1WDCB

Scallop myosin regulatory domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCALLOP MYOSIN
publication title Structure of the regulatory domain of scallop myosin at 2 A resolution: implications for regulation.
pubmed doi rcsb
molecule tags Muscle protein
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1996-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcB02
1KWOB 2WCBA 1DT7B 1J7OA 1SMGA 1V1GA 2JOJA 2LVIA 1L2OB 1OZSA 4YGCB 3TUYB 1F8HA 1PSBA 3GK2A 2WCEA 3OHMB 4ETOA 5IBWA 1CNPA 2AAOA 2JWWA 1SL7A 2MA2A 1XFVO 1V1FA 3H4SE 5HLVA 3PATA 3VRRA 5TNCA 2KI6D 1JC2A 4N5XA 2BE6A 2G2BA 4L9MA 2KFGA 5ER4X 2K7BA 2KYFA 3GK1A 2PALA 1IH0A 2I7AA 4ZCVA 2LHLA 5DKNA 1KK8B 2QPTA 4TNCA 2LVKA 1A4PA 1QTXA 3I5IC 2BL0C 2LLUA 5J3XA 1QVIZ 4R1EA 2LANA 3CGAA 1KFXL 4JQ0D 1QIWA 2NCOA 2Q4UA 1Y1XA 4MZJA 1SBJA 1TTXA 1XFWO 3PN7B 3O4YA 1CM4A 1SCMB 3BUNB 1JFKA 1NP8A 2M7LA 3OX5A 3BYAA 4PHNA 1OSAA 1XFZO 3SJSA 1CFCA 2L5XB 1XO5A 2JPTA 2KFFA 3BUWB 1LA3A 2BE4A 1RK9A 1CB1A 1DJZA 2HQ8A 1PK0D 1M31A 2ZFDA 1R6PA 5CSJA 5HLOA 2A4JA 1S6IA 4M2PA 2WC8A 3EVRA 4I5JA 2L0PA 3CLNA 3AKAA 2KAYA 1RECA 1PULA 1KSMA 1YRUB 4U8DA 3VGOA 1F71A 3D0YB 1XFXO 1LKJA 2HPSA 2PRUA 1A2XA 2ZRSA 1B8RA 1OMDA 2Q91A 2VRGA 5HKZA 1KFUS 1RTP1 2KAXA 5G08A 1SY9A 4BY4A 1B1GA 1XFYO 4YI9A 1EG3A 1DJHA 1IG5A 1K96A 1CLMA 1S6CA 2OTGC 2ZN8A 4YGDB 4CFQA 1M63B 4GPLB 1XA5A 1M46A 4DS7A 2M1UA 5I2OA 2PASA 2FCDA 2MJWB 4NDDA 1ALWA 1BG1A 2GGZA 2KQYA 3FWCA 1KFXS 1PVBA 4MLWA 1TNXA 4MEWA 2LUCA 1IRJA 2M97A 4XJKB 1H4BA 1A29A 2OS8C 4PALA 1JF2A 1XVJA 1IGVA 1U5IA 3BOWA 2EC6B 2BL0B 1WLZA 2WORA 5B8IB 2CNPA 2I2RE 1XYDA 4MVFA 5DKQA 2WCFA 2L98A 1K9PA 1GJYA 5BPJA 1FW4A 2CBLA 1EH2A 3GOFA 1R2UA 1WRLA 1OQPA 4N1GA 5CSIA 2BKIB 1AJ5A 1NWDA 1TNPA 3O2PA 4GNKB 3FIAA 1WY9A 1RROA 1S3PA 3SG5A 2L4HA 2JTZA 1YX8A 4AQJA 4P5OE 2KI6C 1N2DA 3RLZA 1IWQA 4YBHB 1IJ6A 1SRAA 4GBAA 1QLSA 1OMRA 2HF5A 3LLEA 2M49B 4XYNA 1KQMC 4P2YB 1N65A 1IQ5A 2AMIA 2LLSA 2NCPA 2H2KA 1UHNA 2BCXA 2KDHA 2I18A 5CSFA 1AK8A 2LMUA 4HRGA 4A4CA 4MN0A 1CDMA 5AERA 3NSOA 5I2QA 3PLFB 4DUQA 1TCFA 1KK7Z 3SG6A 2M0RA 2M3WA 1BOCA 2MAZA 3OX6A 3VROA 1CLBA 4IL1A 4YGEB 2SCPA 3NSLA 1ZFSA 3CTNA 1SPYA 2K2FA 3O78A 2L2EA 2LNKA 2F3YA 1NCYA 2K2AA 3TDZA 1FF1A 2JT8A 1WLMA 2JNXA 2JTTA 2R2IA 4MSPA 4MZLA 4CIDA 1K95A 4ORBB 1BR4B 2WOSA 1QIVA 3PALA 2M8UA 1JUOA 2LUXA 2OTGB 3WNXB 1KQVA 2M9GA 3OP0A 2JU0A 1XFUO 3PSRA 3PM8A 1DVIA 1QX2A 1TCOB 4D1EA 1UHJA 1K90D 1C7VA 4NQGA 1S36A 1Y6WA 2AUCA 2LP2A 2V53A 1NX1A 1J1DA 1JFJA 4OR9B 4YI8A 1KSOA 1CDNA 4PE0A 1Y0VH 3RM1A 3EKJA 4BY5A 1SCVA 2OS8B 3PFVA 2F3ZA 1B7TZ 2KGRA 1QV0A 1DF0B 1JF0A 3NSIA 4GAOA 1F4QA 1AP4A 1GGZA 1YX7A 1B8CA 3DVEA 5HKYA 3SG4A 1K93D 2M7NA 1EXRA 1MXEA 4GGFC 2MBXA 1MR8A 1SKTA 3WHUB 2KNEA 1QLKA 2LAPA 3CR4X 2FOTA 1S1EA 3LK1A 1BF5A 4UPGA 3TS5B 1QATA 1CMGA 1IQ3A 3ZNIA 1NX3A 2CXJA 4FQOA 2KFHA 2K0JA 2LE9B 2LLTA 3O6BA 2H61A 2KYCA 2I94A 1KQMB 1UHKA 1AUIB 2K7OA 4PE1A 3AAKA 5JOLA 1QVIY 1B47A 1OMVA 1SW8A 2KI4B 4WRIA 1CFFA 1G8IA 1TNQA 2MHHA 1MUXA 1YUTA 2KBIA 4C0KA 1WDCC 3ICBA 2CCMA 4QJ5B 1K94A 3JTDC 3TZ1A 4ORAB 1ZMZA 1RWYA 1SK6D 1NCZA 1UHHA 3DF0B 4NDCA 1QASA 2RGIA 3FS7A 1LINA 3I5HC 2EHBA 4CFRA 1TN4A 1B7TY 4DIRA 3I5GC 2JC2A 2BECA 2K8MB 1FPWA 5D7FA 4MRYA 3A8RA 1CKKA 1S26D 4I5NB 2BKHB 3IQQA 1UUSA 5GQQC 4MZKA 1J1EA 3BOWB 4ZCUA 3I5FC 1TOPA 2JULA 2L50A 3I5IB 3TDIA 1KK8C 2JZIA 4PCWA 1ZOTB 2MRDA 2LMTA 4YGAA 1CDLA 4ICBA 4OKHA 1CFPA 1D1OA 1UHIA 5AXIA 1LA0A 1YRTB 4JPZB 1ZUZA 1W7JB 5ER5A 1AVSA 3SG3A 3GK4X 4WQ3A 1KCYA 5DKRA 1BR1B 2EGDA 4M2OA 3IF7A 1F4OA 1NCXA 3MSEB 1A75B 1H8BA 2H61C 2L51A 1W7IB 3CZTX 2Y1MA 1C07A 1NX0A 1OE9B 1MQ1A 4ORCB 4MRXA 2KOTA 1SNLA 4OCIA 2LMVA 1GQMA 2LVVA 2COLB 3HCMA 2BBNA 3IQOA 3K21A 3AAJA 3DD4A 5I8NA 2CTNA 3JVTC 1Y1AA 4M2QA 1F54A 1TIZA 1QX7A 3KHEA 3VRNA 4C0JA 1M39A 1ODBA 4AOMA 1N0YA 3F45A 2P6BB 3EVVA 2GV5A 1YTZC 2L4IA 3OB2B 1PRWA 2NLNA 5KSZA 3BXKA 1SYMA 1IKUA 5HKWA 2ISDA 3SIAA 1Y1UA 5PALA 2LC5A 1IJ5A 1WDCB 3EK4A 2F33A 2PSRA 2TN4A 1DJYA 2LCPA 2OPOA 3BUMB 3JTDB 5JJGA 1K9KA 2F8PA 1EL4A 1QX5B 1OZOA 4QJ4B 2BCAA 2Y1NA 1TNWA 2ZRTA 3I5HB 4GFTA 1DJWA 3VRPA 1JWDA 3KF9A 4GGNA 1NUBA 1SR6C 1NX2A 3KPXA 1WRZA 3I5GB 5K89A 1CLLA 3NSKA 1YUUA 2SASA 1CFDA 2JT0A 1BT6A 3CR2A 4PHKA 1JBAA 2E30A 1KFUL 2JXCA 2JXLA 1EG4A 1VRKA 1MHOA 5CSNA 2LM5A 3HX4A 3LK0A 3TDUA 1YVHA 2Y5IA 2E6WA 2NXQA 3BQ3A 1WRKA 3I5FB 2K7CA 4PDZA 1KK7Y 4PHMA 4WQ2A 2KGBC 1J55A 4YGBB 2LHIA 2EC6C 5KTYA 1F55A 1NYAA 5KU1A 3SG7A 2PMYA 3VRQA 1CTRA 1BODA 1XK4A 2NZ0A 2JQ6A 5AANA 2LP3A 1UURA 1F70A 2DOQA 1DTLA 2KHNA 3OB1B 3KO0A 3KEVA 1YURA 1S5GZ 1Q80A 2JRFA 4I5KA 3EVUA 1K8UA 5AEQA 3NXAA 3EKHA 4FTGA 4HSZA 1BMOA 2FJUB 1K2HA 2CT9A 3LCPC 3D10A 1DF0A 1QXPA 1ZACA 1E8AA 4CPVA 4PHJA 4E68A 1QS7A 1HQVA 1NIWA 1A03A 1J7PA 2G9BA 3C1VA 1C7WA 2GGMA 2QACA 1HT9A 4OV2A 3WHTB 2IS9A 3JVTB 4YRUA 1KWOC 1B9AA 4N1FA 1DGVA 2FCEA 1L2OC 1LVCD 2BBMA 3TUYC 2HQWA 1PSRA 2JNFA 2KQ6A 1X02A 4AQIA 3CWGA 1DGUA 3D0YA 1MWNA 1B8LA 4F0ZB 1DMOA 1G33A 1PALA 4CLNA 1UP5A 1YR5A 5I2LA 4PE4A 2Y4QA 2O60A 1QV1A 4DCKA 3M0WA 1JSAA 1QJTA 5CPVA 4MBEA 3ZWHA 1YUSA 1OOJA 1GGWA 1S6JA 5F6TA 1BLQA 1K9UA 1U5IB 5FYXA 1J7QA 3EK8A 4Q04A 2B1UA 3EK7A 5AFPA 1S5GY 1MF8B 3DF0A 2LVJA 1SR6B 4HREE 1AJ4A 2O5GA 1BJFA 2K61A 1XK4C 4QJ3B 2ZNDA 3CS1A 4C0LA 3SIBA 1LXFC 1CM1A 2BCBA 2HETA 3A4UB 1NPQA 1FBVA 3PN7C 1B4CA 2MLFC 3QRXA 1SCMC 3BUXB 3E3RA 5HYDA 1L7ZA 4XJKA 1FI5A 1EJ3A 4NDBA 2KSPA 3DVKA 4OVNF 4DRWA 2F2PA 3SG2A 1CDPA 4USLA 2F2OA 4JWQA 2JT3A 2ZN9A 1YVLA 2ZNEA 1CMFA 2ZKMX 1G4YR 1NSHA 1FI6A 2D8NA 5D69A 3LL8B 4PE7A 1AHRA 1DJXA 4HRHA 3CR5X 3DVMA 1TRFA 2KAVA 1MXLC 2LV7A 2MLEC 3DVJA 3TS5C 4A4BA 1UWOA 1BU3A 1ALVA 2M1KB 3BUOB 1DJIA 1A75A 1SL8A 2KBMA 1SL9A 1RFJA 2M29A 3AKBA 4GUKA 1PVAA 1M45A 2KI4C 2WNDA 2K7DA 3WXAA 1DJGA 1RJVA 4GGFA 2PVBA 4I5LB 1J7RA 3FWBA
