4MBEA

Sac3:sus1:cdc31:nup1 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, transcription
molecule keywords Cell division control protein 31
total genus 51
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mbeA01
2ISDA 1B7TZ 2KNEA 3SIAA 2JC2A 2H61C 2KBIA 2LVVA 2MLEC 3HCMA 3AAJA 3GOFA 1KWOB 1CB1A 2JPTA 1K9KA 2KAXA 4L9MA 4MBEA 1EJ3A 2WCEA 4CLNA 1SYMA 2I94A 2K2AA 1FBVA 2MAZA 4PHJA 3ZNIA 2B1UA 1QJTA 4MLWA 5AERA 1M46A 3EVVA 1DMOA 4BY5A 2K7DA 1A2XA 3TZ1A 2LMVA 1HT9A 4ETOA 1IGVA 2PASA 2L4HA 1G33A 2JTTA 1MHOA 2GGZA 3DVJA 3CR4X 4QJ3B 1CKKA 1NP8A 2EC6C 1PRWA 2E6WA 5HKYA 4MVFA 1RJVA 3BUNB 1OMDA 5J3XA 1MXLC 1QX5B 3OB1B 4XJKA 2F2OA 3CGAA 1S36A 2BCBA 3CR2A 4GGNA 1TNWA 4MZJA 1OMRA 2KI6C 1Y6WA 5AFPA 1BT6A 3EVRA 3KO0A 1XO5A 3PFVA 1F70A 1J7OA 1SL8A 3BUMB 3O2PA 2PVBA 1RK9A 1NUBA 2K7CA 1CM4A 4JWQA 1LA0A 2M7NA 1IWQA 1OQPA 5DKRA 2FCEA 3BUXB 4MN0A 3KHEA 4OV2A 1KFUL 5AEQA 1WDCC 4AQJA 4XJKB 1YR5A 2NCOA 2JQ6A 3VGOA 4C0KA 2KBMA 3NSIA 3BXKA 3SJSA 4BY4A 1DGVA 4DCKA 2BBNA 4QJ4B 2GV5A 2JXCA 2HQWA 1AJ5A 1RTP1 1XVJA 1QLSA 3HX4A 5CSFA 1GGWA 4NDCA 5HKZA 1SBJA 5GQQC 1B8CA 1HQVA 1TNQA 3SG7A 1AJ4A 1LXFC 1C07A 4AQIA 1UUSA 3CLNA 2HF5A 2H2KA 2RGIA 1DVIA 1QS7A 3MSEB 1V1GA 1ZUZA 5PALA 1DF0B 2A4JA 1EH2A 1B4CA 3OX6A 2L2EA 3DVKA 1W7IB 2SASA 2M49B 3EKHA 4GUKA 4HRHA 1IRJA 3C1VA 5CSIA 1QVIY 2OPOA 3BOWB 3VRPA 4IL1A 1YURA 3SG2A 1KK7Y 2CNPA 4YGBB 2HETA 2WCFA 4P2YB 4CPVA 1YUTA 2BE4A 2ZFDA 2CT9A 1PSBA 1F71A 4PALA 1UHIA 2ZRSA 1SCMB 2CXJA 2M1KB 2O60A 2NLNA 1JC2A 3CS1A 3LL8B 2Y1NA 3GK4X 3I5GB 4XYNA 1PK0D 4GNKB 4C0JA 1L2OB 2DOQA 1AUIB 3PM8A 1BG1A 1CDMA 3LK0A 2Q4UA 3A4UB 3K21A 4NQGA 1KCYA 3FWCA 2LNKA 1G4YR 1CFPA 1RFJA 2PSRA 1AK8A 2F3YA 2H61A 4PCWA 1ALVA 2K2FA 2R2IA 4YGAA 1KK8B 4E68A 3BOWA 3JTDB 1B1GA 1A4PA 1TCFA 5D7FA 4PE0A 1L7ZA 1F8HA 4WQ3A 2Q91A 1CNPA 1BU3A 2WORA 3AKBA 3IQQA 1SCVA 4ZCUA 1UHHA 3SIBA 2KFHA 2TN4A 1SNLA 2F2PA 1YUSA 1DJHA 4I5NB 4C0LA 4OR9B 1M63B 3D0YA 2WOSA 2JT3A 1A29A 3I5GC 3VRQA 1FPWA 1UURA 3BQ3A 3FWBA 1XK4C 2M7LA 4ORBB 1H8BA 1E8AA 2QPTA 