3GK1A

X-ray structure of bovine sbi132,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk1A00
1CM1A 1XFWO 1QLSA 2MHHA 1LINA 3I5GB 2LAPA 2LANA 1XYDA 1KFXL 2H61C 2LMTA 2QPTA 1JC2A 5DKQA 2Y4QA 4FQOA 3MSEB 1J7QA 1GJYA 1G8IA 2OPOA 3DVJA 4YI8A 3EVVA 3ZNIA 4AOMA 1YUTA 2MLFC 1JBAA 3I5FC 3E3RA 2F3ZA 1Y6WA 2LV7A 2KAXA 1SBJA 2JWWA 2BBMA 2ZRTA 1DJHA 1NX0A 1WRZA 3OX6A 2M7LA 2ZRSA 4N1GA 4MZLA 5HYDA 5AERA 4PALA 2R2IA 4GNKB 1FPWA 1AJ4A 4ORCB 1TRFA 2NCOA 2JOJA 3VRRA 1MXLC 1XFUO 1MXEA 2HF5A 3D0YB 2SCPA 3HX4A 4OVNF 2JZIA 1SNLA 3F45A 4USLA 5DKRA 1Q80A 1TNPA 1CDPA 3IF7A 1TIZA 4NDBA 3BYAA 1YUSA 1W7IB 3SG2A 1IG5A 2H2KA 4QJ4B 4YI9A 4UPGA 1N65A 1QV1A 4QJ3B 3IQQA 1BMOA 1YR5A 3BUMB 3OP0A 5ER5A 3WHUB 5DKNA 4OCIA 1F71A 1OSAA 4ZCVA 1JFJA 3OB2B 3NSKA 5BPJA 4NDCA 1A03A 2I2RE 1PSRA 3O78A 4BY4A 2K61A 2LHIA 3EVRA 1PALA 2HPSA 1KSOA 2KGBC 1B1GA 2L50A 2FCDA 2JT8A 1TTXA 3SG6A 3SG7A 4OKHA 3TS5C 2MBXA 4A4BA 3CR2A 3VGOA 1SCMC 2WC8A 3I5IB 2KBIA 2K7OA 3OX5A 1QLKA 4GGFA 2OTGC 5CSFA 1G4YR 1XO5A 4GGNA 1MWNA 2KFFA 4AQJA 1DJIA 3K21A 1F8HA 1Y0VH 1UWOA 3TDIA 1F55A 5AXIA 1L7ZA 2LNKA 1CFFA 2CNPA 2LUCA 4MZKA 4PHKA 4MRYA 1J7OA 1UHIA 2M3WA 2K7CA 2ISDA 3JVTB 4HRGA 3BOWB 4PDZA 1XFVO 2K0JA 2GGZA 1K96A 1YVHA 4HSZA 4YGEB 5FYXA 3BUXB 1FBVA 1KSMA 4L9MA 2HETA 4YRUA 2L5XB 4GPLB 3GOFA 4WQ2A 4PE4A 3D0YA 1CTRA 1K93D 1B47A 1CFDA 1CMGA 1QIWA 1UHHA 2OS8C 1TCFA 1SR6C 1F4OA 2EGDA 2L4IA 4CIDA 4HRHA 5D69A 1HT9A 1NPQA 2JXCA 5CSIA 1KK7Y 3KF9A 1CM4A 2LVVA 2KI4B 1YRTB 1Y1UA 1OZSA 4DIRA 4CPVA 1K90D 1OMDA 2PSRA 3NSIA 1CB1A 4ETOA 1WRKA 5JJGA 3I5GC 1LKJA 1F54A 1KQMB 1OOJA 1BT6A 2KYCA 1YVLA 1SYMA 2WORA 1WLMA 2JNXA 1S26D 2CT9A 1EG3A 2M7NA 3EK7A 1UHKA 2LHLA 3GK2A 2K7BA 1SL8A 2WNDA 1CFPA 3I5HB 1BG1A 2LMVA 1OZOA 1S6JA 4P5OE 1S6CA 5I8NA 1S5GZ 4U8DA 1ZMZA 1PK0D 1UP5A 2LE9B 2QACA 5GQQC 1FF1A 2AAOA 1EXRA 1B8CA 1BJFA 2JQ6A 3SG3A 5ER4X 3TUYC 3RM1A 2LVIA 1K9UA 1B8LA 1OE9B 1ODBA 3EKHA 1YURA 1M63B 1NWDA 1AP4A 1S3PA 1V1GA 2PMYA 4XJKB 2B1UA 4A4CA 2AMIA 3BUOB 2E30A 1GGZA 3BXKA 1NIWA 3BOWA 2MA2A 4OV2A 3VROA 4M2QA 3AKAA 1H8BA 1PULA 4PHMA 1WY9A 1J1DA 3EK4A 1CNPA 2GV5A 1CFCA 1EG4A 3TDZA 4ICBA 4I5NB 4ORAB 2GGMA 2KQ6A 1KWOB 2BECA 3A4UB 1QS7A 2BE4A 2KAYA 3CR5X 4N5XA 1GQMA 5HLOA 1BLQA 2JU0A 2MLEC 2P6BB 3PLFB 1F70A 2M97A 2ZN8A 1BODA 2WCEA 1KK8C 2I18A 2NZ0A 3VRQA 3EK8A 4PE7A 2KFGA 4MRXA 1YUUA 1QX7A 3BUNB 2F2PA 1XFXO 3ICBA 1FI6A 1IH0A 1SL7A 1TNQA 1DGVA 3LCPC 3DVEA 3I5IC 1JFKA 1SKTA 5G08A 2M49B 2EC6C 2JC2A 5PALA 1K9PA 2Y1NA 3SG5A 5I2QA 2O5GA 4E68A 1IKUA 2F2OA 2V53A 4GAOA 5CSNA 4Q04A 3I5FB 1BR4B 1W7JB 1UUSA 4YGCB 2BCBA 3KO0A 2BKHB 1IWQA 1KFUL 3KHEA 1XK4A 3RLZA 2M1KB 4TNCA 1SRAA 2L51A 1KFXS 3SIAA 1IGVA 1OQPA 4NQGA 2WCFA 2MRDA 2JTTA 1RWYA 1B4CA 1SK6D 3FIAA 3AAKA 1TNWA 1IQ5A 3EVUA 3IQOA 2Q4UA 1N2DA 2KI6D 5F6TA 2SASA 3AKBA 1BOCA 3ZWHA 4XJKA 1S36A 3NSOA 2KGRA 1N0YA 4YGBB 3CZTX 3OHMB 2VRGA 2HQWA 1NP8A 5IBWA 2E6WA 1C7VA 4D1EA 2JT0A 1BF5A 2IS9A 1X02A 2K2AA 1F4QA 4PCWA 2NXQA 1BU3A 1QVIY 1K95A 1C7WA 1QX5B 1H4BA 4JPZB 1B7TY 1QATA 1DJZA 1L2OB 5I2LA 4C0LA 2BKIB 1A4PA 4I5KA 1ZOTB 4MZJA 5D7FA 2ZN9A 1HQVA 4DS7A 5B8IB 1WDCC 4JWQA 2CXJA 2I94A 1MQ1A 3FWCA 1SPYA 3TS5B 1FW4A 1LA0A 2F33A 2WOSA 1MR8A 2H61A 1SCMB 3CTNA 3DD4A 1M45A 1PVAA 1QV0A 3C1VA 1IJ5A 3DF0B 3I5HC 2LLTA 1OMVA 3TZ1A 2CTNA 3KPXA 1DGUA 4I5JA 2LCPA 3JTDC 2OTGB 3BUWB 1LVCD 2CBLA 1BR1B 2PALA 3LK0A 5CPVA 1CDLA 2K7DA 3HCMA 1QJTA 1Y1AA 1CKKA 4M2OA 1RROA 1A75A 1U5IB 2KNEA 1NCXA 4AQIA 1KFUS 1NSHA 1QXPA 2BL0B 2ZNEA 1AJ5A 2ZFDA 4MLWA 1TNXA 1SW8A 4GGFC 4DRWA 2KSPA 5TNCA 1LA3A 1KK7Z 5HKYA 1UHNA 2PVBA 3KEVA 5HLVA 4C0JA 2LC5A 2EHBA 1CMFA 2JPTA 1AK8A 1R6PA 5HKWA 2OS8B 2G9BA 3O6BA 3PFVA 1KWOC 4MVFA 1EJ3A 1SR6B 1A2XA 1YX7A 2O60A 2WCBA 3LL8B 3NSLA 4P2YB 1S6IA 2KOTA 2LMUA 1QX2A 2F8PA 3GK1A 3VRNA 1FI5A 3EKJA 4NDDA 1MHOA 1M39A 1WRLA 2JRFA 3LK1A 2KQYA 3SIBA 4PHNA 2KBMA 2NLNA 1K2HA 1RTP1 3PN7B 1AHRA 1QIVA 1SMGA 2JT3A 1NUBA 2LP3A 1JF2A 2M1UA 3PATA 4PE0A 1DMOA 1YTZC 1B9AA 3AAJA 3O2PA 2COLB 2A4JA 3D10A 5JOLA 1CDNA 4FTGA 1ZFSA 2FCEA 4CLNA 1TOPA 2CCMA 3PALA 1DF0B 3DF0A 4YGAA 5CSJA 1OMRA 2L4HA 1J7PA 2LP2A 1K9KA 1E8AA 1K8UA 4CFQA 1RJVA 2ZNDA 1U5IA 3PSRA 1SCVA 2PRUA 1NX2A 1AUIB 1WLZA 2JTZA 3TUYB 5AFPA 1RK9A 3CLNA 4IL1A 1IQ3A 1JWDA 1ALWA 1ALVA 3VRPA 1TN4A 4R1EA 1VRKA 2M8UA 4WQ3A 1M46A 3FS7A 1A75B 1LXFC 1QASA 2KAVA 1NX3A 1IRJA 1DJYA 2ZKMX 3CWGA 2KFHA 1IJ6A 1TCOB 1DJXA 1DT7B 2KDHA 1D1OA 1B8RA 1EL4A 1PRWA 2PASA 5K89A 1K94A 1KQVA 2BCXA 1XFYO 1ZACA 1MF8B 2JNFA 3JVTC 5HKZA 2JULA 4YBHB 1XVJA 2TN4A 2LVKA 1L2OC 1SY9A 1QTXA 5AANA 4N1FA 1KK8B 4DUQA 1NX1A 1V1FA 1JUOA 1ZUZA 2F3YA 2BE6A 2Y1MA 3TDUA 4JQ0D 4YGDB 5KTYA 2JXLA 3O4YA 2G2BA 4MN0A 4MBEA 1EH2A 1C07A 2LLUA 2EC6B 2KI4C 4HREE 2L98A 2LUXA 2K8MB 1RECA 1J55A 2MAZA 4XYNA 3WXAA 1DF0A 1MUXA 4GFTA 4PHJA 3SJSA 1A29A 1KQMC 1CLBA 4PE1A 5AEQA 2M0RA 1DJWA 3M0WA 1DVIA 2FJUB 2D8NA 1CLLA 1YRUB 1S1EA 2BL0C 3FWBA 2RGIA 1YX8A 3LLEA 3BQ3A 5J3XA 4GUKA 3CR4X 4ZCUA 2M9GA 2HQ8A 1NCZA 1Y1XA 4C0KA 3DVMA 1QVIZ 1XK4C 2BBNA 4MEWA 5KU1A 2AUCA 1GGWA 1B7TZ 2I7AA 4WRIA 1CDMA 2LVJA 1DJGA 3CGAA 1J7RA 5I2OA 1RFJA 2NCPA 4BY5A 1R2UA 2K2FA 2FOTA 4QJ5B 4MSPA 1PSBA 3NXAA 4I5LB 1PVBA 1XA5A 1S5GY 5KSZA 3A8RA 2L0PA 1KCYA 1UHJA 3PN7C 3WNXB 3WHTB 2Q91A 3GK4X 4M2PA 2Y5IA 3SG4A 2MJWB 2KHNA 1G33A 3DVKA 4DCKA 4ORBB 1CLMA 2DOQA 1WDCB 2BCAA 3CS1A 4F0ZB 1NCYA 1DTLA 1J1EA 3H4SE 3OB1B 2LLSA 1JF0A 1M31A 1NYAA 1JSAA 4GBAA 2L2EA 3QRXA 1AVSA 1SL9A 1UURA 2KI6C 2M29A 4OR9B 2KYFA 1XFZO 3PM8A 4CFRA 3JTDB 2LM5A
