2B1UA

Solution structure of calmodulin-like skin protein c terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
ARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calmodulin-like protein 5
publication title A Structural and Dynamic Characterization of the EF-Hand Protein CLSP.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2b1uA00
2CCMA 2ZN9A 5CSNA 2M8UA 2KNEA 5HKZA 1YR5A 3OX6A 1QS7A 2MHHA 1V1FA 1NCZA 1XFVO 1U5IA 3TUYC 1QTXA 1U5IB 4ZCUA 2AMIA 5K89A 1PULA 4XJKA 1MR8A 1N0YA 2JZIA 4P2YB 4GPLB 4XJKB 3KPXA 1K9KA 1KWOC 2E6WA 1CFDA 1SL7A 3CTNA 5AEQA 4MZKA 3DVKA 3BUMB 3PN7B 3BXKA 4DRWA 3TDIA 1Y6WA 1RTP1 1JBAA 2WORA 1BT6A 3BYAA 1IRJA 1CKKA 4DIRA 4OKHA 1JF2A 3I5HC 5GQQC 1ZOTB 3FIAA 1A75A 2BCAA 1FPWA 3CWGA 3ICBA 3K21A 2M7LA 1S6JA 2PMYA 3SG5A 1SKTA 4DCKA 1K90D 1AK8A 1Y0VH 1SRAA 1CM4A 5DKQA 1IQ3A 2M29A 1TNPA 2JTZA 2JULA 1CDMA 1MWNA 2HETA 2KGRA 1OQPA 1GJYA 1CDNA 4CPVA 2BKIB 5JOLA 1SMGA 1L2OC 3DD4A 4P5OE 3EVUA 4MEWA 3WNXB 3PFVA 3ZNIA 4YI9A 3SG6A 2G9BA 3M0WA 1NYAA 2CTNA 2MRDA 4GAOA 3AKBA 2KBIA 2KBMA 3SIAA 5HKYA 2ZFDA 1CM1A 2K2AA 2JTTA 3NSLA 4MRXA 4YGAA 3KF9A 4NDDA 1DMOA 1XK4C 1K93D 5FYXA 4M2QA 1NIWA 1LVCD 1SR6C 2JQ6A 1QXPA 2LVIA 3HCMA 1JF0A 4FQOA 3TS5B 3CLNA 1ZACA 3PSRA 2KI6C 3DF0A 3JVTB 3SG3A 1XFUO 5AERA 1EG4A 2K7BA 2BKHB 1FF1A 3DF0B 3LK1A 3RLZA 3BUXB 1GGZA 2ZRTA 3CZTX 2L50A 1PSBA 2MLFC 1KSMA 1QIVA 4I5JA 1TTXA 2LP2A 3KHEA 2LMUA 4PHKA 1LA0A 5PALA 5KU1A 2Y4QA 2DOQA 2JRFA 3BUNB 2P6BB 2MA2A 4PHMA 1CMGA 1WRZA 1BU3A 2BBMA 1SL8A 2H61A 1M46A 1F4QA 1PK0D 2LAPA 2EC6C 3O2PA 2NZ0A 1K2HA 1HQVA 1XA5A 3BQ3A 3CGAA 2LANA 1KK7Z 1UHKA 2PVBA 4PE7A 1OZOA 5TNCA 1XO5A 1RJVA 1TNQA 1OE9B 1AVSA 2MBXA 1QASA 2TN4A 4PHJA 3AAJA 4QJ4B 4NDCA 5CSIA 2OPOA 1TNXA 1XFXO 2KI4B 2FJUB 2H2KA 2SASA 3I5FB 2LLUA 2JWWA 3JTDB 3OHMB 1B1GA 1BMOA 4TNCA 1S3PA 1A4PA 1NCXA 1JFKA 1YVLA 2NXQA 1QV0A 2F33A 4AQJA 3F45A 4MLWA 3GK2A 1JSAA 3CR4X 3BUWB 4DS7A 1A29A 1S5GY 1UHHA 3E3RA 5CSJA 4AOMA 4CLNA 1F54A 4YBHB 1EJ3A 5I8NA 3I5GB 3LL8B 3DVMA 4Q04A 1J7PA 2K8MB 2L5XB 1QVIY 2KAVA 2BCBA 3BOWB 2K2FA 3OB2B 4YRUA 1YRTB 2A4JA 2LVKA 4GBAA 1KSOA 1R6PA 1SL9A 1EH2A 1WLMA 1RWYA 1S36A 1J7QA 2LE9B 1YUUA 2WCEA 4MBEA 2Y5IA 1DVIA 2F2OA 2LLTA 5CPVA 5I2OA 2BCXA 1SNLA 2K61A 4M2OA 1CNPA 3EVRA 1S6CA 1BR1B 5J3XA 3VRNA 4GUKA 4MVFA 2M3WA 1YX8A 2I2RE 1MF8B 4WRIA 3GOFA 1PSRA 4R1EA 1BJFA 3TS5C 1NP8A 4PE1A 3JVTC 2NCPA 1G4YR 1EL4A 4YGCB 4D1EA 2BE4A 2Y1MA 4HRHA 1F8HA 5DKNA 1IJ5A 3EKHA 3SJSA 1F70A 4PDZA 1QLKA 1M63B 1R2UA 2BL0C 2WCBA 1KCYA 4NQGA 1KQMB 2JT3A 2ZNEA 4YGEB 2FCEA 1YVHA 5HYDA 3KEVA 4A4CA 2Q91A 4PCWA 1WRLA 1SCMC 2HPSA 3D10A 1AJ4A 1IG5A 2HQWA 1AUIB 3PM8A 5ER4X 1BOCA 1NCYA 3LK0A 2K0JA 1BODA 2KAXA 1DGUA 4ORCB 2KFFA 3OB1B 4NDBA 3EK8A 1CFPA 4HRGA 1CFCA 4A4BA 2OTGC 3O6BA 2CT9A 1FW4A 1N65A 2BBNA 2I18A 4I5NB 3PLFB 1ZMZA 2LLSA 1A03A 4YI8A 2JC2A 1JUOA 4QJ5B 3IF7A 4I5KA 2M0RA 1IWQA 3SG7A 2B1UA 2K7OA 1X02A 5HKWA 1SCVA 1W7JB 4GGFC 2WCFA 4ETOA 1JC2A 1B7TZ 2L2EA 1WDCB 3JTDC 2KGBC 1J1DA 3FS7A 1OSAA 5AANA 5KSZA 2JNXA 1KQVA 1SY9A 2LC5A 2LHIA 2OS8B 2QPTA 3EK7A 4AQIA 1QX7A 4MZJA 2LNKA 1F55A 1MXEA 2L4HA 4U8DA 4ZCVA 1K95A 3PATA 1K96A 3C1VA 3GK4X 3I5GC 2LV7A 1KFUS 2ZRSA 1UHIA 1HT9A 3KO0A 4WQ3A 3TUYB 3AAKA 2QACA 2KYFA 1J7RA 1S26D 2I94A 2PALA 1DJIA 3TDUA 1A2XA 4UPGA 2KQYA 1AJ5A 1NX1A 2JPTA 4GFTA 5BPJA 2CBLA 1KFXS 2M9GA 1G8IA 1KK8B 2KI6D 1MQ1A 1IKUA 1BR4B 3I5IB 2CNPA 4DUQA 1YURA 1C07A 5F6TA 3AKAA 3DVJA 2JT8A 2EHBA 2JOJA 3EVVA 3GK1A 3PN7C 4HREE 3MSEB 1CLMA 3O78A 1RFJA 5KTYA 2D8NA 1SK6D 3CS1A 1CLBA 3DVEA 1IGVA 1GGWA 2F2PA 4PALA 1NX2A 2LVVA 1J7OA 2WC8A 1DTLA 1OMRA 3ZWHA 2KDHA 5AXIA 2K7DA 5I2QA 2JT0A 3OP0A 1LXFC 1QV1A 1B4CA 1DJHA 2NLNA 4E68A 2AUCA 2JU0A 3EKJA 3TDZA 3VGOA 4BY5A 1PRWA 1CFFA 2F8PA 2KOTA 4OR9B 5IBWA 3CR5X 1S1EA 2F3YA 3BOWA 1DJWA 4WQ2A 3NSKA 2M7NA 3A4UB 4YGDB 1M45A 4M2PA 2FCDA 3QRXA 2COLB 1CMFA 1ODBA 1QIWA 2VRGA 3VROA 4IL1A 3BUOB 5HLOA 2Y1NA 5D69A 4CFQA 1B8RA 1SPYA 4USLA 1NSHA 1WLZA 1TOPA 1TRFA 1UHNA 2JXCA 1UHJA 1QJTA 1RROA 2NCOA 2IS9A 4C0JA 1J55A 1YTZC 2KSPA 4MSPA 2OS8C 2BECA 2PASA 1QX5B 4PHNA 1AP4A 5B8IB 2MLEC 5D7FA 1YRUB 4GNKB 4N5XA 1GQMA 3WHUB 1F71A 1FI6A 2L51A 3H4SE 1SBJA 1E8AA 1NX3A 1Y1XA 4JQ0D 1YUSA 2LMTA 2EC6B 2GV5A 4BY4A 1B47A 4ORBB 1UP5A 2RGIA 2LP3A 1IQ5A 1B8LA 1C7WA 1SYMA 2M49B 1F4OA 1AHRA 1B8CA 1KK8C 4MZLA 3I5IC 4FTGA 4QJ3B 1JFJA 3PALA 1PVBA 2H61C 1MHOA 2WOSA 3O4YA 3VRQA 1DGVA 2ISDA 2LMVA 1NWDA 3CR2A 1PVAA 1KK7Y 1A75B 1RECA 2ZN8A 2ZNDA 2V53A 2JXLA 1QLSA 2L0PA 1DJGA 4N1FA 5I2LA 4CFRA 4OCIA 3SIBA 4GGNA 1S5GZ 1XFYO 1B9AA 2KI4C 3I5FC 2K7CA 1D1OA 4OV2A 2HQ8A 1QVIZ 1JWDA 2WNDA 4MN0A 2KYCA 1M31A 2E30A 4XYNA 2PSRA 3WXAA 1K94A 1V1GA 4PE4A 1H4BA 1NUBA 3OX5A 1MXLC 1EXRA 5JJGA 1WY9A 2F3ZA 5DKRA 4C0LA 1M39A 3SG4A 3FWCA 1OZSA 1XFZO 1TIZA 1BF5A 1CLLA 1BG1A 1RK9A 2M1KB 3D0YA 2JNFA 1YUTA 3D0YB 4C0KA 1XYDA 2LCPA 1KWOB 1ZUZA 1LINA 4JWQA 1CTRA 3VRRA 1LKJA 2L4IA 1FI5A 1IH0A 3LLEA 3A8RA 2CXJA 2GGZA 3VRPA 3NXAA 2G2BA 1CDPA 4L9MA 2O60A 4MRYA 1K9PA 1Y1UA 3I5HB 1XFWO 5ER5A 2LUXA 1NX0A 4CIDA 1OMVA 1C7VA 3TZ1A 2SCPA 2M97A 3EK4A 3HX4A 2BL0B 2LHLA 1KFUL 3FWBA 2GGMA 1K8UA 1SW8A 1ALWA 2EGDA 2BE6A 3SG2A 1CDLA 1Q80A 1QATA 1QX2A 1TCOB 1VRKA 1FBVA 1S6IA 4I5LB 1MUXA 5HLVA 2KFHA 3RM1A 1SCMB 1ZFSA 2KAYA 1N2DA 1L2OB 5G08A 1L7ZA 2KHNA 2PRUA 2M1UA 2Q4UA 1KFXL 1TN4A 1KQMC 1UURA 1NPQA 1DJXA 2LM5A 5AFPA 4HSZA 1BLQA 1IJ6A 2OTGB 1DJYA 4N1GA 1ALVA 4OVNF 2R2IA 3NSOA 1TNWA 1XVJA 1UWOA 1WRKA 2MJWB 1DF0A 4JPZB 3WHTB 2KQ6A 4PE0A 1XK4A 1DF0B 4GGFA 1LA3A 1TCFA 2FOTA 1OMDA 4YGBB 2MAZA 2LVJA 1CB1A 1PALA 2LUCA 3LCPC 1SR6B 5CSFA 3IQOA 2L98A 1UUSA 2ZKMX 1EG3A 1K9UA 1H8BA 3IQQA 1Y1AA 1YX7A 1DT7B 1WDCC 2I7AA 4ICBA 1W7IB 1B7TY 2AAOA 1J1EA 4ORAB 1G33A 1OOJA 2HF5A 2KFGA 3NSIA 2O5GA 1DJZA 4F0ZB