1C7VA 3TDZA 1CTRA 1UHNA 1DJWA 2JNFA 1LA3A 4OCIA 1K93D 2KAVA 1IKUA 5HKWA 2BCXA 2F3ZA 2F33A 1DJXA 1SY9A 1UP5A 1JWDA 2GGMA 1DJIA 1K94A 1SR6C 2OTGB 2Y1MA 2SCPA 2LHIA 1FI5A 1IJ5A 1JUOA 1ZFSA 2ZN9A 3O78A 3NXAA 4DIRA 2FOTA 3PSRA 2HQ8A 4FTGA 2L5XB 1PVBA 2KI4C 2BL0B 2KQYA 4ICBA 5I8NA 5BPJA 4HRGA 3CZTX 1MR8A 1KK8C 1A03A 2LP2A 3SG4A 1XFWO 1ZACA 1XK4A 1SL9A 2JT0A 4GGFA 4M2OA 3TDUA 3TDIA 1OSAA 2G9BA 4I5JA 4Q04A 1IQ3A 1SMGA 3PN7C 1BMOA 4P5OE 2PMYA 2LVJA 4R1EA 4YI8A 5CPVA 5DKNA 4OVNF 1NWDA 1NX0A 2MBXA 5G08A 5I2LA 1XFUO 2FJUB 3DD4A 4F0ZB 4M2PA 4UPGA 2JXLA 2LM5A 3PALA 1EL4A 2LE9B 2JULA 2KYCA 3TUYC 4MZKA 1BF5A 2LC5A 1N2DA 2ZN8A 1RWYA 2MRDA 1S6CA 3WHTB 1DGUA 3JVTC 2KGRA 2K7BA 5ER5A 1KFXL 1RROA 1JF0A 2VRGA 1TCOB 4N1FA 2LLUA 2LMTA 3EK7A 2V53A 5HLVA 3SG6A 1QX2A 3SG3A 2KFFA 2O5GA 1YUUA 5D69A 1J7QA 1VRKA 1LINA 1BLQA 1NYAA 1S5GZ 2BCAA 3DVEA 1UHKA 5I2QA 1SW8A 1XFZO 3KPXA 3LCPC 2K61A 1Y1UA 4JPZB 2LVIA 3EVUA 3I5FC 5JOLA 3WNXB 2JNXA 2M1UA 1TNPA 1K95A 4PHMA 1BR1B 2ZNEA 3NSLA 1RECA 4PE1A 4FQOA 2K7OA 2M29A 3CR5X 5JJGA 3GK1A 4USLA 1JFJA 2JT8A 1KK7Z 1PULA 1A75A 1WDCB 3F45A 4ZCVA 3FS7A 3RLZA 2LP3A 4YRUA 1KWOC 4CFQA 4N5XA 4DRWA 5CSNA 1TN4A 1GGZA 1D1OA 5IBWA 2KI6D 2LLSA 2NXQA 1TRFA 4MEWA 1NX3A 5I2OA 3DVMA 1NX2A 2LHLA 5AANA 1B8RA 4ORCB 2JRFA 4GPLB 1AHRA 4JQ0D 1S1EA 4OKHA 1MUXA 1CMFA 1TOPA 2KDHA 1WRKA 2LUCA 1PVAA 1C7WA 1QX7A 2JZIA 3RM1A 1V1FA 4M2QA 2M0RA 3O4YA 1WLZA 4YBHB 1A75B 2OS8B 3EK4A 3ICBA 1PSRA 1S26D 2WNDA 1J55A 3M0WA 1CFDA 1DJYA 2COLB 1GQMA 1F4OA 3CTNA 3KEVA 1IJ6A 1KQMB 1M31A 4PE4A 5F6TA 2AMIA 2EC6B 4NDBA 2MLFC 1KFUS 2EGDA 2LV7A 3NSKA 5CSJA 3H4SE 1LVCD 3ZWHA 2I7AA 3I5FB 3SG5A 1FF1A 2MA2A 5HLOA 1FW4A 1XYDA 1H4BA 1NSHA 4MSPA 1NPQA 1SPYA 1OZOA 4HSZA 4NDDA 2KSPA 3DF0A 1X02A 1YRTB 3NSOA 3WHUB 3OP0A 1QTXA 1QIWA 2LANA 1NCZA 1NX1A 1YX7A 2ZKMX 4ORAB 2JWWA 1Y0VH 4TNCA 1ZOTB 4HREE 2LLTA 1NIWA 3O6BA 3IF7A 4U8DA 4I5LB 1SR6B 3OX5A 5KSZA 1PALA 4QJ5B 1WRLA 3IQOA 3JVTB 4CFRA 1CM1A 3OB2B 5ER4X 2Y5IA 1MQ1A 3EK8A 3QRXA 1DTLA 2ZNDA 1KSOA 3DF0B 3TS5C 1IQ5A 