chains in the Genus database with same CATH superfamily
3SS3A 1KWOB 3CZ1A 2WCBA 3R1VA 1DT7B 1J7OA 3PM2A 1SMGA 3NGVA 1V1GA 2JOJA 2LVIA 1L2OB 1OZSA 4YGCB 3TUYB 1F8HA 1PSBA 3GK2A 2WCEA 3OHMB 4ETOA 5IBWA 1CNPA 2AAOA 2JWWA 1SL7A 2MA2A 3UO9A 1XFVO 1V1FA 3H4SE 1DQEA 3PATA 5HLVA 3VRRA 5TNCA 2KI6D 1JC2A 4INWA 4N5XA 2BE6A 2G2BA 4L9MA 2KFGA 5ER4X 2K7BA 2KYFA 3GK1A 2PALA 3S0AA 2I7AA 4ZCVA 1IH0A 3S0FA 2LHLA 5DKNA 1KK8B 2QPTA 4TNCA 2LVKA 1A4PA 1QTXA 3I5IC 2BL0C 2LLUA 3BFAA 5J3XA 1QVIZ 4R1EA 2LANA 3CGAA 1KFXL 4JQ0D 1QIWA 2NCOA 2Q4UA 1Y1XA 1ORGA 4MZJA 1SBJA 1TTXA 1XFWO 3PN7B 3O4YA 1CM4A 1SCMB 3BUNB 1JFKA 1NP8A 2M7LA 3OX5A 3BYAA 4PHNA 1OSAA 1XFZO 3D75A 3SJSA 1CFCA 2L5XB 1XO5A 2JPTA 2KFFA 3BUWB 1LA3A 2BE4A 1RK9A 1CB1A 1DJZA 2HQ8A 1PK0D 1M31A 2ZFDA 1R6PA 3D73A 5CSJA 5HLOA 2A4JA 1C3YA 2BAPA 1S6IA 3Q8IA 4M2PA 2WC8A 3EVRA 4I5JA 2L0PA 3CLNA 3AKAA 2KAYA 1RECA 5I94A 1PULA 1KSMA 2P70A 1YRUB 4U8DA 3VGOA 1F71A 3D0YB 1XFXO 1LKJA 2WCLA 2WCHA 2HPSA 1TWOA 2PRUA 3FE6A 1A2XA 2ZRSA 1B8RA 1OMDA 2Q91A 2VRGA 5HKZA 1KFUS 1RTP1 2KAXA 5G08A 1SY9A 4BY4A 2GTEA 1B1GA 1XFYO 4YI9A 1EG3A 1DJHA 1IG5A 1K96A 1CLMA 1S6CA 2OTGC 2ZN8A 4YGDB 4CFQA 1M63B 4GPLB 1XA5A 1M46A 4DS7A 2M1UA 3B86A 5I2OA 2PASA 2FCDA 2MJWB 3L47A 1ALWA 4NDDA 1BG1A 2GGZA 2KQYA 3FWCA 1KFXS 3NHTA 1PVBA 5HL1A 4MLWA 1TNXA 3CDNA 4MEWA 2LUCA 1IRJA 5FI2A 2M97A 4XJKB 1H4BA 1A29A 2WC5A 2OS8C 1XFRA 2L2CA 4PALA 1JF2A 1XVJA 1IGVA 1U5IA 3BOWA 1DC1A 2EC6B 2BL0B 1WLZA 2WORA 5B8IB 2CNPA 2I2RE 1XYDA 4MVFA 5DKQA 2WCFA 2L98A 1K9PA 1GJYA 5BPJA 1FW4A 2CBLA 1EH2A 3GOFA 1R2UA 1WRLA 2H8VA 1OQPA 3R1PA 4N1GA 5CSIA 2BKIB 1AJ5A 1NWDA 1TNPA 3O2PA 4GNKB 3FIAA 1WY9A 1RROA 1S3PA 3SG5A 2L4HA 2JTZA 1YX8A 3L4AA 4AQJA 4P5OE 2KI6C 1N2DA 3RLZA 1IWQA 4YBHB 1IJ6A 1SRAA 4GBAA 1QLSA 1OMRA 3L4LA 2HF5A 2WCJA 2M49B 3LLEA 1KQMC 4XYNA 4P2YB 1N65A 1IQ5A 2AMIA 2LLSA 2NCPA 3UNWA 2H2KA 1UHNA 2BCXA 2KDHA 2I18A 5CSFA 1AK8A 2LMUA 4HRGA 5FI7A 4A4CA 3QMEA 1CDMA 4MN0A 2JPOA 3NSOA 3S0EA 3PLFB 5AERA 4DUQA 1TCFA 3SS5A 5I2QA 3PJIA 1KK7Z 3SG6A 2M0RA 2M3WA 1BOCA 2MAZA 2P71A 3OX6A 4JKTA 3VROA 1CLBA 4IL1A 4YGEB 2SCPA 3NSLA 1ZFSA 1T14A 1SPYA 3CTNA 2K2FA 3O4XA 2L2EA 3O78A 2KPHA 2LNKA 2F3YA 1NCYA 2K2AA 3TDZA 1FF1A 2JT8A 1WLMA 2ERBA 2JTTA 2JNXA 2R2IA 4MSPA 4MZLA 3V2LA 3SS4A 4CIDA 1K95A 4ORBB 3B87A 1BR4B 2WOSA 1QIVA 3PALA 2M8UA 1JUOA 2LUXA 2OTGB 3WNXB 1KQVA 2M9GA 3OP0A 2JU0A 1XFUO 3PSRA 3PM8A 1DVIA 1QX2A 1TCOB 4D1EA 1UHJA 1K90D 1C7VA 4NQGA 1S36A 1Y6WA 2AUCA 2LP2A 2V53A 1NX1A 1J1DA 4FQTA 1JFJA 3FE9A 4OR9B 4YI8A 1KSOA 1CDNA 4PE0A 1Y0VH 3RM1A 3EKJA 4BY5A 1SCVA 2OS8B 3PFVA 2F3ZA 1B7TZ 1IIOA 2KGRA 3CZ0A 1QV0A 1DF0B 1JF0A 3NSIA 4GAOA 1F4QA 1AP4A 1GGZA 1YX7A 1B8CA 3DVEA 5HKYA 3SG4A 1K93D 2M7NA 1EXRA 1MXEA 4GGFC 2MBXA 1MR8A 1SKTA 3WHUB 2KNEA 1QLKA 2LAPA 3CR4X 3R1OA 4F7FA 2FOTA 1S1EA 1P28A 3LK1A 1BF5A 4UPGA 3TS5B 1QATA 1CMGA 1IQ3A 3ZNIA 1NX3A 2CXJA 4FQOA 2KFHA 2K0JA 2LE9B 2LLTA 3O6BA 2H61A 2KYCA 2I94A 1KQMB 1UHKA 1AUIB 2K7OA 4PE1A 3AAKA 5JOLA 3BJHA 1QVIY 1B47A 1OMVA 1SW8A 2KI4B 4WRIA 1CFFA 1G8IA 1TNQA 2K60A 2MHHA 1MUXA 1YUTA 2KBIA 4C0KA 1WDCC 3ICBA 2CCMA 3VB1A 4QJ5B 1K94A 3JTDC 3TZ1A 4ORAB 1ZMZA 1RWYA 1SK6D 3B88A 1NCZA 1UHHA 3DF0B 5FI6A 4NDCA 1QASA 2RGIA 3FS7A 1LINA 3I5HC 2EHBA 4CFRA 1TN4A 1Z4HA 1B7TY 4DIRA 1OOHA 3I5GC 2JC2A 3S0GA 2BECA 2K8MB 1OW4A 5D7FA 1FPWA 4MRYA 3A8RA 1CKKA 1S26D 4I5NB 2BKHB 3IQQA 1Z2CB 1UUSA 5GQQC 4MZKA 1J1EA 4KYNA 3BOWB 4ZCUA 3I5FC 1TOPA 2WCMA 1DEKA 2JULA 1OOFA 2L50A 3I5IB 3TDIA 1KK8C 2JZIA 4PCWA 1ZOTB 2MRDA 2LMTA 4YGAA 1CDLA 4ICBA 4OKHA 1CFPA 4JD9A 1D1OA 1UHIA 5AXIA 1LA0A 1YRTB 4JPZB 1ZUZA 1W7JB 5ER5A 1AVSA 3N7HA 3SG3A 3GK4X 3BFHA 4WQ3A 1KCYA 5DKRA 1BR1B 2EGDA 4M2OA 2WCKA 3IF7A 1F4OA 1NCXA 3CZ2A 3MSEB 1A75B 1H8BA 2H61C 2L51A 1W7IB 3CZTX 2Y1MA 3R72A 1C07A 1NX0A 1OE9B 3DZTA 1MQ1A 4ORCB 4MRXA 2KOTA 3D76A 1SNLA 4OCIA 4OZDA 2LMVA 2FJYA 1GQMA 2LVVA 2COLB 3HCMA 2BBNA 3IQOA 3K21A 3AAJA 3DD4A 3OBVA 5I8NA 2CTNA 3JVTC 1Y1AA 1W9ZA 4M2QA 1F54A 2YGUA 1TIZA 1QX7A 3KHEA 3VRNA 2KLDA 4C0JA 1M39A 1ODBA 4AOMA 1N0YA 3F45A 2P6BB 3EVVA 2GV5A 1OOIX 1YTZC 3D78A 2KLEA 2L4IA 3OB2B 1PRWA 2NLNA 5KSZA 3BXKA 1SYMA 1IKUA 5HKWA 2ISDA 3SIAA 2QDIA 1Y1UA 3IVTA 2LC5A 1IJ5A 1WDCB 3EK4A 5PALA 2F33A 2PSRA 2TN4A 3B7AA 1DJYA 2LCPA 2OPOA 3BUMB 3JTDB 5JJGA 1K9KA 2F8PA 1EL4A 1QX5B 1OZOA 4QJ4B 2BCAA 2Y1NA 1TNWA 2ZRTA 3I5HB 4GFTA 1DJWA 3VRPA 1JWDA 3KF9A 4GGNA 1NUBA 1SR6C 1NX2A 3KPXA 1WRZA 3I5GB 5K89A 1CLLA 3NSKA 1YUUA 2SASA 1CFDA 2JT0A 1BT6A 3CR2A 4PHKA 1JBAA 2E30A 1KFUL 2JXCA 2JXLA 1EG4A 1VRKA 1MHOA 5CSNA 2LM5A 2PQLA 3OGNA 3HX4A 3LK0A 3TDUA 1YVHA 2Y5IA 2E6WA 2NXQA 3BQ3A 3K1EA 1WRKA 3I5FB 2K7CA 4PDZA 2L5YA 1KK7Y 2QEOA 4PHMA 4WQ2A 2KGBC 1J55A 4YGBB 2LHIA 4PT1A 2EC6C 5KTYA 1F55A 1NYAA 5KU1A 2BNXA 5DICA 3SG7A 2PMYA 3VRQA 1CTRA 1BODA 1XK4A 2NZ0A 2JQ6A 5AANA 2LP3A 1UURA 4INXA 1F70A 2DOQA 1DTLA 2KHNA 3OB1B 2WC6A 3KO0A 3KEVA 1SSEB 1YURA 1S5GZ 1Q80A 2JRFA 4I5KA 1DELA 3EVUA 1K8UA 5AEQA 3NXAA 3EKHA 4FTGA 3EG5B 4HSZA 1BMOA 2FJUB 3RZSA 1K2HA 2CT9A 3LCPC 3D10A 1DF0A 