chains in the Genus database with same CATH superfamily
2CCMA 3B87A 2ZN9A 5CSNA 2M8UA 2KNEA 5HKZA 1YR5A 3OX6A 1QS7A 3CYZA 3IVTA 2MHHA 1V1FA 1NCZA 1XFVO 1U5IA 3TUYC 1QTXA 2K60A 1U5IB 4ZCUA 2AMIA 5K89A 1PULA 4XJKA 1MR8A 1N0YA 2JZIA 4P2YB 4GPLB 4XJKB 3KPXA 2WC5A 1K9KA 1KWOC 2E6WA 1CFDA 1SL7A 3CTNA 5AEQA 4MZKA 3DVKA 3NGVA 3BUMB 3PN7B 1W9ZA 3BXKA 3UO9A 3TDIA 4DRWA 1Y6WA 1RTP1 1JBAA 4KYNA 2WORA 1BT6A 2WCLA 3BJHA 1IRJA 3BYAA 1CKKA 4DIRA 4OKHA 1JF2A 3I5HC 5GQQC 1ZOTB 1Z2CB 3FIAA 1A75A 2BCAA 1FPWA 2WCMA 3CWGA 3ICBA 3K21A 3D77A 2M7LA 1S6JA 2PMYA 3SG5A 1SKTA 3CABA 4DCKA 1K90D 1AK8A 1Y0VH 1SRAA 3UNWA 1CM4A 3PJIA 5DKQA 1IQ3A 2M29A 2GTEA 1TNPA 2JTZA 2JULA 1CDMA 1MWNA 2HETA 2KGRA 1OQPA 3DZTA 3Q8IA 3FE8A 1GJYA 1CDNA 4CPVA 2BKIB 5JOLA 1SMGA 1L2OC 3DD4A 4P5OE 3EVUA 4MEWA 3NHIA 3WNXB 3PFVA 3ZNIA 4YI9A 3SG6A 2G9BA 3CZ1A 3M0WA 1NYAA 2CTNA 2MRDA 4GAOA 3AKBA 2KBIA 2KBMA 3SIAA 5HKYA 2ZFDA 1CM1A 2K2AA 2JTTA 3NSLA 4MRXA 4YGAA 3KF9A 4NDDA 1DMOA 1XK4C 2QEVA 1K93D 5FYXA 4M2QA 1NIWA 1LVCD 1OOGA 1SR6C 1QXPA 2JQ6A 2LVIA 1JF0A 3HCMA 4FQOA 3TS5B 3CLNA 1ZACA 3PSRA 2KI6C 3DF0A 3JVTB 3SG3A 1XFUO 5AERA 1EG4A 2K7BA 2BKHB 1FF1A 3DF0B 3LK1A 3RLZA 3BUXB 1GGZA 2ZRTA 3CZTX 2L50A 1PSBA 2MLFC 1KSMA 1QIVA 4I5JA 1TTXA 2LP2A 3K1EA 3KHEA 2LMUA 4PHKA 1LA0A 5PALA 5KU1A 2Y4QA 2DOQA 2JRFA 3BUNB 2P6BB 2MA2A 4PHMA 1T14A 1CMGA 4OZDA 1WRZA 1BU3A 2BBMA 3BFHA 4F7FA 1SL8A 2H61A 1M46A 1F4QA 1PK0D 2LAPA 2EC6C 4INWA 3O2PA 2NZ0A 1K2HA 1HQVA 1XA5A 3BQ3A 3CGAA 2LANA 1KK7Z 1UHKA 2PVBA 4PE7A 1OZOA 5TNCA 1XO5A 1RJVA 1TNQA 1OE9B 1AVSA 2MBXA 1QASA 2TN4A 4PHJA 3AAJA 4QJ4B 4NDCA 5CSIA 2OPOA 1TNXA 1XFXO 1GM0A 2KI4B 2FJUB 2H2KA 2SASA 3I5FB 4FQTA 2LLUA 2JWWA 3JTDB 3OHMB 1B1GA 1BMOA 4TNCA 1S3PA 1A4PA 1NCXA 1JFKA 1YVLA 2NXQA 1QV0A 2BAPA 2F33A 3F45A 4MLWA 4AQJA 3GK2A 1JSAA 3CR4X 3BUWB 4DS7A 1A29A 1S5GY 1UHHA 3E3RA 5CSJA 4AOMA 3R72A 4CLNA 1F54A 4YBHB 1EJ3A 5I8NA 3I5GB 3LL8B 3DVMA 4Q04A 1J7PA 2K8MB 2L5XB 1QVIY 2KAVA 2BCBA 3BOWB 2K2FA 3OB2B 4YRUA 1YRTB 2A4JA 2LVKA 5D3OA 4GBAA 1KSOA 1R6PA 1SL9A 1EH2A 1WLMA 1RWYA 1S36A 1J7QA 2LE9B 1YUUA 2WCEA 4MBEA 3V2LA 2Y5IA 1DVIA 4PT1A 2P70A 2F2OA 2LLTA 5CPVA 1TUJA 5I2OA 2BCXA 5HL1A 1SNLA 2K61A 4M2OA 1CNPA 3EVRA 3SS3A 1S6CA 1BR1B 5J3XA 3VRNA 4GUKA 4MVFA 3CZ2A 2M3WA 1YX8A 2I2RE 1MF8B 4WRIA 3DY9A 1PSRA 3GOFA 1BJFA 4R1EA 3TS5C 1NP8A 4PE1A 3SS5A 3JVTC 2NCPA 1G4YR 1EL4A 4YGCB 4D1EA 2BE4A 2Y1MA 4HRHA 1F8HA 5DKNA 1IJ5A 3EKHA 3SJSA 1F70A 4PDZA 1QLKA 1M63B 1R2UA 2BL0C 2WCBA 1KCYA 4NQGA 1KQMB 2JT3A 2ZNEA 4YGEB 2FCEA 1YVHA 5HYDA 3KEVA 4A4CA 2Q91A 4PCWA 1WRLA 1SCMC 2HPSA 3D10A 1AJ4A 1IG5A 2HQWA 1AUIB 3PM8A 5ER4X 1BOCA 1NCYA 3LK0A 2K0JA 1DC1A 3QMEA 2L2CA 1BODA 2KAXA 1DGUA 4ORCB 2KFFA 3OB1B 4NDBA 3EK8A 1CFPA 4HRGA 1CFCA 4A4BA 2OTGC 3O6BA 2CT9A 1FW4A 1N65A 2BBNA 2I18A 4IJ7A 3S0AA 4I5NB 3PLFB 1ZMZA 2LLSA 1A03A 4YI8A 2JC2A 1JUOA 3B88A 3IF7A 4QJ5B 4I5KA 2M0RA 1IWQA 3SG7A 2B1UA 1SSEB 2K7OA 1X02A 5HKWA 1SCVA 1W7JB 4GGFC 5I94A 2WCFA 4ETOA 1JC2A 1B7TZ 2L2EA 1WDCB 3JTDC 1QWVA 2KGBC 1J1DA 3FS7A 1OSAA 5AANA 5KSZA 2JNXA 1KQVA 1SY9A 2LC5A 2LHIA 2OS8B 2QPTA 3EG5B 3EK7A 3PM2A 4INXA 1QX7A 4MZJA 4AQIA 2LNKA 1F55A 1MXEA 2L4HA 4U8DA 3S0EA 2WCJA 4ZCVA 1K95A 3PATA 1K96A 3C1VA 3GK4X 3R1PA 3I5GC 4JKTA 2LV7A 1KFUS 2ZRSA 1UHIA 1HT9A 3KO0A 4WQ3A 3TUYB 3AAKA 2QACA 2KYFA 2WCHA 1J7RA 1S26D 2I94A 2PALA 1DJIA 3TDUA 1A2XA 4UPGA 2KQYA 1AJ5A 1NX1A 2JPTA 4GFTA 5BPJA 2CBLA 1KFXS 2BNXA 2M9GA 1G8IA 2PQLA 1KK8B 2KI6D 1MQ1A 1IKUA 1BR4B 3I5IB 2CNPA 4DUQA 1YURA 4JD9A 1C07A 5F6TA 3AKAA 3DVJA 2JT8A 2EHBA 1TWOA 2JOJA 2ERBA 3EVVA 3GK1A 2H8VA 3PN7C 4HREE 3MSEB 1CLMA 3O78A 1RFJA 5KTYA 2D8NA 1SK6D 3CS1A 3CDNA 2L5YA 5FI6A 1CLBA 3DVEA 1IGVA 1GGWA 2F2PA 4PALA 1NX2A 2LVVA 1J7OA 3N7HA 2WC8A 1DTLA 1OMRA 3ZWHA 2KDHA 5AXIA 2KLEA 2K7DA 5I2QA 2JT0A 3OP0A 1OW4A 1LXFC 1QV1A 1B4CA 1DJHA 2NLNA 3NHTA 4E68A 2AUCA 2WC6A 2JU0A 3EKJA 3TDZA 3VGOA 4BY5A 3CZ0A 1PRWA 1CFFA 1Z4HA 2F8PA 2KOTA 3L4LA 4OR9B 5IBWA 3R1OA 3CR5X 1S1EA 2F3YA 3BOWA 1DJWA 4WQ2A 2JPOA 3NSKA 1LS8A 2M7NA 3A4UB 4YGDB 1M45A 4M2PA 2FCDA 2KLDA 3QRXA 2COLB 1CMFA 2FJYA 1ODBA 1QIWA 1DEKA 2VRGA 3VROA 4IL1A 3BUOB 5HLOA 2Y1NA 5D69A 4CFQA 1B8RA 1SPYA 4USLA 1IIOA 1NSHA 1WLZA 1TOPA 1TRFA 1UHNA 3D75A 2JXCA 1UHJA 1QJTA 3DYEA 1RROA 2NCOA 2IS9A 2PYQA 3D78A 3O4XA 4C0JA 3S0BA 1J55A 1YTZC 2KSPA 4MSPA 2OS8C 2BECA 2PASA 1QX5B 3FE6A 4PHNA 1AP4A 5B8IB 2MLEC 5D7FA 1YRUB 4GNKB 1P28A 4N5XA 1GQMA 3WHUB 1F71A 1FI6A 2L51A 3H4SE 1SBJA 1E8AA 2QEOA 1NX3A 3D74A 1Y1XA 4JQ0D 1YUSA 3RZSA 1DQEA 2LMTA 2EC6B 2GV5A 4BY4A 1B47A 4ORBB 1UP5A 2RGIA 2LP3A 5EL2A 1IQ5A 1B8LA 1C7WA 1TUZA 1SYMA 2M49B 1F4OA 1AHRA 1OOIX 1B8CA 1KK8C 4MZLA 3I5IC 4FTGA 4QJ3B 3R1VA 1JFJA 3PALA 1PVBA 2H61C 1MHOA 2WOSA 3O4YA 3VRQA 1DGVA 2ISDA 2LMVA 1NWDA 3B6XA 3CR2A 1PVAA 1KK7Y 1A75B 5FI2A 1RECA 2ZN8A 2ZNDA 2V53A 2JXLA 1QLSA 2L0PA 1DJGA 1DELA 4N1FA 5I2LA 4CFRA 4OCIA 1C3YA 3SIBA 4GGNA 1S5GZ 1XFYO 2P71A 1B9AA 3OGNA 2KI4C 3I5FC 2K7CA 1D1OA 4OV2A 2HQ8A 1QVIZ 2YGUA 1JWDA 3SS4A 2WNDA 4MN0A 3FE9A 1ORGA 1M31A 2E30A 2KYCA 2PSRA 4XYNA 3WXAA 1K94A 