 3NGVA 3SIAA 1BJFA 1GM0A 1UHIA 1PSBA 1RWYA 1YUUA 2CXJA 4ORCB 1NCYA 2WC8A 5AEQA 2ZNDA 3SIBA 4D1EA 1Z2CB 4YRUA 3D76A 2AAOA 3BFAA 1XYDA 1TCFA 2Y1MA 1CFDA 1B8CA 1Q80A 3IQQA 1Y6WA 3EK7A 1F4QA 3BOWA 4GGFC 2WCFA 1FI6A 3N7HA 2WC6A 1PSRA 1J7PA 5I2OA 1L7ZA 4A4BA 1S26D 3ZNIA 1XFZO 2NLNA 3BUMB 3DY9A 2DOQA 2KLDA 1G4YR 1QTXA 3DD4A 1DVIA 1X02A 1JF0A 2I2RE 2RGIA 1UP5A 3I5FC 2EC6C 2GGZA 4QJ5B 1K95A 3OBVA 2HF5A 1QX5B 1SW8A 1OOFA 1F55A 1LXFC 3I5FB 1C3YA 1SR6C 1YX8A 2M7NA 2WCKA 2GV5A 3ICBA 3K1EA 2LVKA 5KSZA 1FI5A 2NCPA 3QMEA 1J7QA 5F6TA 1Y0VH 3PJIA 2WNDA 2ZN8A 3BOWB 2JNFA 1OZSA 2BE4A 3B87A 2Y4QA 2O60A 1N65A 3DF0A 1QWVA 5EL2A 2OTGC 1QASA 1QV1A 3BUWB 4YI8A 3S0EA 1YX7A 1FW4A 3AAJA 4PE4A 2KBIA 4E68A 2YGUA 1H4BA 3IQOA 1IRJA 1WLMA 2OTGB 3S0BA 3SJSA 2M9GA 1SL7A 4C0KA 1IWQA 2H61A 3FIAA 2QEOA 2L4IA 4JKTA 1SBJA 4XYNA 2M7LA 3BQ3A 1NP8A 1EXRA 2KGRA 3AKAA 3BFBA 4MZJA 4AOMA 4DIRA 4MSPA 1B1GA 1MUXA 3DVMA 3SS5A 1WRLA 4HRHA 1A4PA 1YVHA 2OS8C 5CSNA 5BPJA 3RZSA 4PE0A 2F3ZA 3L47A 3DF0B 1DGVA 2BL0C 2QACA 5AANA 2FJUB 2FOTA 1ZMZA 4INWA 4AQIA 2Y5IA 4ICBA 1L2OC 2BL0B 4F0ZB 4INXA 1ALWA 4YI9A 1BOCA 1NX0A 1ODBA 3OGNA 1KQVA 1KFUS 1UHNA 1TCOB 1YRTB 2K60A 3CDNA 1IQ3A 1C3ZA 2E6WA 1XFWO 2JPTA 1DF0A 1BU3A 2BCAA 1KSOA 1A2XA 1GJYA 2FCEA 2HETA 3PLFB 2JTZA 4ZCUA 3S0GA 4OCIA 2QEVA 1TUZA 2COLB 4OV2A 1YURA 3GK1A 1JC2A 5I8NA 1B4CA 1QIVA 3CZ0A 1KFXS 1BMOA 1EG3A 1LKJA 1V1FA 3EKHA 1JBAA 1EJ3A 1DTLA 2LM5A 3CGAA 1TIZA 1QLKA 3WHTB 3IF7A 1M31A 4PALA 1JF2A 1K96A 1QLSA 4HREE 1F8HA 4XJKA 1A75B 3VGOA 1IG5A 1B9AA 2LAPA 1C7WA 3SG4A 1NX3A 2CCMA 1K93D 1KQMC 1TRFA 4ORBB 4MBEA 3D77A 5DKNA 3B86A 2D8NA 4KYNA 1NX2A 3D10A 3TZ1A 3KPXA 2K61A 1OOJA 1OMDA 1K94A 1DJXA 2LMTA 1S3PA 2QDIA 4OKHA 1ZACA 3GK2A 4QJ3B 3QRXA 5HKZA 4GFTA 1SCMC 1PVAA 1HT9A 2LP2A 3FWCA 3TUYC 2Y1NA 3B7AA 1CM1A 3EVRA 1MR8A 1OMVA 1J1DA 5KTYA 1WRKA 4WRIA 1DC1A 2SCPA 2K8MB 1NX1A 2BCBA 1SCMB 2ZRSA 4C0JA 1ORGA 1DJIA 5HKYA 1C07A 1D1OA 3CR5X 2JU0A 3TUYB 3PM8A 2KI6D 4XJKB 3UO9A 4CFQA 2WCJA 2P6BB 3CZ2A 3F45A 3TS5B 1GGWA 2JZIA 1A29A 1OZOA 2M29A 1OOIX 1WY9A 5B8IB 2K7CA 4IJ7A 3CWGA 5DKQA 1YUSA 1DT7B 1KK7Z 1DJZA 2I7AA 4CIDA 1ZFSA 4FQTA 2K7BA 1MHOA 1XFXO 2JQ6A 4CPVA 1TNPA 4MVFA 2VRGA 3EKJA 4PHNA 1WRZA 3GOFA 2PVBA 1SSEB 3DVJA 5FI6A 3JTDB 3EVUA 4DS7A 4PT1A 4IL1A 2KFFA 1CDLA 5CSIA 1KK7Y 3R1VA 4WQ3A 4PDZA 1SPYA 2HQWA 1NIWA 1QJTA 3VRPA 4MRYA 1IJ5A 1AJ5A 3FS7A 1NWDA 1S6CA 3NSLA 1CDMA 2BE6A 3NXAA 1AUIB 3WNXB 1DELA 2LVJA 2M1UA 1Y1UA 1DQEA 3CZ1A 4I5NB 1CFCA 3HCMA 3A8RA 1QIWA 3KF9A 2LC5A 3RM1A 3PATA 1Z4HA 3LK1A 2LMVA 4ORAB 1SRAA 3DVEA 4JQ0D 2KGBC 5FI2A 3L4LA 1J7RA 2CNPA 2E30A 1CDNA 1IIOA 3BUOB 2JOJA 4U8DA 1BF5A 2Q4UA 1OW4A 2KLEA 1E8AA 4OZDA 1JSAA 1J1EA 1AHRA 1UHJA 4FTGA 2PSRA 3S0AA 3R72A 1IH0A 1KK8B 2KFGA 2LCPA 2QEBA 4FQOA 1BT6A 4I5LB 5FI7A 4QJ4B 2KQ6A 1DJWA 4YGAA 1PALA 1JFKA 1JWDA 1NSHA 1RROA 1ALVA 2BKHB 1MXEA 1CFPA 2KI4B 2MLEC 5HKWA 2EGDA 3LCPC 3VRNA 1S6IA 1B8RA 1LS8A 1HQVA 1R2UA 2AMIA 2F2PA 2EHBA 1WLZA 4PHJA 5AXIA 4OR9B 2QEHA 4NDCA 4CLNA 5HLVA 3BFHA 2WCLA 4AQJA 5HL1A 2BECA 2MA2A 4WQ2A 1XA5A 3H4SE 3O4XA 3VRQA 1WDCB 1XFRA 4M2OA 1UURA 1PULA 1SL8A 2ZKMX 5CPVA 2H61C 5TNCA 1NUBA 2M0RA 3CR2A 3FE6A 4UPGA 4YGDB 4A4CA 1DJHA 1VRKA 4BY4A 1OOGA 3PN7B 5ER5A 1JUOA 3NHIA 1B8LA 1BLQA 1UUSA 1YVLA 4YBHB 2LLTA 1BR4B 1QVIZ 3S0DA 1AP4A 3EVVA 1SKTA 4MLWA 3DXLA 5I2LA 4NDBA 1UHHA 4PE7A 3V2LA 4MEWA 1N2DA 2MJWB 3WXAA 1QX2A 3O2PA 1XO5A 2ISDA 1EG4A 5CSFA 4ETOA 1SNLA 1CNPA 2KAYA 1KWOC 1TNWA 3O78A 2AUCA 2K7DA 4P5OE 1QVIY 3B88A 2M49B 2PASA 1EH2A 2WC5A 2WOSA 2V53A 2H8VA 5JJGA 5FYXA 1Y1AA 1KWOB 2KBMA 1MXLC 3O4YA 2JT3A 1OSAA 4YGEB 1QXPA 5G08A 2L51A 2HPSA 2CTNA 3VB1A 3CZTX 4N1GA 1QS7A 5HLOA 2LUCA 2G2BA 2I18A 4HRGA 1QV0A 1DF0B 4JD9A 3SS4A 1RK9A 3CS1A 3E3RA 1BR1B 2F3YA 2PQLA 4OVNF 1XK4A 3K21A 1OOHA 2K2FA 2PALA 2PYQA 2GGMA 3RLZA 3EK8A 4USLA 1K2HA 1FF1A 2KOTA 1M46A 2KI6C 2ZN9A 3D73A 4NQGA 3L4AA 1CLLA 1ZOTB 3IVTA
chains in the Genus database with same CATH topology