1QXPA 3DY9A 3DXLA 1ZACA 1E8AA 3D77A 4CPVA 4PHJA 4E68A 1QS7A 1HQVA 1NIWA 1A03A 1J7PA 2G9BA 3C1VA 1C7WA 2GGMA 2QACA 1HT9A 4OV2A 3WHTB 2IS9A 3JVTB 4YRUA 1KWOC 1B9AA 4N1FA 1DGVA 2FCEA 1L2OC 1LVCD 2BBMA 3TUYC 2HQWA 1PSRA 2JNFA 1QWVA 2KQ6A 1X02A 4AQIA 3CWGA 1DGUA 3D0YA 1MWNA 1B8LA 4F0ZB 1DMOA 2QEHA 1G33A 1PALA 4CLNA 1UP5A 1OOGA 1YR5A 5I2LA 4PE4A 2Y4QA 2O60A 1QV1A 4DCKA 3M0WA 3DYEA 1QJTA 1JSAA 5CPVA 4MBEA 3ZWHA 1YUSA 1OOJA 1GGWA 1S6JA 5F6TA 1BLQA 1K9UA 1U5IB 5FYXA 1J7QA 2PYQA 3EK8A 4Q04A 2B1UA 3EK7A 5AFPA 1S5GY 1MF8B 3DF0A 2LVJA 1SR6B 4HREE 1AJ4A 2O5GA 1BJFA 3S0BA 2K61A 3NHIA 1XK4C 2QEVA 2ZNDA 3CS1A 4QJ3B 4C0LA 3SIBA 1LXFC 1CM1A 2BCBA 2HETA 3A4UB 1NPQA 1FBVA 3PN7C 5D3OA 1B4CA 2MLFC 3QRXA 1SCMC 3BUXB 3B6XA 1C3ZA 3E3RA 5HYDA 1L7ZA 4XJKA 1LS8A 3D74A 1EJ3A 1FI5A 4NDBA 5EL2A 2KSPA 3DVKA 4OVNF 4DRWA 2F2PA 3SG2A 1CDPA 2QEBA 4USLA 3FE8A 2F2OA 4IJ7A 4JWQA 2JT3A 2ZN9A 1YVLA 2ZNEA 1CMFA 2ZKMX 1G4YR 1NSHA 1FI6A 2D8NA 5D69A 1TUZA 3LL8B 4PE7A 1AHRA 1DJXA 3CABA 4HRHA 3CR5X 3DVMA 1TRFA 3CYZA 2KAVA 1MXLC 2LV7A 2MLEC 3DVJA 3TS5C 4A4BA 1UWOA 1BU3A 3BFBA 1ALVA 2M1KB 3BUOB 1DJIA 1A75A 3S0DA 1GM0A 1SL8A 2KBMA 1SL9A 1RFJA 2M29A 3AKBA 4GUKA 1PVAA 1M45A 1TUJA 2KI4C 2WNDA 2K7DA 3WXAA 1DJGA 1RJVA 4GGFA 2PVBA 4I5LB 1J7RA 3FWBA
chains in the Genus database with same CATH topology
1KWOB 2WCBA 1DT7B 1J7OA 1SMGA 1V1GA 2JOJA 2LVIA 1L2OB 1OZSA 4YGCB 3TUYB 1F8HA 1PSBA 3GK2A 2WCEA 3OHMB 4ETOA 5IBWA 1CNPA 2AAOA 2JWWA 1SL7A 2MA2A 1XFVO 1V1FA 3H4SE 5HLVA 3PATA 3VRRA 5TNCA 2KI6D 1JC2A 4N5XA 2BE6A 2G2BA 4L9MA 2KFGA 5ER4X 2K7BA 2KYFA 3GK1A 2PALA 1IH0A 2I7AA 4ZCVA 2LHLA 5DKNA 1KK8B 2QPTA 4TNCA 2LVKA 1A4PA 1QTXA 3I5IC 2BL0C 2LLUA 5J3XA 1QVIZ 4R1EA 2LANA 3CGAA 1KFXL 4JQ0D 1QIWA 2NCOA 2Q4UA 1Y1XA 4MZJA 1SBJA 1TTXA 1XFWO 3PN7B 3O4YA 1CM4A 1SCMB 3BUNB 1JFKA 1NP8A 2M7LA 3OX5A 3BYAA 4PHNA 1OSAA 1XFZO 3SJSA 1CFCA 2L5XB 1XO5A 2JPTA 2KFFA 3BUWB 1LA3A 2BE4A 1RK9A 1CB1A 1DJZA 2HQ8A 1PK0D 1M31A 2ZFDA 1R6PA 5CSJA 5HLOA 2A4JA 1S6IA 4M2PA 2WC8A 3EVRA 4I5JA 2L0PA 3CLNA 3AKAA 2KAYA 1RECA 1PULA 1KSMA 1YRUB 4U8DA 3VGOA 1F71A 3D0YB 1XFXO 1LKJA 2HPSA 2PRUA 1A2XA 2ZRSA 1B8RA 1OMDA 2Q91A 2VRGA 5HKZA 1KFUS 1RTP1 2KAXA 5G08A 1SY9A 4BY4A 1B1GA 1XFYO 4YI9A 1EG3A 1DJHA 1IG5A 1K96A 1CLMA 1S6CA 2OTGC 2ZN8A 4YGDB 4CFQA 1M63B 4GPLB 1XA5A 1M46A 4DS7A 2M1UA 5I2OA 2PASA 2FCDA 2MJWB 4NDDA 1ALWA 1BG1A 2GGZA 2KQYA 3FWCA 1KFXS 1PVBA 4MLWA 1TNXA 4MEWA 2LUCA 1IRJA 2M97A 4XJKB 1H4BA 1A29A 2OS8C 4PALA 1JF2A 1XVJA 1IGVA 1U5IA 3BOWA 2EC6B 2BL0B 1WLZA 2WORA 5B8IB 2CNPA 2I2RE 1XYDA 4MVFA 5DKQA 2WCFA 2L98A 1K9PA 1GJYA 5BPJA 1FW4A 2CBLA 1EH2A 3GOFA 1R2UA 1WRLA 1OQPA 4N1GA 5CSIA 2BKIB 1AJ5A 1NWDA 1TNPA 3O2PA 4GNKB 3FIAA 1WY9A 1RROA 1S3PA 3SG5A 2L4HA 2JTZA 1YX8A 4AQJA 4P5OE 2KI6C 1N2DA 3RLZA 1IWQA 4YBHB 1IJ6A 1SRAA 4GBAA 1QLSA 1OMRA 2HF5A 3LLEA 2M49B 4XYNA 1KQMC 4P2YB 1N65A 1IQ5A 2AMIA 2LLSA 2NCPA 2H2KA 1UHNA 2BCXA 2KDHA 2I18A 5CSFA 1AK8A 2LMUA 4HRGA 4A4CA 4MN0A 1CDMA 5AERA 3NSOA 5I2QA 3PLFB 4DUQA 1TCFA 1KK7Z 3SG6A 2M0RA 2M3WA 1BOCA 2MAZA 3OX6A 3VROA 1CLBA 4IL1A 4YGEB 2SCPA 3NSLA 1ZFSA 3CTNA 1SPYA 2K2FA 3O78A 2L2EA 2LNKA 2F3YA 1NCYA 2K2AA 3TDZA 1FF1A 2JT8A 1WLMA 2JNXA 2JTTA 2R2IA 4MSPA 4MZLA 4CIDA 1K95A 4ORBB 1BR4B 2WOSA 1QIVA 3PALA 2M8UA 1JUOA 2LUXA 2OTGB 3WNXB 1KQVA 2M9GA 3OP0A 2JU0A 1XFUO 3PSRA 3PM8A 1DVIA 1QX2A 1TCOB 4D1EA 1UHJA 1K90D 1C7VA 4NQGA 1S36A 1Y6WA 2AUCA 2LP2A 2V53A 1NX1A 1J1DA 1JFJA 4OR9B 4YI8A 1KSOA 1CDNA 4PE0A 1Y0VH 3RM1A 3EKJA 4BY5A 1SCVA 2OS8B 3PFVA 2F3ZA 1B7TZ 2KGRA 1QV0A 1DF0B 1JF0A 3NSIA 4GAOA 1F4QA 1AP4A 1GGZA 1YX7A 1B8CA 3DVEA 5HKYA 3SG4A 1K93D 2M7NA 1EXRA 1MXEA 4GGFC 2MBXA 1MR8A 1SKTA 3WHUB 2KNEA 1QLKA 2LAPA 3CR4X 2FOTA 1S1EA 3LK1A 1BF5A 4UPGA 3TS5B 1QATA 1CMGA 1IQ3A 3ZNIA 1NX3A 2CXJA 4FQOA 2KFHA 2K0JA 2LE9B 2LLTA 3O6BA 2H61A 2KYCA 2I94A 1KQMB 1UHKA 1AUIB 2K7OA 4PE1A 3AAKA 5JOLA 1QVIY 1B47A 1OMVA 1SW8A 2KI4B 4WRIA 1CFFA 1G8IA 1TNQA 2MHHA 1MUXA 1YUTA 2KBIA 4C0KA 1WDCC 3ICBA 2CCMA 4QJ5B 1K94A 3JTDC 3TZ1A 4ORAB 1ZMZA 1RWYA 1SK6D 1NCZA 1UHHA 3DF0B 4NDCA 1QASA 2RGIA 3FS7A 1LINA 3I5HC 2EHBA 4CFRA 1TN4A 1B7TY 4DIRA 3I5GC 2JC2A 2BECA 2K8MB 1FPWA 5D7FA 4MRYA 3A8RA 1CKKA 1S26D 4I5NB 2BKHB 3IQQA 1UUSA 5GQQC 4MZKA 1J1EA 3BOWB 4ZCUA 3I5FC 1TOPA 2JULA 2L50A 3I5IB 3TDIA 1KK8C 2JZIA 4PCWA 1ZOTB 2MRDA 2LMTA 4YGAA 1CDLA 4ICBA 4OKHA 1CFPA 1D1OA 1UHIA 5AXIA 1LA0A 1YRTB 4JPZB 1ZUZA 1W7JB 5ER5A 1AVSA 3SG3A 3GK4X 4WQ3A 1KCYA 5DKRA 1BR1B 2EGDA 4M2OA 3IF7A 1F4OA 1NCXA 3MSEB 1A75B 1H8BA 2H61C 2L51A 1W7IB 3CZTX 2Y1MA 1C07A 1NX0A 1OE9B 1MQ1A 4ORCB 4MRXA 2KOTA 1SNLA 4OCIA 2LMVA 1GQMA 2LVVA 2COLB 3HCMA 2BBNA 3IQOA 3K21A 3AAJA 3DD4A 5I8NA 2CTNA 3JVTC 1Y1AA 4M2QA 1F54A 1TIZA 1QX7A 3KHEA 3VRNA 4C0JA 1M39A 1ODBA 4AOMA 1N0YA 3F45A 2P6BB 3EVVA 2GV5A 1YTZC 2L4IA 3OB2B 1PRWA 2NLNA 5KSZA 3BXKA 1SYMA 1IKUA 5HKWA 2ISDA 3SIAA 1Y1UA 5PALA 2LC5A 1IJ5A 1WDCB 3EK4A 2F33A 2PSRA 2TN4A 1DJYA 2LCPA 2OPOA 3BUMB 3JTDB 5JJGA 1K9KA 2F8PA 1EL4A 1QX5B 1OZOA 4QJ4B 2BCAA 2Y1NA 1TNWA 2ZRTA 3I5HB 4GFTA 1DJWA 3VRPA 1JWDA 3KF9A 4GGNA 1NUBA 1SR6C 1NX2A 3KPXA 1WRZA 3I5GB 5K89A 1CLLA 3NSKA 1YUUA 2SASA 1CFDA 2JT0A 1BT6A 3CR2A 4PHKA 1JBAA 2E30A 1KFUL 2JXCA 2JXLA 1EG4A 1VRKA 1MHOA 5CSNA 2LM5A 3HX4A 3LK0A 3TDUA 1YVHA 2Y5IA 2E6WA 2NXQA 3BQ3A 1WRKA 3I5FB 2K7CA 4PDZA 1KK7Y 4PHMA 4WQ2A 2KGBC 1J55A 4YGBB 2LHIA 2EC6C 5KTYA 1F55A 1NYAA 5KU1A 3SG7A 2PMYA 3VRQA 1CTRA 1BODA 1XK4A 