1V1GA 4PE4A 3S0DA 1H4BA 1NUBA 3OX5A 1MXLC 1EXRA 5JJGA 1WY9A 2F3ZA 5DKRA 4C0LA 1M39A 3SG4A 3FWCA 1OOHA 1OZSA 1XFZO 1TIZA 1BF5A 1CLLA 1BG1A 3L47A 1RK9A 2M1KB 3D0YA 2JNFA 1YUTA 3D0YB 4C0KA 1XYDA 2LCPA 1KWOB 1ZUZA 1LINA 4JWQA 5DICA 1CTRA 1XFRA 3VRRA 1LKJA 2L4IA 1FI5A 1IH0A 3LLEA 3A8RA 2CXJA 2GGZA 2QDIA 3VRPA 3NXAA 2G2BA 1CDPA 4L9MA 2QEBA 2O60A 4MRYA 1K9PA 1Y1UA 3I5HB 1XFWO 5ER5A 2LUXA 1NX0A 4CIDA 1OMVA 1C7VA 3TZ1A 2SCPA 2M97A 3EK4A 3HX4A 2BL0B 2LHLA 2WCKA 1KFUL 3B7AA 3FWBA 2GGMA 3B86A 1K8UA 1SW8A 1ALWA 2EGDA 2BE6A 3SG2A 1CDLA 1Q80A 1QATA 1QX2A 1TCOB 1VRKA 3S0FA 1FBVA 1S6IA 4I5LB 1MUXA 5HLVA 2KFHA 3RM1A 1SCMB 1ZFSA 5FI7A 2KAYA 1N2DA 1L2OB 3D73A 5G08A 1L7ZA 2KHNA 2PRUA 2M1UA 2Q4UA 3L4AA 1KFXL 1TN4A 1KQMC 1UURA 1NPQA 1DJXA 2LM5A 3BFBA 5AFPA 4HSZA 1BLQA 1IJ6A 3D76A 2OTGB 1DJYA 4N1GA 1ALVA 4OVNF 2R2IA 3NSOA 1TNWA 1XVJA 1UWOA 1WRKA 2MJWB 1DF0A 4JPZB 3WHTB 2KQ6A 4PE0A 1XK4A 1DF0B 4GGFA 1LA3A 1TCFA 2FOTA 1C3ZA 3VB1A 1OMDA 4YGBB 3BFAA 2QEHA 2MAZA 2LVJA 1CB1A 1PALA 2KPHA 2LUCA 3LCPC 1SR6B 5CSFA 3IQOA 2L98A 1UUSA 2ZKMX 1EG3A 1K9UA 1H8BA 3IQQA 1Y1AA 1YX7A 1DT7B 1WDCC 2I7AA 4ICBA 1W7IB 1B7TY 2AAOA 3S0GA 3DXLA 1J1EA 3OBVA 4ORAB 1G33A 1OOJA 2HF5A 2KFGA 1OOFA 3NSIA 2O5GA 1DJZA 4F0ZB
chains in the Genus database with same CATH topology
2CCMA 2ZN9A 5CSNA 2M8UA 2KNEA 5HKZA 1YR5A 3OX6A 1QS7A 2MHHA 1V1FA 1NCZA 1XFVO 1U5IA 3TUYC 1QTXA 1U5IB 4ZCUA 2AMIA 5K89A 1PULA 4XJKA 1MR8A 1N0YA 2JZIA 4P2YB 4GPLB 4XJKB 3KPXA 1K9KA 1KWOC 2E6WA 1CFDA 1SL7A 3CTNA 5AEQA 4MZKA 3DVKA 3BUMB 3PN7B 3BXKA 4DRWA 3TDIA 1Y6WA 1RTP1 1JBAA 2WORA 1BT6A 3BYAA 1IRJA 1CKKA 4DIRA 4OKHA 1JF2A 3I5HC 5GQQC 1ZOTB 3FIAA 1A75A 2BCAA 1FPWA 3CWGA 3ICBA 3K21A 2M7LA 1S6JA 2PMYA 3SG5A 1SKTA 4DCKA 1K90D 1AK8A 1Y0VH 1SRAA 1CM4A 5DKQA 1IQ3A 2M29A 1TNPA 2JTZA 2JULA 1CDMA 1MWNA 2HETA 2KGRA 1OQPA 1GJYA 1CDNA 4CPVA 2BKIB 5JOLA 1SMGA 1L2OC 3DD4A 4P5OE 3EVUA 4MEWA 3WNXB 3PFVA 3ZNIA 4YI9A 3SG6A 2G9BA 3M0WA 1NYAA 2CTNA 2MRDA 4GAOA 3AKBA 2KBIA 2KBMA 3SIAA 5HKYA 2ZFDA 1CM1A 2K2AA 2JTTA 3NSLA 4MRXA 4YGAA 3KF9A 4NDDA 1DMOA 1XK4C 1K93D 5FYXA 4M2QA 1NIWA 1LVCD 1SR6C 2JQ6A 1QXPA 2LVIA 3HCMA 1JF0A 4FQOA 3TS5B 3CLNA 1ZACA 3PSRA 2KI6C 3DF0A 3JVTB 3SG3A 1XFUO 5AERA 1EG4A 2K7BA 2BKHB 1FF1A 3DF0B 3LK1A 3RLZA 3BUXB 1GGZA 2ZRTA 3CZTX 2L50A 1PSBA 2MLFC 1KSMA 1QIVA 4I5JA 1TTXA 2LP2A 3KHEA 2LMUA 4PHKA 1LA0A 5PALA 5KU1A 2Y4QA 2DOQA 2JRFA 3BUNB 2P6BB 2MA2A 4PHMA 1CMGA 1WRZA 1BU3A 2BBMA 1SL8A 2H61A 1M46A 1F4QA 1PK0D 2LAPA 2EC6C 3O2PA 2NZ0A 1K2HA 1HQVA 1XA5A 3BQ3A 3CGAA 2LANA 1KK7Z 1UHKA 2PVBA 4PE7A 1OZOA 5TNCA 1XO5A 1RJVA 1TNQA 1OE9B 1AVSA 2MBXA 1QASA 2TN4A 4PHJA 3AAJA 4QJ4B 4NDCA 5CSIA 2OPOA 1TNXA 1XFXO 2KI4B 2FJUB 2H2KA 2SASA 3I5FB 2LLUA 2JWWA 3JTDB 3OHMB 1B1GA 1BMOA 4TNCA 1S3PA 1A4PA 1NCXA 1JFKA 1YVLA 2NXQA 1QV0A 2F33A 4AQJA 3F45A 4MLWA 3GK2A 1JSAA 3CR4X 3BUWB 4DS7A 1A29A 1S5GY 1UHHA 3E3RA 5CSJA 4AOMA 4CLNA 1F54A 4YBHB 1EJ3A 5I8NA 3I5GB 3LL8B 3DVMA 4Q04A 1J7PA 2K8MB 2L5XB 1QVIY 2KAVA 2BCBA 3BOWB 2K2FA 3OB2B 4YRUA 1YRTB 2A4JA 2LVKA 4GBAA 1KSOA 1R6PA 1SL9A 1EH2A 1WLMA 1RWYA 1S36A 1J7QA 2LE9B 1YUUA 2WCEA 4MBEA 2Y5IA 1DVIA 2F2OA 2LLTA 5CPVA 5I2OA 2BCXA 1SNLA 2K61A 4M2OA 1CNPA 3EVRA 1S6CA 1BR1B 5J3XA 3VRNA 4GUKA 4MVFA 2M3WA 1YX8A 2I2RE 1MF8B 4WRIA 3GOFA 1PSRA 4R1EA 1BJFA 3TS5C 1NP8A 4PE1A 3JVTC 2NCPA 1G4YR 1EL4A 4YGCB 4D1EA 2BE4A 2Y1MA 4HRHA 1F8HA 5DKNA 1IJ5A 3EKHA 3SJSA 1F70A 4PDZA 1QLKA 1M63B 1R2UA 2BL0C 2WCBA 1KCYA 4NQGA 1KQMB 2JT3A 2ZNEA 4YGEB 2FCEA 1YVHA 5HYDA 3KEVA 4A4CA 2Q91A 4PCWA 1WRLA 1SCMC 2HPSA 3D10A 1AJ4A 1IG5A 2HQWA 1AUIB 3PM8A 5ER4X 1BOCA 1NCYA 3LK0A 2K0JA 1BODA 2KAXA 1DGUA 4ORCB 2KFFA 3OB1B 4NDBA 3EK8A 1CFPA 4HRGA 1CFCA 4A4BA 2OTGC 3O6BA 2CT9A 1FW4A 1N65A 2BBNA 2I18A 4I5NB 3PLFB 1ZMZA 2LLSA 1A03A 4YI8A 2JC2A 1JUOA 4QJ5B 3IF7A 4I5KA 2M0RA 1IWQA 3SG7A 2B1UA 2K7OA 1X02A 5HKWA 1SCVA 1W7JB 4GGFC 2WCFA 4ETOA 1JC2A 1B7TZ 2L2EA 1WDCB 3JTDC 2KGBC 1J1DA 3FS7A 1OSAA 5AANA 5KSZA 2JNXA 1KQVA 1SY9A 2LC5A 2LHIA 2OS8B 2QPTA 3EK7A 4AQIA 1QX7A 4MZJA 2LNKA 1F55A 1MXEA 2L4HA 4U8DA 4ZCVA 1K95A 3PATA 1K96A 3C1VA 3GK4X 3I5GC 2LV7A 1KFUS 2ZRSA 1UHIA 1HT9A 3KO0A 4WQ3A 3TUYB 3AAKA 2QACA 2KYFA 1J7RA 1S26D 2I94A 2PALA 1DJIA 3TDUA 1A2XA 4UPGA 2KQYA 1AJ5A 1NX1A 2JPTA 4GFTA 5BPJA 2CBLA 1KFXS 2M9GA 1G8IA 1KK8B 2KI6D 1MQ1A 1IKUA 1BR4B 3I5IB 2CNPA 4DUQA 1YURA 1C07A 5F6TA 3AKAA 3DVJA 2JT8A 2EHBA 2JOJA 3EVVA 3GK1A 3PN7C 4HREE 3MSEB 1CLMA 3O78A 1RFJA 5KTYA 2D8NA 1SK6D 3CS1A 1CLBA 3DVEA 1IGVA 1GGWA 2F2PA 4PALA 1NX2A 2LVVA 1J7OA 2WC8A 1DTLA 1OMRA 3ZWHA 2KDHA 5AXIA 2K7DA 5I2QA 2JT0A 3OP0A 1LXFC 1QV1A 1B4CA 1DJHA 2NLNA 4E68A 2AUCA 2JU0A 3EKJA 3TDZA 3VGOA 4BY5A 1PRWA 1CFFA 2F8PA 2KOTA 4OR9B 5IBWA 3CR5X 1S1EA 2F3YA 3BOWA 1DJWA 4WQ2A 3NSKA 2M7NA 3A4UB 4YGDB 1M45A 4M2PA 2FCDA 3QRXA 2COLB 1CMFA 1ODBA 1QIWA 2VRGA 3VROA 4IL1A 3BUOB 5HLOA 2Y1NA 5D69A 4CFQA 1B8RA 1SPYA 4USLA 1NSHA 1WLZA 1TOPA 1TRFA 1UHNA 2JXCA 1UHJA 1QJTA 1RROA 2NCOA 2IS9A 4C0JA 1J55A 1YTZC 2KSPA 4MSPA 2OS8C 2BECA 2PASA 1QX5B 4PHNA 1AP4A 5B8IB 2MLEC 5D7FA 1YRUB 4GNKB 4N5XA 1GQMA 3WHUB 1F71A 1FI6A 2L51A 3H4SE 1SBJA 1E8AA 1NX3A 1Y1XA 4JQ0D 1YUSA 2LMTA 2EC6B 2GV5A 4BY4A 1B47A 4ORBB 1UP5A 2RGIA 2LP3A 1IQ5A 1B8LA 1C7WA 1SYMA 2M49B 1F4OA 1AHRA 1B8CA 1KK8C 4MZLA 3I5IC 4FTGA 4QJ3B 1JFJA 3PALA 1PVBA 2H61C 1MHOA 2WOSA 3O4YA 3VRQA 1DGVA 2ISDA 2LMVA 1NWDA 3CR2A 1PVAA 1KK7Y 1A75B 1RECA 2ZN8A 2ZNDA 2V53A 