3TS5C 2B1UA 3I5HC 4DCKA 3OX6A 1PRWA 2FCDA 1YUTA 4GBAA 2JT0A 1AJ4A 1ZUZA 4GAOA 3LK0A 3I5HB 3I5IB 3NSOA 2KNEA 1PVBA 1DJGA 3TDUA 2M1KB 1DJYA 2PMYA 1LA0A 2WORA 4Q04A 4DRWA 4YGCB 3OP0A 3BUXB 1OE9B 3KHEA 2LUXA 5I2QA 2M3WA 1G33A 2SASA 2K0JA 2WCBA 3JTDC 2LNKA 1QX7A 4L9MA 4GGFA 1DGUA 1F54A 1K9KA 1YRUB 1M45A 4MZKA 3AAKA 1S6JA 2KDHA 1S1EA 3LLEA 3BUNB 1M39A 2LVIA 1BG1A 1Y1XA 4GUKA 2PRUA 1CB1A 2KYCA 4PHKA 4GNKB 1TOPA 1DMOA 2I94A 4P2YB 2K2AA 1CM4A 1XVJA 1CDPA 1F4OA 4TNCA 1SCVA 4YGBB 1SK6D 5J3XA 2HQ8A 1U5IA 3C1VA 3PSRA 2A4JA 1LA3A 2R2IA 5IBWA 5AERA 3SG7A 1W7IB 4MN0A 2KQYA 2OPOA 3ZWHA 2BBMA 3LL8B 1GQMA 1KK8C 5D7FA 3CR4X 4NDDA 2F2OA 1BODA 3D0YA 3KEVA 5ER4X 5K89A 3PALA 5KU1A 3KO0A 3A4UB 1AVSA 2LMUA 2M8UA 1CTRA 2KI4C 1XFUO 4MRXA 3MSEB 3NSIA 1OMRA 2QPTA 2EC6B 1RJVA 2KSPA 1M63B 2LP3A 3OHMB 1NCXA 4I5JA 4M2QA 1H8BA 1SR6B 1KCYA 1U5IB 1JFJA 1WDCC 3WHUB 2JXLA 4C0LA 1GGZA 1NCZA 2G9BA 2JWWA 1J55A 1XFYO 4PCWA 1S36A 1SL9A 2NCOA 3OB2B 4JWQA 1IGVA 4GPLB 3O6BA 1K8UA 3D0YB 1CMGA 1TNQA 4N1FA 3PN7C 2JC2A 1IJ6A 2LE9B 1UWOA 2NXQA 4R1EA 2L4HA 2ZRTA 2BBNA 2MAZA 2JXCA 2LANA 2MRDA 2LVVA 5D69A 3VROA 1LVCD 1IQ5A 4M2PA 1YTZC 1NYAA 1KFUL 3GK4X 3SG6A 1SY9A 1N0YA 1LINA 2KAVA 1K9UA 1MQ1A 2KYFA 2L50A 4DUQA 1IKUA 4HSZA 1RTP1 5DKRA 2H2KA 1C7VA 1B7TZ 1YR5A 2LLSA 2BCXA 2OS8B 4MZLA 3SG2A 2IS9A 3BXKA 1XFVO 3SG5A 1RFJA 3TDIA 2TN4A 3TDZA 1K9PA 1KFXL 1SMGA 2JULA 4PHMA 1A75A 1V1GA 1FPWA 3M0WA 2F8PA 3SG3A 1L2OB 1PK0D 1W7JB 2LV7A 5AFPA 1CKKA 1TNXA 1KSMA 1B7TY 2JRFA 2JTTA 1J7OA 4JPZB 2KAXA 1MWNA 5JOLA 1EL4A 1TN4A 1F70A 3AKBA 1OQPA 2JT8A 4ZCVA 5CSJA 1SYMA 4BY5A 2CT9A 3PFVA 4PE1A 2L2EA 2L98A 2LLUA 3FWBA 2MBXA 2O5GA 2ZNEA 2WCEA 2LHLA 1G8IA 1B47A 1CLMA 1UHKA 4I5KA 2KFHA 2CBLA 3DVKA 1AK8A 3I5IC 2MLFC 1S5GZ 2L5XB 1TTXA 1MF8B 2ZFDA 2LHIA 1CMFA 2F33A 1NPQA 1RECA 5GQQC 2KHNA 3VRRA 1XK4C 3I5GC 1QATA 5HYDA 2MHHA 4GGNA 2BKIB 2L0PA 1KQMB 2NZ0A 1A03A 2JNXA 2Q91A 3JVTC 4N5XA 3I5GB 3CTNA 3HX4A 1R6PA 1CLBA 1F71A 3NSKA 1K90D 1FBVA 1S5GY 5PALA 3JVTB 3EK4A 1CFFA 3OX5A 2M97A 3CLNA 2K7OA 3OB1B 4CFRA 3BYAA 3SIAA 1BJFA 1UHIA 1PSBA 1RWYA 1YUUA 2CXJA 4ORCB 1NCYA 2WC8A 5AEQA 2ZNDA 3SIBA 4D1EA 4YRUA 2AAOA 1XYDA 1TCFA 2Y1MA 1CFDA 1B8CA 1Q80A 3IQQA 1Y6WA 3EK7A 1F4QA 3BOWA 4GGFC 2WCFA 1FI6A 1J7PA 1PSRA 5I2OA 1L7ZA 4A4BA 1S26D 3ZNIA 1XFZO 2NLNA 3BUMB 2DOQA 1G4YR 1QTXA 3DD4A 1DVIA 1X02A 1JF0A 2I2RE 2RGIA 1UP5A 3I5FC 2EC6C 2GGZA 4QJ5B 1K95A 2HF5A 1QX5B 1SW8A 1F55A 1LXFC 3I5FB 1SR6C 1YX8A 2M7NA 3ICBA 2GV5A 1FI5A 5KSZA 2LVKA 2NCPA 1J7QA 5F6TA 1Y0VH 2WNDA 2ZN8A 3BOWB 2JNFA 1OZSA 2BE4A 2Y4QA 2O60A 1N65A 3DF0A 2OTGC 1QASA 1QV1A 3BUWB 4YI8A 1YX7A 1FW4A 3AAJA 4PE4A 2KBIA 4E68A 1H4BA 3IQOA 1IRJA 1WLMA 2OTGB 3SJSA 2M9GA 1SL7A 4C0KA 1IWQA 2H61A 3FIAA 2L4IA 1SBJA 4XYNA 2M7LA 3BQ3A 1NP8A 1EXRA 2KGRA 3AKAA 4MZJA 4AOMA 4DIRA 1B1GA 4MSPA 1MUXA 3DVMA 1WRLA 4HRHA 1A4PA 1YVHA 2OS8C 5CSNA 5BPJA 4PE0A 2F3ZA 3DF0B 1DGVA 2BL0C 2QACA 5AANA 2FJUB 2FOTA 1ZMZA 4AQIA 2Y5IA 4ICBA 1L2OC 2BL0B 4F0ZB 1ALWA 4YI9A 1NX0A 1ODBA 1KQVA 1KFUS 1UHNA 1TCOB 1YRTB 1IQ3A 2E6WA 1XFWO 2JPTA 1DF0A 1BU3A 2BCAA 1KSOA 1A2XA 1GJYA 2FCEA 2HETA 3PLFB 2JTZA 4ZCUA 4OCIA 2COLB 4OV2A 1YURA 3GK1A 1JC2A 5I8NA 1B4CA 1QIVA 1KFXS 1BMOA 1EG3A 1LKJA 1V1FA 3EKHA 1JBAA 1EJ3A 1DTLA 2LM5A 3CGAA 1TIZA 1QLKA 3WHTB 3IF7A 1M31A 4PALA 1JF2A 1K96A 1QLSA 4HREE 1F8HA 4XJKA 1A75B 3VGOA 1IG5A 1B9AA 2LAPA 1C7WA 3SG4A 1NX3A 2CCMA 1K93D 1KQMC 1TRFA 4ORBB 4MBEA 5DKNA 2D8NA 1NX2A 3D10A 3TZ1A 3KPXA 2K61A 1OOJA 1OMDA 1K94A 1DJXA 2LMTA 1S3PA 4OKHA 4QJ3B 1ZACA 3GK2A 3QRXA 5HKZA 4GFTA 1SCMC 1PVAA 1HT9A 2LP2A 3FWCA 3TUYC 2Y1NA 3EVRA 1CM1A 1MR8A 1OMVA 1J1DA 5KTYA 1WRKA 4WRIA 2SCPA 2K8MB 1NX1A 2BCBA 1SCMB 2ZRSA 4C0JA 5HKYA 1DJIA 1D1OA 1C07A 3CR5X 2JU0A 3TUYB 3PM8A 2KI6D 4XJKB 4CFQA 2P6BB 3F45A 3TS5B 1GGWA 2JZIA 1A29A 1OZOA 2M29A 1WY9A 5B8IB 2K7CA 3CWGA 5DKQA 1YUSA 1DT7B 1KK7Z 1DJZA 2I7AA 4CIDA 1ZFSA 2K7BA 1MHOA 1XFXO 2JQ6A 4CPVA 1TNPA 4MVFA 2VRGA 3EKJA 4PHNA 1WRZA 3GOFA 2PVBA 3DVJA 3JTDB 3EVUA 4DS7A 4IL1A 2KFFA 1CDLA 5CSIA 1KK7Y 4WQ3A 4PDZA 1SPYA 2HQWA 1NIWA 1QJTA 3VRPA 4MRYA 1IJ5A 1AJ5A 3FS7A 1NWDA 1S6CA 3NSLA 1CDMA 2BE6A 3NXAA 1AUIB 3WNXB 2LVJA 2M1UA 1Y1UA 4I5NB 1CFCA 3HCMA 3A8RA 1QIWA 3KF9A 2LC5A 3RM1A 3PATA 3LK1A 2LMVA 4ORAB 1SRAA 3DVEA 4JQ0D 2KGBC 1J7RA 2CNPA 2E30A 1CDNA 3BUOB 2JOJA 4U8DA 1BF5A 2Q4UA 1E8AA 1JSAA 1J1EA 1AHRA 1UHJA 4FTGA 2PSRA 1IH0A 1KK8B 2KFGA 2LCPA 4I5LB 4FQOA 1BT6A 4QJ4B 1BOCA 2KQ6A 1DJWA 4YGAA 1PALA 1JFKA 1JWDA 1NSHA 1RROA 1ALVA 2BKHB 1MXEA 1CFPA 2KI4B 2MLEC 5HKWA 2EGDA 3LCPC 3VRNA 1S6IA 1B8RA 5AXIA 1HQVA 1R2UA 2AMIA 2F2PA 2EHBA 1WLZA 4PHJA 4OR9B 4CLNA 4NDCA 5HLVA 4AQJA 2BECA 2MA2A 4WQ2A 1XA5A 3H4SE 3VRQA 1WDCB 4M2OA 1UURA 1PULA 1SL8A 2ZKMX 5CPVA 2H61C 5TNCA 1NUBA 2M0RA 3CR2A 4UPGA 4YGDB 4A4CA 1DJHA 1VRKA 4BY4A 3PN7B 5ER5A 