chains in the Genus database with same CATH superfamily
1CM1A 1XFWO 1QLSA 2MHHA 1LINA 3S0FA 3I5GB 2LAPA 2LANA 1XYDA 1KFXL 1C3ZA 2H61C 2LMTA 2QPTA 1JC2A 5DKQA 2Y4QA 4FQOA 3MSEB 1J7QA 1GJYA 1G8IA 2OPOA 3DVJA 4YI8A 3EVVA 3ZNIA 4AOMA 1YUTA 2MLFC 1JBAA 3I5FC 2WCMA 2F3ZA 3E3RA 1Y6WA 2LV7A 1DC1A 2KAXA 2L2CA 1SBJA 2JWWA 2BBMA 2ZRTA 1DJHA 1NX0A 1WRZA 3OX6A 2M7LA 1Z2CB 2ZRSA 4N1GA 4MZLA 5HYDA 5AERA 4PALA 2R2IA 4GNKB 1FPWA 1AJ4A 2WC5A 4ORCB 1TRFA 2NCOA 2JOJA 3VRRA 1MXLC 3B7AA 1XFUO 1C3YA 1MXEA 2HF5A 3D0YB 2SCPA 3HX4A 3L4AA 3R1PA 2JZIA 1SNLA 4OVNF 3F45A 4USLA 5DKRA 1Q80A 1TNPA 1CDPA 3IF7A 1TIZA 3RZSA 4NDBA 3BYAA 1YUSA 1W7IB 3SG2A 1IG5A 2H2KA 4QJ4B 4YI9A 4UPGA 1N65A 1QV1A 4QJ3B 3IQQA 1BMOA 1YR5A 3BUMB 3OP0A 5ER5A 3WHUB 5DKNA 4OCIA 1F71A 1OSAA 4ZCVA 3S0BA 1JFJA 3OB2B 3NSKA 5BPJA 4NDCA 2GTEA 2BAPA 1A03A 2WCJA 3NGVA 2I2RE 1PSRA 3O78A 2QEOA 2K61A 3PM8A 3L4LA 4BY4A 2LHIA 3PM2A 3EVRA 1PALA 2HPSA 1KSOA 2KGBC 1B1GA 1XFRA 1TWOA 2L50A 2FCDA 2JT8A 1TTXA 3SG6A 3SG7A 4OKHA 3TS5C 2MBXA 4A4BA 1TUZA 3CR2A 3VGOA 1SCMC 2WC8A 3I5IB 2KBIA 2ERBA 2K7OA 2P70A 3OX5A 5HL1A 1QLKA 4GGFA 2OTGC 5CSFA 1G4YR 1XO5A 3CZ0A 1MWNA 3DY9A 4GGNA 2KFFA 4AQJA 1DJIA 3K21A 1F8HA 2QEBA 3SS5A 1Y0VH 1UWOA 3TDIA 1F55A 5AXIA 1L7ZA 2LNKA 1CFFA 2CNPA 2LUCA 4MZKA 2L5YA 4PHKA 4MRYA 1J7OA 1UHIA 2M3WA 2K7CA 2ISDA 3JVTB 4HRGA 3BOWB 4PDZA 1XFVO 2K0JA 2GGZA 1K96A 1YVHA 4HSZA 4YGEB 5FYXA 3BUXB 1FBVA 1KSMA 4L9MA 2HETA 4YRUA 2L5XB 4GPLB 3GOFA 4WQ2A 4PE4A 3D0YA 1CTRA 1K93D 1B47A 1CFDA 1CMGA 1QIWA 1UHHA 2OS8C 1TCFA 1SR6C 1F4OA 2EGDA 2L4IA 3PJIA 4CIDA 4HRHA 5D69A 1HT9A 1NPQA 2JXCA 5CSIA 1KK7Y 3KF9A 1CM4A 2LVVA 5DICA 2KI4B 1YRTB 1OOHA 1Y1UA 1OZSA 4DIRA 4CPVA 1K90D 1OMDA 2FJYA 2PSRA 3NSIA 1CB1A 4ETOA 1WRKA 5JJGA 3I5GC 1LKJA 1P28A 1F54A 1KQMB 1OOJA 1BT6A 2KYCA 1YVLA 1SYMA 2WORA 1WLMA 2WC6A 2JNXA 1S26D 2CT9A 1EG3A 2M7NA 3EK7A 1UHKA 2LHLA 3GK2A 2K7BA 1SL8A 1OOFA 2WNDA 1CFPA 3I5HB 1BG1A 2LMVA 1OZOA 1S6JA 4P5OE 3EG5B 5D3OA 1S6CA 5I8NA 1S5GZ 4U8DA 1ZMZA 1PK0D 3FE6A 4JKTA 1UP5A 2H8VA 2LE9B 2QACA 5GQQC 1FF1A 2AAOA 1EXRA 1B8CA 1BJFA 2JQ6A 3SG3A 3FE9A 5ER4X 3TUYC 3RM1A 2LVIA 1K9UA 1B8LA 1OE9B 1ODBA 3NHIA 3EKHA 1YURA 1M63B 1DELA 1NWDA 1AP4A 1S3PA 1V1GA 2PMYA 4XJKB 2B1UA 4A4CA 2AMIA 3BUOB 2E30A 1GGZA 3BXKA 1NIWA 3BOWA 2MA2A 4OV2A 3VROA 4M2QA 3AKAA 1H8BA 5FI7A 1PULA 4PHMA 1WY9A 1J1DA 3EK4A 1CNPA 2GV5A 3D77A 1CFCA 1EG4A 5FI2A 3R1OA 3TDZA 4ICBA 4I5NB 4ORAB 2GGMA 2KQ6A 1KWOB 2BECA 3A4UB 1QS7A 2BE4A 2KAYA 3CR5X 3D74A 4N5XA 1GQMA 5HLOA 1BLQA 2JU0A 2MLEC 2P6BB 2JPOA 3PLFB 1F70A 2M97A 3D78A 2ZN8A 1BODA 2WCEA 1KK8C 2I18A 2NZ0A 3VRQA 3EK8A 4PE7A 2KFGA 4MRXA 1YUUA 1QX7A 2KLEA 3BUNB 2F2PA 1XFXO 3ICBA 1FI6A 1IH0A 1SL7A 1TNQA 1DGVA 3LCPC 3DVEA 3I5IC 1JFKA 1SKTA 5G08A 2M49B 2EC6C 2JC2A 5PALA 1K9PA 2Y1NA 3R1VA 3SG5A 5I2QA 2O5GA 4E68A 1IKUA 2F2OA 2QEVA 2V53A 4GAOA 5CSNA 4Q04A 3I5FB 1BR4B 1W7JB 1UUSA 3S0AA 4YGCB 2BCBA 3KO0A 2BKHB 1IWQA 1KFUL 3KHEA 1XK4A 3RLZA 2M1KB 4TNCA 1SRAA 2L51A 1KFXS 3SIAA 3V2LA 1IGVA 1OQPA 4NQGA 4OZDA 2WCFA 2MRDA 3B88A 2JTTA 1RWYA 1B4CA 1SK6D 3FIAA 3OBVA 3AAKA 1TNWA 1IQ5A 3EVUA 3IQOA 3S0GA 2Q4UA 1N2DA 2KI6D 5F6TA 2SASA 3AKBA 1BOCA 3ZWHA 4XJKA 1S36A 2WCLA 1K2HA 3S0EA 3NSOA 2KGRA 1N0YA 4YGBB 3CZTX 3OHMB 2VRGA 2HQWA 1NP8A 5IBWA 2E6WA 1C7VA 4D1EA 2JT0A 1BF5A 2IS9A 2QEHA 1X02A 2K2AA 1F4QA 4KYNA 4PCWA 2NXQA 1BU3A 1QVIY 3Q8IA 1K95A 1C7WA 1QX5B 1H4BA 4JPZB 1B7TY 3BFHA 1QATA 5EL2A 5FI6A 1DJZA 1L2OB 5I2LA 3B87A 4C0LA 2BKIB 1A4PA 4I5KA 1OOIX 1OW4A 1ZOTB 4MZJA 5D7FA 2ZN9A 1HQVA 4DS7A 5B8IB 1WDCC 4JWQA 2CXJA 2I94A 1MQ1A 2QDIA 3FWCA 1SPYA 3TS5B 1FW4A 1LA0A 2F33A 2WOSA 1MR8A 2H61A 1SCMB 3CTNA 3DD4A 1M45A 1PVAA 1QV0A 3C1VA 4MVFA 1IJ5A 2PQLA 3L47A 3DF0B 3I5HC 2LLTA 1OMVA 3TZ1A 2CTNA 3KPXA 1DGUA 4I5JA 2LCPA 3JTDC 2OTGB 3BUWB 1LVCD 2CBLA 1BR1B 2PALA 3LK0A 5CPVA 1CDLA 2K7DA 3HCMA 1QJTA 1Y1AA 1CKKA 4M2OA 1RROA 1A75A 1U5IB 2KLDA 2KNEA 1NCXA 4AQIA 1KFUS 1NSHA 1QXPA 2BL0B 2PYQA 2K60A 1AJ5A 2ZFDA 2ZNEA 4MLWA 1TNXA 1SW8A 4GGFC 4DRWA 2KSPA 3B86A 5TNCA 3UO9A 1LA3A 1KK7Z 5HKYA 5I94A 1UHNA 2PVBA 3KEVA 5HLVA 4C0JA 2LC5A 2EHBA 1CMFA 2JPTA 1AK8A 1R6PA 5HKWA 4JD9A 3SS4A 3VB1A 2OS8B 1DEKA 2G9BA 3CDNA 1KWOC 3O6BA 1EJ3A 1SR6B 1A2XA 1YX7A 2O60A 2WCBA 3LL8B 3NSLA 4P2YB 1S6IA 2KOTA 1OOGA 2LMUA 1QX2A 2F8PA 3GK1A 3VRNA 1ORGA 1FI5A 3EKJA 4NDDA 1MHOA 1M39A 1WRLA 2JRFA 3B6XA 2KQYA 3LK1A 4PHNA 2KBMA 2NLNA 3BFAA 3SIBA 1RTP1 3PN7B 1AHRA 1QIVA 1SMGA 2JT3A 1NUBA 2LP3A 1JF2A 2M1UA 3PATA 4PE0A 3D76A 1Z4HA 1DMOA 1YTZC 1B9AA 3AAJA 3O2PA 4INXA 2COLB 3DYEA 2A4JA 3D10A 5JOLA 1CDNA 4FTGA 1ZFSA 2FCEA 4CLNA 1TOPA 2CCMA 3CZ2A 4FQTA 3PALA 1DF0B 3DF0A 4YGAA 5CSJA 1OMRA 2L4HA 4F7FA 1J7PA 2LP2A 1K9KA 1E8AA 3OGNA 1K8UA 4CFQA 1RJVA 2ZNDA 1QWVA 3O4XA 1U5IA 3PSRA 1SCVA 2PRUA 1NX2A 1AUIB 1WLZA 2JTZA 3TUYB 3R72A 5AFPA 1RK9A 3CABA 1IIOA 3CLNA 4IL1A 1IQ3A 1JWDA 1ALWA 1ALVA 3VRPA 1TN4A 4R1EA 3SS3A 1DQEA 1VRKA 2M8UA 4WQ3A 1M46A 3FS7A 2KPHA 1A75B 1LXFC 1QASA 2KAVA 1NX3A 1IRJA 1DJYA 2ZKMX 3CWGA 2KFHA 1IJ6A 1TCOB 2BNXA 3D75A 1DJXA 1DT7B 2KDHA 1D1OA 1B8RA 1EL4A 1PRWA 1W9ZA 2PASA 3PFVA 1K94A 5K89A 1KQVA 2BCXA 1XFYO 1ZACA 1MF8B 2JNFA 3JVTC 4INWA 4PT1A 5HKZA 2JULA 4YBHB 1XVJA 2TN4A 2LVKA 1L2OC 1SY9A 3FE8A 1QTXA 5AANA 3BJHA 4N1FA 1KK8B 4DUQA 1NX1A 