3NSOA

Crystal structure of s100a3 protein expressed in insect cell
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nsoA00
1NPQA 1RTP1 1LA0A 1RECA 4I5JA 3ICBA 3SG6A 1QVIY 1S26D 5DKRA 3F45A 3BUNB 5B8IB 1KK8C 5HLOA 1FF1A 4M2QA 4UPGA 2M7LA 1JFJA 2LP3A 1FI6A 1NCYA 1EH2A 1SRAA 1WY9A 2LNKA 2M8UA 3I5IB 1SCVA 3TS5C 4DUQA 4GBAA 1Y0VH 1RROA 2L0PA 2D8NA 1DJIA 2Q4UA 1QJTA 2JZIA 1A2XA 1B8LA 2K7CA 4N1GA 2LHLA 1QATA 3AKAA 1Q80A 4YGDB 3MSEB 3TDIA 2NCPA 5J3XA 1F71A 1B9AA 1WLMA 3PN7C 4NDDA 1F54A 2F2PA 3CR4X 4NDCA 1QS7A 1F55A 3EKJA 1QTXA 1PK0D 2K7OA 4MVFA 3HCMA 1BR1B 3BUOB 2NZ0A 1CLMA 2ZN9A 1UP5A 2LP2A 3CR5X 2I18A 3SIBA 1NCZA 1Y1AA 3I5FB 3OHMB 3WHUB 2KYCA 3M0WA 1F70A 3OX5A 3DF0B 2KFGA 1ALVA 1K90D 2K2FA 3O2PA 2KI6C 1XFVO 2LUCA 5CSJA 3WNXB 2KQYA 2AUCA 1GJYA 4ICBA 2LMTA 4OV2A 2IS9A 1NX1A 3GK4X 1DF0B 1QX2A 3WXAA 1J7RA 2L4IA 4GUKA 3I5HC 1JFKA 1QIVA 2BECA 4ORAB 3FWCA 3LK1A 1SPYA 1DF0A 3FWBA 2SASA 1DJZA 1Y6WA 1XVJA 1DJGA 4MZLA 3LCPC 2KI4B 1AUIB 2JNFA 1KQMC 1DGUA 2ZN8A 5FYXA 3LK0A 2LHIA 1DVIA 4MLWA 5GQQC 1L2OB 1M46A 1XO5A 3AAKA 2I7AA 3CLNA 3TUYB 5CPVA 3JVTB 1NX2A 1BT6A 2LVJA 1XFZO 2L98A 1ZUZA 5CSNA 2MBXA 5K89A 3CGAA 3NSKA 2FCEA 3ZNIA 1OZOA 2K2AA 4OKHA 4CFQA 4USLA 1CDPA 1J55A 1B7TY 1KCYA 1CTRA 2BL0C 3HX4A 5HLVA 1TNWA 1J1DA 2LANA 2V53A 1RK9A 1DGVA 5G08A 1S5GZ 4E68A 2JWWA 2LLSA 2KOTA 2ZNDA 1KK7Z 1DJHA 4R1EA 1TNXA 2PALA 5ER4X 1ZFSA 2JXLA 3D10A 2G9BA 5DKNA 2OS8B 1SNLA 5KU1A 3SG7A 1TRFA 1BJFA 5HKWA 2KGBC 5CSIA 1KQVA 1W7JB 2E6WA 4TNCA 1NYAA 1YRTB 2WORA 2K8MB 1JUOA 1YR5A 2LVVA 1QV0A 1EJ3A 2BKIB 3OB1B 1SL7A 1YUSA 1PALA 2LV7A 1JF2A 3LLEA 1OMDA 4JPZB 3SIAA 1QV1A 2NXQA 1BOCA 2JT3A 1MR8A 1XA5A 2CNPA 1SR6C 2BCAA 4ORCB 2I2RE 3RM1A 1PVAA 1OOJA 2ISDA 4FTGA 2FOTA 4YI9A 1S6JA 3FIAA 2Y1MA 4MRXA 2M3WA 1G4YR 2M9GA 1CLBA 2LAPA 1KK8B 3IQOA 2JOJA 3BYAA 1IG5A 1A75A 1BLQA 3TS5B 3EVRA 1MUXA 1RJVA 2K7DA 4HRHA 4PE1A 1KSOA 4QJ3B 1AP4A 2QACA 1F4OA 2ZNEA 2GV5A 1S36A 3DD4A 5BPJA 1DTLA 3D0YA 3JTDC 1CFPA 1GQMA 1K8UA 4F0ZB 2O60A 3TDZA 1KFXS 2F3YA 1YUTA 3PN7B 1KSMA 3EVVA 2OPOA 5HKYA 1LXFC 3PLFB 4WRIA 5KTYA 1S3PA 1A03A 1PVBA 2KSPA 4M2OA 1EXRA 1BMOA 4C0LA 1ALWA 1D1OA 2OTGC 1AJ4A 4C0KA 2BBMA 3EVUA 2LLUA 1YX7A 3O78A 2K7BA 4ZCUA 2HETA 1NX0A 3VROA 2CBLA 3AAJA 1IJ6A 4AQJA 3GOFA 1SBJA 2L5XB 5PALA 4GFTA 2NLNA 3ZWHA 2HQ8A 4NQGA 1J7QA 3PATA 3CTNA 1IGVA 1SK6D 2EHBA 4JWQA 1SW8A 2A4JA 1HT9A 5I2LA 1AHRA 2M0RA 1OZSA 2FCDA 1CDNA 2BBNA 1BU3A 3BOWB 5HKZA 1CFDA 3PALA 4DS7A 1LA3A 4PHMA 3SJSA 3I5HB 1SL9A 2TN4A 3BOWA 4YBHB 2LVKA 1Y1XA 1K95A 2KFFA 4A4CA 2Q91A 2F8PA 3KO0A 3SG4A 1KFXL 4YI8A 1CFFA 1PSRA 5F6TA 1KQMB 4NDBA 2H61C 2KI6D 5CSFA 4GNKB 1YRUB 2HPSA 4I5KA 1UUSA 4N5XA 2MHHA 1DJXA 4OCIA 1KWOC 4HSZA 1SYMA 2JC2A 3BUMB 4PCWA 1MWNA 1U5IA 2LMVA 1C07A 2PSRA 1G33A 2PASA 3IQQA 1IJ5A 1RFJA 1WRZA 2L51A 1C7VA 2LCPA 1YVHA 4PHKA 2JQ6A 4XYNA 2ZKMX 2FJUB 3EK8A 3VGOA 2BL0B 1E8AA 1NCXA 2LVIA 3DVMA 1QIWA 1JC2A 2P6BB 1TN4A 2KBMA 1FBVA 1OSAA 4CIDA 1EG3A 1SCMC 4FQOA 3EK4A 3NSIA 3KPXA 2F2OA 2JT8A 2KFHA 1UWOA 1IQ5A 1ODBA 1QLKA 4OVNF 3A8RA 1B47A 1B8CA 4PE0A 1JBAA 3SG2A 2O5GA 3TDUA 4MZJA 1B8RA 1MQ1A 2HQWA 2KQ6A 1WDCC 1NP8A 1G8IA 4ORBB 2HF5A 2VRGA 1S5GY 1TNPA 2MAZA 2MLEC 1XFUO 1CB1A 5I2QA 1K9UA 2PMYA 1M63B 1WLZA 4WQ3A 1ZMZA 1SR6B 3LL8B 2JTZA 5ER5A 4P2YB 1NSHA 2JTTA 1TIZA 1IQ3A 1UHJA 2LC5A 2PRUA 3CR2A 3VRPA 1NUBA 2CT9A 1CM1A 3IF7A 1B1GA 1BR4B 1N65A 1DJWA 1QXPA 2K61A 5HYDA 1K93D 2WCFA 1A75B 2MJWB 2ZRSA 1Y1UA 3I5GC 1JF0A 3NXAA 2K0JA 1YTZC 1PULA 1XFWO 2KBIA 2GGMA 1YVLA 2M49B 2M1KB 1IH0A 1TCOB 4Q04A 1FW4A 2DOQA 3SG3A 1IRJA 1QVIZ 2EC6C 3D0YB 1CNPA 4PHNA 4PALA 5KSZA 1NWDA 2E30A 3NSOA 2LLTA 4XJKB 4C0JA 1TCFA 3JTDB 2JXCA 3DVEA 1CLLA 3EK7A 3CS1A 3RLZA 3BXKA 4MZKA 3E3RA 4XJKA 4YGCB 3O4YA 1LINA 4CLNA 4DRWA 1KFUS 1AK8A 2PVBA 4PHJA 2JPTA 2MRDA 1AJ5A 1RWYA 3VRNA 3CWGA 2JNXA 1M45A 1CDLA 1CMGA 4MBEA 1J1EA 1VRKA 2BKHB 1B4CA 1M39A 3I5IC 3KF9A 1V1FA 2F33A 1UURA 1IKUA 1H8BA 1FPWA 2F3ZA 3C1VA 2OTGB 3GK2A 1N2DA 4GAOA 4YRUA 4L9MA 3EKHA 2CXJA 1K94A 1R6PA 1K9PA 2ZFDA 5AEQA 5I2OA 1GGWA 1K2HA 2B1UA 4BY5A 2KYFA 2WNDA 5TNCA 1FI5A 3O6BA 1SKTA 1YURA 1PRWA 1MXEA 1NIWA 3BQ3A 1L7ZA 3KEVA 1UHHA 2M97A 4AQIA 1CFCA 5JOLA 1AVSA 1WRKA 1JSAA 3QRXA 4PDZA 2H2KA 1CDMA 1LVCD 1N0YA 4N1FA 1CKKA 1R2UA 1LKJA 1SL8A 4M2PA 2BE4A 1BF5A 3BUWB 5AERA 1K96A 1S6CA 2CTNA 2EGDA 4YGEB 4D1EA 4MEWA 4GPLB 3I5FC 1KFUL 2L4HA 4I5NB 1UHNA 3OB2B 1V1GA 2L50A 2LUXA 4I5LB 4GGNA 2KAVA 1TOPA 4PE4A 1U5IB 3OP0A 1KWOB 2BCXA 2BE6A 2SCPA 1W7IB 2H61A 3DF0A 5JJGA 2M1UA 1MF8B 5AFPA 2CCMA 2WCEA 2WCBA 5DKQA 3SG5A 1OQPA 2Y5IA 2M7NA 3DVKA 1TTXA 1JWDA 1GGZA 1A4PA 1DJYA 1TNQA 1S1EA 4OR9B 2JU0A 2JT0A 1BG1A 1QX5B 1YUUA 1S6IA 1XYDA 4HRGA 2JULA 2LMUA 1CM4A 4CPVA 5IBWA 2KI4C 1F8HA 1H4BA 2MLFC 4YGBB 4PE7A 4QJ4B 2AAOA 3PSRA 1NX3A 2AMIA 2MA2A 1ZOTB 1SCMB 3KHEA 1B7TZ 3TZ1A 3WHTB 2LM5A 4DIRA 3A4UB 1DT7B 4HREE 1PSBA 1L2OC 1K9KA 2KAXA 2WC8A 4MSPA 4BY4A 3K21A 1SY9A 3TUYC 3JVTC 5D7FA 1F4QA 1WDCB 4WQ2A 1MHOA 1QX7A 1ZACA 2BCBA 3FS7A 1X02A 1UHIA 4ETOA 1HQVA 1J7OA 2M29A 2KAYA 1KK7Y 3H4SE 4P5OE 2I94A 1IWQA 2GGZA 4GGFC 4ZCVA 5I8NA 4A4BA 1CMFA 3NSLA 4DCKA 1DMOA 1SMGA 1XK4C 2KNEA 4GGFA 1J7PA 1QLSA 1BODA 1M31A 3PFVA 4JQ0D 2JRFA 1XK4A 2COLB 2OS8C 3VRRA 2LE9B 4MRYA 1EL4A 2KHNA 2WOSA 3PM8A 2ZRTA 3OX6A 4CFRA 2QPTA 5AXIA 3I5GB 3AKBA 4AOMA 3VRQA 2KGRA 4MN0A 5AANA 2KDHA 4YGAA 4U8DA 1MXLC 2G2BA 5D69A 1UHKA 1OMRA 2EC6B 1A29A 1WRLA 4IL1A 2Y1NA 2R2IA 1EG4A 2NCOA 3BUXB 2L2EA 1OE9B 1OMVA 1C7WA 1XFXO 3GK1A 1XFYO 1YX8A 2Y4QA 4QJ5B 2RGIA 3CZTX 1QASA 3DVJA