1JUOA 1BLQA 1B8LA 1UUSA 1YVLA 4YBHB 2LLTA 1BR4B 1QVIZ 1AP4A 3EVVA 1SKTA 4MLWA 5I2LA 4NDBA 1UHHA 4PE7A 4MEWA 1N2DA 2MJWB 3WXAA 1QX2A 3O2PA 1XO5A 2ISDA 1EG4A 5CSFA 4ETOA 1SNLA 1CNPA 2KAYA 1KWOC 1TNWA 3O78A 2AUCA 2K7DA 4P5OE 1QVIY 2M49B 2PASA 1EH2A 2WOSA 2V53A 5JJGA 5FYXA 1Y1AA 1KWOB 2KBMA 1MXLC 3O4YA 2JT3A 1OSAA 4YGEB 1QXPA 5G08A 2L51A 2HPSA 2CTNA 3CZTX 4N1GA 1QS7A 5HLOA 2LUCA 2G2BA 2I18A 4HRGA 1QV0A 1DF0B 1RK9A 3CS1A 3E3RA 1BR1B 2F3YA 4OVNF 1XK4A 3K21A 2K2FA 2PALA 2GGMA 3RLZA 3EK8A 4USLA 1K2HA 1FF1A 2KOTA 1M46A 2KI6C 2ZN9A 4NQGA 1CLLA 1ZOTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 C;  2B1U A;  3I5H C;  4DCK A;  3OX6 A;  1PRW A;  2FCD A;  1YUT A;  4GBA A;  2JT0 A;  1AJ4 A;  1ZUZ A;  4GAO A;  3LK0 A;  3I5H B;  3I5I B;  3NSO A;  2KNE A;  1PVB A;  1DJG A;  3TDU A;  2M1K B;  1DJY A;  2PMY A;  1LA0 A;  2WOR A;  4Q04 A;  4DRW A;  4YGC B;  3OP0 A;  3BUX B;  1OE9 B;  3KHE A;  2LUX A;  5I2Q A;  2M3W A;  1G33 A;  2SAS A;  2K0J A;  2WCB A;  3JTD C;  2LNK A;  1QX7 A;  4L9M A;  4GGF A;  1DGU A;  1F54 A;  1K9K A;  1YRU B;  1M45 A;  4MZK A;  3AAK A;  1S6J A;  2KDH A;  1S1E A;  3LLE A;  3BUN B;  1M39 A;  2LVI A;  1BG1 A;  1Y1X A;  4GUK A;  2PRU A;  1CB1 A;  2KYC A;  4PHK A;  4GNK B;  1TOP A;  1DMO A;  2I94 A;  4P2Y B;  2K2A A;  1CM4 A;  1XVJ A;  1CDP A;  1F4O A;  4TNC A;  1SCV A;  4YGB B;  1SK6 D;  5J3X A;  2HQ8 A;  1U5I A;  3C1V A;  3PSR A;  2A4J A;  1LA3 A;  2R2I A;  5IBW A;  5AER A;  3SG7 A;  1W7I B;  4MN0 A;  2KQY A;  2OPO A;  3ZWH A;  2BBM A;  3LL8 B;  1GQM A;  1KK8 C;  5D7F A;  3CR4 X;  4NDD A;  2F2O A;  1BOD A;  3D0Y A;  3KEV A;  5ER4 X;  5K89 A;  3PAL A;  5KU1 A;  3KO0 A;  3A4U B;  1AVS A;  2LMU A;  2M8U A;  1CTR A;  2KI4 C;  1XFU O;  4MRX A;  3MSE B;  3NSI A;  1OMR A;  2QPT A;  2EC6 B;  1RJV A;  2KSP A;  1M63 B;  2LP3 A;  3OHM B;  1NCX A;  4I5J A;  4M2Q A;  1H8B A;  1SR6 B;  1KCY A;  1U5I B;  1JFJ A;  1WDC C;  3WHU B;  2JXL A;  4C0L A;  1GGZ A;  1NCZ A;  2G9B A;  2JWW A;  1J55 A;  1XFY O;  4PCW A;  1S36 A;  1SL9 A;  2NCO A;  3OB2 B;  4JWQ A;  1IGV A;  4GPL B;  3O6B A;  1K8U A;  3D0Y B;  1CMG A;  1TNQ A;  4N1F A;  3PN7 C;  2JC2 A;  1IJ6 A;  2LE9 B;  1UWO A;  2NXQ A;  4R1E A;  2L4H A;  2ZRT A;  2BBN A;  2MAZ A;  2JXC A;  2LAN A;  2MRD A;  2LVV A;  5D69 A;  3VRO A;  1LVC D;  1IQ5 A;  4M2P A;  1YTZ C;  1NYA A;  1KFU L;  3GK4 X;  3SG6 A;  1SY9 A;  1N0Y A;  1LIN A;  2KAV A;  1K9U A;  1MQ1 A;  2KYF A;  2L50 A;  4DUQ A;  1IKU A;  4HSZ A;  1RTP 1;  5DKR A;  2H2K A;  1C7V A;  1B7T Z;  1YR5 A;  2LLS A;  2BCX A;  2OS8 B;  4MZL A;  3SG2 A;  2IS9 A;  3BXK A;  1XFV O;  3SG5 A;  1RFJ A;  3TDI A;  2TN4 A;  3TDZ A;  1K9P A;  1KFX L;  1SMG A;  2JUL A;  4PHM A;  1A75 A;  1V1G A;  1FPW A;  3M0W A;  2F8P A;  3SG3 A;  1L2O B;  1PK0 D;  1W7J B;  2LV7 A;  5AFP A;  1CKK A;  1TNX A;  1KSM A;  1B7T Y;  2JRF A;  2JTT A;  1J7O A;  4JPZ B;  2KAX A;  1MWN A;  5JOL A;  1EL4 A;  1TN4 A;  1F70 A;  3AKB A;  1OQP A;  2JT8 A;  4ZCV A;  5CSJ A;  1SYM A;  4BY5 A;  2CT9 A;  3PFV A;  4PE1 A;  2L2E A;  2L98 A;  2LLU A;  3FWB A;  2MBX A;  2O5G A;  2ZNE A;  2WCE A;  2LHL A;  1G8I A;  1B47 A;  1CLM A;  1UHK A;  4I5K A;  2KFH A;  2CBL A;  3DVK A;  1AK8 A;  3I5I C;  2MLF C;  1S5G Z;  2L5X B;  1TTX A;  1MF8 B;  2ZFD A;  2LHI A;  1CMF A;  2F33 A;  1NPQ A;  1REC A;  5GQQ C;  2KHN A;  3VRR A;  1XK4 C;  3I5G C;  1QAT A;  5HYD A;  2MHH A;  4GGN A;  2BKI B;  2L0P A;  1KQM B;  2NZ0 A;  1A03 A;  2JNX A;  2Q91 A;  3JVT C;  4N5X A;  3I5G B;  3CTN A;  3HX4 A;  1R6P A;  1CLB A;  1F71 A;  3NSK A;  1K90 D;  1FBV A;  1S5G Y;  5PAL A;  3JVT B;  3EK4 A;  1CFF A;  3OX5 A;  2M97 A;  3CLN A;  2K7O A;  3OB1 B;  4CFR A;  3BYA A;  3SIA A;  1BJF A;  1UHI A;  1PSB A;  1RWY A;  1YUU A;  2CXJ A;  4ORC B;  1NCY A;  2WC8 A;  5AEQ A;  2ZND A;  3SIB A;  4D1E A;  4YRU A;  2AAO A;  1XYD A;  1TCF A;  2Y1M A;  1CFD A;  1B8C A;  1Q80 A;  3IQQ A;  1Y6W A;  3EK7 A;  1F4Q A;  3BOW A;  4GGF C;  2WCF A;  1FI6 A;  1J7P A;  1PSR A;  5I2O A;  1L7Z A;  4A4B A;  1S26 D;  3ZNI A;  1XFZ O;  2NLN A;  3BUM B;  2DOQ A;  1G4Y R;  1QTX A;  3DD4 A;  1DVI A;  1X02 A;  1JF0 A;  2I2R E;  2RGI A;  1UP5 A;  3I5F C;  2EC6 C;  2GGZ A;  4QJ5 B;  1K95 A;  2HF5 A;  1QX5 B;  1SW8 A;  1F55 A;  1LXF C;  3I5F B;  1SR6 C;  1YX8 A;  2M7N A;  3ICB A;  2GV5 A;  1FI5 A;  5KSZ A;  2LVK A;  2NCP