1V1FA 1JUOA 1ZUZA 2F3YA 2BE6A 2Y1MA 3TDUA 2P71A 3UNWA 4JQ0D 4YGDB 5KTYA 2JXLA 3O4YA 3NHTA 2G2BA 3N7HA 4MN0A 3D73A 4MBEA 1EH2A 1C07A 2LLUA 2EC6B 2KI4C 4HREE 2L98A 2LUXA 2K8MB 1RECA 3DXLA 1J55A 2MAZA 4XYNA 3WXAA 1DF0A 1MUXA 3IVTA 4GFTA 4PHJA 3SJSA 1A29A 1KQMC 1CLBA 4PE1A 5AEQA 2M0RA 1DJWA 3M0WA 1GM0A 1DVIA 2WCHA 2FJUB 2D8NA 1CLLA 3S0DA 1YRUB 1S1EA 2BL0C 3FWBA 2RGIA 1YX8A 3LLEA 2YGUA 3BQ3A 4GUKA 5J3XA 2WCKA 3QMEA 3CR4X 4ZCUA 2M9GA 2HQ8A 1NCZA 1Y1XA 4C0KA 3DVMA 3CYZA 1QVIZ 1XK4C 2BBNA 4MEWA 5KU1A 2AUCA 1GGWA 1B7TZ 2I7AA 4WRIA 1CDMA 2LVJA 1DJGA 3CGAA 1J7RA 5I2OA 1RFJA 1TUJA 2NCPA 4BY5A 1R2UA 2K2FA 3DZTA 2FOTA 4QJ5B 4MSPA 1PSBA 3NXAA 1SSEB 4I5LB 1PVBA 1XA5A 1S5GY 5KSZA 3A8RA 2L0PA 1KCYA 1UHJA 3PN7C 3WNXB 3WHTB 2Q91A 3GK4X 4M2PA 1T14A 2Y5IA 3SG4A 2MJWB 2KHNA 3BFBA 1G33A 3DVKA 4DCKA 4ORBB 1CLMA 2DOQA 1WDCB 2BCAA 3CS1A 4F0ZB 1NCYA 1DTLA 4IJ7A 1J1EA 3H4SE 3OB1B 2LLSA 1JF0A 1M31A 1NYAA 1JSAA 3K1EA 1LS8A 2L2EA 3QRXA 4GBAA 1AVSA 1SL9A 1UURA 2KI6C 2M29A 4OR9B 2KYFA 1XFZO 3CZ1A 4CFRA 3JTDB 2LM5A
chains in the Genus database with same CATH topology
1CM1A 1XFWO 1QLSA 2MHHA 1LINA 3I5GB 2LAPA 2LANA 1XYDA 1KFXL 2H61C 2LMTA 2QPTA 1JC2A 5DKQA 2Y4QA 4FQOA 3MSEB 1J7QA 1GJYA 1G8IA 2OPOA 3DVJA 4YI8A 3EVVA 3ZNIA 4AOMA 1YUTA 2MLFC 1JBAA 3I5FC 3E3RA 2F3ZA 1Y6WA 2LV7A 2KAXA 1SBJA 2JWWA 2BBMA 2ZRTA 1DJHA 1NX0A 1WRZA 3OX6A 2M7LA 2ZRSA 4N1GA 4MZLA 5HYDA 5AERA 4PALA 2R2IA 4GNKB 1FPWA 1AJ4A 4ORCB 1TRFA 2NCOA 2JOJA 3VRRA 1MXLC 1XFUO 1MXEA 2HF5A 3D0YB 2SCPA 3HX4A 4OVNF 2JZIA 1SNLA 3F45A 4USLA 5DKRA 1Q80A 1TNPA 1CDPA 3IF7A 1TIZA 4NDBA 3BYAA 1YUSA 1W7IB 3SG2A 1IG5A 2H2KA 4QJ4B 4YI9A 4UPGA 1N65A 1QV1A 4QJ3B 3IQQA 1BMOA 1YR5A 3BUMB 3OP0A 5ER5A 3WHUB 5DKNA 4OCIA 1F71A 1OSAA 4ZCVA 1JFJA 3OB2B 3NSKA 5BPJA 4NDCA 1A03A 2I2RE 1PSRA 3O78A 4BY4A 2K61A 2LHIA 3EVRA 1PALA 2HPSA 1KSOA 2KGBC 1B1GA 2L50A 2FCDA 2JT8A 1TTXA 3SG6A 3SG7A 4OKHA 3TS5C 2MBXA 4A4BA 3CR2A 3VGOA 1SCMC 2WC8A 3I5IB 2KBIA 2K7OA 3OX5A 1QLKA 4GGFA 2OTGC 5CSFA 1G4YR 1XO5A 4GGNA 1MWNA 2KFFA 4AQJA 1DJIA 3K21A 1F8HA 1Y0VH 1UWOA 3TDIA 1F55A 5AXIA 1L7ZA 2LNKA 1CFFA 2CNPA 2LUCA 4MZKA 4PHKA 4MRYA 1J7OA 1UHIA 2M3WA 2K7CA 2ISDA 3JVTB 4HRGA 3BOWB 4PDZA 1XFVO 2K0JA 2GGZA 1K96A 1YVHA 4HSZA 4YGEB 5FYXA 3BUXB 1FBVA 1KSMA 4L9MA 2HETA 4YRUA 2L5XB 4GPLB 3GOFA 4WQ2A 4PE4A 3D0YA 1CTRA 1K93D 1B47A 1CFDA 1CMGA 1QIWA 1UHHA 2OS8C 1TCFA 1SR6C 1F4OA 2EGDA 2L4IA 4CIDA 4HRHA 5D69A 1HT9A 1NPQA 2JXCA 5CSIA 1KK7Y 3KF9A 1CM4A 2LVVA 2KI4B 1YRTB 1Y1UA 1OZSA 4DIRA 4CPVA 1K90D 1OMDA 2PSRA 3NSIA 1CB1A 4ETOA 1WRKA 5JJGA 3I5GC 1LKJA 1F54A 1KQMB 1OOJA 1BT6A 2KYCA 1YVLA 1SYMA 2WORA 1WLMA 2JNXA 1S26D 2CT9A 1EG3A 2M7NA 3EK7A 1UHKA 2LHLA 3GK2A 2K7BA 1SL8A 2WNDA 1CFPA 3I5HB 1BG1A 2LMVA 1OZOA 1S6JA 4P5OE 1S6CA 5I8NA 1S5GZ 4U8DA 1ZMZA 1PK0D 1UP5A 2LE9B 2QACA 5GQQC 1FF1A 2AAOA 1EXRA 1B8CA 1BJFA 2JQ6A 3SG3A 5ER4X 3TUYC 3RM1A 2LVIA 1K9UA 1B8LA 1OE9B 1ODBA 3EKHA 1YURA 1M63B 1NWDA 1AP4A 1S3PA 1V1GA 2PMYA 4XJKB 2B1UA 4A4CA 2AMIA 3BUOB 2E30A 1GGZA 3BXKA 1NIWA 3BOWA 2MA2A 4OV2A 3VROA 4M2QA 3AKAA 1H8BA 1PULA 4PHMA 1WY9A 1J1DA 3EK4A 1CNPA 2GV5A 1CFCA 1EG4A 3TDZA 4ICBA 4I5NB 4ORAB 2GGMA 2KQ6A 1KWOB 2BECA 3A4UB 1QS7A 2BE4A 2KAYA 3CR5X 4N5XA 1GQMA 5HLOA 1BLQA 2JU0A 2MLEC 2P6BB 3PLFB 1F70A 2M97A 2ZN8A 1BODA 2WCEA 1KK8C 2I18A 2NZ0A 3VRQA 3EK8A 4PE7A 2KFGA 4MRXA 1YUUA 1QX7A 3BUNB 2F2PA 1XFXO 3ICBA 1FI6A 1IH0A 1SL7A 1TNQA 1DGVA 3LCPC 3DVEA 3I5IC 1JFKA 1SKTA 5G08A 2M49B 2EC6C 2JC2A 5PALA 1K9PA 2Y1NA 3SG5A 5I2QA 2O5GA 4E68A 1IKUA 2F2OA 2V53A 4GAOA 5CSNA 4Q04A 3I5FB 1BR4B 1W7JB 1UUSA 4YGCB 2BCBA 3KO0A 2BKHB 1IWQA 1KFUL 3KHEA 1XK4A 3RLZA 2M1KB 4TNCA 1SRAA 2L51A 1KFXS 3SIAA 1IGVA 1OQPA 4NQGA 2WCFA 2MRDA 2JTTA 1RWYA 1B4CA 1SK6D 3FIAA 3AAKA 1TNWA 1IQ5A 3EVUA 3IQOA 2Q4UA 1N2DA 2KI6D 5F6TA 2SASA 3AKBA 1BOCA 3ZWHA 4XJKA 1S36A 3NSOA 2KGRA 1N0YA 4YGBB 3CZTX 3OHMB 2VRGA 2HQWA 1NP8A 5IBWA 2E6WA 1C7VA 4D1EA 2JT0A 1BF5A 2IS9A 1X02A 2K2AA 1F4QA 4PCWA 2NXQA 1BU3A 1QVIY 1K95A 1C7WA 1QX5B 1H4BA 4JPZB 1B7TY 1QATA 1DJZA 1L2OB 5I2LA 4C0LA 2BKIB 1A4PA 4I5KA 1ZOTB 4MZJA 5D7FA 2ZN9A 1HQVA 4DS7A 5B8IB 1WDCC 4JWQA 2CXJA 2I94A 1MQ1A 3FWCA 1SPYA 3TS5B 1FW4A 1LA0A 2F33A 2WOSA 1MR8A 2H61A 1SCMB 3CTNA 3DD4A 1M45A 1PVAA 1QV0A 3C1VA 1IJ5A 3DF0B 3I5HC 2LLTA 1OMVA 3TZ1A 2CTNA 3KPXA 1DGUA 4I5JA 2LCPA 3JTDC 2OTGB 3BUWB 1LVCD 2CBLA 1BR1B 2PALA 3LK0A 5CPVA 1CDLA 2K7DA 3HCMA 1QJTA 1Y1AA 1CKKA 4M2OA 1RROA 1A75A 1U5IB 2KNEA 1NCXA 4AQIA 1KFUS 1NSHA 1QXPA 2BL0B 2ZNEA 1AJ5A 2ZFDA 4MLWA 1TNXA 1SW8A 4GGFC 4DRWA 2KSPA 5TNCA 1LA3A 1KK7Z 5HKYA 1UHNA 2PVBA 3KEVA 5HLVA 4C0JA 2LC5A 2EHBA 1CMFA 2JPTA 1AK8A 1R6PA 5HKWA 2OS8B 2G9BA 3O6BA 3PFVA 1KWOC 4MVFA 1EJ3A 1SR6B 1A2XA 1YX7A 2O60A 2WCBA 3LL8B 3NSLA 4P2YB 1S6IA 2KOTA 2LMUA 1QX2A 2F8PA 3GK1A 3VRNA 1FI5A 3EKJA 4NDDA 1MHOA 1M39A 1WRLA 2JRFA 3LK1A 2KQYA 3SIBA 4PHNA 2KBMA 2NLNA 1K2HA 1RTP1 3PN7B 1AHRA 1QIVA 1SMGA 2JT3A 1NUBA 2LP3A 1JF2A 2M1UA 3PATA 4PE0A 1DMOA 1YTZC 1B9AA 3AAJA 3O2PA 2COLB 2A4JA 3D10A 5JOLA 1CDNA 4FTGA 1ZFSA 2FCEA 4CLNA 1TOPA 2CCMA 3PALA 1DF0B 3DF0A 4YGAA 5CSJA 1OMRA 2L4HA 1J7PA 2LP2A 1K9KA 1E8AA 1K8UA 4CFQA 1RJVA 2ZNDA 1U5IA 3PSRA 1SCVA 2PRUA 1NX2A 1AUIB 1WLZA 2JTZA 3TUYB 5AFPA 1RK9A 3CLNA 4IL1A 1IQ3A 1JWDA 1ALWA 1ALVA 3VRPA 1TN4A 4R1EA 1VRKA 2M8UA 4WQ3A 1M46A 3FS7A 1A75B 1LXFC 1QASA 2KAVA 1NX3A 1IRJA 1DJYA 2ZKMX 3CWGA 2KFHA 1IJ6A 