2IS9A 2MHHA 1U5IB 2AAOA 1SL7A 1N0YA 1S6JA 2LCPA 4GAOA 3TUYB 4GGFC 1B47A 4YI9A 1BODA 2L0PA 3BUOB 2G2BA 1ALWA 2M97A 2CTNA 1WLMA 1OMVA 1DT7B 1M45A 1J1DA 3GK2A 3I5IC 3D10A 2QACA 2Y4QA 1NCYA 2WCBA 2L50A 4YGEB 2KYFA 2KFGA 3PN7B 3BYAA 1QLKA 1FI6A 2E30A 1DJGA 1SRAA 1Q80A 2PALA 4WRIA 2M9GA 3JTDC 1WY9A 4PHNA 2M8UA 1J7RA 1K2HA 5DKQA 1TNXA 3VRRA 5TNCA 1CLLA 2KHNA 1K9UA 2BL0C 2KI4B 2L98A 3PLFB 3WXAA 4AOMA 1U5IA 1KSMA 1K8UA 3I5HB 1LKJA 5FYXA 1CLMA 1QV1A 1S6IA 2AUCA 1BR4B 1B9AA 2OTGC 1QATA 1SK6D 1QV0A 1EG3A 1EXRA 1M39A 3I5IB 4I5KA 1JBAA 1L2OC 1SKTA 2NZ0A 2BKIB 4MRXA 1JSAA 1JFKA 1CFCA 1XFVO 1S3PA 1ZMZA 1CFFA 2KGBC 4CIDA 3LK1A 4D1EA 1QASA 1IG5A 2K0JA 1UHJA 4PE7A 1SCMC 4YGCB 1KQVA 2EHBA 1XA5A 1Y1XA 1BOCA 2LVKA 1N65A 2LMUA 3E3RA 1JF2A 1TIZA 2BE6A 1GJYA 3BUWB 2D8NA 2M3WA 1TTXA 1J1EA 1UWOA 4MZLA 5AXIA 4A4BA 1EG4A 1IH0A 1XFXO 2L51A 1OZSA 3OHMB 3A8RA 3FIAA 2MJWB 1XFYO 1QVIZ 1F4QA 3CWGA 2BKHB 5K89A 3I5HC 3VRNA 1Y1AA 2I18A 1OOJA 1YRUB 1DJZA 4DS7A 1DF0A 1YVLA 4WQ2A 3D0YB 1YVHA 3PATA 1YTZC 4GFTA 4DUQA 2ZRTA 3AAKA 2WC8A 5KU1A 2NCPA 3AKAA 2CBLA 1CDNA 2KQ6A 1QIVA 1AP4A 1F55A 2KOTA 1W7JB 1CMGA 1NCXA 2LAPA 2K8MB 1MXEA 2CCMA 3LLEA 4PDZA 5HYDA 2F8PA 1YX8A 1G8IA 1J7PA 1MF8B 2I2RE 4MRYA 1OE9B 1CDPA 1KQMC 1MWNA 2JOJA 1AVSA 1ODBA 1WRZA 2JU0A 4PHKA 1B7TY 1CLBA 2HPSA 5B8IB 2OS8C 2FCDA 1KFXS 3KF9A 2KAYA 4GBAA 5KTYA 3EKJA 3TS5B 4YGDB 1R2UA 1QXPA 1K9PA 3VROA 2BECA 2LUXA 1CDLA 4N1GA 1S5GY 1R6PA 1B8LA 2JTZA 2P6BB 4A4CA 1F54A 1BJFA 2BBMA 1K96A 1K90D 2L4IA 2PRUA
chains in the Genus database with same CATH superfamily
2ISDA 3CABA 1B7TZ 2KNEA 1ORGA 3SIAA 2JC2A 2H61C 3N7HA 2KBIA 2LVVA 2MLEC 3HCMA 3FE8A 3AAJA 3GOFA 1KWOB 4IJ7A 1CB1A 2JPTA 1K9KA 2KAXA 4L9MA 4MBEA 1EJ3A 2WCEA 3OGNA 3DXLA 4CLNA 1SYMA 2I94A 2K2AA 1FBVA 2MAZA 4PHJA 3ZNIA 2B1UA 1QJTA 3BFAA 4MLWA 5AERA 1M46A 3EVVA 1DMOA 4BY5A 2K7DA 1A2XA 3TZ1A 2LMVA 1HT9A 4ETOA 1IGVA 2PASA 2L4HA 1G33A 2JTTA 1MHOA 2P70A 2GGZA 3DVJA 3CR4X 4QJ3B 1CKKA 1NP8A 2EC6C 1PRWA 3B6XA 2E6WA 5HKYA 3NHTA 1RJVA 4MVFA 3BUNB 