2NZ0A 2JQ6A 5AANA 2LP3A 1UURA 1F70A 2DOQA 1DTLA 2KHNA 3OB1B 3KO0A 3KEVA 1YURA 1S5GZ 1Q80A 2JRFA 4I5KA 3EVUA 1K8UA 5AEQA 3NXAA 3EKHA 4FTGA 4HSZA 1BMOA 2FJUB 1K2HA 2CT9A 3LCPC 3D10A 1DF0A 1QXPA 1ZACA 1E8AA 4CPVA 4PHJA 4E68A 1QS7A 1HQVA 1NIWA 1A03A 1J7PA 2G9BA 3C1VA 1C7WA 2GGMA 2QACA 1HT9A 4OV2A 3WHTB 2IS9A 3JVTB 4YRUA 1KWOC 1B9AA 4N1FA 1DGVA 2FCEA 1L2OC 1LVCD 2BBMA 3TUYC 2HQWA 1PSRA 2JNFA 2KQ6A 1X02A 4AQIA 3CWGA 1DGUA 3D0YA 1MWNA 1B8LA 4F0ZB 1DMOA 1G33A 1PALA 4CLNA 1UP5A 1YR5A 5I2LA 4PE4A 2Y4QA 2O60A 1QV1A 4DCKA 3M0WA 1JSAA 1QJTA 5CPVA 4MBEA 3ZWHA 1YUSA 1OOJA 1GGWA 1S6JA 5F6TA 1BLQA 1K9UA 1U5IB 5FYXA 1J7QA 3EK8A 4Q04A 2B1UA 3EK7A 5AFPA 1S5GY 1MF8B 3DF0A 2LVJA 1SR6B 4HREE 1AJ4A 2O5GA 1BJFA 2K61A 1XK4C 4QJ3B 2ZNDA 3CS1A 4C0LA 3SIBA 1LXFC 1CM1A 2BCBA 2HETA 3A4UB 1NPQA 1FBVA 3PN7C 1B4CA 2MLFC 3QRXA 1SCMC 3BUXB 3E3RA 5HYDA 1L7ZA 4XJKA 1FI5A 1EJ3A 4NDBA 2KSPA 3DVKA 4OVNF 4DRWA 2F2PA 3SG2A 1CDPA 4USLA 2F2OA 4JWQA 2JT3A 2ZN9A 1YVLA 2ZNEA 1CMFA 2ZKMX 1G4YR 1NSHA 1FI6A 2D8NA 5D69A 3LL8B 4PE7A 1AHRA 1DJXA 4HRHA 3CR5X 3DVMA 1TRFA 2KAVA 1MXLC 2LV7A 2MLEC 3DVJA 3TS5C 4A4BA 1UWOA 1BU3A 1ALVA 2M1KB 3BUOB 1DJIA 1A75A 1SL8A 2KBMA 1SL9A 1RFJA 2M29A 3AKBA 4GUKA 1PVAA 1M45A 2KI4C 2WNDA 2K7DA 3WXAA 1DJGA 1RJVA 4GGFA 2PVBA 4I5LB 1J7RA 3FWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO B;  2WCB A;  1DT7 B;  1J7O A;  1SMG A;  1V1G A;  2JOJ A;  2LVI A;  1L2O B;  1OZS A;  4YGC B;  3TUY B;  1F8H A;  1PSB A;  3GK2 A;  2WCE A;  3OHM B;  4ETO A;  5IBW A;  1CNP A;  2AAO A;  2JWW A;  1SL7 A;  2MA2 A;  1XFV O;  1V1F A;  3H4S E;  5HLV A;  3PAT A;  3VRR A;  5TNC A;  2KI6 D;  1JC2 A;  4N5X A;  2BE6 A;  2G2B A;  4L9M A;  2KFG A;  5ER4 X;  2K7B A;  2KYF A;  3GK1 A;  2PAL A;  1IH0 A;  2I7A A;  4ZCV A;  2LHL A;  5DKN A;  1KK8 B;  2QPT A;  4TNC A;  2LVK A;  1A4P A;  1QTX A;  3I5I C;  2BL0 C;  2LLU A;  5J3X A;  1QVI Z;  4R1E A;  2LAN A;  3CGA A;  1KFX L;  4JQ0 D;  1QIW A;  2NCO A;  2Q4U A;  1Y1X A;  4MZJ A;  1SBJ A;  1TTX A;  1XFW O;  3PN7 B;  3O4Y A;  1CM4 A;  1SCM B;  3BUN B;  1JFK A;  1NP8 A;  2M7L A;  3OX5 A;  3BYA A;  4PHN A;  1OSA A;  1XFZ O;  3SJS A;  1CFC A;  2L5X B;  1XO5 A;  2JPT A;  2KFF A;  3BUW B;  1LA3 A;  2BE4 A;  1RK9 A;  1CB1 A;  1DJZ A;  2HQ8 A;  1PK0 D;  1M31 A;  2ZFD A;  1R6P A;  5CSJ A;  5HLO A;  2A4J A;  1S6I A;  4M2P A;  2WC8 A;  3EVR A;  4I5J A;  2L0P A;  3CLN A;  3AKA A;  2KAY A;  1REC A;  1PUL A;  1KSM A;  1YRU B;  4U8D A;  3VGO A;  1F71 A;  3D0Y B;  1XFX O;  1LKJ A;  2HPS A;  2PRU A;  1A2X A;  2ZRS A;  1B8R A;  1OMD A;  2Q91 A;  2VRG A;  5HKZ A;  1KFU S;  1RTP 1;  2KAX A;  5G08 A;  1SY9 A;  4BY4 A;  1B1G A;  1XFY O;  4YI9 A;  1EG3 A;  1DJH A;  1IG5 A;  1K96 A;  1CLM A;  1S6C A;  2OTG C;  2ZN8 A;  4YGD B;  4CFQ A;  1M63 B;  4GPL B;  1XA5 A;  1M46 A;  4DS7 A;  2M1U A;  5I2O A;  2PAS A;  2FCD A;  2MJW B;  4NDD A;  1ALW A;  1BG1 A;  2GGZ A;  2KQY A;  3FWC A;  1KFX S;  1PVB A;  4MLW A;  1TNX A;  4MEW A;  2LUC A;  1IRJ A;  2M97 A;  4XJK B;  1H4B A;  1A29 A;  2OS8 C;  4PAL A;  1JF2 A;  1XVJ A;  1IGV A;  1U5I A;  3BOW A;  2EC6 B;  2BL0 B;  1WLZ A;  2WOR A;  5B8I B;  2CNP A;  2I2R E;  1XYD A;  4MVF A;  5DKQ A;  2WCF A;  2L98 A;  1K9P A;  1GJY A;  5BPJ A;  1FW4 A;  2CBL A;  1EH2 A;  3GOF A;  1R2U A;  1WRL A;  1OQP A;  4N1G A;  5CSI A;  2BKI B;  1AJ5 A;  1NWD A;  1TNP A;  3O2P A;  4GNK B;  3FIA A;  1WY9 A;  1RRO A;  1S3P A;  3SG5 A;  2L4H A;  2JTZ A;  1YX8 A;  4AQJ A;  4P5O E;  2KI6 C;  1N2D A;  3RLZ A;  1IWQ A;  4YBH B;  1IJ6 A;  1SRA A;  4GBA A;  1QLS A;  1OMR A;  2HF5 A;  3LLE A;  2M49 B;  4XYN A;  1KQM C;  4P2Y B;  1N65 A;  1IQ5 A;  2AMI A;  2LLS A;  2NCP A;  2H2K A;  1UHN A;  2BCX A;  2KDH A;  2I18 A;  5CSF A;  1AK8 A;  2LMU A;  4HRG A;  4A4C A;  4MN0 A;  1CDM A;  5AER A;  3NSO A;  5I2Q A;  3PLF B;  4DUQ A;  1TCF A;  1KK7 Z;  3SG6 A;  2M0R A;  2M3W A;  1BOC A;  2MAZ A;  3OX6 A;  3VRO A;  1CLB A;  4IL1 A;  4YGE B;  2SCP A;  3NSL A;  1ZFS A;  3CTN A;  1SPY A;  2K2F A;  3O78 A;  2L2E A;  2LNK A;  2F3Y A;  1NCY A;  2K2A A;  3TDZ A;  1FF1 A;  2JT8 A;  1WLM A;  2JNX A;  2JTT A;  2R2I A;  4MSP A;  4MZL A;  4CID A;  1K95 A;  4ORB B;  1BR4 B;  2WOS A;  1QIV A;  3PAL A;  2M8U A;  1JUO A;  2LUX A;  2OTG B;  3WNX B;  1KQV A;  2M9G A;  3OP0 A;  2JU0 A;  1XFU O;  3PSR A;  3PM8 A;  1DVI A;  1QX2 A;  1TCO B;  4D1E A;  1UHJ A;  1K90 D;  1C7V A;  4NQG A;  1S36 A;  1Y6W A;  2AUC A;  2LP2 A;  2V53 A;  1NX1 A;  1J1D A;  1JFJ A;  4OR9 B;  4YI8 A;  1KSO A;  1CDN A;  4PE0 A;  1Y0V H;  3RM1 A;  3EKJ A;  4BY5 A;  1SCV A;  2OS8 B;  3PFV A;  2F3Z A;  1B7T Z;  2KGR A;  1QV0 A;  1DF0 B;  1JF0 A;  3NSI A;  4GAO A;  1F4Q A;  1AP4 A;  1GGZ A;  1YX7 A;  1B8C A;  3DVE A;  5HKY A;  3SG4 A;  1K93 D;  2M7N A;  1EXR A;  1MXE A;  4GGF C;  2MBX A;  1MR8 A;  1SKT A;  3WHU B;  2KNE A;  1QLK A;  2LAP A;  3CR4 X;  2FOT A;  1S1E A;  3LK1 A;  1BF5 A;  4UPG A;  3TS5 B;  1QAT A;  1CMG A;  1IQ3 A;  3ZNI A;  1NX3 A;  2CXJ A;  4FQO A;  2KFH A;  2K0J A;  2LE9 B;  2LLT A;  3O6B A;  2H61 A;  2KYC A;  2I94 A;  1KQM B;  1UHK A;  1AUI B;  2K7O A;  4PE1 A;  3AAK A;  5JOL A;  1QVI Y;  1B47 A;  1OMV A;  1SW8 A;  2KI4 B;  4WRI A;  1CFF A;  1G8I A;  1TNQ A;  2MHH A;  1MUX A;  1YUT A;  2KBI A;  4C0K A;  1WDC C;  3ICB A;  2CCM A;  4QJ5 B;  1K94 A;  3JTD C;  3TZ1 A;  4ORA B;  1ZMZ A;  1RWY A;  1SK6 D;  