1TCOB 1DJXA 1DT7B 2KDHA 1D1OA 1B8RA 1EL4A 1PRWA 2PASA 5K89A 1K94A 1KQVA 2BCXA 1XFYO 1ZACA 1MF8B 2JNFA 3JVTC 5HKZA 2JULA 4YBHB 1XVJA 2TN4A 2LVKA 1L2OC 1SY9A 1QTXA 5AANA 4N1FA 1KK8B 4DUQA 1NX1A 1V1FA 1JUOA 1ZUZA 2F3YA 2BE6A 2Y1MA 3TDUA 4JQ0D 4YGDB 5KTYA 2JXLA 3O4YA 2G2BA 4MN0A 4MBEA 1EH2A 1C07A 2LLUA 2EC6B 2KI4C 4HREE 2L98A 2LUXA 2K8MB 1RECA 1J55A 2MAZA 4XYNA 3WXAA 1DF0A 1MUXA 4GFTA 4PHJA 3SJSA 1A29A 1KQMC 1CLBA 4PE1A 5AEQA 2M0RA 1DJWA 3M0WA 1DVIA 2FJUB 2D8NA 1CLLA 1YRUB 1S1EA 2BL0C 3FWBA 2RGIA 1YX8A 3LLEA 3BQ3A 5J3XA 4GUKA 3CR4X 4ZCUA 2M9GA 2HQ8A 1NCZA 1Y1XA 4C0KA 3DVMA 1QVIZ 1XK4C 2BBNA 4MEWA 5KU1A 2AUCA 1GGWA 1B7TZ 2I7AA 4WRIA 1CDMA 2LVJA 1DJGA 3CGAA 1J7RA 5I2OA 1RFJA 2NCPA 4BY5A 1R2UA 2K2FA 2FOTA 4QJ5B 4MSPA 1PSBA 3NXAA 4I5LB 1PVBA 1XA5A 1S5GY 5KSZA 3A8RA 2L0PA 1KCYA 1UHJA 3PN7C 3WNXB 3WHTB 2Q91A 3GK4X 4M2PA 2Y5IA 3SG4A 2MJWB 2KHNA 1G33A 3DVKA 4DCKA 4ORBB 1CLMA 2DOQA 1WDCB 2BCAA 3CS1A 4F0ZB 1NCYA 1DTLA 1J1EA 3H4SE 3OB1B 2LLSA 1JF0A 1M31A 1NYAA 1JSAA 4GBAA 2L2EA 3QRXA 1AVSA 1SL9A 1UURA 2KI6C 2M29A 4OR9B 2KYFA 1XFZO 3PM8A 4CFRA 3JTDB 2LM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM1 A;  1XFW O;  1QLS A;  2MHH A;  1LIN A;  3I5G B;  2LAP A;  2LAN A;  1XYD A;  1KFX L;  2H61 C;  2LMT A;  2QPT A;  1JC2 A;  5DKQ A;  2Y4Q A;  4FQO A;  3MSE B;  1J7Q A;  1GJY A;  1G8I A;  2OPO A;  3DVJ A;  4YI8 A;  3EVV A;  3ZNI A;  4AOM A;  1YUT A;  2MLF C;  1JBA A;  3I5F C;  3E3R A;  2F3Z A;  1Y6W A;  2LV7 A;  2KAX A;  1SBJ A;  2JWW A;  2BBM A;  2ZRT A;  1DJH A;  1NX0 A;  1WRZ A;  3OX6 A;  2M7L A;  2ZRS A;  4N1G A;  4MZL A;  5HYD A;  5AER A;  4PAL A;  2R2I A;  4GNK B;  1FPW A;  1AJ4 A;  4ORC B;  1TRF A;  2NCO A;  2JOJ A;  3VRR A;  1MXL C;  1XFU O;  1MXE A;  2HF5 A;  3D0Y B;  2SCP A;  3HX4 A;  4OVN F;  2JZI A;  1SNL A;  3F45 A;  4USL A;  5DKR A;  1Q80 A;  1TNP A;  1CDP A;  3IF7 A;  1TIZ A;  4NDB A;  3BYA A;  1YUS A;  1W7I B;  3SG2 A;  1IG5 A;  2H2K A;  4QJ4 B;  4YI9 A;  4UPG A;  1N65 A;  1QV1 A;  4QJ3 B;  3IQQ A;  1BMO A;  1YR5 A;  3BUM B;  3OP0 A;  5ER5 A;  3WHU B;  5DKN A;  4OCI A;  1F71 A;  1OSA A;  4ZCV A;  1JFJ A;  3OB2 B;  3NSK A;  5BPJ A;  4NDC A;  1A03 A;  2I2R E;  1PSR A;  3O78 A;  4BY4 A;  2K61 A;  2LHI A;  3EVR A;  1PAL A;  2HPS A;  1KSO A;  2KGB C;  1B1G A;  2L50 A;  2FCD A;  2JT8 A;  1TTX A;  3SG6 A;  3SG7 A;  4OKH A;  3TS5 C;  2MBX A;  4A4B A;  3CR2 A;  3VGO A;  1SCM C;  2WC8 A;  3I5I B;  2KBI A;  2K7O A;  3OX5 A;  1QLK A;  4GGF A;  2OTG C;  5CSF A;  1G4Y R;  1XO5 A;  4GGN A;  1MWN A;  2KFF A;  4AQJ A;  1DJI A;  3K21 A;  1F8H A;  1Y0V H;  1UWO A;  3TDI A;  1F55 A;  5AXI A;  1L7Z A;  2LNK A;  1CFF A;  2CNP A;  2LUC A;  4MZK A;  4PHK A;  4MRY A;  1J7O A;  1UHI A;  2M3W A;  2K7C A;  2ISD A;  3JVT B;  4HRG A;  3BOW B;  4PDZ A;  1XFV O;  2K0J A;  2GGZ A;  1K96 A;  1YVH A;  4HSZ A;  4YGE B;  5FYX A;  3BUX B;  1FBV A;  1KSM A;  4L9M A;  2HET A;  4YRU A;  2L5X B;  4GPL B;  3GOF A;  4WQ2 A;  4PE4 A;  3D0Y A;  1CTR A;  1K93 D;  1B47 A;  1CFD A;  1CMG A;  1QIW A;  1UHH A;  2OS8 C;  1TCF A;  1SR6 C;  1F4O A;  2EGD A;  2L4I A;  4CID A;  4HRH A;  5D69 A;  1HT9 A;  1NPQ A;  2JXC A;  5CSI A;  1KK7 Y;  3KF9 A;  1CM4 A;  2LVV A;  2KI4 B;  1YRT B;  1Y1U A;  1OZS A;  4DIR A;  4CPV A;  1K90 D;  1OMD A;  2PSR A;  3NSI A;  1CB1 A;  4ETO A;  1WRK A;  5JJG A;  3I5G C;  1LKJ A;  1F54 A;  1KQM B;  1OOJ A;  1BT6 A;  2KYC A;  1YVL A;  1SYM A;  2WOR A;  1WLM A;  2JNX A;  1S26 D;  2CT9 A;  1EG3 A;  2M7N A;  3EK7 A;  1UHK A;  2LHL A;  3GK2 A;  2K7B A;  1SL8 A;  2WND A;  1CFP A;  3I5H B;  1BG1 A;  2LMV A;  1OZO A;  1S6J A;  4P5O E;  1S6C A;  5I8N A;  1S5G Z;  4U8D A;  1ZMZ A;  1PK0 D;  1UP5 A;  2LE9 B;  2QAC A;  5GQQ C;  1FF1 A;  2AAO A;  1EXR A;  1B8C A;  1BJF A;  2JQ6 A;  3SG3 A;  5ER4 X;  3TUY C;  3RM1 A;  2LVI A;  1K9U A;  1B8L A;  1OE9 B;  1ODB A;  3EKH A;  1YUR A;  1M63 B;  1NWD A;  1AP4 A;  1S3P A;  1V1G A;  2PMY A;  4XJK B;  2B1U A;  4A4C A;  2AMI A;  3BUO B;  2E30 A;  1GGZ A;  3BXK A;  1NIW A;  3BOW A;  2MA2 A;  4OV2 A;  3VRO A;  4M2Q A;  3AKA A;  1H8B A;  1PUL A;  4PHM A;  1WY9 A;  1J1D A;  3EK4 A;  1CNP A;  2GV5 A;  1CFC A;  1EG4 A;  3TDZ A;  4ICB A;  4I5N B;  4ORA B;  2GGM A;  2KQ6 A;  1KWO B;  2BEC A;  3A4U B;  1QS7 A;  2BE4 A;  2KAY A;  3CR5 X;  4N5X A;  1GQM A;  5HLO A;  1BLQ A;  2JU0 A;  2MLE C;  2P6B B;  3PLF B;  1F70 A;  2M97 A;  2ZN8 A;  1BOD A;  2WCE A;  1KK8 C;  2I18 A;  2NZ0 A;  3VRQ A;  3EK8 A;  4PE7 A;  2KFG A;  4MRX A;  1YUU A;  1QX7 A;  3BUN B;  2F2P A;  1XFX O;  3ICB A;  1FI6 A;  1IH0 A;  1SL7 A;  1TNQ A;  1DGV A;  3LCP C;  3DVE A;  3I5I C;  1JFK A;  1SKT A;  5G08 A;  2M49 B;  2EC6 C;  2JC2 A;  5PAL A;  1K9P A;  2Y1N A;  3SG5 A;  5I2Q A;  2O5G A;  4E68 A;  1IKU A;  2F2O A;  2V53 A;  4GAO A;  5CSN A;  4Q04 A;  3I5F B;  1BR4 B;  1W7J B;  1UUS A;  4YGC B;  2BCB A;  3KO0 A;  2BKH B;  1IWQ A;  1KFU L;  3KHE A;  1XK4 A;  3RLZ A;  2M1K B;  4TNC A;  1SRA A;  2L51 A;  1KFX S;  3SIA A;  1IGV A;  1OQP A;  4NQG A;  2WCF A;  2MRD A;  2JTT A;  1RWY A;  1B4C A;  1SK6 D;  3FIA A;  3AAK A;  1TNW A;  1IQ5 A;  3EVU A;  3IQO A;  2Q4U A;  1N2D A;  2KI6 D;  5F6T A;  2SAS A;  3AKB A;  1BOC A;  3ZWH A;  4XJK A;  1S36 A;  3NSO A;  2KGR A;  1N0Y A;  4YGB B;  3CZT X;  3OHM B;  2VRG A;  2HQW A;  1NP8 A;  5IBW A;  2E6W A;  