chains in the Genus database with same CATH superfamily
3D78A 1NPQA 1RTP1 1LA0A 1RECA 4I5JA 2ERBA 3ICBA 3SG6A 4F7FA 1QVIY 1S26D 5DKRA 3F45A 3BUNB 5B8IB 1KK8C 5HLOA 1FF1A 4M2QA 4UPGA 2M7LA 1JFJA 2LP3A 1FI6A 2JPOA 1NCYA 1EH2A 1SRAA 1WY9A 2LNKA 2M8UA 2BAPA 1SCVA 3I5IB 3TS5C 4DUQA 4GBAA 1Y0VH 1RROA 2L0PA 2D8NA 1DJIA 1QWVA 1QJTA 2JZIA 1A2XA 1B8LA 2K7CA 2Q4UA 3CZ1A 3R1PA 2LHLA 3DY9A 1QATA 3AKAA 1Q80A 4FQTA 4YGDB 3MSEB 3TDIA 2NCPA 5J3XA 1F71A 1B9AA 1WLMA 3B86A 3PN7C 4NDDA 1F54A 2F2PA 3CR4X 4NDCA 1QS7A 1Z4HA 3SS4A 1F55A 3EKJA 1QTXA 1PK0D 2K7OA 4MVFA 3HCMA 1BR1B 3BUOB 2NZ0A 1CLMA 2ZN9A 1UP5A 2LP2A 3CR5X 2I18A 3SIBA 1NCZA 1Y1AA 3NHTA 1IIOA 2KLEA 3I5FB 3OHMB 3WHUB 2KYCA 3M0WA 3Q8IA 1F70A 3OX5A 3DF0B 3FE9A 2KFGA 1ALVA 1K90D 2K2FA 3O2PA 2FJYA 2KI6C 1XFVO 2LUCA 5CSJA 3WNXB 2KQYA 2AUCA 1GJYA 1DQEA 4ICBA 2LMTA 4OV2A 2IS9A 1NX1A 3GK4X 1DF0B 1QX2A 3CYZA 3WXAA 1T14A 1J7RA 2L4IA 2QEHA 3I5HC 1JFKA 1QIVA 2BECA 4GUKA 4ORAB 2YGUA 3FWCA 3LK1A 1LS8A 3D75A 1SPYA 1DF0A 2L2CA 2P71A 3NHIA 3FWBA 2QEOA 1DJZA 1Y6WA 1XVJA 1DJGA 2SASA 4MZLA 3LCPC 2KI4B 3NGVA 1AUIB 2JNFA 1KQMC 1DGUA 2ZN8A 1P28A 5FYXA 3LK0A 2LHIA 1DVIA 4MLWA 5GQQC 2P70A 3DXLA 1L2OB 1M46A 1XO5A 3AAKA 2I7AA 3CLNA 3TUYB 5CPVA 3JVTB 1NX2A 1BT6A 2LVJA 1XFZO 2L98A 1DELA 1ZUZA 2WCKA 5CSNA 2MBXA 3K1EA 5K89A 3CGAA 3NSKA 2FCEA 3ZNIA 1OZOA 2K2AA 4IJ7A 4OKHA 4USLA 1CDPA 1J55A 1B7TY 4CFQA 1KCYA 1CTRA 2BL0C 3HX4A 5HLVA 1TNWA 1J1DA 2LANA 2V53A 3CZTX 1RK9A 1DGVA 1OOHA 5G08A 1S5GZ 4E68A 2JWWA 2LLSA 2KOTA 2ZNDA 1KK7Z 1DJHA 4R1EA 1TNXA 2PALA 3CABA 2WC5A 5ER4X 3S0FA 1ZFSA 2JXLA 3D10A 2G9BA 5DKNA 2OS8B 1SNLA 4INWA 5KU1A 3SG7A 1TRFA 1BJFA 5HKWA 2KGBC 3PM2A 5CSIA 1KQVA 1W7JB 2E6WA 3DZTA 1NYAA 1YRTB 4TNCA 2WORA 3UO9A 2K8MB 1JUOA 1YR5A 2LVVA 1QV0A 1EJ3A 2BKIB 3OB1B 1SL7A 1YUSA 1PALA 2LV7A 1JF2A 3LLEA 1OMDA 4JPZB 3SIAA 1QV1A 2NXQA 1BOCA 2JT3A 1MR8A 1XA5A 2CNPA 1SR6C 2BCAA 4ORCB 2I2RE 3SS5A 3VB1A 3RM1A 1PVAA 1OOJA 2ISDA 4FTGA 2FOTA 4YI9A 1S6JA 3FIAA 2Y1MA 2PQLA 4MRXA 2M3WA 1G4YR 2M9GA 1CLBA 2LAPA 1KK8B 3UNWA 3IQOA 3V2LA 2JOJA 3BYAA 1IG5A 1A75A 1BLQA 3CZ2A 3TS5B 3EVRA 1MUXA 1RJVA 2K7DA 4HRHA 3BFBA 1KSOA 4PE1A 4QJ3B 1AP4A 2QACA 1F4OA 2ZNEA 2GV5A 1S36A 3B6XA 2GTEA 3DD4A 1DTLA 3D0YA 3JTDC 5BPJA 1CFPA 3CZ0A 1GQMA 1K8UA 4F0ZB 2O60A 3TDZA 1KFXS 2F3YA 1YUTA 3PN7B 1KSMA 3D77A 3EVVA 2OPOA 5HKYA 1LXFC 3EG5B 3PLFB 3PJIA 4WRIA 5I94A 1S3PA 5KTYA 4JD9A 1A03A 1PVBA 2KSPA 4M2OA 1EXRA 1BMOA 4C0LA 1ALWA 3O4XA 3RZSA 1D1OA 2OTGC 1AJ4A 4C0KA 2BBMA 5HL1A 3EVUA 1XFRA 2LLUA 1YX7A 3O78A 2K7BA 5EL2A 2HETA 1NX0A 3B7AA 4ZCUA 3VROA 2CBLA 3AAJA 1IJ6A 4AQJA 3GOFA 1SBJA 2L5XB 5PALA 4GFTA 2NLNA 3ZWHA 2HQ8A 4NQGA 1J7QA 3PATA 3CTNA 1IGVA 1SK6D 5D3OA 2EHBA 4JWQA 1SW8A 3OGNA 2A4JA 1HT9A 5I2LA 1AHRA 2M0RA 1OZSA 4N1GA 2FCDA 3R72A 1CDNA 3L47A 2BBNA 1BU3A 3BOWB 5HKZA 1CFDA 3PALA 2L5YA 4DS7A 1LA3A 4PHMA 4OZDA 3SJSA 3I5HB 1SL9A 2TN4A 3BOWA 4YBHB 2LVKA 1Y1XA 1K95A 2KFFA 4A4CA 2Q91A 2F8PA 3KO0A 5DICA 3S0BA 1KFXL 1W9ZA 4YI8A 3SG4A 1CFFA 1PSRA 5F6TA 1KQMB 4NDBA 2H61C 2KI6D 5CSFA 4GNKB 1YRUB 3L4LA 2HPSA 4I5KA 1UUSA 2WCHA 4N5XA 2MHHA 1DJXA 4OCIA 1KWOC 2K60A 4HSZA 1SYMA 2JC2A 3BUMB 4PCWA 1MWNA 1U5IA 2LMVA 1C07A 2PSRA 1G33A 3B87A 2PASA 3IQQA 1IJ5A 1RFJA 1WRZA 2L51A 1C7VA 2LCPA 1YVHA 4PHKA 2JQ6A 4XYNA 2ZKMX 3BFAA 3D76A 2FJUB 3EK8A 3VGOA 2BL0B 1E8AA 1NCXA 2LVIA 3DVMA 1QIWA 1JC2A 2P6BB 1TN4A 1OOIX 2KBMA 3S0GA 1FBVA 1OSAA 4CIDA 1EG3A 1SCMC 3S0AA 4FQOA 3EK4A 3NSIA 3KPXA 2F2OA 2JT8A 2KFHA 1UWOA 1IQ5A 1ODBA 1QLKA 4OVNF 3A8RA 1B47A 1B8CA 4PE0A 1JBAA 3SG2A 2O5GA 3TDUA 4MZJA 1B8RA 1MQ1A 2HQWA 2WC6A 2KPHA 2KQ6A 1WDCC 1NP8A 1G8IA 4ORBB 2HF5A 5FI6A 2VRGA 1S5GY 1TNPA 2MAZA 2MLEC 1XFUO 3S0DA 1DC1A 1CB1A 3OBVA 5I2QA 3S0EA 1K9UA 2PMYA 1M63B 1WLZA 4WQ3A 1ZMZA 1SR6B 3LL8B 2JTZA 5ER5A 4P2YB 2H8VA 1NSHA 2JTTA 1TIZA 1IQ3A 1UHJA 2LC5A 3FE6A 2PRUA 3CR2A 3VRPA 1NUBA 2CT9A 1CM1A 3IF7A 1B1GA 1BR4B 2KLDA 1N65A 1DJWA 1QXPA 2K61A 5HYDA 1K93D 2WCFA 1A75B 2MJWB 2ZRSA 1Y1UA 3I5GC 3SS3A 1JF0A 3NXAA 2K0JA 1YTZC 1PULA 1XFWO 2KBIA 2GGMA 1YVLA 2M49B 2M1KB 1IH0A 1TCOB 4Q04A 1FW4A 2DOQA 3SG3A 1IRJA 1QVIZ 2EC6C 3D0YB 1CNPA 4PHNA 4PALA 5KSZA 1NWDA 2E30A 3NSOA 2LLTA 4XJKB 4C0JA 1TCFA 3JTDB 2JXCA 3DVEA 1CLLA 3EK7A 3CS1A 3BFHA 3BXKA 4MZKA 3E3RA 4XJKA 4YGCB 3O4YA 1LINA 4INXA 3RLZA 4CLNA 1KFUS 4DRWA 1AK8A 2PVBA 4PHJA 2JPTA 5FI7A 2MRDA 1AJ5A 3L4AA 1RWYA 3VRNA 2WCMA 3CWGA 2JNXA 3R1VA 1M45A 1CDLA 1CMGA 4MBEA 1J1EA 1VRKA 2BKHB 1B4CA 1M39A 3I5IC 3KF9A 1V1FA 2F33A 1UURA 1IKUA 1H8BA 1FPWA 2WCJA 3QMEA 2F3ZA 3C1VA 2OTGB 2QEBA 1C3YA 3GK2A 1N2DA 4GAOA 4YRUA 4L9MA 3EKHA 2CXJA 1K94A 1R6PA 1K9PA 2ZFDA 5AEQA 5I2OA 1GGWA 1K2HA 2B1UA 4BY5A 2KYFA 2WNDA 5TNCA 1FI5A 3O6BA 1OOGA 1SKTA 1YURA 1PRWA 1MXEA 1NIWA 3BQ3A 1L7ZA 3KEVA 1UHHA 2M97A 4AQIA 1CFCA 5JOLA 1AVSA 1WRKA 1JSAA 4PT1A 3QRXA 4PDZA 2H2KA 2WCLA 1CDMA 1LVCD 1N0YA 4N1FA 1CKKA 1R2UA 2PYQA 1LKJA 1SL8A 4M2PA 4JKTA 2BE4A 1BF5A 3BUWB 5AERA 1K96A 1S6CA 2CTNA 2EGDA 4YGEB 4D1EA 4MEWA 4GPLB 3I5FC 1KFUL 2L4HA 4I5NB 1UHNA 3B88A 3OB2B 1GM0A 1V1GA 1TUJA 2L50A 2LUXA 3IVTA 4I5LB 4GGNA 2KAVA 1TOPA 3D73A 4PE4A 1U5IB 3OP0A 1KWOB 2BCXA 2BE6A 2SCPA 1W7IB 2H61A 3DF0A 5JJGA 2M1UA 1MF8B 5AFPA 2CCMA 2WCEA 2WCBA 5DKQA 3SG5A 1OQPA 2Y5IA 2M7NA 