2JXLA 1QLSA 2L0PA 1DJGA 4N1FA 5I2LA 4CFRA 4OCIA 3SIBA 4GGNA 1S5GZ 1XFYO 1B9AA 2KI4C 3I5FC 2K7CA 1D1OA 4OV2A 2HQ8A 1QVIZ 1JWDA 2WNDA 4MN0A 2KYCA 1M31A 2E30A 4XYNA 2PSRA 3WXAA 1K94A 1V1GA 4PE4A 1H4BA 1NUBA 3OX5A 1MXLC 1EXRA 5JJGA 1WY9A 2F3ZA 5DKRA 4C0LA 1M39A 3SG4A 3FWCA 1OZSA 1XFZO 1TIZA 1BF5A 1CLLA 1BG1A 1RK9A 2M1KB 3D0YA 2JNFA 1YUTA 3D0YB 4C0KA 1XYDA 2LCPA 1KWOB 1ZUZA 1LINA 4JWQA 1CTRA 3VRRA 1LKJA 2L4IA 1FI5A 1IH0A 3LLEA 3A8RA 2CXJA 2GGZA 3VRPA 3NXAA 2G2BA 1CDPA 4L9MA 2O60A 4MRYA 1K9PA 1Y1UA 3I5HB 1XFWO 5ER5A 2LUXA 1NX0A 4CIDA 1OMVA 1C7VA 3TZ1A 2SCPA 2M97A 3EK4A 3HX4A 2BL0B 2LHLA 1KFUL 3FWBA 2GGMA 1K8UA 1SW8A 1ALWA 2EGDA 2BE6A 3SG2A 1CDLA 1Q80A 1QATA 1QX2A 1TCOB 1VRKA 1FBVA 1S6IA 4I5LB 1MUXA 5HLVA 2KFHA 3RM1A 1SCMB 1ZFSA 2KAYA 1N2DA 1L2OB 5G08A 1L7ZA 2KHNA 2PRUA 2M1UA 2Q4UA 1KFXL 1TN4A 1KQMC 1UURA 1NPQA 1DJXA 2LM5A 5AFPA 4HSZA 1BLQA 1IJ6A 2OTGB 1DJYA 4N1GA 1ALVA 4OVNF 2R2IA 3NSOA 1TNWA 1XVJA 1UWOA 1WRKA 2MJWB 1DF0A 4JPZB 3WHTB 2KQ6A 4PE0A 1XK4A 1DF0B 4GGFA 1LA3A 1TCFA 2FOTA 1OMDA 4YGBB 2MAZA 2LVJA 1CB1A 1PALA 2LUCA 3LCPC 1SR6B 5CSFA 3IQOA 2L98A 1UUSA 2ZKMX 1EG3A 1K9UA 1H8BA 3IQQA 1Y1AA 1YX7A 1DT7B 1WDCC 2I7AA 4ICBA 1W7IB 1B7TY 2AAOA 1J1EA 4ORAB 1G33A 1OOJA 2HF5A 2KFGA 3NSIA 2O5GA 1DJZA 4F0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCM A;  2ZN9 A;  5CSN A;  2M8U A;  2KNE A;  5HKZ A;  1YR5 A;  3OX6 A;  1QS7 A;  2MHH A;  1V1F A;  1NCZ A;  1XFV O;  1U5I A;  3TUY C;  1QTX A;  1U5I B;  4ZCU A;  2AMI A;  5K89 A;  1PUL A;  4XJK A;  1MR8 A;  1N0Y A;  2JZI A;  4P2Y B;  4GPL B;  4XJK B;  3KPX A;  1K9K A;  1KWO C;  2E6W A;  1CFD A;  1SL7 A;  3CTN A;  5AEQ A;  4MZK A;  3DVK A;  3BUM B;  3PN7 B;  3BXK A;  4DRW A;  3TDI A;  1Y6W A;  1RTP 1;  1JBA A;  2WOR A;  1BT6 A;  3BYA A;  1IRJ A;  1CKK A;  4DIR A;  4OKH A;  1JF2 A;  3I5H C;  5GQQ C;  1ZOT B;  3FIA A;  1A75 A;  2BCA A;  1FPW A;  3CWG A;  3ICB A;  3K21 A;  2M7L A;  1S6J A;  2PMY A;  3SG5 A;  1SKT A;  4DCK A;  1K90 D;  1AK8 A;  1Y0V H;  1SRA A;  1CM4 A;  5DKQ A;  1IQ3 A;  2M29 A;  1TNP A;  2JTZ A;  2JUL A;  1CDM A;  1MWN A;  2HET A;  2KGR A;  1OQP A;  1GJY A;  1CDN A;  4CPV A;  2BKI B;  5JOL A;  1SMG A;  1L2O C;  3DD4 A;  4P5O E;  3EVU A;  4MEW A;  3WNX B;  3PFV A;  3ZNI A;  4YI9 A;  3SG6 A;  2G9B A;  3M0W A;  1NYA A;  2CTN A;  2MRD A;  4GAO A;  3AKB A;  2KBI A;  2KBM A;  3SIA A;  5HKY A;  2ZFD A;  1CM1 A;  2K2A A;  2JTT A;  3NSL A;  4MRX A;  4YGA A;  3KF9 A;  4NDD A;  1DMO A;  1XK4 C;  1K93 D;  5FYX A;  4M2Q A;  1NIW A;  1LVC D;  1SR6 C;  2JQ6 A;  1QXP A;  2LVI A;  3HCM A;  1JF0 A;  4FQO A;  3TS5 B;  3CLN A;  1ZAC A;  3PSR A;  2KI6 C;  3DF0 A;  3JVT B;  3SG3 A;  1XFU O;  5AER A;  1EG4 A;  2K7B A;  2BKH B;  1FF1 A;  3DF0 B;  3LK1 A;  3RLZ A;  3BUX B;  1GGZ A;  2ZRT A;  3CZT X;  2L50 A;  1PSB A;  2MLF C;  1KSM A;  1QIV A;  4I5J A;  1TTX A;  2LP2 A;  3KHE A;  2LMU A;  4PHK A;  1LA0 A;  5PAL A;  5KU1 A;  2Y4Q A;  2DOQ A;  2JRF A;  3BUN B;  2P6B B;  2MA2 A;  4PHM A;  1CMG A;  1WRZ A;  1BU3 A;  2BBM A;  1SL8 A;  2H61 A;  1M46 A;  1F4Q A;  1PK0 D;  2LAP A;  2EC6 C;  3O2P A;  2NZ0 A;  1K2H A;  1HQV A;  1XA5 A;  3BQ3 A;  3CGA A;  2LAN A;  1KK7 Z;  1UHK A;  2PVB A;  4PE7 A;  1OZO A;  5TNC A;  1XO5 A;  1RJV A;  1TNQ A;  1OE9 B;  1AVS A;  2MBX A;  1QAS A;  2TN4 A;  4PHJ A;  3AAJ A;  4QJ4 B;  4NDC A;  5CSI A;  2OPO A;  1TNX A;  1XFX O;  2KI4 B;  2FJU B;  2H2K A;  2SAS A;  3I5F B;  2LLU A;  2JWW A;  3JTD B;  3OHM B;  1B1G A;  1BMO A;  4TNC A;  1S3P A;  1A4P A;  1NCX A;  1JFK A;  1YVL A;  2NXQ A;  1QV0 A;  2F33 A;  4AQJ A;  3F45 A;  4MLW A;  3GK2 A;  1JSA A;  3CR4 X;  3BUW B;  4DS7 A;  1A29 A;  1S5G Y;  1UHH A;  3E3R A;  5CSJ A;  4AOM A;  4CLN A;  1F54 A;  4YBH B;  1EJ3 A;  5I8N A;  3I5G B;  3LL8 B;  3DVM A;  4Q04 A;  1J7P A;  2K8M B;  2L5X B;  1QVI Y;  2KAV A;  2BCB A;  3BOW B;  2K2F A;  3OB2 B;  4YRU A;  1YRT B;  2A4J A;  2LVK A;  4GBA A;  1KSO A;  1R6P A;  1SL9 A;  1EH2 A;  1WLM A;  1RWY A;  1S36 A;  1J7Q A;  2LE9 B;  1YUU A;  2WCE A;  4MBE A;  2Y5I A;  1DVI A;  2F2O A;  2LLT A;  5CPV A;  5I2O A;  2BCX A;  1SNL A;  2K61 A;  4M2O A;  1CNP A;  3EVR A;  1S6C A;  1BR1 B;  5J3X A;  3VRN A;  4GUK A;  4MVF A;  2M3W A;  1YX8 A;  2I2R E;  1MF8 B;  4WRI A;  3GOF A;  1PSR A;  4R1E A;  1BJF A;  3TS5 C;  1NP8 A;  4PE1 A;  3JVT C;  2NCP A;  1G4Y R;  1EL4 A;  4YGC B;  4D1E A;  2BE4 A;  2Y1M A;  4HRH A;  1F8H A;  5DKN A;  1IJ5 A;  3EKH A;  3SJS A;  1F70 A;  4PDZ A;  1QLK A;  1M63 B;  1R2U A;  2BL0 C;  2WCB A;  1KCY A;  4NQG A;  1KQM B;  2JT3 A;  2ZNE A;  4YGE B;  2FCE A;  1YVH A;  5HYD A;  3KEV A;  4A4C A;  2Q91 A;  4PCW A;  1WRL A;  1SCM C;  2HPS A;  3D10 A;  1AJ4 A;  1IG5 A;  2HQW A;  1AUI B;  3PM8 A;  5ER4 X;  1BOC A;  1NCY A;  3LK0 A;  2K0J A;  1BOD A;  2KAX A;  1DGU A;  4ORC B;  2KFF A;  3OB1 B;  4NDB A;  3EK8 A;  1CFP A;  4HRG A;  1CFC A;  4A4B A;  2OTG C;  3O6B A;  2CT9 A;  1FW4 A;  1N65 A;  2BBN A;  2I18 A;  4I5N B;  3PLF B;  1ZMZ A;  2LLS A;  1A03 A;  4YI8 A;  2JC2 A;  1JUO A;  4QJ5 B;  3IF7 A;  4I5K A;  2M0R A;  1IWQ A;  3SG7 A;  2B1U A;  2K7O A;  1X02 A;  5HKW A;  1SCV A;  1W7J B;  4GGF C;  2WCF A;  4ETO A;  1JC2 A;  1B7T Z;  2L2E A;  1WDC B;  3JTD C;  2KGB C;  1J1D A;  3FS7 A;  1OSA A;  5AAN A;  5KSZ A;  2JNX A;  1KQV A;  1SY9 A;  2LC5 A;  2LHI A;  2OS8 B;  2QPT A;  3EK7 A;  4AQI A;  