1NCZ A;  1UHH A;  3DF0 B;  4NDC A;  1QAS A;  2RGI A;  3FS7 A;  1LIN A;  3I5H C;  2EHB A;  4CFR A;  1TN4 A;  1B7T Y;  4DIR A;  3I5G C;  2JC2 A;  2BEC A;  2K8M B;  1FPW A;  5D7F A;  4MRY A;  3A8R A;  1CKK A;  1S26 D;  4I5N B;  2BKH B;  3IQQ A;  1UUS A;  5GQQ C;  4MZK A;  1J1E A;  3BOW B;  4ZCU A;  3I5F C;  1TOP A;  2JUL A;  2L50 A;  3I5I B;  3TDI A;  1KK8 C;  2JZI A;  4PCW A;  1ZOT B;  2MRD A;  2LMT A;  4YGA A;  1CDL A;  4ICB A;  4OKH A;  1CFP A;  1D1O A;  1UHI A;  5AXI A;  1LA0 A;  1YRT B;  4JPZ B;  1ZUZ A;  1W7J B;  5ER5 A;  1AVS A;  3SG3 A;  3GK4 X;  4WQ3 A;  1KCY A;  5DKR A;  1BR1 B;  2EGD A;  4M2O A;  3IF7 A;  1F4O A;  1NCX A;  3MSE B;  1A75 B;  1H8B A;  2H61 C;  2L51 A;  1W7I B;  3CZT X;  2Y1M A;  1C07 A;  1NX0 A;  1OE9 B;  1MQ1 A;  4ORC B;  4MRX A;  2KOT A;  1SNL A;  4OCI A;  2LMV A;  1GQM A;  2LVV A;  2COL B;  3HCM A;  2BBN A;  3IQO A;  3K21 A;  3AAJ A;  3DD4 A;  5I8N A;  2CTN A;  3JVT C;  1Y1A A;  4M2Q A;  1F54 A;  1TIZ A;  1QX7 A;  3KHE A;  3VRN A;  4C0J A;  1M39 A;  1ODB A;  4AOM A;  1N0Y A;  3F45 A;  2P6B B;  3EVV A;  2GV5 A;  1YTZ C;  2L4I A;  3OB2 B;  1PRW A;  2NLN A;  5KSZ A;  3BXK A;  1SYM A;  1IKU A;  5HKW A;  2ISD A;  3SIA A;  1Y1U A;  5PAL A;  2LC5 A;  1IJ5 A;  1WDC B;  3EK4 A;  2F33 A;  2PSR A;  2TN4 A;  1DJY A;  2LCP A;  2OPO A;  3BUM B;  3JTD B;  5JJG A;  1K9K A;  2F8P A;  1EL4 A;  1QX5 B;  1OZO A;  4QJ4 B;  2BCA A;  2Y1N A;  1TNW A;  2ZRT A;  3I5H B;  4GFT A;  1DJW A;  3VRP A;  1JWD A;  3KF9 A;  4GGN A;  1NUB A;  1SR6 C;  1NX2 A;  3KPX A;  1WRZ A;  3I5G B;  5K89 A;  1CLL A;  3NSK A;  1YUU A;  2SAS A;  1CFD A;  2JT0 A;  1BT6 A;  3CR2 A;  4PHK A;  1JBA A;  2E30 A;  1KFU L;  2JXC A;  2JXL A;  1EG4 A;  1VRK A;  1MHO A;  5CSN A;  2LM5 A;  3HX4 A;  3LK0 A;  3TDU A;  1YVH A;  2Y5I A;  2E6W A;  2NXQ A;  3BQ3 A;  1WRK A;  3I5F B;  2K7C A;  4PDZ A;  1KK7 Y;  4PHM A;  4WQ2 A;  2KGB C;  1J55 A;  4YGB B;  2LHI A;  2EC6 C;  5KTY A;  1F55 A;  1NYA A;  5KU1 A;  3SG7 A;  2PMY A;  3VRQ A;  1CTR A;  1BOD A;  1XK4 A;  2NZ0 A;  2JQ6 A;  5AAN A;  2LP3 A;  1UUR A;  1F70 A;  2DOQ A;  1DTL A;  2KHN A;  3OB1 B;  3KO0 A;  3KEV A;  1YUR A;  1S5G Z;  1Q80 A;  2JRF A;  4I5K A;  3EVU A;  1K8U A;  5AEQ A;  3NXA A;  3EKH A;  4FTG A;  4HSZ A;  1BMO A;  2FJU B;  1K2H A;  2CT9 A;  3LCP C;  3D10 A;  1DF0 A;  1QXP A;  1ZAC A;  1E8A A;  4CPV A;  4PHJ A;  4E68 A;  1QS7 A;  1HQV A;  1NIW A;  1A03 A;  1J7P A;  2G9B A;  3C1V A;  1C7W A;  2GGM A;  2QAC A;  1HT9 A;  4OV2 A;  3WHT B;  2IS9 A;  3JVT B;  4YRU A;  1KWO C;  1B9A A;  4N1F A;  1DGV A;  2FCE A;  1L2O C;  1LVC D;  2BBM A;  3TUY C;  2HQW A;  1PSR A;  2JNF A;  2KQ6 A;  1X02 A;  4AQI A;  3CWG A;  1DGU A;  3D0Y A;  1MWN A;  1B8L A;  4F0Z B;  1DMO A;  1G33 A;  1PAL A;  4CLN A;  1UP5 A;  1YR5 A;  5I2L A;  4PE4 A;  2Y4Q A;  2O60 A;  1QV1 A;  4DCK A;  3M0W A;  1JSA A;  1QJT A;  5CPV A;  4MBE A;  3ZWH A;  1YUS A;  1OOJ A;  1GGW A;  1S6J A;  5F6T A;  1BLQ A;  1K9U A;  1U5I B;  5FYX A;  1J7Q A;  3EK8 A;  4Q04 A;  2B1U A;  3EK7 A;  5AFP A;  1S5G Y;  1MF8 B;  3DF0 A;  2LVJ A;  1SR6 B;  4HRE E;  1AJ4 A;  2O5G A;  1BJF A;  2K61 A;  1XK4 C;  4QJ3 B;  2ZND A;  3CS1 A;  4C0L A;  3SIB A;  1LXF C;  1CM1 A;  2BCB A;  2HET A;  3A4U B;  1NPQ A;  1FBV A;  3PN7 C;  1B4C A;  2MLF C;  3QRX A;  1SCM C;  3BUX B;  3E3R A;  5HYD A;  1L7Z A;  4XJK A;  1FI5 A;  1EJ3 A;  4NDB A;  2KSP A;  3DVK A;  4OVN F;  4DRW A;  2F2P A;  3SG2 A;  1CDP A;  4USL A;  2F2O A;  4JWQ A;  2JT3 A;  2ZN9 A;  1YVL A;  2ZNE A;  1CMF A;  2ZKM X;  1G4Y R;  1NSH A;  1FI6 A;  2D8N A;  5D69 A;  3LL8 B;  4PE7 A;  1AHR A;  1DJX A;  4HRH A;  3CR5 X;  3DVM A;  1TRF A;  2KAV A;  1MXL C;  2LV7 A;  2MLE C;  3DVJ A;  3TS5 C;  4A4B A;  1UWO A;  1BU3 A;  1ALV A;  2M1K B;  3BUO B;  1DJI A;  1A75 A;  1SL8 A;  2KBM A;  1SL9 A;  1RFJ A;  2M29 A;  3AKB A;  4GUK A;  1PVA A;  1M45 A;  2KI4 C;  2WND A;  2K7D A;  3WXA A;  1DJG A;  1RJV A;  4GGF A;  2PVB A;  4I5L B;  1J7R A;  3FWB A; 
#chains in the Genus database with same CATH topology
 3SS3 A;  1KWO B;  3CZ1 A;  2WCB A;  3R1V A;  1DT7 B;  1J7O A;  3PM2 A;  1SMG A;  3NGV A;  1V1G A;  2JOJ A;  2LVI A;  1L2O B;  1OZS A;  4YGC B;  3TUY B;  1F8H A;  1PSB A;  3GK2 A;  2WCE A;  3OHM B;  4ETO A;  5IBW A;  1CNP A;  2AAO A;  2JWW A;  1SL7 A;  2MA2 A;  3UO9 A;  1XFV O;  1V1F A;  3H4S E;  1DQE A;  3PAT A;  5HLV A;  3VRR A;  5TNC A;  2KI6 D;  1JC2 A;  4INW A;  4N5X A;  2BE6 A;  2G2B A;  4L9M A;  2KFG A;  5ER4 X;  2K7B A;  2KYF A;  3GK1 A;  2PAL A;  3S0A A;  2I7A A;  4ZCV A;  1IH0 A;  3S0F A;  2LHL A;  5DKN A;  1KK8 B;  2QPT A;  4TNC A;  2LVK A;  1A4P A;  1QTX A;  3I5I C;  2BL0 C;  2LLU A;  3BFA A;  5J3X A;  1QVI Z;  4R1E A;  2LAN A;  3CGA A;  1KFX L;  4JQ0 D;  1QIW A;  2NCO A;  2Q4U A;  1Y1X A;  1ORG A;  4MZJ A;  1SBJ A;  1TTX A;  1XFW O;  3PN7 B;  3O4Y A;  1CM4 A;  1SCM B;  3BUN B;  1JFK A;  1NP8 A;  2M7L A;  3OX5 A;  3BYA A;  4PHN A;  1OSA A;  1XFZ O;  3D75 A;  3SJS A;  1CFC A;  2L5X B;  1XO5 A;  2JPT A;  2KFF A;  3BUW B;  1LA3 A;  2BE4 A;  1RK9 A;  1CB1 A;  1DJZ A;  2HQ8 A;  1PK0 D;  1M31 A;  2ZFD A;  1R6P A;  3D73 A;  5CSJ A;  5HLO A;  2A4J A;  1C3Y A;  2BAP A;  1S6I A;  3Q8I A;  4M2P A;  2WC8 A;  3EVR A;  4I5J A;  2L0P A;  3CLN A;  3AKA A;  2KAY A;  1REC A;  5I94 A;  1PUL A;  1KSM A;  2P70 A;  1YRU B;  4U8D A;  3VGO A;  1F71 A;  