3DVKA 1TTXA 1JWDA 1GGZA 1A4PA 1DJYA 1TNQA 1S1EA 1TUZA 4OR9B 2JU0A 2JT0A 1BG1A 1QX5B 1YUUA 1S6IA 1XYDA 4HRGA 2JULA 2LMUA 1CM4A 4CPVA 5IBWA 2KI4C 1F8HA 1H4BA 2MLFC 4YGBB 4PE7A 4QJ4B 2AAOA 3CDNA 1NX3A 2AMIA 2MA2A 1ZOTB 1SCMB 3KHEA 1B7TZ 3PSRA 3TZ1A 3WHTB 2LM5A 4DIRA 3A4UB 1DT7B 4HREE 1PSBA 1L2OC 1K9KA 2KAXA 2WC8A 3D74A 4MSPA 4BY4A 3K21A 1SY9A 3TUYC 3JVTC 4KYNA 1SSEB 2QDIA 3DYEA 5D7FA 1F4QA 1WDCB 4WQ2A 1MHOA 5FI2A 1QX7A 1ZACA 2BCBA 3FS7A 1X02A 1UHIA 1Z2CB 4ETOA 1HQVA 1J7OA 2M29A 2KAYA 1KK7Y 3H4SE 4P5OE 2I94A 1IWQA 2GGZA 4GGFC 4ZCVA 5I8NA 4A4BA 1CMFA 3NSLA 4DCKA 1DMOA 1SMGA 1TWOA 1XK4C 2KNEA 4GGFA 1J7PA 1QLSA 2BNXA 1BODA 1M31A 3PFVA 4JQ0D 1ORGA 2JRFA 1XK4A 2COLB 1OW4A 3FE8A 2OS8C 3VRRA 2LE9B 4MRYA 1EL4A 2KHNA 2WOSA 2QEVA 3PM8A 2ZRTA 3OX6A 4CFRA 2QPTA 5AXIA 3I5GB 1C3ZA 3AKBA 4AOMA 3VRQA 2KGRA 3R1OA 4MN0A 5AANA 2KDHA 4YGAA 4U8DA 1MXLC 2G2BA 5D69A 1UHKA 1OMRA 2EC6B 1A29A 1WRLA 4IL1A 2Y1NA 2R2IA 1EG4A 2NCOA 3BUXB 2L2EA 1OE9B 1OMVA 1C7WA 1OOFA 1XFXO 3N7HA 3GK1A 1XFYO 3BJHA 1YX8A 2Y4QA 4QJ5B 2RGIA 1DEKA 1QASA 3DVJA
chains in the Genus database with same CATH topology
1NPQA 1RTP1 1LA0A 1RECA 4I5JA 3ICBA 3SG6A 1QVIY 1S26D 5DKRA 3F45A 3BUNB 5B8IB 1KK8C 5HLOA 1FF1A 4M2QA 4UPGA 2M7LA 1JFJA 2LP3A 1FI6A 1NCYA 1EH2A 1SRAA 1WY9A 2LNKA 2M8UA 3I5IB 1SCVA 3TS5C 4DUQA 4GBAA 1Y0VH 1RROA 2L0PA 2D8NA 1DJIA 2Q4UA 1QJTA 2JZIA 1A2XA 1B8LA 2K7CA 4N1GA 2LHLA 1QATA 3AKAA 1Q80A 4YGDB 3MSEB 3TDIA 2NCPA 5J3XA 1F71A 1B9AA 1WLMA 3PN7C 4NDDA 1F54A 2F2PA 3CR4X 4NDCA 1QS7A 1F55A 3EKJA 1QTXA 1PK0D 2K7OA 4MVFA 3HCMA 1BR1B 3BUOB 2NZ0A 1CLMA 2ZN9A 1UP5A 2LP2A 3CR5X 2I18A 3SIBA 1NCZA 1Y1AA 3I5FB 3OHMB 3WHUB 2KYCA 3M0WA 1F70A 3OX5A 3DF0B 2KFGA 1ALVA 1K90D 2K2FA 3O2PA 2KI6C 1XFVO 2LUCA 5CSJA 3WNXB 2KQYA 2AUCA 1GJYA 4ICBA 2LMTA 4OV2A 2IS9A 1NX1A 3GK4X 1DF0B 1QX2A 3WXAA 1J7RA 2L4IA 4GUKA 3I5HC 1JFKA 1QIVA 2BECA 4ORAB 3FWCA 3LK1A 1SPYA 1DF0A 3FWBA 2SASA 1DJZA 1Y6WA 1XVJA 1DJGA 4MZLA 3LCPC 2KI4B 1AUIB 2JNFA 1KQMC 1DGUA 2ZN8A 5FYXA 3LK0A 2LHIA 1DVIA 4MLWA 5GQQC 1L2OB 1M46A 1XO5A 3AAKA 2I7AA 3CLNA 3TUYB 5CPVA 3JVTB 1NX2A 1BT6A 2LVJA 1XFZO 2L98A 1ZUZA 5CSNA 2MBXA 5K89A 3CGAA 3NSKA 2FCEA 3ZNIA 1OZOA 2K2AA 4OKHA 4CFQA 4USLA 1CDPA 1J55A 1B7TY 1KCYA 1CTRA 2BL0C 3HX4A 5HLVA 1TNWA 1J1DA 2LANA 2V53A 1RK9A 1DGVA 5G08A 1S5GZ 4E68A 2JWWA 2LLSA 2KOTA 2ZNDA 1KK7Z 1DJHA 4R1EA 1TNXA 2PALA 5ER4X 1ZFSA 2JXLA 3D10A 2G9BA 5DKNA 2OS8B 1SNLA 5KU1A 3SG7A 1TRFA 1BJFA 5HKWA 2KGBC 5CSIA 1KQVA 1W7JB 2E6WA 4TNCA 1NYAA 1YRTB 2WORA 2K8MB 1JUOA 1YR5A 2LVVA 1QV0A 1EJ3A 2BKIB 3OB1B 1SL7A 1YUSA 1PALA 2LV7A 1JF2A 3LLEA 1OMDA 4JPZB 3SIAA 1QV1A 2NXQA 1BOCA 2JT3A 1MR8A 1XA5A 2CNPA 1SR6C 2BCAA 4ORCB 2I2RE 3RM1A 1PVAA 1OOJA 2ISDA 4FTGA 2FOTA 4YI9A 1S6JA 3FIAA 2Y1MA 4MRXA 2M3WA 1G4YR 2M9GA 1CLBA 2LAPA 1KK8B 3IQOA 2JOJA 3BYAA 1IG5A 1A75A 1BLQA 3TS5B 3EVRA 1MUXA 1RJVA 2K7DA 4HRHA 4PE1A 1KSOA 4QJ3B 1AP4A 2QACA 1F4OA 2ZNEA 2GV5A 1S36A 3DD4A 5BPJA 1DTLA 3D0YA 3JTDC 1CFPA 1GQMA 1K8UA 4F0ZB 2O60A 3TDZA 1KFXS 2F3YA 1YUTA 3PN7B 1KSMA 3EVVA 2OPOA 5HKYA 1LXFC 3PLFB 4WRIA 5KTYA 1S3PA 1A03A 1PVBA 2KSPA 4M2OA 1EXRA 1BMOA 4C0LA 1ALWA 1D1OA 2OTGC 1AJ4A 4C0KA 2BBMA 3EVUA 2LLUA 1YX7A 3O78A 2K7BA 4ZCUA 2HETA 1NX0A 3VROA 2CBLA 3AAJA 1IJ6A 4AQJA 3GOFA 1SBJA 2L5XB 5PALA 4GFTA 2NLNA 3ZWHA 2HQ8A 4NQGA 1J7QA 3PATA 3CTNA 1IGVA 1SK6D 2EHBA 4JWQA 1SW8A 2A4JA 1HT9A 5I2LA 1AHRA 2M0RA 1OZSA 2FCDA 1CDNA 2BBNA 1BU3A 3BOWB 5HKZA 1CFDA 3PALA 4DS7A 1LA3A 4PHMA 3SJSA 3I5HB 1SL9A 2TN4A 3BOWA 4YBHB 2LVKA 1Y1XA 1K95A 2KFFA 4A4CA 2Q91A 2F8PA 3KO0A 3SG4A 1KFXL 4YI8A 1CFFA 1PSRA 5F6TA 1KQMB 4NDBA 2H61C 2KI6D 5CSFA 4GNKB 1YRUB 2HPSA 4I5KA 1UUSA 4N5XA 2MHHA 1DJXA 4OCIA 1KWOC 4HSZA 1SYMA 2JC2A 3BUMB 4PCWA 1MWNA 1U5IA 2LMVA 1C07A 2PSRA 1G33A 2PASA 3IQQA 1IJ5A 1RFJA 1WRZA 2L51A 1C7VA 2LCPA 1YVHA 4PHKA 2JQ6A 4XYNA 2ZKMX 2FJUB 3EK8A 3VGOA 2BL0B 1E8AA 1NCXA 2LVIA 3DVMA 1QIWA 1JC2A 2P6BB 1TN4A 2KBMA 1FBVA 1OSAA 4CIDA 1EG3A 1SCMC 4FQOA 3EK4A 3NSIA 3KPXA 2F2OA 2JT8A 2KFHA 1UWOA 1IQ5A 1ODBA 1QLKA 4OVNF 3A8RA 1B47A 1B8CA 4PE0A 1JBAA 3SG2A 2O5GA 3TDUA 4MZJA 1B8RA 1MQ1A 2HQWA 2KQ6A 1WDCC 1NP8A 1G8IA 4ORBB 2HF5A 2VRGA 1S5GY 1TNPA 2MAZA 2MLEC 1XFUO 1CB1A 5I2QA 1K9UA 2PMYA 1M63B 1WLZA 4WQ3A 1ZMZA 1SR6B 3LL8B 2JTZA 5ER5A 4P2YB 1NSHA 2JTTA 1TIZA 1IQ3A 1UHJA 2LC5A 2PRUA 3CR2A 3VRPA 1NUBA 2CT9A 1CM1A 3IF7A 1B1GA 1BR4B 1N65A 1DJWA 1QXPA 2K61A 5HYDA 1K93D 2WCFA 1A75B 2MJWB 2ZRSA 1Y1UA 3I5GC 1JF0A 3NXAA 2K0JA 1YTZC 1PULA 1XFWO 2KBIA 2GGMA 1YVLA 2M49B 2M1KB 1IH0A 1TCOB 4Q04A 1FW4A 2DOQA 3SG3A 1IRJA 1QVIZ 2EC6C 3D0YB 1CNPA 4PHNA 4PALA 5KSZA 1NWDA 2E30A 3NSOA 2LLTA 4XJKB 4C0JA 1TCFA 3JTDB 2JXCA 3DVEA 1CLLA 3EK7A 3CS1A 3RLZA 3BXKA 4MZKA 3E3RA 4XJKA 4YGCB 3O4YA 1LINA 4CLNA 4DRWA 1KFUS 1AK8A 2PVBA 4PHJA 2JPTA 2MRDA 1AJ5A 1RWYA 3VRNA 3CWGA 2JNXA 1M45A 1CDLA 1CMGA 4MBEA 1J1EA 1VRKA 2BKHB 1B4CA 1M39A 3I5IC 3KF9A 1V1FA 2F33A 1UURA 1IKUA 1H8BA 1FPWA 2F3ZA 3C1VA 2OTGB 3GK2A 1N2DA 4GAOA 4YRUA 4L9MA 3EKHA 2CXJA 1K94A 1R6PA 1K9PA 2ZFDA 5AEQA 5I2OA 1GGWA 1K2HA 2B1UA 4BY5A 2KYFA 2WNDA 5TNCA 1FI5A 3O6BA 1SKTA 1YURA 1PRWA 1MXEA 1NIWA 3BQ3A 1L7ZA 3KEVA 1UHHA 2M97A 4AQIA 1CFCA 5JOLA 1AVSA 1WRKA 1JSAA 3QRXA 4PDZA 2H2KA 1CDMA 1LVCD 1N0YA 4N1FA 1CKKA 1R2UA 1LKJA 1SL8A 4M2PA 2BE4A 1BF5A 3BUWB 5AERA 1K96A 1S6CA 2CTNA 2EGDA 4YGEB 4D1EA 4MEWA 4GPLB 3I5FC 1KFUL 2L4HA 4I5NB 1UHNA 