1C7V A;  4D1E A;  2JT0 A;  1BF5 A;  2IS9 A;  1X02 A;  2K2A A;  1F4Q A;  4PCW A;  2NXQ A;  1BU3 A;  1QVI Y;  1K95 A;  1C7W A;  1QX5 B;  1H4B A;  4JPZ B;  1B7T Y;  1QAT A;  1DJZ A;  1L2O B;  5I2L A;  4C0L A;  2BKI B;  1A4P A;  4I5K A;  1ZOT B;  4MZJ A;  5D7F A;  2ZN9 A;  1HQV A;  4DS7 A;  5B8I B;  1WDC C;  4JWQ A;  2CXJ A;  2I94 A;  1MQ1 A;  3FWC A;  1SPY A;  3TS5 B;  1FW4 A;  1LA0 A;  2F33 A;  2WOS A;  1MR8 A;  2H61 A;  1SCM B;  3CTN A;  3DD4 A;  1M45 A;  1PVA A;  1QV0 A;  3C1V A;  1IJ5 A;  3DF0 B;  3I5H C;  2LLT A;  1OMV A;  3TZ1 A;  2CTN A;  3KPX A;  1DGU A;  4I5J A;  2LCP A;  3JTD C;  2OTG B;  3BUW B;  1LVC D;  2CBL A;  1BR1 B;  2PAL A;  3LK0 A;  5CPV A;  1CDL A;  2K7D A;  3HCM A;  1QJT A;  1Y1A A;  1CKK A;  4M2O A;  1RRO A;  1A75 A;  1U5I B;  2KNE A;  1NCX A;  4AQI A;  1KFU S;  1NSH A;  1QXP A;  2BL0 B;  2ZNE A;  1AJ5 A;  2ZFD A;  4MLW A;  1TNX A;  1SW8 A;  4GGF C;  4DRW A;  2KSP A;  5TNC A;  1LA3 A;  1KK7 Z;  5HKY A;  1UHN A;  2PVB A;  3KEV A;  5HLV A;  4C0J A;  2LC5 A;  2EHB A;  1CMF A;  2JPT A;  1AK8 A;  1R6P A;  5HKW A;  2OS8 B;  2G9B A;  3O6B A;  3PFV A;  1KWO C;  4MVF A;  1EJ3 A;  1SR6 B;  1A2X A;  1YX7 A;  2O60 A;  2WCB A;  3LL8 B;  3NSL A;  4P2Y B;  1S6I A;  2KOT A;  2LMU A;  1QX2 A;  2F8P A;  3GK1 A;  3VRN A;  1FI5 A;  3EKJ A;  4NDD A;  1MHO A;  1M39 A;  1WRL A;  2JRF A;  3LK1 A;  2KQY A;  3SIB A;  4PHN A;  2KBM A;  2NLN A;  1K2H A;  1RTP 1;  3PN7 B;  1AHR A;  1QIV A;  1SMG A;  2JT3 A;  1NUB A;  2LP3 A;  1JF2 A;  2M1U A;  3PAT A;  4PE0 A;  1DMO A;  1YTZ C;  1B9A A;  3AAJ A;  3O2P A;  2COL B;  2A4J A;  3D10 A;  5JOL A;  1CDN A;  4FTG A;  1ZFS A;  2FCE A;  4CLN A;  1TOP A;  2CCM A;  3PAL A;  1DF0 B;  3DF0 A;  4YGA A;  5CSJ A;  1OMR A;  2L4H A;  1J7P A;  2LP2 A;  1K9K A;  1E8A A;  1K8U A;  4CFQ A;  1RJV A;  2ZND A;  1U5I A;  3PSR A;  1SCV A;  2PRU A;  1NX2 A;  1AUI B;  1WLZ A;  2JTZ A;  3TUY B;  5AFP A;  1RK9 A;  3CLN A;  4IL1 A;  1IQ3 A;  1JWD A;  1ALW A;  1ALV A;  3VRP A;  1TN4 A;  4R1E A;  1VRK A;  2M8U A;  4WQ3 A;  1M46 A;  3FS7 A;  1A75 B;  1LXF C;  1QAS A;  2KAV A;  1NX3 A;  1IRJ A;  1DJY A;  2ZKM X;  3CWG A;  2KFH A;  1IJ6 A;  1TCO B;  1DJX A;  1DT7 B;  2KDH A;  1D1O A;  1B8R A;  1EL4 A;  1PRW A;  2PAS A;  5K89 A;  1K94 A;  1KQV A;  2BCX A;  1XFY O;  1ZAC A;  1MF8 B;  2JNF A;  3JVT C;  5HKZ A;  2JUL A;  4YBH B;  1XVJ A;  2TN4 A;  2LVK A;  1L2O C;  1SY9 A;  1QTX A;  5AAN A;  4N1F A;  1KK8 B;  4DUQ A;  1NX1 A;  1V1F A;  1JUO A;  1ZUZ A;  2F3Y A;  2BE6 A;  2Y1M A;  3TDU A;  4JQ0 D;  4YGD B;  5KTY A;  2JXL A;  3O4Y A;  2G2B A;  4MN0 A;  4MBE A;  1EH2 A;  1C07 A;  2LLU A;  2EC6 B;  2KI4 C;  4HRE E;  2L98 A;  2LUX A;  2K8M B;  1REC A;  1J55 A;  2MAZ A;  4XYN A;  3WXA A;  1DF0 A;  1MUX A;  4GFT A;  4PHJ A;  3SJS A;  1A29 A;  1KQM C;  1CLB A;  4PE1 A;  5AEQ A;  2M0R A;  1DJW A;  3M0W A;  1DVI A;  2FJU B;  2D8N A;  1CLL A;  1YRU B;  1S1E A;  2BL0 C;  3FWB A;  2RGI A;  1YX8 A;  3LLE A;  3BQ3 A;  5J3X A;  4GUK A;  3CR4 X;  4ZCU A;  2M9G A;  2HQ8 A;  1NCZ A;  1Y1X A;  4C0K A;  3DVM A;  1QVI Z;  1XK4 C;  2BBN A;  4MEW A;  5KU1 A;  2AUC A;  1GGW A;  1B7T Z;  2I7A A;  4WRI A;  1CDM A;  2LVJ A;  1DJG A;  3CGA A;  1J7R A;  5I2O A;  1RFJ A;  2NCP A;  4BY5 A;  1R2U A;  2K2F A;  2FOT A;  4QJ5 B;  4MSP A;  1PSB A;  3NXA A;  4I5L B;  1PVB A;  1XA5 A;  1S5G Y;  5KSZ A;  3A8R A;  2L0P A;  1KCY A;  1UHJ A;  3PN7 C;  3WNX B;  3WHT B;  2Q91 A;  3GK4 X;  4M2P A;  2Y5I A;  3SG4 A;  2MJW B;  2KHN A;  1G33 A;  3DVK A;  4DCK A;  4ORB B;  1CLM A;  2DOQ A;  1WDC B;  2BCA A;  3CS1 A;  4F0Z B;  1NCY A;  1DTL A;  1J1E A;  3H4S E;  3OB1 B;  2LLS A;  1JF0 A;  1M31 A;  1NYA A;  1JSA A;  4GBA A;  2L2E A;  3QRX A;  1AVS A;  1SL9 A;  1UUR A;  2KI6 C;  2M29 A;  4OR9 B;  2KYF A;  1XFZ O;  3PM8 A;  4CFR A;  3JTD B;  2LM5 A; 
#chains in the Genus database with same CATH topology
 1CM1 A;  1XFW O;  1QLS A;  2MHH A;  1LIN A;  3S0F A;  3I5G B;  2LAP A;  2LAN A;  1XYD A;  1KFX L;  1C3Z A;  2H61 C;  2LMT A;  2QPT A;  1JC2 A;  5DKQ A;  2Y4Q A;  4FQO A;  3MSE B;  1J7Q A;  1GJY A;  1G8I A;  2OPO A;  3DVJ A;  4YI8 A;  3EVV A;  3ZNI A;  4AOM A;  1YUT A;  2MLF C;  1JBA A;  3I5F C;  2WCM A;  2F3Z A;  3E3R A;  1Y6W A;  2LV7 A;  1DC1 A;  2KAX A;  2L2C A;  1SBJ A;  2JWW A;  2BBM A;  2ZRT A;  1DJH A;  1NX0 A;  1WRZ A;  3OX6 A;  2M7L A;  1Z2C B;  2ZRS A;  4N1G A;  4MZL A;  5HYD A;  5AER A;  4PAL A;  2R2I A;  4GNK B;  1FPW A;  1AJ4 A;  2WC5 A;  4ORC B;  1TRF A;  2NCO A;  2JOJ A;  3VRR A;  1MXL C;  3B7A A;  1XFU O;  1C3Y A;  1MXE A;  2HF5 A;  3D0Y B;  2SCP A;  3HX4 A;  3L4A A;  3R1P A;  2JZI A;  1SNL A;  4OVN F;  3F45 A;  4USL A;  5DKR A;  1Q80 A;  1TNP A;  1CDP A;  3IF7 A;  1TIZ A;  3RZS A;  4NDB A;  3BYA A;  1YUS A;  1W7I B;  3SG2 A;  1IG5 A;  2H2K A;  4QJ4 B;  4YI9 A;  4UPG A;  1N65 A;  1QV1 A;  4QJ3 B;  3IQQ A;  1BMO A;  1YR5 A;  3BUM B;  3OP0 A;  5ER5 A;  3WHU B;  5DKN A;  4OCI A;  1F71 A;  1OSA A;  4ZCV A;  3S0B A;  1JFJ A;  3OB2 B;  3NSK A;  5BPJ A;  4NDC A;  2GTE A;  2BAP A;  1A03 A;  2WCJ A;  3NGV A;  2I2R E;  1PSR A;  3O78 A;  2QEO A;  2K61 A;  3PM8 A;  3L4L A;  4BY4 A;  2LHI A;  3PM2 A;  3EVR A;  1PAL A;  2HPS A;  1KSO A;  2KGB C;  1B1G A;  1XFR A;  1TWO A;  2L50 A;  2FCD A;  2JT8 A;  1TTX A;  3SG6 A;  3SG7 A;  4OKH A;  3TS5 C;  