A;  1J7Q A;  5F6T A;  1Y0V H;  2WND A;  2ZN8 A;  3BOW B;  2JNF A;  1OZS A;  2BE4 A;  2Y4Q A;  2O60 A;  1N65 A;  3DF0 A;  2OTG C;  1QAS A;  1QV1 A;  3BUW B;  4YI8 A;  1YX7 A;  1FW4 A;  3AAJ A;  4PE4 A;  2KBI A;  4E68 A;  1H4B A;  3IQO A;  1IRJ A;  1WLM A;  2OTG B;  3SJS A;  2M9G A;  1SL7 A;  4C0K A;  1IWQ A;  2H61 A;  3FIA A;  2L4I A;  1SBJ A;  4XYN A;  2M7L A;  3BQ3 A;  1NP8 A;  1EXR A;  2KGR A;  3AKA A;  4MZJ A;  4AOM A;  4DIR A;  1B1G A;  4MSP A;  1MUX A;  3DVM A;  1WRL A;  4HRH A;  1A4P A;  1YVH A;  2OS8 C;  5CSN A;  5BPJ A;  4PE0 A;  2F3Z A;  3DF0 B;  1DGV A;  2BL0 C;  2QAC A;  5AAN A;  2FJU B;  2FOT A;  1ZMZ A;  4AQI A;  2Y5I A;  4ICB A;  1L2O C;  2BL0 B;  4F0Z B;  1ALW A;  4YI9 A;  1NX0 A;  1ODB A;  1KQV A;  1KFU S;  1UHN A;  1TCO B;  1YRT B;  1IQ3 A;  2E6W A;  1XFW O;  2JPT A;  1DF0 A;  1BU3 A;  2BCA A;  1KSO A;  1A2X A;  1GJY A;  2FCE A;  2HET A;  3PLF B;  2JTZ A;  4ZCU A;  4OCI A;  2COL B;  4OV2 A;  1YUR A;  3GK1 A;  1JC2 A;  5I8N A;  1B4C A;  1QIV A;  1KFX S;  1BMO A;  1EG3 A;  1LKJ A;  1V1F A;  3EKH A;  1JBA A;  1EJ3 A;  1DTL A;  2LM5 A;  3CGA A;  1TIZ A;  1QLK A;  3WHT B;  3IF7 A;  1M31 A;  4PAL A;  1JF2 A;  1K96 A;  1QLS A;  4HRE E;  1F8H A;  4XJK A;  1A75 B;  3VGO A;  1IG5 A;  1B9A A;  2LAP A;  1C7W A;  3SG4 A;  1NX3 A;  2CCM A;  1K93 D;  1KQM C;  1TRF A;  4ORB B;  4MBE A;  5DKN A;  2D8N A;  1NX2 A;  3D10 A;  3TZ1 A;  3KPX A;  2K61 A;  1OOJ A;  1OMD A;  1K94 A;  1DJX A;  2LMT A;  1S3P A;  4OKH A;  4QJ3 B;  1ZAC A;  3GK2 A;  3QRX A;  5HKZ A;  4GFT A;  1SCM C;  1PVA A;  1HT9 A;  2LP2 A;  3FWC A;  3TUY C;  2Y1N A;  3EVR A;  1CM1 A;  1MR8 A;  1OMV A;  1J1D A;  5KTY A;  1WRK A;  4WRI A;  2SCP A;  2K8M B;  1NX1 A;  2BCB A;  1SCM B;  2ZRS A;  4C0J A;  5HKY A;  1DJI A;  1D1O A;  1C07 A;  3CR5 X;  2JU0 A;  3TUY B;  3PM8 A;  2KI6 D;  4XJK B;  4CFQ A;  2P6B B;  3F45 A;  3TS5 B;  1GGW A;  2JZI A;  1A29 A;  1OZO A;  2M29 A;  1WY9 A;  5B8I B;  2K7C A;  3CWG A;  5DKQ A;  1YUS A;  1DT7 B;  1KK7 Z;  1DJZ A;  2I7A A;  4CID A;  1ZFS A;  2K7B A;  1MHO A;  1XFX O;  2JQ6 A;  4CPV A;  1TNP A;  4MVF A;  2VRG A;  3EKJ A;  4PHN A;  1WRZ A;  3GOF A;  2PVB A;  3DVJ A;  3JTD B;  3EVU A;  4DS7 A;  4IL1 A;  2KFF A;  1CDL A;  5CSI A;  1KK7 Y;  4WQ3 A;  4PDZ A;  1SPY A;  2HQW A;  1NIW A;  1QJT A;  3VRP A;  4MRY A;  1IJ5 A;  1AJ5 A;  3FS7 A;  1NWD A;  1S6C A;  3NSL A;  1CDM A;  2BE6 A;  3NXA A;  1AUI B;  3WNX B;  2LVJ A;  2M1U A;  1Y1U A;  4I5N B;  1CFC A;  3HCM A;  3A8R A;  1QIW A;  3KF9 A;  2LC5 A;  3RM1 A;  3PAT A;  3LK1 A;  2LMV A;  4ORA B;  1SRA A;  3DVE A;  4JQ0 D;  2KGB C;  1J7R A;  2CNP A;  2E30 A;  1CDN A;  3BUO B;  2JOJ A;  4U8D A;  1BF5 A;  2Q4U A;  1E8A A;  1JSA A;  1J1E A;  1AHR A;  1UHJ A;  4FTG A;  2PSR A;  1IH0 A;  1KK8 B;  2KFG A;  2LCP A;  4I5L B;  4FQO A;  1BT6 A;  4QJ4 B;  1BOC A;  2KQ6 A;  1DJW A;  4YGA A;  1PAL A;  1JFK A;  1JWD A;  1NSH A;  1RRO A;  1ALV A;  2BKH B;  1MXE A;  1CFP A;  2KI4 B;  2MLE C;  5HKW A;  2EGD A;  3LCP C;  3VRN A;  1S6I A;  1B8R A;  5AXI A;  1HQV A;  1R2U A;  2AMI A;  2F2P A;  2EHB A;  1WLZ A;  4PHJ A;  4OR9 B;  4CLN A;  4NDC A;  5HLV A;  4AQJ A;  2BEC A;  2MA2 A;  4WQ2 A;  1XA5 A;  3H4S E;  3VRQ A;  1WDC B;  4M2O A;  1UUR A;  1PUL A;  1SL8 A;  2ZKM X;  5CPV A;  2H61 C;  5TNC A;  1NUB A;  2M0R A;  3CR2 A;  4UPG A;  4YGD B;  4A4C A;  1DJH A;  1VRK A;  4BY4 A;  3PN7 B;  5ER5 A;  1JUO A;  1BLQ A;  1B8L A;  1UUS A;  1YVL A;  4YBH B;  2LLT A;  1BR4 B;  1QVI Z;  1AP4 A;  3EVV A;  1SKT A;  4MLW A;  5I2L A;  4NDB A;  1UHH A;  4PE7 A;  4MEW A;  1N2D A;  2MJW B;  3WXA A;  1QX2 A;  3O2P A;  1XO5 A;  2ISD A;  1EG4 A;  5CSF A;  4ETO A;  1SNL A;  1CNP A;  2KAY A;  1KWO C;  1TNW A;  3O78 A;  2AUC A;  2K7D A;  4P5O E;  1QVI Y;  2M49 B;  2PAS A;  1EH2 A;  2WOS A;  2V53 A;  5JJG A;  5FYX A;  1Y1A A;  1KWO B;  2KBM A;  1MXL C;  3O4Y A;  2JT3 A;  1OSA A;  4YGE B;  1QXP A;  5G08 A;  2L51 A;  2HPS A;  2CTN A;  3CZT X;  4N1G A;  1QS7 A;  5HLO A;  2LUC A;  2G2B A;  2I18 A;  4HRG A;  1QV0 A;  1DF0 B;  1RK9 A;  3CS1 A;  3E3R A;  1BR1 B;  2F3Y A;  4OVN F;  1XK4 A;  3K21 A;  2K2F A;  2PAL A;  2GGM A;  3RLZ A;  3EK8 A;  4USL A;  1K2H A;  1FF1 A;  2KOT A;  1M46 A;  2KI6 C;  2ZN9 A;  4NQG A;  1CLL A;  1ZOT B; 
#chains in the Genus database with same CATH topology