1QX7 A;  4MZJ A;  2LNK A;  1F55 A;  1MXE A;  2L4H A;  4U8D A;  4ZCV A;  1K95 A;  3PAT A;  1K96 A;  3C1V A;  3GK4 X;  3I5G C;  2LV7 A;  1KFU S;  2ZRS A;  1UHI A;  1HT9 A;  3KO0 A;  4WQ3 A;  3TUY B;  3AAK A;  2QAC A;  2KYF A;  1J7R A;  1S26 D;  2I94 A;  2PAL A;  1DJI A;  3TDU A;  1A2X A;  4UPG A;  2KQY A;  1AJ5 A;  1NX1 A;  2JPT A;  4GFT A;  5BPJ A;  2CBL A;  1KFX S;  2M9G A;  1G8I A;  1KK8 B;  2KI6 D;  1MQ1 A;  1IKU A;  1BR4 B;  3I5I B;  2CNP A;  4DUQ A;  1YUR A;  1C07 A;  5F6T A;  3AKA A;  3DVJ A;  2JT8 A;  2EHB A;  2JOJ A;  3EVV A;  3GK1 A;  3PN7 C;  4HRE E;  3MSE B;  1CLM A;  3O78 A;  1RFJ A;  5KTY A;  2D8N A;  1SK6 D;  3CS1 A;  1CLB A;  3DVE A;  1IGV A;  1GGW A;  2F2P A;  4PAL A;  1NX2 A;  2LVV A;  1J7O A;  2WC8 A;  1DTL A;  1OMR A;  3ZWH A;  2KDH A;  5AXI A;  2K7D A;  5I2Q A;  2JT0 A;  3OP0 A;  1LXF C;  1QV1 A;  1B4C A;  1DJH A;  2NLN A;  4E68 A;  2AUC A;  2JU0 A;  3EKJ A;  3TDZ A;  3VGO A;  4BY5 A;  1PRW A;  1CFF A;  2F8P A;  2KOT A;  4OR9 B;  5IBW A;  3CR5 X;  1S1E A;  2F3Y A;  3BOW A;  1DJW A;  4WQ2 A;  3NSK A;  2M7N A;  3A4U B;  4YGD B;  1M45 A;  4M2P A;  2FCD A;  3QRX A;  2COL B;  1CMF A;  1ODB A;  1QIW A;  2VRG A;  3VRO A;  4IL1 A;  3BUO B;  5HLO A;  2Y1N A;  5D69 A;  4CFQ A;  1B8R A;  1SPY A;  4USL A;  1NSH A;  1WLZ A;  1TOP A;  1TRF A;  1UHN A;  2JXC A;  1UHJ A;  1QJT A;  1RRO A;  2NCO A;  2IS9 A;  4C0J A;  1J55 A;  1YTZ C;  2KSP A;  4MSP A;  2OS8 C;  2BEC A;  2PAS A;  1QX5 B;  4PHN A;  1AP4 A;  5B8I B;  2MLE C;  5D7F A;  1YRU B;  4GNK B;  4N5X A;  1GQM A;  3WHU B;  1F71 A;  1FI6 A;  2L51 A;  3H4S E;  1SBJ A;  1E8A A;  1NX3 A;  1Y1X A;  4JQ0 D;  1YUS A;  2LMT A;  2EC6 B;  2GV5 A;  4BY4 A;  1B47 A;  4ORB B;  1UP5 A;  2RGI A;  2LP3 A;  1IQ5 A;  1B8L A;  1C7W A;  1SYM A;  2M49 B;  1F4O A;  1AHR A;  1B8C A;  1KK8 C;  4MZL A;  3I5I C;  4FTG A;  4QJ3 B;  1JFJ A;  3PAL A;  1PVB A;  2H61 C;  1MHO A;  2WOS A;  3O4Y A;  3VRQ A;  1DGV A;  2ISD A;  2LMV A;  1NWD A;  3CR2 A;  1PVA A;  1KK7 Y;  1A75 B;  1REC A;  2ZN8 A;  2ZND A;  2V53 A;  2JXL A;  1QLS A;  2L0P A;  1DJG A;  4N1F A;  5I2L A;  4CFR A;  4OCI A;  3SIB A;  4GGN A;  1S5G Z;  1XFY O;  1B9A A;  2KI4 C;  3I5F C;  2K7C A;  1D1O A;  4OV2 A;  2HQ8 A;  1QVI Z;  1JWD A;  2WND A;  4MN0 A;  2KYC A;  1M31 A;  2E30 A;  4XYN A;  2PSR A;  3WXA A;  1K94 A;  1V1G A;  4PE4 A;  1H4B A;  1NUB A;  3OX5 A;  1MXL C;  1EXR A;  5JJG A;  1WY9 A;  2F3Z A;  5DKR A;  4C0L A;  1M39 A;  3SG4 A;  3FWC A;  1OZS A;  1XFZ O;  1TIZ A;  1BF5 A;  1CLL A;  1BG1 A;  1RK9 A;  2M1K B;  3D0Y A;  2JNF A;  1YUT A;  3D0Y B;  4C0K A;  1XYD A;  2LCP A;  1KWO B;  1ZUZ A;  1LIN A;  4JWQ A;  1CTR A;  3VRR A;  1LKJ A;  2L4I A;  1FI5 A;  1IH0 A;  3LLE A;  3A8R A;  2CXJ A;  2GGZ A;  3VRP A;  3NXA A;  2G2B A;  1CDP A;  4L9M A;  2O60 A;  4MRY A;  1K9P A;  1Y1U A;  3I5H B;  1XFW O;  5ER5 A;  2LUX A;  1NX0 A;  4CID A;  1OMV A;  1C7V A;  3TZ1 A;  2SCP A;  2M97 A;  3EK4 A;  3HX4 A;  2BL0 B;  2LHL A;  1KFU L;  3FWB A;  2GGM A;  1K8U A;  1SW8 A;  1ALW A;  2EGD A;  2BE6 A;  3SG2 A;  1CDL A;  1Q80 A;  1QAT A;  1QX2 A;  1TCO B;  1VRK A;  1FBV A;  1S6I A;  4I5L B;  1MUX A;  5HLV A;  2KFH A;  3RM1 A;  1SCM B;  1ZFS A;  2KAY A;  1N2D A;  1L2O B;  5G08 A;  1L7Z A;  2KHN A;  2PRU A;  2M1U A;  2Q4U A;  1KFX L;  1TN4 A;  1KQM C;  1UUR A;  1NPQ A;  1DJX A;  2LM5 A;  5AFP A;  4HSZ A;  1BLQ A;  1IJ6 A;  2OTG B;  1DJY A;  4N1G A;  1ALV A;  4OVN F;  2R2I A;  3NSO A;  1TNW A;  1XVJ A;  1UWO A;  1WRK A;  2MJW B;  1DF0 A;  4JPZ B;  3WHT B;  2KQ6 A;  4PE0 A;  1XK4 A;  1DF0 B;  4GGF A;  1LA3 A;  1TCF A;  2FOT A;  1OMD A;  4YGB B;  2MAZ A;  2LVJ A;  1CB1 A;  1PAL A;  2LUC A;  3LCP C;  1SR6 B;  5CSF A;  3IQO A;  2L98 A;  1UUS A;  2ZKM X;  1EG3 A;  1K9U A;  1H8B A;  3IQQ A;  1Y1A A;  1YX7 A;  1DT7 B;  1WDC C;  2I7A A;  4ICB A;  1W7I B;  1B7T Y;  2AAO A;  1J1E A;  4ORA B;  1G33 A;  1OOJ A;  2HF5 A;  2KFG A;  3NSI A;  2O5G A;  1DJZ A;  4F0Z B; 
#chains in the Genus database with same CATH topology
 2CCM A;  3B87 A;  2ZN9 A;  5CSN A;  2M8U A;  2KNE A;  5HKZ A;  1YR5 A;  3OX6 A;  1QS7 A;  3CYZ A;  3IVT A;  2MHH A;  1V1F A;  1NCZ A;  1XFV O;  1U5I A;  3TUY C;  1QTX A;  2K60 A;  1U5I B;  4ZCU A;  2AMI A;  5K89 A;  1PUL A;  4XJK A;  1MR8 A;  1N0Y A;  2JZI A;  4P2Y B;  4GPL B;  4XJK B;  3KPX A;  2WC5 A;  1K9K A;  1KWO C;  2E6W A;  1CFD A;  1SL7 A;  3CTN A;  5AEQ A;  4MZK A;  3DVK A;  3NGV A;  3BUM B;  3PN7 B;  1W9Z A;  3BXK A;  3UO9 A;  3TDI A;  4DRW A;  1Y6W A;  1RTP 1;  1JBA A;  4KYN A;  2WOR A;  1BT6 A;  2WCL A;  3BJH A;  1IRJ A;  3BYA A;  1CKK A;  4DIR A;  4OKH A;  1JF2 A;  3I5H C;  5GQQ C;  1ZOT B;  1Z2C B;  3FIA A;  1A75 A;  2BCA A;  1FPW A;  2WCM A;  3CWG A;  3ICB A;  3K21 A;  3D77 A;  2M7L A;  1S6J A;  2PMY A;  3SG5 A;  1SKT A;  3CAB A;  4DCK A;  1K90 D;  1AK8 A;  1Y0V H;  1SRA A;  3UNW A;  1CM4 A;  3PJI A;  5DKQ A;  1IQ3 A;  2M29 A;  2GTE A;  1TNP A;  2JTZ A;  2JUL A;  1CDM A;  1MWN A;  2HET A;  2KGR A;  1OQP A;  3DZT A;  3Q8I A;  3FE8 A;  1GJY A;  1CDN A;  4CPV A;  2BKI B;  5JOL A;  1SMG A;  1L2O C;  3DD4 A;  4P5O E;  3EVU A;  4MEW A;  3NHI A;  3WNX B;  3PFV A;  3ZNI A;  4YI9 A;  3SG6 A;  2G9B A;  3CZ1 A;  3M0W A;  1NYA A;  2CTN A;  2MRD A;  4GAO A;  3AKB A;  2KBI A;  2KBM A;  3SIA A;  5HKY A;  2ZFD A;  1CM1 A;  2K2A A;  2JTT A;  3NSL A;  4MRX