2MBX A;  4A4B A;  1TUZ A;  3CR2 A;  3VGO A;  1SCM C;  2WC8 A;  3I5I B;  2KBI A;  2ERB A;  2K7O A;  2P70 A;  3OX5 A;  5HL1 A;  1QLK A;  4GGF A;  2OTG C;  5CSF A;  1G4Y R;  1XO5 A;  3CZ0 A;  1MWN A;  3DY9 A;  4GGN A;  2KFF A;  4AQJ A;  1DJI A;  3K21 A;  1F8H A;  2QEB A;  3SS5 A;  1Y0V H;  1UWO A;  3TDI A;  1F55 A;  5AXI A;  1L7Z A;  2LNK A;  1CFF A;  2CNP A;  2LUC A;  4MZK A;  2L5Y A;  4PHK A;  4MRY A;  1J7O A;  1UHI A;  2M3W A;  2K7C A;  2ISD A;  3JVT B;  4HRG A;  3BOW B;  4PDZ A;  1XFV O;  2K0J A;  2GGZ A;  1K96 A;  1YVH A;  4HSZ A;  4YGE B;  5FYX A;  3BUX B;  1FBV A;  1KSM A;  4L9M A;  2HET A;  4YRU A;  2L5X B;  4GPL B;  3GOF A;  4WQ2 A;  4PE4 A;  3D0Y A;  1CTR A;  1K93 D;  1B47 A;  1CFD A;  1CMG A;  1QIW A;  1UHH A;  2OS8 C;  1TCF A;  1SR6 C;  1F4O A;  2EGD A;  2L4I A;  3PJI A;  4CID A;  4HRH A;  5D69 A;  1HT9 A;  1NPQ A;  2JXC A;  5CSI A;  1KK7 Y;  3KF9 A;  1CM4 A;  2LVV A;  5DIC A;  2KI4 B;  1YRT B;  1OOH A;  1Y1U A;  1OZS A;  4DIR A;  4CPV A;  1K90 D;  1OMD A;  2FJY A;  2PSR A;  3NSI A;  1CB1 A;  4ETO A;  1WRK A;  5JJG A;  3I5G C;  1LKJ A;  1P28 A;  1F54 A;  1KQM B;  1OOJ A;  1BT6 A;  2KYC A;  1YVL A;  1SYM A;  2WOR A;  1WLM A;  2WC6 A;  2JNX A;  1S26 D;  2CT9 A;  1EG3 A;  2M7N A;  3EK7 A;  1UHK A;  2LHL A;  3GK2 A;  2K7B A;  1SL8 A;  1OOF A;  2WND A;  1CFP A;  3I5H B;  1BG1 A;  2LMV A;  1OZO A;  1S6J A;  4P5O E;  3EG5 B;  5D3O A;  1S6C A;  5I8N A;  1S5G Z;  4U8D A;  1ZMZ A;  1PK0 D;  3FE6 A;  4JKT A;  1UP5 A;  2H8V A;  2LE9 B;  2QAC A;  5GQQ C;  1FF1 A;  2AAO A;  1EXR A;  1B8C A;  1BJF A;  2JQ6 A;  3SG3 A;  3FE9 A;  5ER4 X;  3TUY C;  3RM1 A;  2LVI A;  1K9U A;  1B8L A;  1OE9 B;  1ODB A;  3NHI A;  3EKH A;  1YUR A;  1M63 B;  1DEL A;  1NWD A;  1AP4 A;  1S3P A;  1V1G A;  2PMY A;  4XJK B;  2B1U A;  4A4C A;  2AMI A;  3BUO B;  2E30 A;  1GGZ A;  3BXK A;  1NIW A;  3BOW A;  2MA2 A;  4OV2 A;  3VRO A;  4M2Q A;  3AKA A;  1H8B A;  5FI7 A;  1PUL A;  4PHM A;  1WY9 A;  1J1D A;  3EK4 A;  1CNP A;  2GV5 A;  3D77 A;  1CFC A;  1EG4 A;  5FI2 A;  3R1O A;  3TDZ A;  4ICB A;  4I5N B;  4ORA B;  2GGM A;  2KQ6 A;  1KWO B;  2BEC A;  3A4U B;  1QS7 A;  2BE4 A;  2KAY A;  3CR5 X;  3D74 A;  4N5X A;  1GQM A;  5HLO A;  1BLQ A;  2JU0 A;  2MLE C;  2P6B B;  2JPO A;  3PLF B;  1F70 A;  2M97 A;  3D78 A;  2ZN8 A;  1BOD A;  2WCE A;  1KK8 C;  2I18 A;  2NZ0 A;  3VRQ A;  3EK8 A;  4PE7 A;  2KFG A;  4MRX A;  1YUU A;  1QX7 A;  2KLE A;  3BUN B;  2F2P A;  1XFX O;  3ICB A;  1FI6 A;  1IH0 A;  1SL7 A;  1TNQ A;  1DGV A;  3LCP C;  3DVE A;  3I5I C;  1JFK A;  1SKT A;  5G08 A;  2M49 B;  2EC6 C;  2JC2 A;  5PAL A;  1K9P A;  2Y1N A;  3R1V A;  3SG5 A;  5I2Q A;  2O5G A;  4E68 A;  1IKU A;  2F2O A;  2QEV A;  2V53 A;  4GAO A;  5CSN A;  4Q04 A;  3I5F B;  1BR4 B;  1W7J B;  1UUS A;  3S0A A;  4YGC B;  2BCB A;  3KO0 A;  2BKH B;  1IWQ A;  1KFU L;  3KHE A;  1XK4 A;  3RLZ A;  2M1K B;  4TNC A;  1SRA A;  2L51 A;  1KFX S;  3SIA A;  3V2L A;  1IGV A;  1OQP A;  4NQG A;  4OZD A;  2WCF A;  2MRD A;  3B88 A;  2JTT A;  1RWY A;  1B4C A;  1SK6 D;  3FIA A;  3OBV A;  3AAK A;  1TNW A;  1IQ5 A;  3EVU A;  3IQO A;  3S0G A;  2Q4U A;  1N2D A;  2KI6 D;  5F6T A;  2SAS A;  3AKB A;  1BOC A;  3ZWH A;  4XJK A;  1S36 A;  2WCL A;  1K2H A;  3S0E A;  3NSO A;  2KGR A;  1N0Y A;  4YGB B;  3CZT X;  3OHM B;  2VRG A;  2HQW A;  1NP8 A;  5IBW A;  2E6W A;  1C7V A;  4D1E A;  2JT0 A;  1BF5 A;  2IS9 A;  2QEH A;  1X02 A;  2K2A A;  1F4Q A;  4KYN A;  4PCW A;  2NXQ A;  1BU3 A;  1QVI Y;  3Q8I A;  1K95 A;  1C7W A;  1QX5 B;  1H4B A;  4JPZ B;  1B7T Y;  3BFH A;  1QAT A;  5EL2 A;  5FI6 A;  1DJZ A;  1L2O B;  5I2L A;  3B87 A;  4C0L A;  2BKI B;  1A4P A;  4I5K A;  1OOI X;  1OW4 A;  1ZOT B;  4MZJ A;  5D7F A;  2ZN9 A;  1HQV A;  4DS7 A;  5B8I B;  1WDC C;  4JWQ A;  2CXJ A;  2I94 A;  1MQ1 A;  2QDI A;  3FWC A;  1SPY A;  3TS5 B;  1FW4 A;  1LA0 A;  2F33 A;  2WOS A;  1MR8 A;  2H61 A;  1SCM B;  3CTN A;  3DD4 A;  1M45 A;  1PVA A;  1QV0 A;  3C1V A;  4MVF A;  1IJ5 A;  2PQL A;  3L47 A;  3DF0 B;  3I5H C;  2LLT A;  1OMV A;  3TZ1 A;  2CTN A;  3KPX A;  1DGU A;  4I5J A;  2LCP A;  3JTD C;  2OTG B;  3BUW B;  1LVC D;  2CBL A;  1BR1 B;  2PAL A;  3LK0 A;  5CPV A;  1CDL A;  2K7D A;  3HCM A;  1QJT A;  1Y1A A;  1CKK A;  4M2O A;  1RRO A;  1A75 A;  1U5I B;  2KLD A;  2KNE A;  1NCX A;  4AQI A;  1KFU S;  1NSH A;  1QXP A;  2BL0 B;  2PYQ A;  2K60 A;  1AJ5 A;  2ZFD A;  2ZNE A;  4MLW A;  1TNX A;  1SW8 A;  4GGF C;  4DRW A;  2KSP A;  3B86 A;  5TNC A;  3UO9 A;  1LA3 A;  1KK7 Z;  5HKY A;  5I94 A;  1UHN A;  2PVB A;  3KEV A;  5HLV A;  4C0J A;  2LC5 A;  2EHB A;  1CMF A;  2JPT A;  1AK8 A;  1R6P A;  5HKW A;  4JD9 A;  3SS4 A;  3VB1 A;  2OS8 B;  1DEK A;  2G9B A;  3CDN A;  1KWO C;  3O6B A;  1EJ3 A;  1SR6 B;  1A2X A;  1YX7 A;  2O60 A;  2WCB A;  3LL8 B;  3NSL A;  4P2Y B;  1S6I A;  2KOT A;  1OOG A;  2LMU A;  1QX2 A;  2F8P A;  3GK1 A;  3VRN A;  1ORG A;  1FI5 A;  3EKJ A;  4NDD A;  1MHO A;  1M39 A;  1WRL A;  2JRF A;  3B6X A;  2KQY A;  3LK1 A;  4PHN A;  2KBM A;  2NLN A;  3BFA A;  3SIB A;  1RTP 1;  3PN7 B;  1AHR A;  1QIV A;  1SMG A;  2JT3 A;  1NUB A;  2LP3 A;  1JF2 A;  2M1U A;  3PAT A;  4PE0 A;  3D76 A;  1Z4H A;  1DMO A;  1YTZ C;  1B9A A;  3AAJ A;  3O2P A;  4INX A;  2COL B;  3DYE A;  2A4J A;  3D10 A;  5JOL A;  1CDN A;  4FTG A;  1ZFS A;  2FCE A;  4CLN A;  1TOP A;  2CCM