3OB2B 1V1GA 2L50A 2LUXA 4I5LB 4GGNA 2KAVA 1TOPA 4PE4A 1U5IB 3OP0A 1KWOB 2BCXA 2BE6A 2SCPA 1W7IB 2H61A 3DF0A 5JJGA 2M1UA 1MF8B 5AFPA 2CCMA 2WCEA 2WCBA 5DKQA 3SG5A 1OQPA 2Y5IA 2M7NA 3DVKA 1TTXA 1JWDA 1GGZA 1A4PA 1DJYA 1TNQA 1S1EA 4OR9B 2JU0A 2JT0A 1BG1A 1QX5B 1YUUA 1S6IA 1XYDA 4HRGA 2JULA 2LMUA 1CM4A 4CPVA 5IBWA 2KI4C 1F8HA 1H4BA 2MLFC 4YGBB 4PE7A 4QJ4B 2AAOA 3PSRA 1NX3A 2AMIA 2MA2A 1ZOTB 1SCMB 3KHEA 1B7TZ 3TZ1A 3WHTB 2LM5A 4DIRA 3A4UB 1DT7B 4HREE 1PSBA 1L2OC 1K9KA 2KAXA 2WC8A 4MSPA 4BY4A 3K21A 1SY9A 3TUYC 3JVTC 5D7FA 1F4QA 1WDCB 4WQ2A 1MHOA 1QX7A 1ZACA 2BCBA 3FS7A 1X02A 1UHIA 4ETOA 1HQVA 1J7OA 2M29A 2KAYA 1KK7Y 3H4SE 4P5OE 2I94A 1IWQA 2GGZA 4GGFC 4ZCVA 5I8NA 4A4BA 1CMFA 3NSLA 4DCKA 1DMOA 1SMGA 1XK4C 2KNEA 4GGFA 1J7PA 1QLSA 1BODA 1M31A 3PFVA 4JQ0D 2JRFA 1XK4A 2COLB 2OS8C 3VRRA 2LE9B 4MRYA 1EL4A 2KHNA 2WOSA 3PM8A 2ZRTA 3OX6A 4CFRA 2QPTA 5AXIA 3I5GB 3AKBA 4AOMA 3VRQA 2KGRA 4MN0A 5AANA 2KDHA 4YGAA 4U8DA 1MXLC 2G2BA 5D69A 1UHKA 1OMRA 2EC6B 1A29A 1WRLA 4IL1A 2Y1NA 2R2IA 1EG4A 2NCOA 3BUXB 2L2EA 1OE9B 1OMVA 1C7WA 1XFXO 3GK1A 1XFYO 1YX8A 2Y4QA 4QJ5B 2RGIA 3CZTX 1QASA 3DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPQ A;  1RTP 1;  1LA0 A;  1REC A;  4I5J A;  3ICB A;  3SG6 A;  1QVI Y;  1S26 D;  5DKR A;  3F45 A;  3BUN B;  5B8I B;  1KK8 C;  5HLO A;  1FF1 A;  4M2Q A;  4UPG A;  2M7L A;  1JFJ A;  2LP3 A;  1FI6 A;  1NCY A;  1EH2 A;  1SRA A;  1WY9 A;  2LNK A;  2M8U A;  3I5I B;  1SCV A;  3TS5 C;  4DUQ A;  4GBA A;  1Y0V H;  1RRO A;  2L0P A;  2D8N A;  1DJI A;  2Q4U A;  1QJT A;  2JZI A;  1A2X A;  1B8L A;  2K7C A;  4N1G A;  2LHL A;  1QAT A;  3AKA A;  1Q80 A;  4YGD B;  3MSE B;  3TDI A;  2NCP A;  5J3X A;  1F71 A;  1B9A A;  1WLM A;  3PN7 C;  4NDD A;  1F54 A;  2F2P A;  3CR4 X;  4NDC A;  1QS7 A;  1F55 A;  3EKJ A;  1QTX A;  1PK0 D;  2K7O A;  4MVF A;  3HCM A;  1BR1 B;  3BUO B;  2NZ0 A;  1CLM A;  2ZN9 A;  1UP5 A;  2LP2 A;  3CR5 X;  2I18 A;  3SIB A;  1NCZ A;  1Y1A A;  3I5F B;  3OHM B;  3WHU B;  2KYC A;  3M0W A;  1F70 A;  3OX5 A;  3DF0 B;  2KFG A;  1ALV A;  1K90 D;  2K2F A;  3O2P A;  2KI6 C;  1XFV O;  2LUC A;  5CSJ A;  3WNX B;  2KQY A;  2AUC A;  1GJY A;  4ICB A;  2LMT A;  4OV2 A;  2IS9 A;  1NX1 A;  3GK4 X;  1DF0 B;  1QX2 A;  3WXA A;  1J7R A;  2L4I A;  4GUK A;  3I5H C;  1JFK A;  1QIV A;  2BEC A;  4ORA B;  3FWC A;  3LK1 A;  1SPY A;  1DF0 A;  3FWB A;  2SAS A;  1DJZ A;  1Y6W A;  1XVJ A;  1DJG A;  4MZL A;  3LCP C;  2KI4 B;  1AUI B;  2JNF A;  1KQM C;  1DGU A;  2ZN8 A;  5FYX A;  3LK0 A;  2LHI A;  1DVI A;  4MLW A;  5GQQ C;  1L2O B;  1M46 A;  1XO5 A;  3AAK A;  2I7A A;  3CLN A;  3TUY B;  5CPV A;  3JVT B;  1NX2 A;  1BT6 A;  2LVJ A;  1XFZ O;  2L98 A;  1ZUZ A;  5CSN A;  2MBX A;  5K89 A;  3CGA A;  3NSK A;  2FCE A;  3ZNI A;  1OZO A;  2K2A A;  4OKH A;  4CFQ A;  4USL A;  1CDP A;  1J55 A;  1B7T Y;  1KCY A;  1CTR A;  2BL0 C;  3HX4 A;  5HLV A;  1TNW A;  1J1D A;  2LAN A;  2V53 A;  1RK9 A;  1DGV A;  5G08 A;  1S5G Z;  4E68 A;  2JWW A;  2LLS A;  2KOT A;  2ZND A;  1KK7 Z;  1DJH A;  4R1E A;  1TNX A;  2PAL A;  5ER4 X;  1ZFS A;  2JXL A;  3D10 A;  2G9B A;  5DKN A;  2OS8 B;  1SNL A;  5KU1 A;  3SG7 A;  1TRF A;  1BJF A;  5HKW A;  2KGB C;  5CSI A;  1KQV A;  1W7J B;  2E6W A;  4TNC A;  1NYA A;  1YRT B;  2WOR A;  2K8M B;  1JUO A;  1YR5 A;  2LVV A;  1QV0 A;  1EJ3 A;  2BKI B;  3OB1 B;  1SL7 A;  1YUS A;  1PAL A;  2LV7 A;  1JF2 A;  3LLE A;  1OMD A;  4JPZ B;  3SIA A;  1QV1 A;  2NXQ A;  1BOC A;  2JT3 A;  1MR8 A;  1XA5 A;  2CNP A;  1SR6 C;  2BCA A;  4ORC B;  2I2R E;  3RM1 A;  1PVA A;  1OOJ A;  2ISD A;  4FTG A;  2FOT A;  4YI9 A;  1S6J A;  3FIA A;  2Y1M A;  4MRX A;  2M3W A;  1G4Y R;  2M9G A;  1CLB A;  2LAP A;  1KK8 B;  3IQO A;  2JOJ A;  3BYA A;  1IG5 A;  1A75 A;  1BLQ A;  3TS5 B;  3EVR A;  1MUX A;  1RJV A;  2K7D A;  4HRH A;  4PE1 A;  1KSO A;  4QJ3 B;  1AP4 A;  2QAC A;  1F4O A;  2ZNE A;  2GV5 A;  1S36 A;  3DD4 A;  5BPJ A;  1DTL A;  3D0Y A;  3JTD C;  1CFP A;  1GQM A;  1K8U A;  4F0Z B;  2O60 A;  3TDZ A;  1KFX S;  2F3Y A;  1YUT A;  3PN7 B;  1KSM A;  3EVV A;  2OPO A;  5HKY A;  1LXF C;  3PLF B;  4WRI A;  5KTY A;  1S3P A;  1A03 A;  1PVB A;  2KSP A;  4M2O A;  1EXR A;  1BMO A;  4C0L A;  1ALW A;  1D1O A;  2OTG C;  1AJ4 A;  4C0K A;  2BBM A;  3EVU A;  2LLU A;  1YX7 A;  3O78 A;  2K7B A;  4ZCU A;  2HET A;  1NX0 A;  3VRO A;  2CBL A;  3AAJ A;  1IJ6 A;  4AQJ A;  3GOF A;  1SBJ A;  2L5X B;  5PAL A;  4GFT A;  2NLN A;  3ZWH A;  2HQ8 A;  4NQG A;  1J7Q A;  3PAT A;  3CTN A;  1IGV A;  1SK6 D;  2EHB A;  4JWQ A;  1SW8 A;  2A4J A;  1HT9 A;  5I2L A;  1AHR A;  2M0R A;  1OZS A;  2FCD A;  1CDN A;  2BBN A;  1BU3 A;  3BOW B;  5HKZ A;  1CFD A;  3PAL A;  4DS7 A;  1LA3 A;  4PHM A;  3SJS A;  3I5H B;  1SL9 A;  2TN4 A;  3BOW A;  4YBH B;  2LVK A;  1Y1X A;  1K95 A;  2KFF A;  4A4C A;  2Q91 A;  2F8P A;  3KO0 A;  3SG4 A;  1KFX L;  4YI8 A;  1CFF A;  1PSR A;  5F6T A;  1KQM B;  4NDB A;  2H61 C;  2KI6 D;  5CSF A;  4GNK B;  1YRU B;  2HPS A;  4I5K A;  1UUS A;  4N5X A;  2MHH A;  1DJX A;  4OCI A;  1KWO C;  4HSZ A;  1SYM A;  2JC2 A;  3BUM B;  4PCW A;  1MWN A;  1U5I A;  2LMV A;  1C07 A;  2PSR A;  1G33 A;  2PAS A;  3IQQ A;  1IJ5 A;  1RFJ A;  1WRZ A;  2L51 A;  1C7V A;  2LCP A;  1YVH A;  4PHK A;  2JQ6 A;  4XYN A;  2ZKM X;  2FJU B;  3EK8 A;  3VGO A;  2BL0 B;  1E8A A;  1NCX A;  2LVI A;  3DVM A;  1QIW A;  1JC2 A;  2P6B B;  1TN4 