 3TS5 C;  2B1U A;  3I5H C;  4DCK A;  3OX6 A;  1PRW A;  2FCD A;  1YUT A;  4GBA A;  2JT0 A;  2WCH A;  1AJ4 A;  1ZUZ A;  4GAO A;  3LK0 A;  3I5H B;  3I5I B;  3NSO A;  2KNE A;  1PVB A;  1DJG A;  2JPO A;  3TDU A;  2M1K B;  1DJY A;  2PMY A;  1LA0 A;  2WOR A;  4Q04 A;  4DRW A;  4YGC B;  2KPH A;  3OP0 A;  3BUX B;  1OE9 B;  1P28 A;  2LUX A;  3KHE A;  5I2Q A;  2FJY A;  2M3W A;  1G33 A;  3FE9 A;  2SAS A;  3PM2 A;  2K0J A;  2WCB A;  3JTD C;  2LNK A;  1QX7 A;  4L9M A;  4GGF A;  1DGU A;  5I94 A;  1F54 A;  1K9K A;  1YRU B;  1M45 A;  4MZK A;  3AAK A;  1S6J A;  5DIC A;  3D74 A;  2KDH A;  3CAB A;  1S1E A;  3LLE A;  3BUN B;  1M39 A;  2LVI A;  1BG1 A;  1Y1X A;  4GUK A;  2PRU A;  1CB1 A;  2KYC A;  3NHT A;  4PHK A;  4GNK B;  1TOP A;  1DMO A;  2I94 A;  2L2C A;  4P2Y B;  2K2A A;  2BAP A;  1CM4 A;  1XVJ A;  1CDP A;  1F4O A;  2BNX A;  1SCV A;  4TNC A;  4YGB B;  1SK6 D;  3R1O A;  5J3X A;  2HQ8 A;  1U5I A;  3C1V A;  3PSR A;  2A4J A;  1LA3 A;  2R2I A;  3UNW A;  5AER A;  5IBW A;  3SG7 A;  1DEK A;  1W7I B;  4MN0 A;  2KQY A;  2OPO A;  3ZWH A;  2BBM A;  3LL8 B;  1GQM A;  1KK8 C;  5D7F A;  3CR4 X;  4NDD A;  2F2O A;  2GTE A;  1BOD A;  3D0Y A;  3KEV A;  3D75 A;  5ER4 X;  3D78 A;  5K89 A;  3PAL A;  5KU1 A;  3KO0 A;  3A4U B;  3DYE A;  3BJH A;  1AVS A;  2LMU A;  2M8U A;  1CTR A;  2KI4 C;  1XFU O;  4MRX A;  3MSE B;  3NSI A;  1OMR A;  2QPT A;  2EC6 B;  1RJV A;  2KSP A;  2P71 A;  1M63 B;  2LP3 A;  3OHM B;  1NCX A;  4I5J A;  4M2Q A;  1H8B A;  1SR6 B;  1KCY A;  1U5I B;  1JFJ A;  1WDC C;  3WHU B;  2JXL A;  4C0L A;  1GGZ A;  1NCZ A;  4F7F A;  2G9B A;  2JWW A;  1J55 A;  1XFY O;  4PCW A;  1S36 A;  1SL9 A;  2NCO A;  3OB2 B;  4JWQ A;  1IGV A;  4GPL B;  3O6B A;  1K8U A;  3D0Y B;  1CMG A;  1TNQ A;  4N1F A;  3PN7 C;  2JC2 A;  1IJ6 A;  2LE9 B;  1UWO A;  2NXQ A;  4R1E A;  2L4H A;  2ZRT A;  2BBN A;  2MAZ A;  2JXC A;  2LAN A;  2MRD A;  2LVV A;  5D69 A;  3VRO A;  1LVC D;  1IQ5 A;  4M2P A;  1YTZ C;  1NYA A;  1KFU L;  3GK4 X;  3SG6 A;  1SY9 A;  1N0Y A;  1LIN A;  2KAV A;  1K9U A;  1MQ1 A;  2KYF A;  2L50 A;  2P70 A;  4DUQ A;  1IKU A;  4HSZ A;  1RTP 1;  3DZT A;  5DKR A;  1W9Z A;  2H2K A;  1C7V A;  1B7T Z;  1YR5 A;  2LLS A;  2BCX A;  2OS8 B;  4MZL A;  3SG2 A;  2IS9 A;  3BXK A;  1XFV O;  3SG5 A;  1RFJ A;  3TDI A;  2TN4 A;  3TDZ A;  1K9P A;  1KFX L;  1SMG A;  2JUL A;  4PHM A;  1A75 A;  1V1G A;  1FPW A;  3M0W A;  2F8P A;  3SS3 A;  3SG3 A;  1L2O B;  1PK0 D;  1W7J B;  2LV7 A;  5AFP A;  1CKK A;  1TNX A;  1KSM A;  1B7T Y;  2ERB A;  2JRF A;  2JTT A;  1J7O A;  3FE8 A;  4JPZ B;  2KAX A;  1MWN A;  5JOL A;  1EL4 A;  1TN4 A;  1TUJ A;  1F70 A;  3AKB A;  1OQP A;  2JT8 A;  4ZCV A;  5CSJ A;  1SYM A;  4BY5 A;  2CT9 A;  3PFV A;  4PE1 A;  2L2E A;  2L98 A;  2LLU A;  3FWB A;  2MBX A;  2O5G A;  2ZNE A;  2WCE A;  2LHL A;  1G8I A;  1B47 A;  1CLM A;  1UHK A;  4I5K A;  2KFH A;  2CBL A;  3DVK A;  1AK8 A;  3CYZ A;  3I5I C;  2MLF C;  1S5G Z;  2L5X B;  1TTX A;  1MF8 B;  2ZFD A;  2LHI A;  3S0F A;  2F33 A;  1NPQ A;  1REC A;  5GQQ C;  1CMF A;  2KHN A;  3VRR A;  1XK4 C;  3EG5 B;  3I5G C;  1QAT A;  5HYD A;  2MHH A;  4GGN A;  2BKI B;  2L0P A;  1KQM B;  2NZ0 A;  1A03 A;  2JNX A;  2Q91 A;  3JVT C;  5D3O A;  1T14 A;  4N5X A;  3R1P A;  2WCM A;  3I5G B;  3CTN A;  3HX4 A;  1R6P A;  1CLB A;  1F71 A;  3NSK A;  1K90 D;  1FBV A;  1S5G Y;  5PAL A;  3JVT B;  3EK4 A;  1CFF A;  3OX5 A;  2M97 A;  3B6X A;  1TWO A;  2K7O A;  3CLN A;  3OB1 B;  4CFR A;  3Q8I A;  2L5Y A;  3BYA A;  3NGV A;  3SIA A;  1BJF A;  1GM0 A;  1UHI A;  1PSB A;  1RWY A;  1YUU A;  2CXJ A;  4ORC B;  1NCY A;  2WC8 A;  5AEQ A;  2ZND A;  3SIB A;  4D1E A;  1Z2C B;  4YRU A;  3D76 A;  2AAO A;  3BFA A;  1XYD A;  1TCF A;  2Y1M A;  1CFD A;  1B8C A;  1Q80 A;  3IQQ A;  1Y6W A;  3EK7 A;  1F4Q A;  3BOW A;  4GGF C;  2WCF A;  1FI6 A;  3N7H A;  2WC6 A;  1PSR A;  1J7P A;  5I2O A;  1L7Z A;  4A4B A;  1S26 D;  3ZNI A;  1XFZ O;  2NLN A;  3BUM B;  3DY9 A;  2DOQ A;  2KLD A;  1G4Y R;  1QTX A;  3DD4 A;  1DVI A;  1X02 A;  1JF0 A;  2I2R E;  2RGI A;  1UP5 A;  3I5F C;  2EC6 C;  2GGZ A;  4QJ5 B;  1K95 A;  3OBV A;  2HF5 A;  1QX5 B;  1SW8 A;  1OOF A;  1F55 A;  1LXF C;  3I5F B;  1C3Y A;  1SR6 C;  1YX8 A;  2M7N A;  2WCK A;  2GV5 A;  3ICB A;  3K1E A;  2LVK A;  5KSZ A;  1FI5 A;  2NCP A;  3QME A;  1J7Q A;  5F6T A;  1Y0V H;  3PJI A;  2WND A;  2ZN8 A;  3BOW B;  2JNF A;  1OZS A;  