A;  3CZ2 A;  4FQT A;  3PAL A;  1DF0 B;  3DF0 A;  4YGA A;  5CSJ A;  1OMR A;  2L4H A;  4F7F A;  1J7P A;  2LP2 A;  1K9K A;  1E8A A;  3OGN A;  1K8U A;  4CFQ A;  1RJV A;  2ZND A;  1QWV A;  3O4X A;  1U5I A;  3PSR A;  1SCV A;  2PRU A;  1NX2 A;  1AUI B;  1WLZ A;  2JTZ A;  3TUY B;  3R72 A;  5AFP A;  1RK9 A;  3CAB A;  1IIO A;  3CLN A;  4IL1 A;  1IQ3 A;  1JWD A;  1ALW A;  1ALV A;  3VRP A;  1TN4 A;  4R1E A;  3SS3 A;  1DQE A;  1VRK A;  2M8U A;  4WQ3 A;  1M46 A;  3FS7 A;  2KPH A;  1A75 B;  1LXF C;  1QAS A;  2KAV A;  1NX3 A;  1IRJ A;  1DJY A;  2ZKM X;  3CWG A;  2KFH A;  1IJ6 A;  1TCO B;  2BNX A;  3D75 A;  1DJX A;  1DT7 B;  2KDH A;  1D1O A;  1B8R A;  1EL4 A;  1PRW A;  1W9Z A;  2PAS A;  3PFV A;  1K94 A;  5K89 A;  1KQV A;  2BCX A;  1XFY O;  1ZAC A;  1MF8 B;  2JNF A;  3JVT C;  4INW A;  4PT1 A;  5HKZ A;  2JUL A;  4YBH B;  1XVJ A;  2TN4 A;  2LVK A;  1L2O C;  1SY9 A;  3FE8 A;  1QTX A;  5AAN A;  3BJH A;  4N1F A;  1KK8 B;  4DUQ A;  1NX1 A;  1V1F A;  1JUO A;  1ZUZ A;  2F3Y A;  2BE6 A;  2Y1M A;  3TDU A;  2P71 A;  3UNW A;  4JQ0 D;  4YGD B;  5KTY A;  2JXL A;  3O4Y A;  3NHT A;  2G2B A;  3N7H A;  4MN0 A;  3D73 A;  4MBE A;  1EH2 A;  1C07 A;  2LLU A;  2EC6 B;  2KI4 C;  4HRE E;  2L98 A;  2LUX A;  2K8M B;  1REC A;  3DXL A;  1J55 A;  2MAZ A;  4XYN A;  3WXA A;  1DF0 A;  1MUX A;  3IVT A;  4GFT A;  4PHJ A;  3SJS A;  1A29 A;  1KQM C;  1CLB A;  4PE1 A;  5AEQ A;  2M0R A;  1DJW A;  3M0W A;  1GM0 A;  1DVI A;  2WCH A;  2FJU B;  2D8N A;  1CLL A;  3S0D A;  1YRU B;  1S1E A;  2BL0 C;  3FWB A;  2RGI A;  1YX8 A;  3LLE A;  2YGU A;  3BQ3 A;  4GUK A;  5J3X A;  2WCK A;  3QME A;  3CR4 X;  4ZCU A;  2M9G A;  2HQ8 A;  1NCZ A;  1Y1X A;  4C0K A;  3DVM A;  3CYZ A;  1QVI Z;  1XK4 C;  2BBN A;  4MEW A;  5KU1 A;  2AUC A;  1GGW A;  1B7T Z;  2I7A A;  4WRI A;  1CDM A;  2LVJ A;  1DJG A;  3CGA A;  1J7R A;  5I2O A;  1RFJ A;  1TUJ A;  2NCP A;  4BY5 A;  1R2U A;  2K2F A;  3DZT A;  2FOT A;  4QJ5 B;  4MSP A;  1PSB A;  3NXA A;  1SSE B;  4I5L B;  1PVB A;  1XA5 A;  1S5G Y;  5KSZ A;  3A8R A;  2L0P A;  1KCY A;  1UHJ A;  3PN7 C;  3WNX B;  3WHT B;  2Q91 A;  3GK4 X;  4M2P A;  1T14 A;  2Y5I A;  3SG4 A;  2MJW B;  2KHN A;  3BFB A;  1G33 A;  3DVK A;  4DCK A;  4ORB B;  1CLM A;  2DOQ A;  1WDC B;  2BCA A;  3CS1 A;  4F0Z B;  1NCY A;  1DTL A;  4IJ7 A;  1J1E A;  3H4S E;  3OB1 B;  2LLS A;  1JF0 A;  1M31 A;  1NYA A;  1JSA A;  3K1E A;  1LS8 A;  2L2E A;  3QRX A;  4GBA A;  1AVS A;  1SL9 A;  1UUR A;  2KI6 C;  2M29 A;  4OR9 B;  2KYF A;  1XFZ O;  3CZ1 A;  4CFR A;  3JTD B;  2LM5 A; 
#chains in the Genus database with same CATH homology
 1CM1 A;  1XFW O;  1QLS A;  2MHH A;  1LIN A;  3I5G B;  2LAP A;  2LAN A;  1XYD A;  1KFX L;  2H61 C;  2LMT A;  2QPT A;  1JC2 A;  5DKQ A;  2Y4Q A;  4FQO A;  3MSE B;  1J7Q A;  1GJY A;  1G8I A;  2OPO A;  3DVJ A;  4YI8 A;  3EVV A;  3ZNI A;  4AOM A;  1YUT A;  2MLF C;  1JBA A;  3I5F C;  3E3R A;  2F3Z A;  1Y6W A;  2LV7 A;  2KAX A;  1SBJ A;  2JWW A;  2BBM A;  2ZRT A;  1DJH A;  1NX0 A;  1WRZ A;  3OX6 A;  2M7L A;  2ZRS A;  4N1G A;  4MZL A;  5HYD A;  5AER A;  4PAL A;  2R2I A;  4GNK B;  1FPW A;  1AJ4 A;  4ORC B;  1TRF A;  2NCO A;  2JOJ A;  3VRR A;  1MXL C;  1XFU O;  1MXE A;  2HF5 A;  3D0Y B;  2SCP A;  3HX4 A;  4OVN F;  2JZI A;  1SNL A;  3F45 A;  4USL A;  5DKR A;  1Q80 A;  1TNP A;  1CDP A;  3IF7 A;  1TIZ A;  4NDB A;  3BYA A;  1YUS A;  1W7I B;  3SG2 A;  1IG5 A;  2H2K A;  4QJ4 B;  4YI9 A;  4UPG A;  1N65 A;  1QV1 A;  4QJ3 B;  3IQQ A;  1BMO A;  1YR5 A;  3BUM B;  3OP0 A;  5ER5 A;  3WHU B;  5DKN A;  4OCI A;  1F71 A;  1OSA A;  4ZCV A;  1JFJ A;  3OB2 B;  3NSK A;  5BPJ A;  4NDC A;  1A03 A;  2I2R E;  1PSR A;  3O78 A;  4BY4 A;  2K61 A;  2LHI A;  3EVR A;  1PAL A;  2HPS A;  1KSO A;  2KGB C;  1B1G A;  2L50 A;  2FCD A;  2JT8 A;  1TTX A;  3SG6 A;  3SG7 A;  4OKH A;  3TS5 C;  2MBX A;  4A4B A;  3CR2 A;  3VGO A;  1SCM C;  2WC8 A;  3I5I B;  2KBI A;  2K7O A;  3OX5 A;  1QLK A;  4GGF A;  2OTG C;  5CSF A;  1G4Y R;  1XO5 A;  4GGN A;  1MWN A;  2KFF A;  4AQJ A;  1DJI A;  3K21 A;  1F8H A;  1Y0V H;  1UWO A;  3TDI A;  1F55 A;  5AXI A;  1L7Z A;  2LNK A;  1CFF A;  2CNP A;  2LUC A;  4MZK A;  4PHK A;  4MRY A;  1J7O A;  1UHI A;  2M3W A;  2K7C A;  2ISD A;  3JVT B;  4HRG A;  3BOW B;  4PDZ A;  1XFV O;  2K0J A;  2GGZ A;  1K96 A;  1YVH A;  4HSZ A;  4YGE B;  5FYX A;  3BUX B;  1FBV A;  1KSM A;  4L9M A;  2HET A;  4YRU A;  2L5X B;  4GPL B;  3GOF A;  4WQ2 A;  4PE4 A;  3D0Y A;  1CTR A;  1K93 D;  1B47 A;  1CFD A;  1CMG A;  1QIW A;  1UHH A;  2OS8 C;  1TCF A;  1SR6 C;  1F4O A;  2EGD A;  2L4I A;  4CID A;  4HRH A;  5D69 A;  1HT9 A;  1NPQ A;  2JXC A;  5CSI A;  1KK7 Y;  3KF9 A;  1CM4 A;  2LVV A;  2KI4 B;  1YRT B;  1Y1U A;  1OZS A;  4DIR A;  4CPV A;  1K90 D;  1OMD A;  2PSR A;  3NSI A;  1CB1 A;  4ETO A;  1WRK A;  5JJG A;  3I5G C;  1LKJ A;  1F54 A;  1KQM B;  1OOJ A;  1BT6 A;  2KYC A;  1YVL A;  1SYM A;  2WOR A;  1WLM A;  2JNX A;  1S26 D;  2CT9 A;  1EG3 A;  2M7N A;  3EK7 A;  1UHK A;  2LHL A;  3GK2 A;  2K7B A;  1SL8 A;  2WND A;  1CFP A;  3I5H B;  1BG1 A;  2LMV A;  1OZO A;  1S6J A;  4P5O E;  1S6C A;  5I8N A;  1S5G Z;  4U8D A;  1ZMZ A;  1PK0 D;  1UP5 A;  2LE9 B;  2QAC A;  5GQQ C;  1FF1 A;  2AAO A;  1EXR A;  1B8C A;  1BJF A;  2JQ6 A;  3SG3 A;  5ER4 X;  3TUY C;  3RM1 A;  2LVI A;  1K9U A;  1B8L A;  1OE9 B;  1ODB A;  3EKH A;  1YUR A;  1M63 