A;  2KBM A;  1FBV A;  1OSA A;  4CID A;  1EG3 A;  1SCM C;  4FQO A;  3EK4 A;  3NSI A;  3KPX A;  2F2O A;  2JT8 A;  2KFH A;  1UWO A;  1IQ5 A;  1ODB A;  1QLK A;  4OVN F;  3A8R A;  1B47 A;  1B8C A;  4PE0 A;  1JBA A;  3SG2 A;  2O5G A;  3TDU A;  4MZJ A;  1B8R A;  1MQ1 A;  2HQW A;  2KQ6 A;  1WDC C;  1NP8 A;  1G8I A;  4ORB B;  2HF5 A;  2VRG A;  1S5G Y;  1TNP A;  2MAZ A;  2MLE C;  1XFU O;  1CB1 A;  5I2Q A;  1K9U A;  2PMY A;  1M63 B;  1WLZ A;  4WQ3 A;  1ZMZ A;  1SR6 B;  3LL8 B;  2JTZ A;  5ER5 A;  4P2Y B;  1NSH A;  2JTT A;  1TIZ A;  1IQ3 A;  1UHJ A;  2LC5 A;  2PRU A;  3CR2 A;  3VRP A;  1NUB A;  2CT9 A;  1CM1 A;  3IF7 A;  1B1G A;  1BR4 B;  1N65 A;  1DJW A;  1QXP A;  2K61 A;  5HYD A;  1K93 D;  2WCF A;  1A75 B;  2MJW B;  2ZRS A;  1Y1U A;  3I5G C;  1JF0 A;  3NXA A;  2K0J A;  1YTZ C;  1PUL A;  1XFW O;  2KBI A;  2GGM A;  1YVL A;  2M49 B;  2M1K B;  1IH0 A;  1TCO B;  4Q04 A;  1FW4 A;  2DOQ A;  3SG3 A;  1IRJ A;  1QVI Z;  2EC6 C;  3D0Y B;  1CNP A;  4PHN A;  4PAL A;  5KSZ A;  1NWD A;  2E30 A;  3NSO A;  2LLT A;  4XJK B;  4C0J A;  1TCF A;  3JTD B;  2JXC A;  3DVE A;  1CLL A;  3EK7 A;  3CS1 A;  3RLZ A;  3BXK A;  4MZK A;  3E3R A;  4XJK A;  4YGC B;  3O4Y A;  1LIN A;  4CLN A;  4DRW A;  1KFU S;  1AK8 A;  2PVB A;  4PHJ A;  2JPT A;  2MRD A;  1AJ5 A;  1RWY A;  3VRN A;  3CWG A;  2JNX A;  1M45 A;  1CDL A;  1CMG A;  4MBE A;  1J1E A;  1VRK A;  2BKH B;  1B4C A;  1M39 A;  3I5I C;  3KF9 A;  1V1F A;  2F33 A;  1UUR A;  1IKU A;  1H8B A;  1FPW A;  2F3Z A;  3C1V A;  2OTG B;  3GK2 A;  1N2D A;  4GAO A;  4YRU A;  4L9M A;  3EKH A;  2CXJ A;  1K94 A;  1R6P A;  1K9P A;  2ZFD A;  5AEQ A;  5I2O A;  1GGW A;  1K2H A;  2B1U A;  4BY5 A;  2KYF A;  2WND A;  5TNC A;  1FI5 A;  3O6B A;  1SKT A;  1YUR A;  1PRW A;  1MXE A;  1NIW A;  3BQ3 A;  1L7Z A;  3KEV A;  1UHH A;  2M97 A;  4AQI A;  1CFC A;  5JOL A;  1AVS A;  1WRK A;  1JSA A;  3QRX A;  4PDZ A;  2H2K A;  1CDM A;  1LVC D;  1N0Y A;  4N1F A;  1CKK A;  1R2U A;  1LKJ A;  1SL8 A;  4M2P A;  2BE4 A;  1BF5 A;  3BUW B;  5AER A;  1K96 A;  1S6C A;  2CTN A;  2EGD A;  4YGE B;  4D1E A;  4MEW A;  4GPL B;  3I5F C;  1KFU L;  2L4H A;  4I5N B;  1UHN A;  3OB2 B;  1V1G A;  2L50 A;  2LUX A;  4I5L B;  4GGN A;  2KAV A;  1TOP A;  4PE4 A;  1U5I B;  3OP0 A;  1KWO B;  2BCX A;  2BE6 A;  2SCP A;  1W7I B;  2H61 A;  3DF0 A;  5JJG A;  2M1U A;  1MF8 B;  5AFP A;  2CCM A;  2WCE A;  2WCB A;  5DKQ A;  3SG5 A;  1OQP A;  2Y5I A;  2M7N A;  3DVK A;  1TTX A;  1JWD A;  1GGZ A;  1A4P A;  1DJY A;  1TNQ A;  1S1E A;  4OR9 B;  2JU0 A;  2JT0 A;  1BG1 A;  1QX5 B;  1YUU A;  1S6I A;  1XYD A;  4HRG A;  2JUL A;  2LMU A;  1CM4 A;  4CPV A;  5IBW A;  2KI4 C;  1F8H A;  1H4B A;  2MLF C;  4YGB B;  4PE7 A;  4QJ4 B;  2AAO A;  3PSR A;  1NX3 A;  2AMI A;  2MA2 A;  1ZOT B;  1SCM B;  3KHE A;  1B7T Z;  3TZ1 A;  3WHT B;  2LM5 A;  4DIR A;  3A4U B;  1DT7 B;  4HRE E;  1PSB A;  1L2O C;  1K9K A;  2KAX A;  2WC8 A;  4MSP A;  4BY4 A;  3K21 A;  1SY9 A;  3TUY C;  3JVT C;  5D7F A;  1F4Q A;  1WDC B;  4WQ2 A;  1MHO A;  1QX7 A;  1ZAC A;  2BCB A;  3FS7 A;  1X02 A;  1UHI A;  4ETO A;  1HQV A;  1J7O A;  2M29 A;  2KAY A;  1KK7 Y;  3H4S E;  4P5O E;  2I94 A;  1IWQ A;  2GGZ A;  4GGF C;  4ZCV A;  5I8N A;  4A4B A;  1CMF A;  3NSL A;  4DCK A;  1DMO A;  1SMG A;  1XK4 C;  2KNE A;  4GGF A;  1J7P A;  1QLS A;  1BOD A;  1M31 A;  3PFV A;  4JQ0 D;  2JRF A;  1XK4 A;  2COL B;  2OS8 C;  3VRR A;  2LE9 B;  4MRY A;  1EL4 A;  2KHN A;  2WOS A;  3PM8 A;  2ZRT A;  3OX6 A;  4CFR A;  2QPT A;  5AXI A;  3I5G B;  3AKB A;  4AOM A;  3VRQ A;  2KGR A;  4MN0 A;  5AAN A;  2KDH A;  4YGA A;  4U8D A;  1MXL C;  2G2B A;  5D69 A;  1UHK A;  1OMR A;  2EC6 B;  1A29 A;  1WRL A;  4IL1 A;  2Y1N A;  2R2I A;  1EG4 A;  2NCO A;  3BUX B;  2L2E A;  1OE9 B;  1OMV A;  1C7W A;  1XFX O;  3GK1 A;  1XFY O;  1YX8 A;  2Y4Q A;  4QJ5 B;  2RGI A;  3CZT X;  1QAS A;  3DVJ A; 
#chains in the Genus database with same CATH topology
 3D78 A;  1NPQ A;  1RTP 1;  1LA0 A;  1REC A;  4I5J A;  2ERB A;  3ICB A;  3SG6 A;  4F7F A;  1QVI Y;  1S26 D;  5DKR A;  3F45 A;  3BUN B;  5B8I B;  1KK8 C;  5HLO A;  1FF1 A;  4M2Q A;  4UPG A;  2M7L A;  1JFJ A;  2LP3 A;  1FI6 A;  2JPO A;  1NCY A;  1EH2 A;  1SRA A;  1WY9 A;  2LNK A;  2M8U A;  2BAP A;  1SCV A;  3I5I B;  3TS5 C;  4DUQ A;  4GBA A;  1Y0V H;  1RRO A;  2L0P A;  2D8N A;  1DJI A;  1QWV A;  1QJT A;  2JZI A;  1A2X A;  1B8L A;  2K7C A;  2Q4U A;  3CZ1 A;  3R1P A;  2LHL A;  3DY9 A;  1QAT A;  3AKA A;  1Q80 A;  4FQT A;  4YGD B;  3MSE B;  3TDI A;  2NCP A;  5J3X A;  1F71 A;  1B9A A;  1WLM A;  3B86 A;  3PN7 C;  4NDD A;  1F54 A;  2F2P A;  3CR4 X;  4NDC A;  1QS7 A;  1Z4H A;  3SS4 A;  1F55 A;  3EKJ A;  1QTX A;  1PK0 D;  2K7O A;  4MVF A;  3HCM A;  1BR1 B;  3BUO B;  2NZ0 A;  1CLM A;  2ZN9 A;  1UP5 A;  2LP2 A;  3CR5 X;  2I18 A;  3SIB A;  1NCZ A;  1Y1A A;  3NHT A;  1IIO A;  2KLE A;  3I5F B;  3OHM B;  3WHU B;  2KYC A;  3M0W A;  3Q8I A;  1F70 A;  3OX5 A;  3DF0 B;  3FE9 A;  2KFG A;  1ALV A;  1K90 D;  2K2F A;  3O2P A;  2FJY A;  2KI6 C;  1XFV O;  2LUC A;  5CSJ A;  3WNX B;  2KQY A;  2AUC A;  1GJY A;  1DQE A;  4ICB A;  2LMT A;  4OV2 A;  2IS9 A;  1NX1 A;  3GK4 X;  1DF0 B;  1QX2 A;  3CYZ A;  3WXA A;  1T14 A;  1J7R A;  2L4I A;  2QEH A;  3I5H C;  1JFK A;  1QIV A;  2BEC A;  4GUK A;  4ORA B;  2YGU A;  3FWC A;  3LK1 A;  1LS8 A;  3D75 A;  1SPY A;  1DF0 A;  2L2C