3D0Y B;  1XFX O;  1LKJ A;  2WCL A;  2WCH A;  2HPS A;  1TWO A;  2PRU A;  3FE6 A;  1A2X A;  2ZRS A;  1B8R A;  1OMD A;  2Q91 A;  2VRG A;  5HKZ A;  1KFU S;  1RTP 1;  2KAX A;  5G08 A;  1SY9 A;  4BY4 A;  2GTE A;  1B1G A;  1XFY O;  4YI9 A;  1EG3 A;  1DJH A;  1IG5 A;  1K96 A;  1CLM A;  1S6C A;  2OTG C;  2ZN8 A;  4YGD B;  4CFQ A;  1M63 B;  4GPL B;  1XA5 A;  1M46 A;  4DS7 A;  2M1U A;  3B86 A;  5I2O A;  2PAS A;  2FCD A;  2MJW B;  3L47 A;  1ALW A;  4NDD A;  1BG1 A;  2GGZ A;  2KQY A;  3FWC A;  1KFX S;  3NHT A;  1PVB A;  5HL1 A;  4MLW A;  1TNX A;  3CDN A;  4MEW A;  2LUC A;  1IRJ A;  5FI2 A;  2M97 A;  4XJK B;  1H4B A;  1A29 A;  2WC5 A;  2OS8 C;  1XFR A;  2L2C A;  4PAL A;  1JF2 A;  1XVJ A;  1IGV A;  1U5I A;  3BOW A;  1DC1 A;  2EC6 B;  2BL0 B;  1WLZ A;  2WOR A;  5B8I B;  2CNP A;  2I2R E;  1XYD A;  4MVF A;  5DKQ A;  2WCF A;  2L98 A;  1K9P A;  1GJY A;  5BPJ A;  1FW4 A;  2CBL A;  1EH2 A;  3GOF A;  1R2U A;  1WRL A;  2H8V A;  1OQP A;  3R1P A;  4N1G A;  5CSI A;  2BKI B;  1AJ5 A;  1NWD A;  1TNP A;  3O2P A;  4GNK B;  3FIA A;  1WY9 A;  1RRO A;  1S3P A;  3SG5 A;  2L4H A;  2JTZ A;  1YX8 A;  3L4A A;  4AQJ A;  4P5O E;  2KI6 C;  1N2D A;  3RLZ A;  1IWQ A;  4YBH B;  1IJ6 A;  1SRA A;  4GBA A;  1QLS A;  1OMR A;  3L4L A;  2HF5 A;  2WCJ A;  2M49 B;  3LLE A;  1KQM C;  4XYN A;  4P2Y B;  1N65 A;  1IQ5 A;  2AMI A;  2LLS A;  2NCP A;  3UNW A;  2H2K A;  1UHN A;  2BCX A;  2KDH A;  2I18 A;  5CSF A;  1AK8 A;  2LMU A;  4HRG A;  5FI7 A;  4A4C A;  3QME A;  1CDM A;  4MN0 A;  2JPO A;  3NSO A;  3S0E A;  3PLF B;  5AER A;  4DUQ A;  1TCF A;  3SS5 A;  5I2Q A;  3PJI A;  1KK7 Z;  3SG6 A;  2M0R A;  2M3W A;  1BOC A;  2MAZ A;  2P71 A;  3OX6 A;  4JKT A;  3VRO A;  1CLB A;  4IL1 A;  4YGE B;  2SCP A;  3NSL A;  1ZFS A;  1T14 A;  1SPY A;  3CTN A;  2K2F A;  3O4X A;  2L2E A;  3O78 A;  2KPH A;  2LNK A;  2F3Y A;  1NCY A;  2K2A A;  3TDZ A;  1FF1 A;  2JT8 A;  1WLM A;  2ERB A;  2JTT A;  2JNX A;  2R2I A;  4MSP A;  4MZL A;  3V2L A;  3SS4 A;  4CID A;  1K95 A;  4ORB B;  3B87 A;  1BR4 B;  2WOS A;  1QIV A;  3PAL A;  2M8U A;  1JUO A;  2LUX A;  2OTG B;  3WNX B;  1KQV A;  2M9G A;  3OP0 A;  2JU0 A;  1XFU O;  3PSR A;  3PM8 A;  1DVI A;  1QX2 A;  1TCO B;  4D1E A;  1UHJ A;  1K90 D;  1C7V A;  4NQG A;  1S36 A;  1Y6W A;  2AUC A;  2LP2 A;  2V53 A;  1NX1 A;  1J1D A;  4FQT A;  1JFJ A;  3FE9 A;  4OR9 B;  4YI8 A;  1KSO A;  1CDN A;  4PE0 A;  1Y0V H;  3RM1 A;  3EKJ A;  4BY5 A;  1SCV A;  2OS8 B;  3PFV A;  2F3Z A;  1B7T Z;  1IIO A;  2KGR A;  3CZ0 A;  1QV0 A;  1DF0 B;  1JF0 A;  3NSI A;  4GAO A;  1F4Q A;  1AP4 A;  1GGZ A;  1YX7 A;  1B8C A;  3DVE A;  5HKY A;  3SG4 A;  1K93 D;  2M7N A;  1EXR A;  1MXE A;  4GGF C;  2MBX A;  1MR8 A;  1SKT A;  3WHU B;  2KNE A;  1QLK A;  2LAP A;  3CR4 X;  3R1O A;  4F7F A;  2FOT A;  1S1E A;  1P28 A;  3LK1 A;  1BF5 A;  4UPG A;  3TS5 B;  1QAT A;  1CMG A;  1IQ3 A;  3ZNI A;  1NX3 A;  2CXJ A;  4FQO A;  2KFH A;  2K0J A;  2LE9 B;  2LLT A;  3O6B A;  2H61 A;  2KYC A;  2I94 A;  1KQM B;  1UHK A;  1AUI B;  2K7O A;  4PE1 A;  3AAK A;  5JOL A;  3BJH A;  1QVI Y;  1B47 A;  1OMV A;  1SW8 A;  2KI4 B;  4WRI A;  1CFF A;  1G8I A;  1TNQ A;  2K60 A;  2MHH A;  1MUX A;  1YUT A;  2KBI A;  4C0K A;  1WDC C;  3ICB A;  2CCM A;  3VB1 A;  4QJ5 B;  1K94 A;  3JTD C;  3TZ1 A;  4ORA B;  1ZMZ A;  1RWY A;  1SK6 D;  3B88 A;  1NCZ A;  1UHH A;  3DF0 B;  5FI6 A;  4NDC A;  1QAS A;  2RGI A;  3FS7 A;  1LIN A;  3I5H C;  2EHB A;  4CFR A;  1TN4 A;  1Z4H A;  1B7T Y;  4DIR A;  1OOH A;  3I5G C;  2JC2 A;  3S0G A;  2BEC A;  2K8M B;  1OW4 A;  5D7F A;  1FPW A;  4MRY A;  3A8R A;  1CKK A;  1S26 D;  4I5N B;  2BKH B;  3IQQ A;  1Z2C B;  1UUS A;  5GQQ C;  4MZK A;  1J1E A;  4KYN A;  3BOW B;  4ZCU A;  3I5F C;  1TOP A;  2WCM A;  1DEK A;  2JUL A;  1OOF A;  2L50 A;  3I5I B;  3TDI A;  1KK8 C;  2JZI A;  4PCW A;  1ZOT B;  2MRD A;  2LMT A;  4YGA A;  1CDL A;  4ICB A;  4OKH A;  1CFP A;  4JD9 A;  1D1O A;  1UHI A;  5AXI A;  1LA0 A;  1YRT B;  4JPZ B;  1ZUZ A;  1W7J B;  5ER5 A;  1AVS A;  3N7H A;  3SG3 A;  3GK4 X;  3BFH A;  4WQ3 A;  1KCY A;  5DKR A;  1BR1 B;  2EGD A;  4M2O A;  2WCK A;  3IF7 A;  1F4O A;  1NCX A;  3CZ2 A;  3MSE B;  1A75 B;  1H8B A;  2H61 C;  2L51 A;  1W7I B;  3CZT X;  2Y1M A;  3R72 A;  1C07 A;  1NX0 A;  1OE9 B;  3DZT A;  1MQ1 A;  4ORC B;  4MRX A;  2KOT A;  3D76 A;  1SNL A;  4OCI A;  4OZD A;  2LMV A;  2FJY A;  1GQM A;  2LVV A;  2COL B;  3HCM A;  2BBN A;  3IQO A;  3K21 A;  3AAJ A;  3DD4 A;  3OBV A;  5I8N A;  2CTN A;  3JVT C;  1Y1A A;  1W9Z A;  4M2Q A;  1F54 A;  2YGU A;  1TIZ A;  1QX7 A;  3KHE A;  3VRN A;  2KLD A;  4C0J A;  1M39 A;  1ODB A;  4AOM A;  1N0Y A;  3F45 A;  2P6B B;  3EVV A;  2GV5 A;  1OOI X;  1YTZ C;  3D78 A;  2KLE A;  2L4I A;  3OB2 B;  1PRW A;  2NLN A;  5KSZ A;  3BXK A;  1SYM A;  1IKU A;  5HKW A;  2ISD A;  3SIA A;  2QDI A;  1Y1U A;  3IVT A;  2LC5 A;  1IJ5 A;  1WDC B;  3EK4 A;  5PAL A;  2F33 A;  2PSR A;  2TN4 A;  3B7A A;  1DJY A;  2LCP A;  2OPO A;  3BUM B;  3JTD B;  5JJG A;  1K9K A;  2F8P A;  1EL4 A;  1QX5 B;  1OZO A;  4QJ4 B;  2BCA A;  2Y1N A;  1TNW A;  2ZRT A;  3I5H B;  4GFT A;  1DJW A;  3VRP A;  1JWD A;  3KF9 A;  4GGN A;  1NUB A;  1SR6 C;  1NX2 A;  3KPX A;  1WRZ A;  3I5G B;  5K89 A;  1CLL A;  3NSK A;  1YUU A;  2SAS A;  1CFD A;  2JT0 A;  1BT6 A;  3CR2 A;  4PHK A;  1JBA A;  2E30 A;  1KFU L;  2JXC A;  2JXL A;  1EG4 A;  1VRK A;  1MHO A;  5CSN A;  2LM5 A;  