2BE4 A;  3B87 A;  2Y4Q A;  2O60 A;  1N65 A;  3DF0 A;  1QWV A;  5EL2 A;  2OTG C;  1QAS A;  1QV1 A;  3BUW B;  4YI8 A;  3S0E A;  1YX7 A;  1FW4 A;  3AAJ A;  4PE4 A;  2KBI A;  4E68 A;  2YGU A;  1H4B A;  3IQO A;  1IRJ A;  1WLM A;  2OTG B;  3S0B A;  3SJS A;  2M9G A;  1SL7 A;  4C0K A;  1IWQ A;  2H61 A;  3FIA A;  2QEO A;  2L4I A;  4JKT A;  1SBJ A;  4XYN A;  2M7L A;  3BQ3 A;  1NP8 A;  1EXR A;  2KGR A;  3AKA A;  3BFB A;  4MZJ A;  4AOM A;  4DIR A;  4MSP A;  1B1G A;  1MUX A;  3DVM A;  3SS5 A;  1WRL A;  4HRH A;  1A4P A;  1YVH A;  2OS8 C;  5CSN A;  5BPJ A;  3RZS A;  4PE0 A;  2F3Z A;  3L47 A;  3DF0 B;  1DGV A;  2BL0 C;  2QAC A;  5AAN A;  2FJU B;  2FOT A;  1ZMZ A;  4INW A;  4AQI A;  2Y5I A;  4ICB A;  1L2O C;  2BL0 B;  4F0Z B;  4INX A;  1ALW A;  4YI9 A;  1BOC A;  1NX0 A;  1ODB A;  3OGN A;  1KQV A;  1KFU S;  1UHN A;  1TCO B;  1YRT B;  2K60 A;  3CDN A;  1IQ3 A;  1C3Z A;  2E6W A;  1XFW O;  2JPT A;  1DF0 A;  1BU3 A;  2BCA A;  1KSO A;  1A2X A;  1GJY A;  2FCE A;  2HET A;  3PLF B;  2JTZ A;  4ZCU A;  3S0G A;  4OCI A;  2QEV A;  1TUZ A;  2COL B;  4OV2 A;  1YUR A;  3GK1 A;  1JC2 A;  5I8N A;  1B4C A;  1QIV A;  3CZ0 A;  1KFX S;  1BMO A;  1EG3 A;  1LKJ A;  1V1F A;  3EKH A;  1JBA A;  1EJ3 A;  1DTL A;  2LM5 A;  3CGA A;  1TIZ A;  1QLK A;  3WHT B;  3IF7 A;  1M31 A;  4PAL A;  1JF2 A;  1K96 A;  1QLS A;  4HRE E;  1F8H A;  4XJK A;  1A75 B;  3VGO A;  1IG5 A;  1B9A A;  2LAP A;  1C7W A;  3SG4 A;  1NX3 A;  2CCM A;  1K93 D;  1KQM C;  1TRF A;  4ORB B;  4MBE A;  3D77 A;  5DKN A;  3B86 A;  2D8N A;  4KYN A;  1NX2 A;  3D10 A;  3TZ1 A;  3KPX A;  2K61 A;  1OOJ A;  1OMD A;  1K94 A;  1DJX A;  2LMT A;  1S3P A;  2QDI A;  4OKH A;  1ZAC A;  3GK2 A;  4QJ3 B;  3QRX A;  5HKZ A;  4GFT A;  1SCM C;  1PVA A;  1HT9 A;  2LP2 A;  3FWC A;  3TUY C;  2Y1N A;  3B7A A;  1CM1 A;  3EVR A;  1MR8 A;  1OMV A;  1J1D A;  5KTY A;  1WRK A;  4WRI A;  1DC1 A;  2SCP A;  2K8M B;  1NX1 A;  2BCB A;  1SCM B;  2ZRS A;  4C0J A;  1ORG A;  1DJI A;  5HKY A;  1C07 A;  1D1O A;  3CR5 X;  2JU0 A;  3TUY B;  3PM8 A;  2KI6 D;  4XJK B;  3UO9 A;  4CFQ A;  2WCJ A;  2P6B B;  3CZ2 A;  3F45 A;  3TS5 B;  1GGW A;  2JZI A;  1A29 A;  1OZO A;  2M29 A;  1OOI X;  1WY9 A;  5B8I B;  2K7C A;  4IJ7 A;  3CWG A;  5DKQ A;  1YUS A;  1DT7 B;  1KK7 Z;  1DJZ A;  2I7A A;  4CID A;  1ZFS A;  4FQT A;  2K7B A;  1MHO A;  1XFX O;  2JQ6 A;  4CPV A;  1TNP A;  4MVF A;  2VRG A;  3EKJ A;  4PHN A;  1WRZ A;  3GOF A;  2PVB A;  1SSE B;  3DVJ A;  5FI6 A;  3JTD B;  3EVU A;  4DS7 A;  4PT1 A;  4IL1 A;  2KFF A;  1CDL A;  5CSI A;  1KK7 Y;  3R1V A;  4WQ3 A;  4PDZ A;  1SPY A;  2HQW A;  1NIW A;  1QJT A;  3VRP A;  4MRY A;  1IJ5 A;  1AJ5 A;  3FS7 A;  1NWD A;  1S6C A;  3NSL A;  1CDM A;  2BE6 A;  3NXA A;  1AUI B;  3WNX B;  1DEL A;  2LVJ A;  2M1U A;  1Y1U A;  1DQE A;  3CZ1 A;  4I5N B;  1CFC A;  3HCM A;  3A8R A;  1QIW A;  3KF9 A;  2LC5 A;  3RM1 A;  3PAT A;  1Z4H A;  3LK1 A;  2LMV A;  4ORA B;  1SRA A;  3DVE A;  4JQ0 D;  2KGB C;  5FI2 A;  3L4L A;  1J7R A;  2CNP A;  2E30 A;  1CDN A;  1IIO A;  3BUO B;  2JOJ A;  4U8D A;  1BF5 A;  2Q4U A;  1OW4 A;  2KLE A;  1E8A A;  4OZD A;  1JSA A;  1J1E A;  1AHR A;  1UHJ A;  4FTG A;  2PSR A;  3S0A A;  3R72 A;  1IH0 A;  1KK8 B;  2KFG A;  2LCP A;  2QEB A;  4FQO A;  1BT6 A;  4I5L B;  5FI7 A;  4QJ4 B;  2KQ6 A;  1DJW A;  4YGA A;  1PAL A;  1JFK A;  1JWD A;  1NSH A;  1RRO A;  1ALV A;  2BKH B;  1MXE A;  1CFP A;  2KI4 B;  2MLE C;  5HKW A;  2EGD A;  3LCP C;  3VRN A;  1S6I A;  1B8R A;  1LS8 A;  1HQV A;  1R2U A;  2AMI A;  2F2P A;  2EHB A;  1WLZ A;  4PHJ A;  5AXI A;  4OR9 B;  2QEH A;  4NDC A;  4CLN A;  5HLV A;  3BFH A;  2WCL A;  4AQJ A;  5HL1 A;  2BEC A;  2MA2 A;  4WQ2 A;  1XA5 A;  3H4S E;  3O4X A;  3VRQ A;  1WDC B;  1XFR A;  4M2O A;  1UUR A;  1PUL A;  1SL8 A;  2ZKM X;  5CPV A;  2H61 C;  5TNC A;  1NUB A;  2M0R A;  3CR2 A;  3FE6 A;  4UPG A;  4YGD B;  4A4C A;  1DJH A;  1VRK A;  4BY4 A;  1OOG A;  3PN7 B;  5ER5 A;  1JUO A;  3NHI A;  1B8L A;  1BLQ A;  1UUS A;  1YVL A;  4YBH B;  2LLT A;  1BR4 B;  1QVI Z;  3S0D A;  1AP4 A;  3EVV A;  1SKT A;  4MLW A;  3DXL A;  5I2L A;  4NDB A;  1UHH A;  4PE7 A;  3V2L A;  4MEW A;  1N2D A;  2MJW B;  3WXA A;  1QX2 A;  3O2P A;  1XO5 A;  2ISD A;  1EG4 A;  5CSF A;  4ETO A;  1SNL A;  1CNP A;  2KAY A;  1KWO C;  1TNW A;  3O78 A;  2AUC A;  2K7D A;  4P5O E;  1QVI Y;  3B88 A;  2M49 B;  2PAS A;  1EH2 A;  2WC5 A;  2WOS A;  2V53 A;  2H8V A;  5JJG A;  5FYX A;  1Y1A A;  1KWO B;  2KBM A;  1MXL C;  3O4Y A;  2JT3 A;  1OSA A;  4YGE B;  1QXP A;  5G08 A;  2L51 A;  2HPS A;  2CTN A;  3VB1 A;  3CZT X;  4N1G A;  1QS7 A;  5HLO A;  2LUC A;  2G2B A;  2I18 A;  4HRG A;  1QV0 A;  1DF0 B;  4JD9 A;  3SS4 A;  1RK9 A;  3CS1 A;  3E3R A;  1BR1 B;  2F3Y A;  2PQL A;  4OVN F;  1XK4 A;  3K21 A;  1OOH A;  2K2F A;  2PAL A;  2PYQ A;  2GGM A;  3RLZ A;  3EK8 A;  4USL A;  1K2H A;  1FF1 A;  2KOT A;  1M46 A;  2KI6 C;  2ZN9 A;  3D73 A;  4NQG A;  3L4A A;  1CLL A;  1ZOT B;  3IVT A; 