A;  2P71 A;  3NHI A;  3FWB A;  2QEO A;  1DJZ A;  1Y6W A;  1XVJ A;  1DJG A;  2SAS A;  4MZL A;  3LCP C;  2KI4 B;  3NGV A;  1AUI B;  2JNF A;  1KQM C;  1DGU A;  2ZN8 A;  1P28 A;  5FYX A;  3LK0 A;  2LHI A;  1DVI A;  4MLW A;  5GQQ C;  2P70 A;  3DXL A;  1L2O B;  1M46 A;  1XO5 A;  3AAK A;  2I7A A;  3CLN A;  3TUY B;  5CPV A;  3JVT B;  1NX2 A;  1BT6 A;  2LVJ A;  1XFZ O;  2L98 A;  1DEL A;  1ZUZ A;  2WCK A;  5CSN A;  2MBX A;  3K1E A;  5K89 A;  3CGA A;  3NSK A;  2FCE A;  3ZNI A;  1OZO A;  2K2A A;  4IJ7 A;  4OKH A;  4USL A;  1CDP A;  1J55 A;  1B7T Y;  4CFQ A;  1KCY A;  1CTR A;  2BL0 C;  3HX4 A;  5HLV A;  1TNW A;  1J1D A;  2LAN A;  2V53 A;  3CZT X;  1RK9 A;  1DGV A;  1OOH A;  5G08 A;  1S5G Z;  4E68 A;  2JWW A;  2LLS A;  2KOT A;  2ZND A;  1KK7 Z;  1DJH A;  4R1E A;  1TNX A;  2PAL A;  3CAB A;  2WC5 A;  5ER4 X;  3S0F A;  1ZFS A;  2JXL A;  3D10 A;  2G9B A;  5DKN A;  2OS8 B;  1SNL A;  4INW A;  5KU1 A;  3SG7 A;  1TRF A;  1BJF A;  5HKW A;  2KGB C;  3PM2 A;  5CSI A;  1KQV A;  1W7J B;  2E6W A;  3DZT A;  1NYA A;  1YRT B;  4TNC A;  2WOR A;  3UO9 A;  2K8M B;  1JUO A;  1YR5 A;  2LVV A;  1QV0 A;  1EJ3 A;  2BKI B;  3OB1 B;  1SL7 A;  1YUS A;  1PAL A;  2LV7 A;  1JF2 A;  3LLE A;  1OMD A;  4JPZ B;  3SIA A;  1QV1 A;  2NXQ A;  1BOC A;  2JT3 A;  1MR8 A;  1XA5 A;  2CNP A;  1SR6 C;  2BCA A;  4ORC B;  2I2R E;  3SS5 A;  3VB1 A;  3RM1 A;  1PVA A;  1OOJ A;  2ISD A;  4FTG A;  2FOT A;  4YI9 A;  1S6J A;  3FIA A;  2Y1M A;  2PQL A;  4MRX A;  2M3W A;  1G4Y R;  2M9G A;  1CLB A;  2LAP A;  1KK8 B;  3UNW A;  3IQO A;  3V2L A;  2JOJ A;  3BYA A;  1IG5 A;  1A75 A;  1BLQ A;  3CZ2 A;  3TS5 B;  3EVR A;  1MUX A;  1RJV A;  2K7D A;  4HRH A;  3BFB A;  1KSO A;  4PE1 A;  4QJ3 B;  1AP4 A;  2QAC A;  1F4O A;  2ZNE A;  2GV5 A;  1S36 A;  3B6X A;  2GTE A;  3DD4 A;  1DTL A;  3D0Y A;  3JTD C;  5BPJ A;  1CFP A;  3CZ0 A;  1GQM A;  1K8U A;  4F0Z B;  2O60 A;  3TDZ A;  1KFX S;  2F3Y A;  1YUT A;  3PN7 B;  1KSM A;  3D77 A;  3EVV A;  2OPO A;  5HKY A;  1LXF C;  3EG5 B;  3PLF B;  3PJI A;  4WRI A;  5I94 A;  1S3P A;  5KTY A;  4JD9 A;  1A03 A;  1PVB A;  2KSP A;  4M2O A;  1EXR A;  1BMO A;  4C0L A;  1ALW A;  3O4X A;  3RZS A;  1D1O A;  2OTG C;  1AJ4 A;  4C0K A;  2BBM A;  5HL1 A;  3EVU A;  1XFR A;  2LLU A;  1YX7 A;  3O78 A;  2K7B A;  5EL2 A;  2HET A;  1NX0 A;  3B7A A;  4ZCU A;  3VRO A;  2CBL A;  3AAJ A;  1IJ6 A;  4AQJ A;  3GOF A;  1SBJ A;  2L5X B;  5PAL A;  4GFT A;  2NLN A;  3ZWH A;  2HQ8 A;  4NQG A;  1J7Q A;  3PAT A;  3CTN A;  1IGV A;  1SK6 D;  5D3O A;  2EHB A;  4JWQ A;  1SW8 A;  3OGN A;  2A4J A;  1HT9 A;  5I2L A;  1AHR A;  2M0R A;  1OZS A;  4N1G A;  2FCD A;  3R72 A;  1CDN A;  3L47 A;  2BBN A;  1BU3 A;  3BOW B;  5HKZ A;  1CFD A;  3PAL A;  2L5Y A;  4DS7 A;  1LA3 A;  4PHM A;  4OZD A;  3SJS A;  3I5H B;  1SL9 A;  2TN4 A;  3BOW A;  4YBH B;  2LVK A;  1Y1X A;  1K95 A;  2KFF A;  4A4C A;  2Q91 A;  2F8P A;  3KO0 A;  5DIC A;  3S0B A;  1KFX L;  1W9Z A;  4YI8 A;  3SG4 A;  1CFF A;  1PSR A;  5F6T A;  1KQM B;  4NDB A;  2H61 C;  2KI6 D;  5CSF A;  4GNK B;  1YRU B;  3L4L A;  2HPS A;  4I5K A;  1UUS A;  2WCH A;  4N5X A;  2MHH A;  1DJX A;  4OCI A;  1KWO C;  2K60 A;  4HSZ A;  1SYM A;  2JC2 A;  3BUM B;  4PCW A;  1MWN A;  1U5I A;  2LMV A;  1C07 A;  2PSR A;  1G33 A;  3B87 A;  2PAS A;  3IQQ A;  1IJ5 A;  1RFJ A;  1WRZ A;  2L51 A;  1C7V A;  2LCP A;  1YVH A;  4PHK A;  2JQ6 A;  4XYN A;  2ZKM X;  3BFA A;  3D76 A;  2FJU B;  3EK8 A;  3VGO A;  2BL0 B;  1E8A A;  1NCX A;  2LVI A;  3DVM A;  1QIW A;  1JC2 A;  2P6B B;  1TN4 A;  1OOI X;  2KBM A;  3S0G A;  1FBV A;  1OSA A;  4CID A;  1EG3 A;  1SCM C;  3S0A A;  4FQO A;  3EK4 A;  3NSI A;  3KPX A;  2F2O A;  2JT8 A;  2KFH A;  1UWO A;  1IQ5 A;  1ODB A;  1QLK A;  4OVN F;  3A8R A;  1B47 A;  1B8C A;  4PE0 A;  1JBA A;  3SG2 A;  2O5G A;  3TDU A;  4MZJ A;  1B8R A;  1MQ1 A;  2HQW A;  2WC6 A;  2KPH A;  2KQ6 A;  1WDC C;  1NP8 A;  1G8I A;  4ORB B;  2HF5 A;  5FI6 A;  2VRG A;  1S5G Y;  1TNP A;  2MAZ A;  2MLE C;  1XFU O;  3S0D A;  1DC1 A;  1CB1 A;  3OBV A;  5I2Q A;  3S0E A;  1K9U A;  2PMY A;  1M63 B;  1WLZ A;  4WQ3 A;  1ZMZ A;  1SR6 B;  3LL8 B;  2JTZ A;  5ER5 A;  4P2Y B;  2H8V A;  1NSH A;  2JTT A;  1TIZ A;  1IQ3 A;  1UHJ A;  2LC5 A;  3FE6 A;  2PRU A;  3CR2 A;  3VRP A;  1NUB A;  2CT9 A;  1CM1 A;  3IF7 A;  1B1G A;  1BR4 B;  2KLD A;  1N65 A;  1DJW A;  1QXP A;  2K61 A;  5HYD A;  1K93 D;  2WCF A;  1A75 B;  2MJW B;  2ZRS A;  1Y1U A;  3I5G C;  3SS3 A;  1JF0 A;  3NXA A;  2K0J A;  1YTZ C;  1PUL A;  1XFW O;  2KBI A;  2GGM A;  1YVL A;  2M49 B;  2M1K B;  1IH0 A;  1TCO B;  4Q04 A;  1FW4 A;  2DOQ A;  3SG3 A;  1IRJ A;  1QVI Z;  2EC6 C;  3D0Y B;  1CNP A;  4PHN A;  4PAL A;  5KSZ A;  1NWD A;  2E30 A;  3NSO A;  2LLT A;  4XJK B;  4C0J A;  1TCF A;  3JTD B;  2JXC A;  3DVE A;  1CLL A;  3EK7 A;  3CS1 A;  3BFH A;  3BXK A;  4MZK A;  3E3R A;  4XJK A;  4YGC B;  3O4Y A;  1LIN A;  4INX A;  3RLZ A;  4CLN A;  1KFU S;  4DRW A;  1AK8 A;  2PVB A;  4PHJ A;  2JPT A;  5FI7 A;  2MRD A;  1AJ5 A;  3L4A A;  1RWY A;  3VRN A;  2WCM A;  3CWG A;  2JNX A;  3R1V A;  1M45 A;  1CDL A;  1CMG A;  4MBE A;  1J1E A;  1VRK A;  2BKH B;  1B4C A;  1M39 A;  3I5I C;  3KF9 A;  1V1F A;  2F33 A;  1UUR A;  1IKU A;  1H8B A;  1FPW A;  2WCJ A;  3QME A;  2F3Z A;  3C1V A;  2OTG B;  2QEB A;  1C3Y A;  3GK2 A;  1N2D A;  4GAO A;  4YRU A;  4L9M A;  3EKH A;  2CXJ A;  