B;  1NWD A;  1AP4 A;  1S3P A;  1V1G A;  2PMY A;  4XJK B;  2B1U A;  4A4C A;  2AMI A;  3BUO B;  2E30 A;  1GGZ A;  3BXK A;  1NIW A;  3BOW A;  2MA2 A;  4OV2 A;  3VRO A;  4M2Q A;  3AKA A;  1H8B A;  1PUL A;  4PHM A;  1WY9 A;  1J1D A;  3EK4 A;  1CNP A;  2GV5 A;  1CFC A;  1EG4 A;  3TDZ A;  4ICB A;  4I5N B;  4ORA B;  2GGM A;  2KQ6 A;  1KWO B;  2BEC A;  3A4U B;  1QS7 A;  2BE4 A;  2KAY A;  3CR5 X;  4N5X A;  1GQM A;  5HLO A;  1BLQ A;  2JU0 A;  2MLE C;  2P6B B;  3PLF B;  1F70 A;  2M97 A;  2ZN8 A;  1BOD A;  2WCE A;  1KK8 C;  2I18 A;  2NZ0 A;  3VRQ A;  3EK8 A;  4PE7 A;  2KFG A;  4MRX A;  1YUU A;  1QX7 A;  3BUN B;  2F2P A;  1XFX O;  3ICB A;  1FI6 A;  1IH0 A;  1SL7 A;  1TNQ A;  1DGV A;  3LCP C;  3DVE A;  3I5I C;  1JFK A;  1SKT A;  5G08 A;  2M49 B;  2EC6 C;  2JC2 A;  5PAL A;  1K9P A;  2Y1N A;  3SG5 A;  5I2Q A;  2O5G A;  4E68 A;  1IKU A;  2F2O A;  2V53 A;  4GAO A;  5CSN A;  4Q04 A;  3I5F B;  1BR4 B;  1W7J B;  1UUS A;  4YGC B;  2BCB A;  3KO0 A;  2BKH B;  1IWQ A;  1KFU L;  3KHE A;  1XK4 A;  3RLZ A;  2M1K B;  4TNC A;  1SRA A;  2L51 A;  1KFX S;  3SIA A;  1IGV A;  1OQP A;  4NQG A;  2WCF A;  2MRD A;  2JTT A;  1RWY A;  1B4C A;  1SK6 D;  3FIA A;  3AAK A;  1TNW A;  1IQ5 A;  3EVU A;  3IQO A;  2Q4U A;  1N2D A;  2KI6 D;  5F6T A;  2SAS A;  3AKB A;  1BOC A;  3ZWH A;  4XJK A;  1S36 A;  3NSO A;  2KGR A;  1N0Y A;  4YGB B;  3CZT X;  3OHM B;  2VRG A;  2HQW A;  1NP8 A;  5IBW A;  2E6W A;  1C7V A;  4D1E A;  2JT0 A;  1BF5 A;  2IS9 A;  1X02 A;  2K2A A;  1F4Q A;  4PCW A;  2NXQ A;  1BU3 A;  1QVI Y;  1K95 A;  1C7W A;  1QX5 B;  1H4B A;  4JPZ B;  1B7T Y;  1QAT A;  1DJZ A;  1L2O B;  5I2L A;  4C0L A;  2BKI B;  1A4P A;  4I5K A;  1ZOT B;  4MZJ A;  5D7F A;  2ZN9 A;  1HQV A;  4DS7 A;  5B8I B;  1WDC C;  4JWQ A;  2CXJ A;  2I94 A;  1MQ1 A;  3FWC A;  1SPY A;  3TS5 B;  1FW4 A;  1LA0 A;  2F33 A;  2WOS A;  1MR8 A;  2H61 A;  1SCM B;  3CTN A;  3DD4 A;  1M45 A;  1PVA A;  1QV0 A;  3C1V A;  1IJ5 A;  3DF0 B;  3I5H C;  2LLT A;  1OMV A;  3TZ1 A;  2CTN A;  3KPX A;  1DGU A;  4I5J A;  2LCP A;  3JTD C;  2OTG B;  3BUW B;  1LVC D;  2CBL A;  1BR1 B;  2PAL A;  3LK0 A;  5CPV A;  1CDL A;  2K7D A;  3HCM A;  1QJT A;  1Y1A A;  1CKK A;  4M2O A;  1RRO A;  1A75 A;  1U5I B;  2KNE A;  1NCX A;  4AQI A;  1KFU S;  1NSH A;  1QXP A;  2BL0 B;  2ZNE A;  1AJ5 A;  2ZFD A;  4MLW A;  1TNX A;  1SW8 A;  4GGF C;  4DRW A;  2KSP A;  5TNC A;  1LA3 A;  1KK7 Z;  5HKY A;  1UHN A;  2PVB A;  3KEV A;  5HLV A;  4C0J A;  2LC5 A;  2EHB A;  1CMF A;  2JPT A;  1AK8 A;  1R6P A;  5HKW A;  2OS8 B;  2G9B A;  3O6B A;  3PFV A;  1KWO C;  4MVF A;  1EJ3 A;  1SR6 B;  1A2X A;  1YX7 A;  2O60 A;  2WCB A;  3LL8 B;  3NSL A;  4P2Y B;  1S6I A;  2KOT A;  2LMU A;  1QX2 A;  2F8P A;  3GK1 A;  3VRN A;  1FI5 A;  3EKJ A;  4NDD A;  1MHO A;  1M39 A;  1WRL A;  2JRF A;  3LK1 A;  2KQY A;  3SIB A;  4PHN A;  2KBM A;  2NLN A;  1K2H A;  1RTP 1;  3PN7 B;  1AHR A;  1QIV A;  1SMG A;  2JT3 A;  1NUB A;  2LP3 A;  1JF2 A;  2M1U A;  3PAT A;  4PE0 A;  1DMO A;  1YTZ C;  1B9A A;  3AAJ A;  3O2P A;  2COL B;  2A4J A;  3D10 A;  5JOL A;  1CDN A;  4FTG A;  1ZFS A;  2FCE A;  4CLN A;  1TOP A;  2CCM A;  3PAL A;  1DF0 B;  3DF0 A;  4YGA A;  5CSJ A;  1OMR A;  2L4H A;  1J7P A;  2LP2 A;  1K9K A;  1E8A A;  1K8U A;  4CFQ A;  1RJV A;  2ZND A;  1U5I A;  3PSR A;  1SCV A;  2PRU A;  1NX2 A;  1AUI B;  1WLZ A;  2JTZ A;  3TUY B;  5AFP A;  1RK9 A;  3CLN A;  4IL1 A;  1IQ3 A;  1JWD A;  1ALW A;  1ALV A;  3VRP A;  1TN4 A;  4R1E A;  1VRK A;  2M8U A;  4WQ3 A;  1M46 A;  3FS7 A;  1A75 B;  1LXF C;  1QAS A;  2KAV A;  1NX3 A;  1IRJ A;  1DJY A;  2ZKM X;  3CWG A;  2KFH A;  1IJ6 A;  1TCO B;  1DJX A;  1DT7 B;  2KDH A;  1D1O A;  1B8R A;  1EL4 A;  1PRW A;  2PAS A;  5K89 A;  1K94 A;  1KQV A;  2BCX A;  1XFY O;  1ZAC A;  1MF8 B;  2JNF A;  3JVT C;  5HKZ A;  2JUL A;  4YBH B;  1XVJ A;  2TN4 A;  2LVK A;  1L2O C;  1SY9 A;  1QTX A;  5AAN A;  4N1F A;  1KK8 B;  4DUQ A;  1NX1 A;  1V1F A;  1JUO A;  1ZUZ A;  2F3Y A;  2BE6 A;  2Y1M A;  3TDU A;  4JQ0 D;  4YGD B;  5KTY A;  2JXL A;  3O4Y A;  2G2B A;  4MN0 A;  4MBE A;  1EH2 A;  1C07 A;  2LLU A;  2EC6 B;  2KI4 C;  4HRE E;  2L98 A;  2LUX A;  2K8M B;  1REC A;  1J55 A;  2MAZ A;  4XYN A;  3WXA A;  1DF0 A;  1MUX A;  4GFT A;  4PHJ A;  3SJS A;  1A29 A;  1KQM C;  1CLB A;  4PE1 A;  5AEQ A;  2M0R A;  1DJW A;  3M0W A;  1DVI A;  2FJU B;  2D8N A;  1CLL A;  1YRU B;  1S1E A;  2BL0 C;  3FWB A;  2RGI A;  1YX8 A;  3LLE A;  3BQ3 A;  5J3X A;  4GUK A;  3CR4 X;  4ZCU A;  2M9G A;  2HQ8 A;  1NCZ A;  1Y1X A;  4C0K A;  3DVM A;  1QVI Z;  1XK4 C;  2BBN A;  4MEW A;  5KU1 A;  2AUC A;  1GGW A;  1B7T Z;  2I7A A;  4WRI A;  1CDM A;  2LVJ A;  1DJG A;  3CGA A;  1J7R A;  5I2O A;  1RFJ A;  2NCP A;  4BY5 A;  1R2U A;  2K2F A;  2FOT A;  4QJ5 B;  4MSP A;  1PSB A;  3NXA A;  4I5L B;  1PVB A;  1XA5 A;  1S5G Y;  5KSZ A;  3A8R A;  2L0P A;  1KCY A;  1UHJ A;  3PN7 C;  3WNX B;  3WHT B;  2Q91 A;  3GK4 X;  4M2P A;  2Y5I A;  3SG4 A;  2MJW B;  2KHN A;  1G33 A;  3DVK A;  4DCK A;  4ORB B;  1CLM A;  2DOQ A;  1WDC B;  2BCA A;  3CS1 A;  4F0Z B;  1NCY A;  1DTL A;  1J1E A;  3H4S E;  3OB1 B;  2LLS A;  1JF0 A;  1M31 A;  1NYA A;  1JSA A;  4GBA A;  2L2E A;  3QRX A;  1AVS A;  1SL9 A;  1UUR A;  2KI6 C;  2M29 A;  4OR9 B;  2KYF A;  1XFZ O;  3PM8 A;  4CFR A;  3JTD B;  2LM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...