A;  4YGA A;  3KF9 A;  4NDD A;  1DMO A;  1XK4 C;  2QEV A;  1K93 D;  5FYX A;  4M2Q A;  1NIW A;  1LVC D;  1OOG A;  1SR6 C;  1QXP A;  2JQ6 A;  2LVI A;  1JF0 A;  3HCM A;  4FQO A;  3TS5 B;  3CLN A;  1ZAC A;  3PSR A;  2KI6 C;  3DF0 A;  3JVT B;  3SG3 A;  1XFU O;  5AER A;  1EG4 A;  2K7B A;  2BKH B;  1FF1 A;  3DF0 B;  3LK1 A;  3RLZ A;  3BUX B;  1GGZ A;  2ZRT A;  3CZT X;  2L50 A;  1PSB A;  2MLF C;  1KSM A;  1QIV A;  4I5J A;  1TTX A;  2LP2 A;  3K1E A;  3KHE A;  2LMU A;  4PHK A;  1LA0 A;  5PAL A;  5KU1 A;  2Y4Q A;  2DOQ A;  2JRF A;  3BUN B;  2P6B B;  2MA2 A;  4PHM A;  1T14 A;  1CMG A;  4OZD A;  1WRZ A;  1BU3 A;  2BBM A;  3BFH A;  4F7F A;  1SL8 A;  2H61 A;  1M46 A;  1F4Q A;  1PK0 D;  2LAP A;  2EC6 C;  4INW A;  3O2P A;  2NZ0 A;  1K2H A;  1HQV A;  1XA5 A;  3BQ3 A;  3CGA A;  2LAN A;  1KK7 Z;  1UHK A;  2PVB A;  4PE7 A;  1OZO A;  5TNC A;  1XO5 A;  1RJV A;  1TNQ A;  1OE9 B;  1AVS A;  2MBX A;  1QAS A;  2TN4 A;  4PHJ A;  3AAJ A;  4QJ4 B;  4NDC A;  5CSI A;  2OPO A;  1TNX A;  1XFX O;  1GM0 A;  2KI4 B;  2FJU B;  2H2K A;  2SAS A;  3I5F B;  4FQT A;  2LLU A;  2JWW A;  3JTD B;  3OHM B;  1B1G A;  1BMO A;  4TNC A;  1S3P A;  1A4P A;  1NCX A;  1JFK A;  1YVL A;  2NXQ A;  1QV0 A;  2BAP A;  2F33 A;  3F45 A;  4MLW A;  4AQJ A;  3GK2 A;  1JSA A;  3CR4 X;  3BUW B;  4DS7 A;  1A29 A;  1S5G Y;  1UHH A;  3E3R A;  5CSJ A;  4AOM A;  3R72 A;  4CLN A;  1F54 A;  4YBH B;  1EJ3 A;  5I8N A;  3I5G B;  3LL8 B;  3DVM A;  4Q04 A;  1J7P A;  2K8M B;  2L5X B;  1QVI Y;  2KAV A;  2BCB A;  3BOW B;  2K2F A;  3OB2 B;  4YRU A;  1YRT B;  2A4J A;  2LVK A;  5D3O A;  4GBA A;  1KSO A;  1R6P A;  1SL9 A;  1EH2 A;  1WLM A;  1RWY A;  1S36 A;  1J7Q A;  2LE9 B;  1YUU A;  2WCE A;  4MBE A;  3V2L A;  2Y5I A;  1DVI A;  4PT1 A;  2P70 A;  2F2O A;  2LLT A;  5CPV A;  1TUJ A;  5I2O A;  2BCX A;  5HL1 A;  1SNL A;  2K61 A;  4M2O A;  1CNP A;  3EVR A;  3SS3 A;  1S6C A;  1BR1 B;  5J3X A;  3VRN A;  4GUK A;  4MVF A;  3CZ2 A;  2M3W A;  1YX8 A;  2I2R E;  1MF8 B;  4WRI A;  3DY9 A;  1PSR A;  3GOF A;  1BJF A;  4R1E A;  3TS5 C;  1NP8 A;  4PE1 A;  3SS5 A;  3JVT C;  2NCP A;  1G4Y R;  1EL4 A;  4YGC B;  4D1E A;  2BE4 A;  2Y1M A;  4HRH A;  1F8H A;  5DKN A;  1IJ5 A;  3EKH A;  3SJS A;  1F70 A;  4PDZ A;  1QLK A;  1M63 B;  1R2U A;  2BL0 C;  2WCB A;  1KCY A;  4NQG A;  1KQM B;  2JT3 A;  2ZNE A;  4YGE B;  2FCE A;  1YVH A;  5HYD A;  3KEV A;  4A4C A;  2Q91 A;  4PCW A;  1WRL A;  1SCM C;  2HPS A;  3D10 A;  1AJ4 A;  1IG5 A;  2HQW A;  1AUI B;  3PM8 A;  5ER4 X;  1BOC A;  1NCY A;  3LK0 A;  2K0J A;  1DC1 A;  3QME A;  2L2C A;  1BOD A;  2KAX A;  1DGU A;  4ORC B;  2KFF A;  3OB1 B;  4NDB A;  3EK8 A;  1CFP A;  4HRG A;  1CFC A;  4A4B A;  2OTG C;  3O6B A;  2CT9 A;  1FW4 A;  1N65 A;  2BBN A;  2I18 A;  4IJ7 A;  3S0A A;  4I5N B;  3PLF B;  1ZMZ A;  2LLS A;  1A03 A;  4YI8 A;  2JC2 A;  1JUO A;  3B88 A;  3IF7 A;  4QJ5 B;  4I5K A;  2M0R A;  1IWQ A;  3SG7 A;  2B1U A;  1SSE B;  2K7O A;  1X02 A;  5HKW A;  1SCV A;  1W7J B;  4GGF C;  5I94 A;  2WCF A;  4ETO A;  1JC2 A;  1B7T Z;  2L2E A;  1WDC B;  3JTD C;  1QWV A;  2KGB C;  1J1D A;  3FS7 A;  1OSA A;  5AAN A;  5KSZ A;  2JNX A;  1KQV A;  1SY9 A;  2LC5 A;  2LHI A;  2OS8 B;  2QPT A;  3EG5 B;  3EK7 A;  3PM2 A;  4INX A;  1QX7 A;  4MZJ A;  4AQI A;  2LNK A;  1F55 A;  1MXE A;  2L4H A;  4U8D A;  3S0E A;  2WCJ A;  4ZCV A;  1K95 A;  3PAT A;  1K96 A;  3C1V A;  3GK4 X;  3R1P A;  3I5G C;  4JKT A;  2LV7 A;  1KFU S;  2ZRS A;  1UHI A;  1HT9 A;  3KO0 A;  4WQ3 A;  3TUY B;  3AAK A;  2QAC A;  2KYF A;  2WCH A;  1J7R A;  1S26 D;  2I94 A;  2PAL A;  1DJI A;  3TDU A;  1A2X A;  4UPG A;  2KQY A;  1AJ5 A;  1NX1 A;  2JPT A;  4GFT A;  5BPJ A;  2CBL A;  1KFX S;  2BNX A;  2M9G A;  1G8I A;  2PQL A;  1KK8 B;  2KI6 D;  1MQ1 A;  1IKU A;  1BR4 B;  3I5I B;  2CNP A;  4DUQ A;  1YUR A;  4JD9 A;  1C07 A;  5F6T A;  3AKA A;  3DVJ A;  2JT8 A;  2EHB A;  1TWO A;  2JOJ A;  2ERB A;  3EVV A;  3GK1 A;  2H8V A;  3PN7 C;  4HRE E;  3MSE B;  1CLM A;  3O78 A;  1RFJ A;  5KTY A;  2D8N A;  1SK6 D;  3CS1 A;  3CDN A;  2L5Y A;  5FI6 A;  1CLB A;  3DVE A;  1IGV A;  1GGW A;  2F2P A;  4PAL A;  1NX2 A;  2LVV A;  1J7O A;  3N7H A;  2WC8 A;  1DTL A;  1OMR A;  3ZWH A;  2KDH A;  5AXI A;  2KLE A;  2K7D A;  5I2Q A;  2JT0 A;  3OP0 A;  1OW4 A;  1LXF C;  1QV1 A;  1B4C A;  1DJH A;  2NLN A;  3NHT A;  4E68 A;  2AUC A;  2WC6 A;  2JU0 A;  3EKJ A;  3TDZ A;  3VGO A;  4BY5 A;  3CZ0 A;  1PRW A;  1CFF A;  1Z4H A;  2F8P A;  2KOT A;  3L4L A;  4OR9 B;  5IBW A;  3R1O A;  3CR5 X;  1S1E A;  2F3Y A;  3BOW A;  1DJW A;  4WQ2 A;  2JPO A;  3NSK A;  1LS8 A;  2M7N A;  3A4U B;  4YGD B;  1M45 A;  4M2P A;  2FCD A;  2KLD A;  3QRX A;  2COL B;  1CMF A;  2FJY A;  1ODB A;  1QIW A;  1DEK A;  2VRG A;  3VRO A;  4IL1 A;  3BUO B;  5HLO A;  2Y1N A;  5D69 A;  4CFQ A;  1B8R A;  1SPY A;  4USL A;  1IIO A;  1NSH A;  1WLZ A;  1TOP A;  1TRF A;  1UHN A;  3D75 A;  2JXC A;  1UHJ A;  1QJT A;  3DYE A;  1RRO A;  2NCO A;  2IS9 A;  2PYQ A;  3D78 A;  3O4X A;  4C0J A;  3S0B A;  1J55 A;  1YTZ C;  2KSP A;  4MSP A;  2OS8 C;  2BEC A;  2PAS A;  1QX5 B;  3FE6 A;  4PHN A;  1AP4 A;  5B8I B;  2MLE C;  5D7F A;  1YRU B;  4GNK B;  1P28 A;  4N5X A;  1GQM A;  3WHU B;  1F71 A;  1FI6 A;  2L51 A;  3H4S E;  1SBJ A;  1E8A A;  2QEO A;  1NX3 A;  3D74 A;  1Y1X A;  4JQ0 D;  1YUS A;  3RZS A;  1DQE A;  2LMT A;  2EC6 B;  2GV5 A;  4BY4 A;  1B47 A;  4ORB B;  1UP5 A;  