1K94 A;  1R6P A;  1K9P A;  2ZFD A;  5AEQ A;  5I2O A;  1GGW A;  1K2H A;  2B1U A;  4BY5 A;  2KYF A;  2WND A;  5TNC A;  1FI5 A;  3O6B A;  1OOG A;  1SKT A;  1YUR A;  1PRW A;  1MXE A;  1NIW A;  3BQ3 A;  1L7Z A;  3KEV A;  1UHH A;  2M97 A;  4AQI A;  1CFC A;  5JOL A;  1AVS A;  1WRK A;  1JSA A;  4PT1 A;  3QRX A;  4PDZ A;  2H2K A;  2WCL A;  1CDM A;  1LVC D;  1N0Y A;  4N1F A;  1CKK A;  1R2U A;  2PYQ A;  1LKJ A;  1SL8 A;  4M2P A;  4JKT A;  2BE4 A;  1BF5 A;  3BUW B;  5AER A;  1K96 A;  1S6C A;  2CTN A;  2EGD A;  4YGE B;  4D1E A;  4MEW A;  4GPL B;  3I5F C;  1KFU L;  2L4H A;  4I5N B;  1UHN A;  3B88 A;  3OB2 B;  1GM0 A;  1V1G A;  1TUJ A;  2L50 A;  2LUX A;  3IVT A;  4I5L B;  4GGN A;  2KAV A;  1TOP A;  3D73 A;  4PE4 A;  1U5I B;  3OP0 A;  1KWO B;  2BCX A;  2BE6 A;  2SCP A;  1W7I B;  2H61 A;  3DF0 A;  5JJG A;  2M1U A;  1MF8 B;  5AFP A;  2CCM A;  2WCE A;  2WCB A;  5DKQ A;  3SG5 A;  1OQP A;  2Y5I A;  2M7N A;  3DVK A;  1TTX A;  1JWD A;  1GGZ A;  1A4P A;  1DJY A;  1TNQ A;  1S1E A;  1TUZ A;  4OR9 B;  2JU0 A;  2JT0 A;  1BG1 A;  1QX5 B;  1YUU A;  1S6I A;  1XYD A;  4HRG A;  2JUL A;  2LMU A;  1CM4 A;  4CPV A;  5IBW A;  2KI4 C;  1F8H A;  1H4B A;  2MLF C;  4YGB B;  4PE7 A;  4QJ4 B;  2AAO A;  3CDN A;  1NX3 A;  2AMI A;  2MA2 A;  1ZOT B;  1SCM B;  3KHE A;  1B7T Z;  3PSR A;  3TZ1 A;  3WHT B;  2LM5 A;  4DIR A;  3A4U B;  1DT7 B;  4HRE E;  1PSB A;  1L2O C;  1K9K A;  2KAX A;  2WC8 A;  3D74 A;  4MSP A;  4BY4 A;  3K21 A;  1SY9 A;  3TUY C;  3JVT C;  4KYN A;  1SSE B;  2QDI A;  3DYE A;  5D7F A;  1F4Q A;  1WDC B;  4WQ2 A;  1MHO A;  5FI2 A;  1QX7 A;  1ZAC A;  2BCB A;  3FS7 A;  1X02 A;  1UHI A;  1Z2C B;  4ETO A;  1HQV A;  1J7O A;  2M29 A;  2KAY A;  1KK7 Y;  3H4S E;  4P5O E;  2I94 A;  1IWQ A;  2GGZ A;  4GGF C;  4ZCV A;  5I8N A;  4A4B A;  1CMF A;  3NSL A;  4DCK A;  1DMO A;  1SMG A;  1TWO A;  1XK4 C;  2KNE A;  4GGF A;  1J7P A;  1QLS A;  2BNX A;  1BOD A;  1M31 A;  3PFV A;  4JQ0 D;  1ORG A;  2JRF A;  1XK4 A;  2COL B;  1OW4 A;  3FE8 A;  2OS8 C;  3VRR A;  2LE9 B;  4MRY A;  1EL4 A;  2KHN A;  2WOS A;  2QEV A;  3PM8 A;  2ZRT A;  3OX6 A;  4CFR A;  2QPT A;  5AXI A;  3I5G B;  1C3Z A;  3AKB A;  4AOM A;  3VRQ A;  2KGR A;  3R1O A;  4MN0 A;  5AAN A;  2KDH A;  4YGA A;  4U8D A;  1MXL C;  2G2B A;  5D69 A;  1UHK A;  1OMR A;  2EC6 B;  1A29 A;  1WRL A;  4IL1 A;  2Y1N A;  2R2I A;  1EG4 A;  2NCO A;  3BUX B;  2L2E A;  1OE9 B;  1OMV A;  1C7W A;  1OOF A;  1XFX O;  3N7H A;  3GK1 A;  1XFY O;  3BJH A;  1YX8 A;  2Y4Q A;  4QJ5 B;  2RGI A;  1DEK A;  1QAS A;  3DVJ A; 
#chains in the Genus database with same CATH homology
 1NPQ A;  1RTP 1;  1LA0 A;  1REC A;  4I5J A;  3ICB A;  3SG6 A;  1QVI Y;  1S26 D;  5DKR A;  3F45 A;  3BUN B;  5B8I B;  1KK8 C;  5HLO A;  1FF1 A;  4M2Q A;  4UPG A;  2M7L A;  1JFJ A;  2LP3 A;  1FI6 A;  1NCY A;  1EH2 A;  1SRA A;  1WY9 A;  2LNK A;  2M8U A;  3I5I B;  1SCV A;  3TS5 C;  4DUQ A;  4GBA A;  1Y0V H;  1RRO A;  2L0P A;  2D8N A;  1DJI A;  2Q4U A;  1QJT A;  2JZI A;  1A2X A;  1B8L A;  2K7C A;  4N1G A;  2LHL A;  1QAT A;  3AKA A;  1Q80 A;  4YGD B;  3MSE B;  3TDI A;  2NCP A;  5J3X A;  1F71 A;  1B9A A;  1WLM A;  3PN7 C;  4NDD A;  1F54 A;  2F2P A;  3CR4 X;  4NDC A;  1QS7 A;  1F55 A;  3EKJ A;  1QTX A;  1PK0 D;  2K7O A;  4MVF A;  3HCM A;  1BR1 B;  3BUO B;  2NZ0 A;  1CLM A;  2ZN9 A;  1UP5 A;  2LP2 A;  3CR5 X;  2I18 A;  3SIB A;  1NCZ A;  1Y1A A;  3I5F B;  3OHM B;  3WHU B;  2KYC A;  3M0W A;  1F70 A;  3OX5 A;  3DF0 B;  2KFG A;  1ALV A;  1K90 D;  2K2F A;  3O2P A;  2KI6 C;  1XFV O;  2LUC A;  5CSJ A;  3WNX B;  2KQY A;  2AUC A;  1GJY A;  4ICB A;  2LMT A;  4OV2 A;  2IS9 A;  1NX1 A;  3GK4 X;  1DF0 B;  1QX2 A;  3WXA A;  1J7R A;  2L4I A;  4GUK A;  3I5H C;  1JFK A;  1QIV A;  2BEC A;  4ORA B;  3FWC A;  3LK1 A;  1SPY A;  1DF0 A;  3FWB A;  2SAS A;  1DJZ A;  1Y6W A;  1XVJ A;  1DJG A;  4MZL A;  3LCP C;  2KI4 B;  1AUI B;  2JNF A;  1KQM C;  1DGU A;  2ZN8 A;  5FYX A;  3LK0 A;  2LHI A;  1DVI A;  4MLW A;  5GQQ C;  1L2O B;  1M46 A;  1XO5 A;  3AAK A;  2I7A A;  3CLN A;  3TUY B;  5CPV A;  3JVT B;  1NX2 A;  1BT6 A;  2LVJ A;  1XFZ O;  2L98 A;  1ZUZ A;  5CSN A;  2MBX A;  5K89 A;  3CGA A;  3NSK A;  2FCE A;  3ZNI A;  1OZO A;  2K2A A;  4OKH A;  4CFQ A;  4USL A;  1CDP A;  1J55 A;  1B7T Y;  1KCY A;  1CTR A;  2BL0 C;  3HX4 A;  5HLV A;  1TNW A;  1J1D A;  2LAN A;  2V53 A;  1RK9 A;  1DGV A;  5G08 A;  1S5G Z;  4E68 A;  2JWW A;  2LLS A;  2KOT A;  2ZND A;  1KK7 Z;  1DJH A;  4R1E A;  1TNX A;  2PAL A;  5ER4 X;  1ZFS A;  2JXL A;  3D10 A;  2G9B A;  5DKN A;  2OS8 B;  1SNL A;  5KU1 A;  3SG7 A;  1TRF A;  1BJF A;  5HKW A;  2KGB C;  5CSI A;  1KQV A;  1W7J B;  2E6W A;  4TNC A;  1NYA A;  1YRT B;  2WOR A;  2K8M B;  1JUO A;  1YR5 A;  2LVV A;  1QV0 A;  1EJ3 A;  2BKI B;  3OB1 B;  1SL7 A;  1YUS A;  1PAL A;  2LV7 A;  1JF2 A;  3LLE A;  1OMD A;  4JPZ B;  3SIA A;  1QV1 A;  2NXQ A;  1BOC A;  2JT3 A;  1MR8 A;  1XA5 A;  2CNP A;  1SR6 C;  2BCA A;  4ORC B;  2I2R E;  3RM1 A;  1PVA A;  1OOJ A;  2ISD A;  4FTG A;  2FOT A;  4YI9 A;  1S6J A;  3FIA A;  2Y1M A;  4MRX A;  2M3W A;  1G4Y R;  2M9G A;  1CLB A;  2LAP A;  1KK8 B;  3IQO A;  2JOJ A;  3BYA A;  1IG5 A;  1A75 A;  1BLQ A;  3TS5 B;  3EVR A;  1MUX A;  1RJV A;  2K7D A;  4HRH A;  4PE1 A;  1KSO A;  4QJ3 B;  1AP4 A;  2QAC A;  1F4O A;  2ZNE A;  2GV5 A;  1S36 A;  3DD4 A;  5BPJ A;  1DTL A;  3D0Y A;  3JTD C;  1CFP A;  1GQM A;  1K8U A;  4F0Z B;  2O60 A;  3TDZ A;  1KFX S;  2F3Y A;  1YUT A;  3PN7 B;  1KSM A;  3EVV A;  2OPO A;  5HKY A;  1LXF C;  3PLF B;  4WRI A;  5KTY A;  1S3P A;  1A03 A;  1PVB A;  2KSP A;  4M2O A;  1EXR A;  1BMO A;  4C0L A;  1ALW A;  1D1O A;  2OTG C;  1AJ4 A;  4C0K A;  2BBM A;  3EVU A;  2LLU A;  1YX7 A;  3O78 A;  2K7B A;  4ZCU A;  2HET A;  1NX0 A;  3VRO A;  2CBL A;  3AAJ A;  1IJ6 A;  4AQJ A;  3GOF A;  1SBJ A;  2L5X B;  5PAL A;  4GFT A;  2NLN A;  3ZWH A;  2HQ8 A;  4NQG A;  1J7Q A;  3PAT A;  3CTN A;  1IGV A;  1SK6 D;  2EHB A;  4JWQ A;  1SW8 A;  2A4J A;  1HT9 A;  5I2L A;  1AHR A;  2M0R A;  1OZS A;  2FCD A;  1CDN A;  2BBN A;  1BU3 A;  3BOW B;  5HKZ A;  1CFD A;  3PAL A;  4DS7 A;  1LA3 A;  4PHM A;  3SJS A;  3I5H B;  1SL9 A;  2TN4 A;  3BOW A;  4YBH B;  2LVK A;  1Y1X A;  1K95 A;  2KFF A;  4A4C A;  2Q91 A;  2F8P A;  3KO0 A;  3SG4 A;  1KFX L;  4YI8 A;  1CFF A;  1PSR A;  5F6T A;  1KQM B;  4NDB A;  2H61 C;  2KI6 D;  5CSF A;  4GNK B;  1YRU B;  2HPS A;  4I5K A;  1UUS A;  4N5X A;  2MHH A;  1DJX A;  4OCI A;  1KWO C;  4HSZ A;  1SYM A;  2JC2 A;  3BUM B;  4PCW A;  1MWN A;  1U5I A;  2LMV A;  1C07 A;  2PSR A;  1G33 A;  2PAS A;  3IQQ A;  1IJ5 A;  1RFJ A;  1WRZ A;  2L51 A;  1C7V A;  2LCP A;  1YVH A;  4PHK A;  2JQ6 A;  4XYN A;  2ZKM X;  2FJU B;  3EK8 A;  3VGO A;  2BL0 B;  1E8A A;  1NCX A;  2LVI A;  3DVM A;  1QIW A;  1JC2 A;  2P6B B;  1TN4 A;  2KBM A;  1FBV A;  1OSA A;  4CID A;  1EG3 A;  1SCM C;  4FQO A;  3EK4 A;  3NSI A;  3KPX A;  2F2O A;  2JT8 A;  2KFH A;  1UWO A;  1IQ5 A;  1ODB A;  1QLK A;  4OVN F;  3A8R A;  1B47 A;  1B8C A;  4PE0 A;  1JBA A;  3SG2 A;  2O5G A;  3TDU A;  4MZJ A;  1B8R A;  1MQ1 A;  2HQW A;  2KQ6 A;  1WDC C;  1NP8 A;  1G8I A;  4ORB B;  2HF5 A;  2VRG A;  1S5G Y;  1TNP A;  2MAZ A;  2MLE C;  1XFU O;  1CB1 A;  5I2Q A;  1K9U A;  2PMY A;  1M63 B;  1WLZ A;  4WQ3 A;  1ZMZ A;  1SR6 B;  3LL8 B;  2JTZ A;  5ER5 A;  4P2Y B;  1NSH A;  2JTT A;  1TIZ A;  1IQ3 A;  1UHJ A;  2LC5 A;  2PRU A;  3CR2 A;  3VRP A;  1NUB A;  2CT9 A;  1CM1 A;  3IF7 A;  1B1G A;  1BR4 B;  1N65 A;  1DJW A;  1QXP A;  2K61 A;  5HYD A;  1K93 D;  2WCF A;  1A75 B;  2MJW B;  2ZRS A;  1Y1U A;  3I5G C;  1JF0 A;  3NXA A;  2K0J A;  1YTZ C;  1PUL A;  1XFW O;  2KBI A;  2GGM A;  1YVL A;  2M49 B;  2M1K B;  1IH0 A;  1TCO B;  4Q04 A;  1FW4 A;  2DOQ A;  3SG3 A;  1IRJ A;  1QVI Z;  2EC6 C;  3D0Y B;  1CNP A;  4PHN A;  4PAL A;  5KSZ A;  1NWD A;  2E30 A;  3NSO A;  2LLT A;  4XJK B;  4C0J A;  1TCF A;  3JTD B;  2JXC A;  3DVE A;  1CLL A;  3EK7 A;  3CS1 A;  3RLZ A;  3BXK A;  4MZK A;  3E3R A;  4XJK A;  4YGC B;  3O4Y A;  1LIN A;  4CLN A;  4DRW A;  1KFU S;  1AK8 A;  2PVB A;  4PHJ A;  2JPT A;  2MRD A;  1AJ5 A;  1RWY A;  3VRN A;  3CWG A;  2JNX A;  1M45 A;  1CDL A;  1CMG A;  4MBE A;  1J1E A;  1VRK A;  2BKH B;  1B4C A;  1M39 A;  3I5I C;  3KF9 A;  1V1F A;  2F33 A;  1UUR A;  1IKU A;  1H8B A;  1FPW A;  2F3Z A;  3C1V A;  2OTG B;  3GK2 A;  1N2D A;  4GAO A;  4YRU A;  4L9M A;  3EKH A;  2CXJ A;  1K94 A;  1R6P A;  1K9P A;  2ZFD A;  5AEQ A;  5I2O A;  1GGW A;  1K2H A;  2B1U A;  4BY5 A;  2KYF A;  2WND A;  5TNC A;  1FI5 A;  3O6B A;  1SKT A;  1YUR A;  1PRW A;  1MXE A;  1NIW A;  3BQ3 A;  1L7Z A;  3KEV A;  1UHH A;  2M97 A;  4AQI A;  1CFC A;  5JOL A;  1AVS A;  1WRK A;  1JSA A;  3QRX A;  4PDZ A;  2H2K A;  1CDM A;  1LVC D;  1N0Y A;  4N1F A;  1CKK A;  1R2U A;  1LKJ A;  1SL8 A;  4M2P A;  2BE4 A;  1BF5 A;  3BUW B;  5AER A;  1K96 A;  1S6C A;  2CTN A;  2EGD A;  4YGE B;  4D1E A;  4MEW A;  4GPL B;  3I5F C;  1KFU L;  2L4H A;  4I5N B;  1UHN A;  3OB2 B;  1V1G A;  2L50 A;  2LUX A;  4I5L B;  4GGN A;  2KAV A;  1TOP A;  4PE4 A;  1U5I B;  3OP0 A;  1KWO B;  2BCX A;  2BE6 A;  2SCP A;  1W7I B;  2H61 A;  3DF0 A;  5JJG A;  2M1U A;  1MF8 B;  5AFP A;  2CCM A;  2WCE A;  2WCB A;  5DKQ A;  3SG5 A;  1OQP A;  2Y5I A;  2M7N A;  3DVK A;  1TTX A;  1JWD A;  1GGZ A;  1A4P A;  1DJY A;  1TNQ A;  1S1E A;  4OR9 B;  2JU0 A;  2JT0 A;  1BG1 A;  1QX5 B;  1YUU A;  1S6I A;  1XYD A;  4HRG A;  2JUL A;  2LMU A;  1CM4 A;  4CPV A;  5IBW A;  2KI4 C;  1F8H A;  1H4B A;  2MLF C;  4YGB B;  4PE7 A;  4QJ4 B;  2AAO A;  3PSR A;  1NX3 A;  2AMI A;  2MA2 A;  1ZOT B;  1SCM B;  3KHE A;  1B7T Z;  3TZ1 A;  3WHT B;  2LM5 A;  4DIR A;  3A4U B;  1DT7 B;  4HRE E;  1PSB A;  1L2O C;  1K9K A;  2KAX A;  2WC8 A;  4MSP A;  4BY4 A;  3K21 A;  1SY9 A;  3TUY C;  3JVT C;  5D7F A;  1F4Q A;  1WDC B;  4WQ2 A;  1MHO A;  1QX7 A;  1ZAC A;  2BCB A;  3FS7 A;  1X02 A;  1UHI A;  4ETO A;  1HQV A;  1J7O A;  2M29 A;  2KAY A;  1KK7 Y;  3H4S E;  4P5O E;  2I94 A;  1IWQ A;  2GGZ A;  4GGF C;  4ZCV A;  5I8N A;  4A4B A;  1CMF A;  3NSL A;  4DCK A;  1DMO A;  1SMG A;  1XK4 C;  2KNE A;  4GGF A;  1J7P A;  1QLS A;  1BOD A;  1M31 A;  3PFV A;  4JQ0 D;  2JRF A;  1XK4 A;  2COL B;  2OS8 C;  3VRR A;  2LE9 B;  4MRY A;  1EL4 A;  2KHN A;  2WOS A;  3PM8 A;  2ZRT A;  3OX6 A;  4CFR A;  2QPT A;  5AXI A;  3I5G B;  3AKB A;  4AOM A;  3VRQ A;  2KGR A;  4MN0 A;  5AAN A;  2KDH A;  4YGA A;  4U8D A;  1MXL C;  2G2B A;  5D69 A;  1UHK A;  1OMR A;  2EC6 B;  1A29 A;  1WRL A;  4IL1 A;  2Y1N A;  2R2I A;  1EG4 A;  2NCO A;  3BUX B;  2L2E A;  1OE9 B;  1OMV A;  1C7W A;  1XFX O;  3GK1 A;  1XFY O;  1YX8 A;  2Y4Q A;  4QJ5 B;  2RGI A;  3CZT X;  1QAS A;  3DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...