2PQL A;  3OGN A;  3HX4 A;  3LK0 A;  3TDU A;  1YVH A;  2Y5I A;  2E6W A;  2NXQ A;  3BQ3 A;  3K1E A;  1WRK A;  3I5F B;  2K7C A;  4PDZ A;  2L5Y A;  1KK7 Y;  2QEO A;  4PHM A;  4WQ2 A;  2KGB C;  1J55 A;  4YGB B;  2LHI A;  4PT1 A;  2EC6 C;  5KTY A;  1F55 A;  1NYA A;  5KU1 A;  2BNX A;  5DIC A;  3SG7 A;  2PMY A;  3VRQ A;  1CTR A;  1BOD A;  1XK4 A;  2NZ0 A;  2JQ6 A;  5AAN A;  2LP3 A;  1UUR A;  4INX A;  1F70 A;  2DOQ A;  1DTL A;  2KHN A;  3OB1 B;  2WC6 A;  3KO0 A;  3KEV A;  1SSE B;  1YUR A;  1S5G Z;  1Q80 A;  2JRF A;  4I5K A;  1DEL A;  3EVU A;  1K8U A;  5AEQ A;  3NXA A;  3EKH A;  4FTG A;  3EG5 B;  4HSZ A;  1BMO A;  2FJU B;  3RZS A;  1K2H A;  2CT9 A;  3LCP C;  3D10 A;  1DF0 A;  1QXP A;  3DY9 A;  3DXL A;  1ZAC A;  1E8A A;  3D77 A;  4CPV A;  4PHJ A;  4E68 A;  1QS7 A;  1HQV A;  1NIW A;  1A03 A;  1J7P A;  2G9B A;  3C1V A;  1C7W A;  2GGM A;  2QAC A;  1HT9 A;  4OV2 A;  3WHT B;  2IS9 A;  3JVT B;  4YRU A;  1KWO C;  1B9A A;  4N1F A;  1DGV A;  2FCE A;  1L2O C;  1LVC D;  2BBM A;  3TUY C;  2HQW A;  1PSR A;  2JNF A;  1QWV A;  2KQ6 A;  1X02 A;  4AQI A;  3CWG A;  1DGU A;  3D0Y A;  1MWN A;  1B8L A;  4F0Z B;  1DMO A;  2QEH A;  1G33 A;  1PAL A;  4CLN A;  1UP5 A;  1OOG A;  1YR5 A;  5I2L A;  4PE4 A;  2Y4Q A;  2O60 A;  1QV1 A;  4DCK A;  3M0W A;  3DYE A;  1QJT A;  1JSA A;  5CPV A;  4MBE A;  3ZWH A;  1YUS A;  1OOJ A;  1GGW A;  1S6J A;  5F6T A;  1BLQ A;  1K9U A;  1U5I B;  5FYX A;  1J7Q A;  2PYQ A;  3EK8 A;  4Q04 A;  2B1U A;  3EK7 A;  5AFP A;  1S5G Y;  1MF8 B;  3DF0 A;  2LVJ A;  1SR6 B;  4HRE E;  1AJ4 A;  2O5G A;  1BJF A;  3S0B A;  2K61 A;  3NHI A;  1XK4 C;  2QEV A;  2ZND A;  3CS1 A;  4QJ3 B;  4C0L A;  3SIB A;  1LXF C;  1CM1 A;  2BCB A;  2HET A;  3A4U B;  1NPQ A;  1FBV A;  3PN7 C;  5D3O A;  1B4C A;  2MLF C;  3QRX A;  1SCM C;  3BUX B;  3B6X A;  1C3Z A;  3E3R A;  5HYD A;  1L7Z A;  4XJK A;  1LS8 A;  3D74 A;  1EJ3 A;  1FI5 A;  4NDB A;  5EL2 A;  2KSP A;  3DVK A;  4OVN F;  4DRW A;  2F2P A;  3SG2 A;  1CDP A;  2QEB A;  4USL A;  3FE8 A;  2F2O A;  4IJ7 A;  4JWQ A;  2JT3 A;  2ZN9 A;  1YVL A;  2ZNE A;  1CMF A;  2ZKM X;  1G4Y R;  1NSH A;  1FI6 A;  2D8N A;  5D69 A;  1TUZ A;  3LL8 B;  4PE7 A;  1AHR A;  1DJX A;  3CAB A;  4HRH A;  3CR5 X;  3DVM A;  1TRF A;  3CYZ A;  2KAV A;  1MXL C;  2LV7 A;  2MLE C;  3DVJ A;  3TS5 C;  4A4B A;  1UWO A;  1BU3 A;  3BFB A;  1ALV A;  2M1K B;  3BUO B;  1DJI A;  1A75 A;  3S0D A;  1GM0 A;  1SL8 A;  2KBM A;  1SL9 A;  1RFJ A;  2M29 A;  3AKB A;  4GUK A;  1PVA A;  1M45 A;  1TUJ A;  2KI4 C;  2WND A;  2K7D A;  3WXA A;  1DJG A;  1RJV A;  4GGF A;  2PVB A;  4I5L B;  1J7R A;  3FWB A; 
#chains in the Genus database with same CATH homology
 1KWO B;  2WCB A;  1DT7 B;  1J7O A;  1SMG A;  1V1G A;  2JOJ A;  2LVI A;  1L2O B;  1OZS A;  4YGC B;  3TUY B;  1F8H A;  1PSB A;  3GK2 A;  2WCE A;  3OHM B;  4ETO A;  5IBW A;  1CNP A;  2AAO A;  2JWW A;  1SL7 A;  2MA2 A;  1XFV O;  1V1F A;  3H4S E;  5HLV A;  3PAT A;  3VRR A;  5TNC A;  2KI6 D;  1JC2 A;  4N5X A;  2BE6 A;  2G2B A;  4L9M A;  2KFG A;  5ER4 X;  2K7B A;  2KYF A;  3GK1 A;  2PAL A;  1IH0 A;  2I7A A;  4ZCV A;  2LHL A;  5DKN A;  1KK8 B;  2QPT A;  4TNC A;  2LVK A;  1A4P A;  1QTX A;  3I5I C;  2BL0 C;  2LLU A;  5J3X A;  1QVI Z;  4R1E A;  2LAN A;  3CGA A;  1KFX L;  4JQ0 D;  1QIW A;  2NCO A;  2Q4U A;  1Y1X A;  4MZJ A;  1SBJ A;  1TTX A;  1XFW O;  3PN7 B;  3O4Y A;  1CM4 A;  1SCM B;  3BUN B;  1JFK A;  1NP8 A;  2M7L A;  3OX5 A;  3BYA A;  4PHN A;  1OSA A;  1XFZ O;  3SJS A;  1CFC A;  2L5X B;  1XO5 A;  2JPT A;  2KFF A;  3BUW B;  1LA3 A;  2BE4 A;  1RK9 A;  1CB1 A;  1DJZ A;  2HQ8 A;  1PK0 D;  1M31 A;  2ZFD A;  1R6P A;  5CSJ A;  5HLO A;  2A4J A;  1S6I A;  4M2P A;  2WC8 A;  3EVR A;  4I5J A;  2L0P A;  3CLN A;  3AKA A;  2KAY A;  1REC A;  1PUL A;  1KSM A;  1YRU B;  4U8D A;  3VGO A;  1F71 A;  3D0Y B;  1XFX O;  1LKJ A;  2HPS A;  2PRU A;  1A2X A;  2ZRS A;  1B8R A;  1OMD A;  2Q91 A;  2VRG A;  5HKZ A;  1KFU S;  1RTP 1;  2KAX A;  5G08 A;  1SY9 A;  4BY4 A;  1B1G A;  1XFY O;  4YI9 A;  1EG3 A;  1DJH A;  1IG5 A;  1K96 A;  1CLM A;  1S6C A;  2OTG C;  2ZN8 A;  4YGD B;  4CFQ A;  1M63 B;  4GPL B;  1XA5 A;  1M46 A;  4DS7 A;  2M1U A;  5I2O A;  2PAS A;  2FCD A;  2MJW B;  4NDD A;  1ALW A;  1BG1 A;  2GGZ A;  2KQY A;  3FWC A;  1KFX S;  1PVB A;  4MLW A;  1TNX A;  4MEW A;  2LUC A;  1IRJ A;  2M97 A;  4XJK B;  1H4B A;  1A29 A;  2OS8 C;  4PAL A;  1JF2 A;  1XVJ A;  1IGV A;  1U5I A;  3BOW A;  2EC6 B;  2BL0 B;  1WLZ A;  2WOR A;  5B8I B;  2CNP A;  2I2R E;  1XYD A;  4MVF A;  5DKQ A;  2WCF A;  2L98 A;  1K9P A;  1GJY A;  5BPJ A;  1FW4 A;  2CBL A;  1EH2 A;  3GOF A;  1R2U A;  1WRL A;  1OQP A;  4N1G A;  5CSI A;  2BKI B;  1AJ5 A;  1NWD A;  1TNP A;  3O2P A;  4GNK B;  3FIA A;  1WY9 A;  1RRO A;  1S3P A;  3SG5 A;  2L4H A;  2JTZ A;  1YX8 A;  4AQJ A;  4P5O E;  2KI6 C;  1N2D A;  3RLZ A;  1IWQ A;  4YBH B;  1IJ6 A;  1SRA A;  4GBA A;  1QLS A;  1OMR A;  2HF5 A;  3LLE A;  2M49 B;  4XYN A;  1KQM C;  4P2Y B;  1N65 A;  1IQ5 A;  2AMI A;  2LLS A;  2NCP A;  2H2K A;  1UHN A;  2BCX A;  2KDH A;  2I18 A;  5CSF A;  1AK8 A;  2LMU A;  4HRG A;  4A4C A;  4MN0 A;  1CDM A;  5AER A;  3NSO A;  5I2Q A;  3PLF B;  4DUQ A;  1TCF A;  1KK7 Z;  3SG6 A;  2M0R A;  2M3W A;  1BOC A;  2MAZ A;  3OX6 A;  3VRO A;  1CLB A;  4IL1 A;  4YGE B;  2SCP A;  3NSL A;  1ZFS A;  3CTN A;  1SPY A;  2K2F A;  3O78 A;  2L2E A;  2LNK A;  2F3Y