2RGI A;  2LP3 A;  5EL2 A;  1IQ5 A;  1B8L A;  1C7W A;  1TUZ A;  1SYM A;  2M49 B;  1F4O A;  1AHR A;  1OOI X;  1B8C A;  1KK8 C;  4MZL A;  3I5I C;  4FTG A;  4QJ3 B;  3R1V A;  1JFJ A;  3PAL A;  1PVB A;  2H61 C;  1MHO A;  2WOS A;  3O4Y A;  3VRQ A;  1DGV A;  2ISD A;  2LMV A;  1NWD A;  3B6X A;  3CR2 A;  1PVA A;  1KK7 Y;  1A75 B;  5FI2 A;  1REC A;  2ZN8 A;  2ZND A;  2V53 A;  2JXL A;  1QLS A;  2L0P A;  1DJG A;  1DEL A;  4N1F A;  5I2L A;  4CFR A;  4OCI A;  1C3Y A;  3SIB A;  4GGN A;  1S5G Z;  1XFY O;  2P71 A;  1B9A A;  3OGN A;  2KI4 C;  3I5F C;  2K7C A;  1D1O A;  4OV2 A;  2HQ8 A;  1QVI Z;  2YGU A;  1JWD A;  3SS4 A;  2WND A;  4MN0 A;  3FE9 A;  1ORG A;  1M31 A;  2E30 A;  2KYC A;  2PSR A;  4XYN A;  3WXA A;  1K94 A;  1V1G A;  4PE4 A;  3S0D A;  1H4B A;  1NUB A;  3OX5 A;  1MXL C;  1EXR A;  5JJG A;  1WY9 A;  2F3Z A;  5DKR A;  4C0L A;  1M39 A;  3SG4 A;  3FWC A;  1OOH A;  1OZS A;  1XFZ O;  1TIZ A;  1BF5 A;  1CLL A;  1BG1 A;  3L47 A;  1RK9 A;  2M1K B;  3D0Y A;  2JNF A;  1YUT A;  3D0Y B;  4C0K A;  1XYD A;  2LCP A;  1KWO B;  1ZUZ A;  1LIN A;  4JWQ A;  5DIC A;  1CTR A;  1XFR A;  3VRR A;  1LKJ A;  2L4I A;  1FI5 A;  1IH0 A;  3LLE A;  3A8R A;  2CXJ A;  2GGZ A;  2QDI A;  3VRP A;  3NXA A;  2G2B A;  1CDP A;  4L9M A;  2QEB A;  2O60 A;  4MRY A;  1K9P A;  1Y1U A;  3I5H B;  1XFW O;  5ER5 A;  2LUX A;  1NX0 A;  4CID A;  1OMV A;  1C7V A;  3TZ1 A;  2SCP A;  2M97 A;  3EK4 A;  3HX4 A;  2BL0 B;  2LHL A;  2WCK A;  1KFU L;  3B7A A;  3FWB A;  2GGM A;  3B86 A;  1K8U A;  1SW8 A;  1ALW A;  2EGD A;  2BE6 A;  3SG2 A;  1CDL A;  1Q80 A;  1QAT A;  1QX2 A;  1TCO B;  1VRK A;  3S0F A;  1FBV A;  1S6I A;  4I5L B;  1MUX A;  5HLV A;  2KFH A;  3RM1 A;  1SCM B;  1ZFS A;  5FI7 A;  2KAY A;  1N2D A;  1L2O B;  3D73 A;  5G08 A;  1L7Z A;  2KHN A;  2PRU A;  2M1U A;  2Q4U A;  3L4A A;  1KFX L;  1TN4 A;  1KQM C;  1UUR A;  1NPQ A;  1DJX A;  2LM5 A;  3BFB A;  5AFP A;  4HSZ A;  1BLQ A;  1IJ6 A;  3D76 A;  2OTG B;  1DJY A;  4N1G A;  1ALV A;  4OVN F;  2R2I A;  3NSO A;  1TNW A;  1XVJ A;  1UWO A;  1WRK A;  2MJW B;  1DF0 A;  4JPZ B;  3WHT B;  2KQ6 A;  4PE0 A;  1XK4 A;  1DF0 B;  4GGF A;  1LA3 A;  1TCF A;  2FOT A;  1C3Z A;  3VB1 A;  1OMD A;  4YGB B;  3BFA A;  2QEH A;  2MAZ A;  2LVJ A;  1CB1 A;  1PAL A;  2KPH A;  2LUC A;  3LCP C;  1SR6 B;  5CSF A;  3IQO A;  2L98 A;  1UUS A;  2ZKM X;  1EG3 A;  1K9U A;  1H8B A;  3IQQ A;  1Y1A A;  1YX7 A;  1DT7 B;  1WDC C;  2I7A A;  4ICB A;  1W7I B;  1B7T Y;  2AAO A;  3S0G A;  3DXL A;  1J1E A;  3OBV A;  4ORA B;  1G33 A;  1OOJ A;  2HF5 A;  2KFG A;  1OOF A;  3NSI A;  2O5G A;  1DJZ A;  4F0Z B; 
#chains in the Genus database with same CATH homology
 2CCM A;  2ZN9 A;  5CSN A;  2M8U A;  2KNE A;  5HKZ A;  1YR5 A;  3OX6 A;  1QS7 A;  2MHH A;  1V1F A;  1NCZ A;  1XFV O;  1U5I A;  3TUY C;  1QTX A;  1U5I B;  4ZCU A;  2AMI A;  5K89 A;  1PUL A;  4XJK A;  1MR8 A;  1N0Y A;  2JZI A;  4P2Y B;  4GPL B;  4XJK B;  3KPX A;  1K9K A;  1KWO C;  2E6W A;  1CFD A;  1SL7 A;  3CTN A;  5AEQ A;  4MZK A;  3DVK A;  3BUM B;  3PN7 B;  3BXK A;  4DRW A;  3TDI A;  1Y6W A;  1RTP 1;  1JBA A;  2WOR A;  1BT6 A;  3BYA A;  1IRJ A;  1CKK A;  4DIR A;  4OKH A;  1JF2 A;  3I5H C;  5GQQ C;  1ZOT B;  3FIA A;  1A75 A;  2BCA A;  1FPW A;  3CWG A;  3ICB A;  3K21 A;  2M7L A;  1S6J A;  2PMY A;  3SG5 A;  1SKT A;  4DCK A;  1K90 D;  1AK8 A;  1Y0V H;  1SRA A;  1CM4 A;  5DKQ A;  1IQ3 A;  2M29 A;  1TNP A;  2JTZ A;  2JUL A;  1CDM A;  1MWN A;  2HET A;  2KGR A;  1OQP A;  1GJY A;  1CDN A;  4CPV A;  2BKI B;  5JOL A;  1SMG A;  1L2O C;  3DD4 A;  4P5O E;  3EVU A;  4MEW A;  3WNX B;  3PFV A;  3ZNI A;  4YI9 A;  3SG6 A;  2G9B A;  3M0W A;  1NYA A;  2CTN A;  2MRD A;  4GAO A;  3AKB A;  2KBI A;  2KBM A;  3SIA A;  5HKY A;  2ZFD A;  1CM1 A;  2K2A A;  2JTT A;  3NSL A;  4MRX A;  4YGA A;  3KF9 A;  4NDD A;  1DMO A;  1XK4 C;  1K93 D;  5FYX A;  4M2Q A;  1NIW A;  1LVC D;  1SR6 C;  2JQ6 A;  1QXP A;  2LVI A;  3HCM A;  1JF0 A;  4FQO A;  3TS5 B;  3CLN A;  1ZAC A;  3PSR A;  2KI6 C;  3DF0 A;  3JVT B;  3SG3 A;  1XFU O;  5AER A;  1EG4 A;  2K7B A;  2BKH B;  1FF1 A;  3DF0 B;  3LK1 A;  3RLZ A;  3BUX B;  1GGZ A;  2ZRT A;  3CZT X;  2L50 A;  1PSB A;  2MLF C;  1KSM A;  1QIV A;  4I5J A;  1TTX A;  2LP2 A;  3KHE A;  2LMU A;  4PHK A;  1LA0 A;  5PAL A;  5KU1 A;  2Y4Q A;  2DOQ A;  2JRF A;  3BUN B;  2P6B B;  2MA2 A;  4PHM A;  1CMG A;  1WRZ A;  1BU3 A;  2BBM A;  1SL8 A;  2H61 A;  1M46 A;  1F4Q A;  1PK0 D;  2LAP A;  2EC6 C;  3O2P A;  2NZ0 A;  1K2H A;  1HQV A;  1XA5 A;  3BQ3 A;  3CGA A;  2LAN A;  1KK7 Z;  1UHK A;  2PVB A;  4PE7 A;  1OZO A;  5TNC A;  1XO5 A;  1RJV A;  1TNQ A;  1OE9 B;  1AVS A;  2MBX A;  1QAS A;  2TN4 A;  4PHJ A;  3AAJ A;  4QJ4 B;  4NDC A;  5CSI A;  2OPO A;  1TNX A;  1XFX O;  2KI4 B;  2FJU B;  2H2K A;  2SAS A;  3I5F B;  2LLU A;  2JWW A;  3JTD B;  3OHM B;  1B1G A;  1BMO A;  4TNC A;  1S3P A;  1A4P A;  1NCX A;  1JFK A;  1YVL A;  2NXQ A;  1QV0 A;  2F33 A;  4AQJ A;  3F45 A;  4MLW A;  3GK2 A;  1JSA A;  3CR4 X;  3BUW B;  4DS7 A;  1A29 A;  1S5G Y;  1UHH A;  3E3R A;  5CSJ A;  4AOM A;  4CLN A;  1F54 A;  4YBH B;  1EJ3 A;  5I8N A;  3I5G B;  3LL8 B;  3DVM A;  4Q04 A;  1J7P A;  2K8M B;  2L5X B;  1QVI Y;  2KAV A;  2BCB A;  3BOW B;  2K2F A;  3OB2 B;  4YRU A;  1YRT B;  2A4J A;  2LVK A;  4GBA A;  1KSO A;  1R6P A;  1SL9 A;  1EH2 A;  1WLM A;  1RWY A;  1S36 A;  1J7Q A;  2LE9 B;  1YUU A;  