#chains in the Genus database with same CATH homology
 3TS5 C;  2B1U A;  3I5H C;  4DCK A;  3OX6 A;  1PRW A;  2FCD A;  1YUT A;  4GBA A;  2JT0 A;  1AJ4 A;  1ZUZ A;  4GAO A;  3LK0 A;  3I5H B;  3I5I B;  3NSO A;  2KNE A;  1PVB A;  1DJG A;  3TDU A;  2M1K B;  1DJY A;  2PMY A;  1LA0 A;  2WOR A;  4Q04 A;  4DRW A;  4YGC B;  3OP0 A;  3BUX B;  1OE9 B;  3KHE A;  2LUX A;  5I2Q A;  2M3W A;  1G33 A;  2SAS A;  2K0J A;  2WCB A;  3JTD C;  2LNK A;  1QX7 A;  4L9M A;  4GGF A;  1DGU A;  1F54 A;  1K9K A;  1YRU B;  1M45 A;  4MZK A;  3AAK A;  1S6J A;  2KDH A;  1S1E A;  3LLE A;  3BUN B;  1M39 A;  2LVI A;  1BG1 A;  1Y1X A;  4GUK A;  2PRU A;  1CB1 A;  2KYC A;  4PHK A;  4GNK B;  1TOP A;  1DMO A;  2I94 A;  4P2Y B;  2K2A A;  1CM4 A;  1XVJ A;  1CDP A;  1F4O A;  4TNC A;  1SCV A;  4YGB B;  1SK6 D;  5J3X A;  2HQ8 A;  1U5I A;  3C1V A;  3PSR A;  2A4J A;  1LA3 A;  2R2I A;  5IBW A;  5AER A;  3SG7 A;  1W7I B;  4MN0 A;  2KQY A;  2OPO A;  3ZWH A;  2BBM A;  3LL8 B;  1GQM A;  1KK8 C;  5D7F A;  3CR4 X;  4NDD A;  2F2O A;  1BOD A;  3D0Y A;  3KEV A;  5ER4 X;  5K89 A;  3PAL A;  5KU1 A;  3KO0 A;  3A4U B;  1AVS A;  2LMU A;  2M8U A;  1CTR A;  2KI4 C;  1XFU O;  4MRX A;  3MSE B;  3NSI A;  1OMR A;  2QPT A;  2EC6 B;  1RJV A;  2KSP A;  1M63 B;  2LP3 A;  3OHM B;  1NCX A;  4I5J A;  4M2Q A;  1H8B A;  1SR6 B;  1KCY A;  1U5I B;  1JFJ A;  1WDC C;  3WHU B;  2JXL A;  4C0L A;  1GGZ A;  1NCZ A;  2G9B A;  2JWW A;  1J55 A;  1XFY O;  4PCW A;  1S36 A;  1SL9 A;  2NCO A;  3OB2 B;  4JWQ A;  1IGV A;  4GPL B;  3O6B A;  1K8U A;  3D0Y B;  1CMG A;  1TNQ A;  4N1F A;  3PN7 C;  2JC2 A;  1IJ6 A;  2LE9 B;  1UWO A;  2NXQ A;  4R1E A;  2L4H A;  2ZRT A;  2BBN A;  2MAZ A;  2JXC A;  2LAN A;  2MRD A;  2LVV A;  5D69 A;  3VRO A;  1LVC D;  1IQ5 A;  4M2P A;  1YTZ C;  1NYA A;  1KFU L;  3GK4 X;  3SG6 A;  1SY9 A;  1N0Y A;  1LIN A;  2KAV A;  1K9U A;  1MQ1 A;  2KYF A;  2L50 A;  4DUQ A;  1IKU A;  4HSZ A;  1RTP 1;  5DKR A;  2H2K A;  1C7V A;  1B7T Z;  1YR5 A;  2LLS A;  2BCX A;  2OS8 B;  4MZL A;  3SG2 A;  2IS9 A;  3BXK A;  1XFV O;  3SG5 A;  1RFJ A;  3TDI A;  2TN4 A;  3TDZ A;  1K9P A;  1KFX L;  1SMG A;  2JUL A;  4PHM A;  1A75 A;  1V1G A;  1FPW A;  3M0W A;  2F8P A;  3SG3 A;  1L2O B;  1PK0 D;  1W7J B;  2LV7 A;  5AFP A;  1CKK A;  1TNX A;  1KSM A;  1B7T Y;  2JRF A;  2JTT A;  1J7O A;  4JPZ B;  2KAX A;  1MWN A;  5JOL A;  1EL4 A;  1TN4 A;  1F70 A;  3AKB A;  1OQP A;  2JT8 A;  4ZCV A;  5CSJ A;  1SYM A;  4BY5 A;  2CT9 A;  3PFV A;  4PE1 A;  2L2E A;  2L98 A;  2LLU A;  3FWB A;  2MBX A;  2O5G A;  2ZNE A;  2WCE A;  2LHL A;  1G8I A;  1B47 A;  1CLM A;  1UHK A;  4I5K A;  2KFH A;  2CBL A;  3DVK A;  1AK8 A;  3I5I C;  2MLF C;  1S5G Z;  2L5X B;  1TTX A;  1MF8 B;  2ZFD A;  2LHI A;  1CMF A;  2F33 A;  1NPQ A;  1REC A;  5GQQ C;  2KHN A;  3VRR A;  1XK4 C;  3I5G C;  1QAT A;  5HYD A;  2MHH A;  4GGN A;  2BKI B;  2L0P A;  1KQM B;  2NZ0 A;  1A03 A;  2JNX A;  2Q91 A;  3JVT C;  4N5X A;  3I5G B;  3CTN A;  3HX4 A;  1R6P A;  1CLB A;  1F71 A;  3NSK A;  1K90 D;  1FBV A;  1S5G Y;  5PAL A;  3JVT B;  3EK4 A;  1CFF A;  3OX5 A;  2M97 A;  3CLN A;  2K7O A;  3OB1 B;  4CFR A;  3BYA A;  3SIA A;  1BJF A;  1UHI A;  1PSB A;  1RWY A;  1YUU A;  2CXJ A;  4ORC B;  1NCY A;  2WC8 A;  5AEQ A;  2ZND A;  3SIB A;  4D1E A;  4YRU A;  2AAO A;  1XYD A;  1TCF A;  2Y1M A;  1CFD A;  1B8C A;  1Q80 A;  3IQQ A;  1Y6W A;  3EK7 A;  1F4Q A;  3BOW A;  4GGF C;  2WCF A;  1FI6 A;  1J7P A;  1PSR A;  5I2O A;  1L7Z A;  4A4B A;  1S26 D;  3ZNI A;  1XFZ O;  2NLN A;  3BUM B;  2DOQ A;  1G4Y R;  1QTX A;  3DD4 A;  1DVI A;  1X02 A;  1JF0 A;  2I2R E;  2RGI A;  1UP5 A;  3I5F C;  2EC6 C;  2GGZ A;  4QJ5 B;  1K95 A;  2HF5 A;  1QX5 B;  1SW8 A;  1F55 A;  1LXF C;  3I5F B;  1SR6 C;  1YX8 A;  2M7N A;  3ICB A;  2GV5 A;  1FI5 A;  5KSZ A;  2LVK A;  2NCP A;  1J7Q A;  5F6T A;  1Y0V H;  2WND A;  2ZN8 A;  3BOW B;  2JNF A;  1OZS A;  2BE4 A;  2Y4Q A;  2O60 A;  1N65 A;  3DF0 A;  2OTG C;  1QAS A;  1QV1 A;  3BUW B;  4YI8 A;  1YX7 A;  1FW4 A;  3AAJ A;  4PE4 A;  2KBI A;  4E68 A;  1H4B A;  3IQO A;  1IRJ A;  1WLM A;  2OTG B;  3SJS A;  2M9G A;  1SL7 A;  4C0K A;  1IWQ A;  2H61 A;  3FIA A;  2L4I A;  1SBJ A;  4XYN A;  2M7L A;  3BQ3 A;  1NP8 A;  1EXR A;  2KGR A;  3AKA A;  4MZJ A;  4AOM A;  4DIR A;  1B1G A;  4MSP A;  1MUX A;  3DVM A;  1WRL A;  4HRH A;  1A4P A;  1YVH A;  2OS8 C;  5CSN A;  5BPJ A;  4PE0 A;  2F3Z A;  3DF0 B;  1DGV A;  2BL0 C;  2QAC A;  5AAN A;  2FJU B;  2FOT A;  1ZMZ A;  4AQI A;  2Y5I A;  4ICB A;  1L2O C;  2BL0 B;  4F0Z B;  1ALW A;  4YI9 A;  1NX0 A;  1ODB A;  1KQV A;  1KFU S;  1UHN A;  1TCO B;  1YRT B;  1IQ3 A;  2E6W A;  1XFW O;  2JPT A;  1DF0 A;  1BU3 A;  2BCA A;  1KSO A;  1A2X A;  1GJY A;  2FCE A;  2HET A;  3PLF B;  2JTZ A;  4ZCU A;  4OCI A;  2COL B;  4OV2 A;  1YUR A;  3GK1 A;  1JC2 A;  5I8N A;  1B4C A;  1QIV A;  1KFX S;  1BMO A;  1EG3 A;  1LKJ A;  1V1F A;  3EKH A;  1JBA A;  1EJ3 A;  1DTL A;  2LM5 A;  3CGA A;  1TIZ A;  1QLK A;  3WHT B;  3IF7 A;  1M31 A;  4PAL A;  1JF2 A;  1K96 A;  1QLS A;  4HRE E;  1F8H A;  4XJK A;  1A75 B;  3VGO A;  1IG5 A;  1B9A A;  2LAP A;  1C7W A;  3SG4 A;  1NX3 A;  2CCM A;  1K93 D;  1KQM C;  1TRF A;  4ORB B;  4MBE A;  5DKN A;  2D8N A;  1NX2 A;  3D10 A;  3TZ1 A;  3KPX A;  2K61 A;  1OOJ A;  1OMD A;  1K94 A;  1DJX A;  2LMT A;  1S3P A;  4OKH A;  4QJ3 B;  1ZAC A;  3GK2 A;  3QRX A;  5HKZ A;  4GFT A;  1SCM C;  1PVA A;  1HT9 A;  2LP2 A;  3FWC A;  3TUY C;  2Y1N A;  3EVR A;  1CM1 A;  1MR8 A;  1OMV A;  1J1D A;  5KTY A;  1WRK A;  4WRI A;  2SCP A;  2K8M B;  1NX1 A;  2BCB A;  1SCM B;  2ZRS A;  4C0J A;  5HKY A;  1DJI A;  1D1O A;  1C07 A;  3CR5 X;  2JU0 A;  3TUY B;  3PM8 A;  2KI6 D;  4XJK B;  4CFQ A;  2P6B B;  3F45 A;  3TS5 B;  1GGW A;  2JZI A;  1A29 A;  1OZO A;  2M29 A;  1WY9 A;  5B8I B;  2K7C A;  3CWG A;  5DKQ A;  1YUS A;  1DT7 B;  1KK7 Z;  1DJZ A;  2I7A A;  4CID A;  1ZFS A;  2K7B A;  1MHO A;  1XFX O;  2JQ6 A;  4CPV A;  1TNP A;  4MVF A;  2VRG A;  3EKJ A;  4PHN A;  1WRZ A;  3GOF A;  2PVB A;  3DVJ A;  3JTD B;  3EVU A;  4DS7 A;  4IL1 A;  2KFF A;  1CDL A;  5CSI A;  1KK7 Y;  4WQ3 A;  4PDZ A;  1SPY A;  2HQW A;  1NIW A;  1QJT A;  3VRP A;  4MRY A;  1IJ5 A;  1AJ5 A;  3FS7 A;  1NWD A;  1S6C A;  3NSL A;  1CDM A;  2BE6 A;  3NXA A;  1AUI B;  3WNX B;  2LVJ A;  2M1U A;  1Y1U A;  4I5N B;  1CFC A;  3HCM A;  3A8R A;  1QIW A;  3KF9 A;  2LC5 A;  3RM1 A;  3PAT A;  3LK1 A;  2LMV A;  4ORA B;  1SRA A;  3DVE A;  4JQ0 D;  2KGB C;  1J7R A;  2CNP A;  2E30 A;  1CDN A;  3BUO B;  2JOJ A;  4U8D A;  1BF5 A;  2Q4U A;  1E8A A;  1JSA A;  1J1E A;  1AHR A;  1UHJ A;  4FTG A;  2PSR A;  1IH0 A;  1KK8 B;  2KFG A;  2LCP A;  4I5L B;  4FQO A;  1BT6 A;  4QJ4 B;  1BOC A;  2KQ6 A;  1DJW A;  4YGA A;  1PAL A;  1JFK A;  1JWD A;  1NSH A;  1RRO A;  1ALV A;  2BKH B;  1MXE A;  1CFP A;  2KI4 B;  2MLE C;  5HKW A;  2EGD A;  3LCP C;  3VRN A;  1S6I A;  1B8R A;  5AXI A;  1HQV A;  1R2U A;  2AMI A;  2F2P A;  2EHB A;  1WLZ A;  4PHJ A;  4OR9 B;  4CLN A;  4NDC A;  5HLV A;  4AQJ A;  2BEC A;  2MA2 A;  4WQ2 A;  1XA5 A;  3H4S E;  3VRQ A;  1WDC B;  4M2O A;  1UUR A;  1PUL A;  1SL8 A;  2ZKM X;  5CPV A;  2H61 C;  5TNC A;  1NUB A;  2M0R A;  3CR2 A;  4UPG A;  4YGD B;  4A4C A;  1DJH A;  1VRK A;  4BY4 A;  3PN7 B;  5ER5 A;  1JUO A;  1BLQ A;  1B8L A;  1UUS A;  1YVL A;  4YBH B;  2LLT A;  1BR4 B;  1QVI Z;  1AP4 A;  3EVV A;  1SKT A;  4MLW A;  5I2L A;  4NDB A;  1UHH A;  4PE7 A;  4MEW A;  1N2D A;  2MJW B;  3WXA A;  1QX2 A;  3O2P A;  1XO5 A;  2ISD A;  1EG4 A;  5CSF A;  4ETO A;  1SNL A;  1CNP A;  2KAY A;  1KWO C;  1TNW A;  3O78 A;  2AUC A;  2K7D A;  4P5O E;  1QVI Y;  2M49 B;  2PAS A;  1EH2 A;  2WOS A;  2V53 A;  5JJG A;  5FYX A;  1Y1A A;  1KWO B;  2KBM A;  1MXL C;  3O4Y A;  2JT3 A;  1OSA A;  4YGE B;  1QXP A;  5G08 A;  2L51 A;  2HPS A;  2CTN A;  3CZT X;  4N1G A;  1QS7 A;  5HLO A;  2LUC A;  2G2B A;  2I18 A;  4HRG A;  1QV0 A;  1DF0 B;  1RK9 A;  3CS1 A;  3E3R A;  1BR1 B;  2F3Y A;  4OVN F;  1XK4 A;  3K21 A;  2K2F A;  2PAL A;  2GGM A;  3RLZ A;  3EK8 A;  4USL A;  1K2H A;  1FF1 A;  2KOT A;  1M46 A;  2KI6 C;  2ZN9 A;  4NQG A;  1CLL A;  1ZOT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...