A;  1NCY A;  2K2A A;  3TDZ A;  1FF1 A;  2JT8 A;  1WLM A;  2JNX A;  2JTT A;  2R2I A;  4MSP A;  4MZL A;  4CID A;  1K95 A;  4ORB B;  1BR4 B;  2WOS A;  1QIV A;  3PAL A;  2M8U A;  1JUO A;  2LUX A;  2OTG B;  3WNX B;  1KQV A;  2M9G A;  3OP0 A;  2JU0 A;  1XFU O;  3PSR A;  3PM8 A;  1DVI A;  1QX2 A;  1TCO B;  4D1E A;  1UHJ A;  1K90 D;  1C7V A;  4NQG A;  1S36 A;  1Y6W A;  2AUC A;  2LP2 A;  2V53 A;  1NX1 A;  1J1D A;  1JFJ A;  4OR9 B;  4YI8 A;  1KSO A;  1CDN A;  4PE0 A;  1Y0V H;  3RM1 A;  3EKJ A;  4BY5 A;  1SCV A;  2OS8 B;  3PFV A;  2F3Z A;  1B7T Z;  2KGR A;  1QV0 A;  1DF0 B;  1JF0 A;  3NSI A;  4GAO A;  1F4Q A;  1AP4 A;  1GGZ A;  1YX7 A;  1B8C A;  3DVE A;  5HKY A;  3SG4 A;  1K93 D;  2M7N A;  1EXR A;  1MXE A;  4GGF C;  2MBX A;  1MR8 A;  1SKT A;  3WHU B;  2KNE A;  1QLK A;  2LAP A;  3CR4 X;  2FOT A;  1S1E A;  3LK1 A;  1BF5 A;  4UPG A;  3TS5 B;  1QAT A;  1CMG A;  1IQ3 A;  3ZNI A;  1NX3 A;  2CXJ A;  4FQO A;  2KFH A;  2K0J A;  2LE9 B;  2LLT A;  3O6B A;  2H61 A;  2KYC A;  2I94 A;  1KQM B;  1UHK A;  1AUI B;  2K7O A;  4PE1 A;  3AAK A;  5JOL A;  1QVI Y;  1B47 A;  1OMV A;  1SW8 A;  2KI4 B;  4WRI A;  1CFF A;  1G8I A;  1TNQ A;  2MHH A;  1MUX A;  1YUT A;  2KBI A;  4C0K A;  1WDC C;  3ICB A;  2CCM A;  4QJ5 B;  1K94 A;  3JTD C;  3TZ1 A;  4ORA B;  1ZMZ A;  1RWY A;  1SK6 D;  1NCZ A;  1UHH A;  3DF0 B;  4NDC A;  1QAS A;  2RGI A;  3FS7 A;  1LIN A;  3I5H C;  2EHB A;  4CFR A;  1TN4 A;  1B7T Y;  4DIR A;  3I5G C;  2JC2 A;  2BEC A;  2K8M B;  1FPW A;  5D7F A;  4MRY A;  3A8R A;  1CKK A;  1S26 D;  4I5N B;  2BKH B;  3IQQ A;  1UUS A;  5GQQ C;  4MZK A;  1J1E A;  3BOW B;  4ZCU A;  3I5F C;  1TOP A;  2JUL A;  2L50 A;  3I5I B;  3TDI A;  1KK8 C;  2JZI A;  4PCW A;  1ZOT B;  2MRD A;  2LMT A;  4YGA A;  1CDL A;  4ICB A;  4OKH A;  1CFP A;  1D1O A;  1UHI A;  5AXI A;  1LA0 A;  1YRT B;  4JPZ B;  1ZUZ A;  1W7J B;  5ER5 A;  1AVS A;  3SG3 A;  3GK4 X;  4WQ3 A;  1KCY A;  5DKR A;  1BR1 B;  2EGD A;  4M2O A;  3IF7 A;  1F4O A;  1NCX A;  3MSE B;  1A75 B;  1H8B A;  2H61 C;  2L51 A;  1W7I B;  3CZT X;  2Y1M A;  1C07 A;  1NX0 A;  1OE9 B;  1MQ1 A;  4ORC B;  4MRX A;  2KOT A;  1SNL A;  4OCI A;  2LMV A;  1GQM A;  2LVV A;  2COL B;  3HCM A;  2BBN A;  3IQO A;  3K21 A;  3AAJ A;  3DD4 A;  5I8N A;  2CTN A;  3JVT C;  1Y1A A;  4M2Q A;  1F54 A;  1TIZ A;  1QX7 A;  3KHE A;  3VRN A;  4C0J A;  1M39 A;  1ODB A;  4AOM A;  1N0Y A;  3F45 A;  2P6B B;  3EVV A;  2GV5 A;  1YTZ C;  2L4I A;  3OB2 B;  1PRW A;  2NLN A;  5KSZ A;  3BXK A;  1SYM A;  1IKU A;  5HKW A;  2ISD A;  3SIA A;  1Y1U A;  5PAL A;  2LC5 A;  1IJ5 A;  1WDC B;  3EK4 A;  2F33 A;  2PSR A;  2TN4 A;  1DJY A;  2LCP A;  2OPO A;  3BUM B;  3JTD B;  5JJG A;  1K9K A;  2F8P A;  1EL4 A;  1QX5 B;  1OZO A;  4QJ4 B;  2BCA A;  2Y1N A;  1TNW A;  2ZRT A;  3I5H B;  4GFT A;  1DJW A;  3VRP A;  1JWD A;  3KF9 A;  4GGN A;  1NUB A;  1SR6 C;  1NX2 A;  3KPX A;  1WRZ A;  3I5G B;  5K89 A;  1CLL A;  3NSK A;  1YUU A;  2SAS A;  1CFD A;  2JT0 A;  1BT6 A;  3CR2 A;  4PHK A;  1JBA A;  2E30 A;  1KFU L;  2JXC A;  2JXL A;  1EG4 A;  1VRK A;  1MHO A;  5CSN A;  2LM5 A;  3HX4 A;  3LK0 A;  3TDU A;  1YVH A;  2Y5I A;  2E6W A;  2NXQ A;  3BQ3 A;  1WRK A;  3I5F B;  2K7C A;  4PDZ A;  1KK7 Y;  4PHM A;  4WQ2 A;  2KGB C;  1J55 A;  4YGB B;  2LHI A;  2EC6 C;  5KTY A;  1F55 A;  1NYA A;  5KU1 A;  3SG7 A;  2PMY A;  3VRQ A;  1CTR A;  1BOD A;  1XK4 A;  2NZ0 A;  2JQ6 A;  5AAN A;  2LP3 A;  1UUR A;  1F70 A;  2DOQ A;  1DTL A;  2KHN A;  3OB1 B;  3KO0 A;  3KEV A;  1YUR A;  1S5G Z;  1Q80 A;  2JRF A;  4I5K A;  3EVU A;  1K8U A;  5AEQ A;  3NXA A;  3EKH A;  4FTG A;  4HSZ A;  1BMO A;  2FJU B;  1K2H A;  2CT9 A;  3LCP C;  3D10 A;  1DF0 A;  1QXP A;  1ZAC A;  1E8A A;  4CPV A;  4PHJ A;  4E68 A;  1QS7 A;  1HQV A;  1NIW A;  1A03 A;  1J7P A;  2G9B A;  3C1V A;  1C7W A;  2GGM A;  2QAC A;  1HT9 A;  4OV2 A;  3WHT B;  2IS9 A;  3JVT B;  4YRU A;  1KWO C;  1B9A A;  4N1F A;  1DGV A;  2FCE A;  1L2O C;  1LVC D;  2BBM A;  3TUY C;  2HQW A;  1PSR A;  2JNF A;  2KQ6 A;  1X02 A;  4AQI A;  3CWG A;  1DGU A;  3D0Y A;  1MWN A;  1B8L A;  4F0Z B;  1DMO A;  1G33 A;  1PAL A;  4CLN A;  1UP5 A;  1YR5 A;  5I2L A;  4PE4 A;  2Y4Q A;  2O60 A;  1QV1 A;  4DCK A;  3M0W A;  1JSA A;  1QJT A;  5CPV A;  4MBE A;  3ZWH A;  1YUS A;  1OOJ A;  1GGW A;  1S6J A;  5F6T A;  1BLQ A;  1K9U A;  1U5I B;  5FYX A;  1J7Q A;  3EK8 A;  4Q04 A;  2B1U A;  3EK7 A;  5AFP A;  1S5G Y;  1MF8 B;  3DF0 A;  2LVJ A;  1SR6 B;  4HRE E;  1AJ4 A;  2O5G A;  1BJF A;  2K61 A;  1XK4 C;  4QJ3 B;  2ZND A;  3CS1 A;  4C0L A;  3SIB A;  1LXF C;  1CM1 A;  2BCB A;  2HET A;  3A4U B;  1NPQ A;  1FBV A;  3PN7 C;  1B4C A;  2MLF C;  3QRX A;  1SCM C;  3BUX B;  3E3R A;  5HYD A;  1L7Z A;  4XJK A;  1FI5 A;  1EJ3 A;  4NDB A;  2KSP A;  3DVK A;  4OVN F;  4DRW A;  2F2P A;  3SG2 A;  1CDP A;  4USL A;  2F2O A;  4JWQ A;  2JT3 A;  2ZN9 A;  1YVL A;  2ZNE A;  1CMF A;  2ZKM X;  1G4Y R;  1NSH A;  1FI6 A;  2D8N A;  5D69 A;  3LL8 B;  4PE7 A;  1AHR A;  1DJX A;  4HRH A;  3CR5 X;  3DVM A;  1TRF A;  2KAV A;  1MXL C;  2LV7 A;  2MLE C;  3DVJ A;  3TS5 C;  4A4B A;  1UWO A;  1BU3 A;  1ALV A;  2M1K B;  3BUO B;  1DJI A;  1A75 A;  1SL8 A;  2KBM A;  1SL9 A;  1RFJ A;  2M29 A;  3AKB A;  4GUK A;  1PVA A;  1M45 A;  2KI4 C;  2WND A;  2K7D A;  3WXA A;  1DJG A;  1RJV A;  4GGF A;  2PVB A;  4I5L B;  1J7R A;  3FWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...