2WCE A;  4MBE A;  2Y5I A;  1DVI A;  2F2O A;  2LLT A;  5CPV A;  5I2O A;  2BCX A;  1SNL A;  2K61 A;  4M2O A;  1CNP A;  3EVR A;  1S6C A;  1BR1 B;  5J3X A;  3VRN A;  4GUK A;  4MVF A;  2M3W A;  1YX8 A;  2I2R E;  1MF8 B;  4WRI A;  3GOF A;  1PSR A;  4R1E A;  1BJF A;  3TS5 C;  1NP8 A;  4PE1 A;  3JVT C;  2NCP A;  1G4Y R;  1EL4 A;  4YGC B;  4D1E A;  2BE4 A;  2Y1M A;  4HRH A;  1F8H A;  5DKN A;  1IJ5 A;  3EKH A;  3SJS A;  1F70 A;  4PDZ A;  1QLK A;  1M63 B;  1R2U A;  2BL0 C;  2WCB A;  1KCY A;  4NQG A;  1KQM B;  2JT3 A;  2ZNE A;  4YGE B;  2FCE A;  1YVH A;  5HYD A;  3KEV A;  4A4C A;  2Q91 A;  4PCW A;  1WRL A;  1SCM C;  2HPS A;  3D10 A;  1AJ4 A;  1IG5 A;  2HQW A;  1AUI B;  3PM8 A;  5ER4 X;  1BOC A;  1NCY A;  3LK0 A;  2K0J A;  1BOD A;  2KAX A;  1DGU A;  4ORC B;  2KFF A;  3OB1 B;  4NDB A;  3EK8 A;  1CFP A;  4HRG A;  1CFC A;  4A4B A;  2OTG C;  3O6B A;  2CT9 A;  1FW4 A;  1N65 A;  2BBN A;  2I18 A;  4I5N B;  3PLF B;  1ZMZ A;  2LLS A;  1A03 A;  4YI8 A;  2JC2 A;  1JUO A;  4QJ5 B;  3IF7 A;  4I5K A;  2M0R A;  1IWQ A;  3SG7 A;  2B1U A;  2K7O A;  1X02 A;  5HKW A;  1SCV A;  1W7J B;  4GGF C;  2WCF A;  4ETO A;  1JC2 A;  1B7T Z;  2L2E A;  1WDC B;  3JTD C;  2KGB C;  1J1D A;  3FS7 A;  1OSA A;  5AAN A;  5KSZ A;  2JNX A;  1KQV A;  1SY9 A;  2LC5 A;  2LHI A;  2OS8 B;  2QPT A;  3EK7 A;  4AQI A;  1QX7 A;  4MZJ A;  2LNK A;  1F55 A;  1MXE A;  2L4H A;  4U8D A;  4ZCV A;  1K95 A;  3PAT A;  1K96 A;  3C1V A;  3GK4 X;  3I5G C;  2LV7 A;  1KFU S;  2ZRS A;  1UHI A;  1HT9 A;  3KO0 A;  4WQ3 A;  3TUY B;  3AAK A;  2QAC A;  2KYF A;  1J7R A;  1S26 D;  2I94 A;  2PAL A;  1DJI A;  3TDU A;  1A2X A;  4UPG A;  2KQY A;  1AJ5 A;  1NX1 A;  2JPT A;  4GFT A;  5BPJ A;  2CBL A;  1KFX S;  2M9G A;  1G8I A;  1KK8 B;  2KI6 D;  1MQ1 A;  1IKU A;  1BR4 B;  3I5I B;  2CNP A;  4DUQ A;  1YUR A;  1C07 A;  5F6T A;  3AKA A;  3DVJ A;  2JT8 A;  2EHB A;  2JOJ A;  3EVV A;  3GK1 A;  3PN7 C;  4HRE E;  3MSE B;  1CLM A;  3O78 A;  1RFJ A;  5KTY A;  2D8N A;  1SK6 D;  3CS1 A;  1CLB A;  3DVE A;  1IGV A;  1GGW A;  2F2P A;  4PAL A;  1NX2 A;  2LVV A;  1J7O A;  2WC8 A;  1DTL A;  1OMR A;  3ZWH A;  2KDH A;  5AXI A;  2K7D A;  5I2Q A;  2JT0 A;  3OP0 A;  1LXF C;  1QV1 A;  1B4C A;  1DJH A;  2NLN A;  4E68 A;  2AUC A;  2JU0 A;  3EKJ A;  3TDZ A;  3VGO A;  4BY5 A;  1PRW A;  1CFF A;  2F8P A;  2KOT A;  4OR9 B;  5IBW A;  3CR5 X;  1S1E A;  2F3Y A;  3BOW A;  1DJW A;  4WQ2 A;  3NSK A;  2M7N A;  3A4U B;  4YGD B;  1M45 A;  4M2P A;  2FCD A;  3QRX A;  2COL B;  1CMF A;  1ODB A;  1QIW A;  2VRG A;  3VRO A;  4IL1 A;  3BUO B;  5HLO A;  2Y1N A;  5D69 A;  4CFQ A;  1B8R A;  1SPY A;  4USL A;  1NSH A;  1WLZ A;  1TOP A;  1TRF A;  1UHN A;  2JXC A;  1UHJ A;  1QJT A;  1RRO A;  2NCO A;  2IS9 A;  4C0J A;  1J55 A;  1YTZ C;  2KSP A;  4MSP A;  2OS8 C;  2BEC A;  2PAS A;  1QX5 B;  4PHN A;  1AP4 A;  5B8I B;  2MLE C;  5D7F A;  1YRU B;  4GNK B;  4N5X A;  1GQM A;  3WHU B;  1F71 A;  1FI6 A;  2L51 A;  3H4S E;  1SBJ A;  1E8A A;  1NX3 A;  1Y1X A;  4JQ0 D;  1YUS A;  2LMT A;  2EC6 B;  2GV5 A;  4BY4 A;  1B47 A;  4ORB B;  1UP5 A;  2RGI A;  2LP3 A;  1IQ5 A;  1B8L A;  1C7W A;  1SYM A;  2M49 B;  1F4O A;  1AHR A;  1B8C A;  1KK8 C;  4MZL A;  3I5I C;  4FTG A;  4QJ3 B;  1JFJ A;  3PAL A;  1PVB A;  2H61 C;  1MHO A;  2WOS A;  3O4Y A;  3VRQ A;  1DGV A;  2ISD A;  2LMV A;  1NWD A;  3CR2 A;  1PVA A;  1KK7 Y;  1A75 B;  1REC A;  2ZN8 A;  2ZND A;  2V53 A;  2JXL A;  1QLS A;  2L0P A;  1DJG A;  4N1F A;  5I2L A;  4CFR A;  4OCI A;  3SIB A;  4GGN A;  1S5G Z;  1XFY O;  1B9A A;  2KI4 C;  3I5F C;  2K7C A;  1D1O A;  4OV2 A;  2HQ8 A;  1QVI Z;  1JWD A;  2WND A;  4MN0 A;  2KYC A;  1M31 A;  2E30 A;  4XYN A;  2PSR A;  3WXA A;  1K94 A;  1V1G A;  4PE4 A;  1H4B A;  1NUB A;  3OX5 A;  1MXL C;  1EXR A;  5JJG A;  1WY9 A;  2F3Z A;  5DKR A;  4C0L A;  1M39 A;  3SG4 A;  3FWC A;  1OZS A;  1XFZ O;  1TIZ A;  1BF5 A;  1CLL A;  1BG1 A;  1RK9 A;  2M1K B;  3D0Y A;  2JNF A;  1YUT A;  3D0Y B;  4C0K A;  1XYD A;  2LCP A;  1KWO B;  1ZUZ A;  1LIN A;  4JWQ A;  1CTR A;  3VRR A;  1LKJ A;  2L4I A;  1FI5 A;  1IH0 A;  3LLE A;  3A8R A;  2CXJ A;  2GGZ A;  3VRP A;  3NXA A;  2G2B A;  1CDP A;  4L9M A;  2O60 A;  4MRY A;  1K9P A;  1Y1U A;  3I5H B;  1XFW O;  5ER5 A;  2LUX A;  1NX0 A;  4CID A;  1OMV A;  1C7V A;  3TZ1 A;  2SCP A;  2M97 A;  3EK4 A;  3HX4 A;  2BL0 B;  2LHL A;  1KFU L;  3FWB A;  2GGM A;  1K8U A;  1SW8 A;  1ALW A;  2EGD A;  2BE6 A;  3SG2 A;  1CDL A;  1Q80 A;  1QAT A;  1QX2 A;  1TCO B;  1VRK A;  1FBV A;  1S6I A;  4I5L B;  1MUX A;  5HLV A;  2KFH A;  3RM1 A;  1SCM B;  1ZFS A;  2KAY A;  1N2D A;  1L2O B;  5G08 A;  1L7Z A;  2KHN A;  2PRU A;  2M1U A;  2Q4U A;  1KFX L;  1TN4 A;  1KQM C;  1UUR A;  1NPQ A;  1DJX A;  2LM5 A;  5AFP A;  4HSZ A;  1BLQ A;  1IJ6 A;  2OTG B;  1DJY A;  4N1G A;  1ALV A;  4OVN F;  2R2I A;  3NSO A;  1TNW A;  1XVJ A;  1UWO A;  1WRK A;  2MJW B;  1DF0 A;  4JPZ B;  3WHT B;  2KQ6 A;  4PE0 A;  1XK4 A;  1DF0 B;  4GGF A;  1LA3 A;  1TCF A;  2FOT A;  1OMD A;  4YGB B;  2MAZ A;  2LVJ A;  1CB1 A;  1PAL A;  2LUC A;  3LCP C;  1SR6 B;  5CSF A;  3IQO A;  2L98 A;  1UUS A;  2ZKM X;  1EG3 A;  1K9U A;  1H8B A;  3IQQ A;  1Y1A A;  1YX7 A;  1DT7 B;  1WDC C;  2I7A A;  4ICB A;  1W7I B;  1B7T Y;  2AAO A;  1J1E A;  4ORA B;  1G33 A;  1OOJ A;  2HF5 A;  2KFG A;  3NSI A;  2O5G A;  1DJZ A;  4F0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...