1OMDA 5J3XA 1MXLC 1QX5B 3OB1B 4XJKA 2F2OA 3CGAA 1S36A 2BCBA 3CR2A 4GGNA 1TNWA 2WCKA 5D3OA 4MZJA 1OMRA 2KI6C 1Y6WA 5AFPA 2PYQA 5HL1A 1BT6A 1DEKA 1C3ZA 3EVRA 1XO5A 3IVTA 3KO0A 3PFVA 1F70A 1J7OA 1SL8A 3BUMB 3O2PA 2PVBA 1RK9A 1NUBA 2K7CA 1CM4A 4JWQA 1XFRA 1LA0A 2M7NA 1IWQA 1OQPA 5DKRA 1DQEA 2FCEA 3BUXB 4MN0A 3KHEA 4OV2A 1KFUL 5AEQA 1WDCC 4AQJA 4XJKB 1YR5A 2NCOA 2JQ6A 3VGOA 4C0KA 2KBMA 3NSIA 3BXKA 3SJSA 4BY4A 3D75A 1DGVA 4DCKA 2BBNA 2QEBA 4QJ4B 2GV5A 2JXCA 2HQWA 2P71A 1AJ5A 1RTP1 1XVJA 1QLSA 3HX4A 5CSFA 1GGWA 3D77A 3FE6A 4NDCA 5HKZA 1SBJA 5GQQC 1B8CA 1HQVA 1TNQA 3SG7A 1AJ4A 1LXFC 2WCJA 3NGVA 1C07A 1QWVA 4AQIA 1UUSA 3CLNA 2HF5A 2H2KA 2RGIA 1DVIA 1QS7A 3MSEB 1V1GA 1ZUZA 5PALA 1DF0B 2A4JA 4KYNA 1B4CA 3OX6A 1EH2A 3S0AA 1P28A 2L2EA 3DVKA 5DICA 1W7IB 2ERBA 2SASA 4INXA 2M49B 2QEVA 3EKHA 4GUKA 4HRHA 1IRJA 1OOFA 3C1VA 1C3YA 5CSIA 1QVIY 1LS8A 2OPOA 3BOWB 3VRPA 3S0DA 4IL1A 1YURA 3SG2A 3V2LA 1KK7Y 2CNPA 4YGBB 2HETA 2WCFA 3R1PA 4P2YB 4CPVA 1YUTA 2BE4A 2ZFDA 2CT9A 1PSBA 1F71A 4PALA 2QEOA 1UHIA 2ZRSA 1SCMB 3CDNA 2H8VA 2CXJA 2M1KB 2O60A 3B88A 2NLNA 1JC2A 3CS1A 3FE9A 3LL8B 2Y1NA 3GK4X 3I5GB 4XYNA 1PK0D 4GNKB 4C0JA 1DELA 1L2OB 2DOQA 1AUIB 3PM8A 1BG1A 1CDMA 3LK0A 2Q4UA 3A4UB 3K21A 2GTEA 4NQGA 3PJIA 1KCYA 3FWCA 2LNKA 3D76A 1G4YR 1CFPA 1RFJA 2PSRA 1AK8A 1SSEB 2F3YA 2H61A 4PCWA 1ALVA 2K2FA 2R2IA 4YGAA 1KK8B 4E68A 3BOWA 3JTDB 2FJYA 1A4PA 1TCFA 1B1GA 5D7FA 4PE0A 1L7ZA 1F8HA 4WQ3A 2Q91A 1CNPA 1BU3A 2WORA 3AKBA 3IQQA 1SCVA 4ZCUA 1UHHA 3SIBA 2KFHA 3SS5A 2TN4A 1SNLA 2F2PA 1YUSA 1DJHA 1DC1A 4I5NB 4C0LA 4OR9B 1M63B 3D0YA 2WOSA 2JT3A 1A29A 3I5GC 3VRQA 1FPWA 1UURA 3BQ3A 3FWBA 1XK4C 2M7LA 4ORBB 1H8BA 1E8AA 2QPTA 1C7VA 3VB1A 3TDZA 1CTRA 1UHNA 1DJWA 2JNFA 1LA3A 4OCIA 1K93D 2KAVA 1IKUA 3R1OA 3SS4A 5HKWA 2BCXA 2F3ZA 2F33A 1DJXA 3D74A 1SY9A 1UP5A 4JD9A 1JWDA 2GGMA 3SS3A 1DJIA 1K94A 1SR6C 2OTGB 2Y1MA 2SCPA 2LHIA 1FI5A 1IJ5A 1JUOA 1Z2CB 1ZFSA 2ZN9A 3O78A 3NXAA 4DIRA 2FOTA 3PSRA 2HQ8A 4FTGA 2L5XB 3R72A 1PVBA 2KI4C 2BL0B 2KQYA 4ICBA 5I8NA 5BPJA 1TWOA 4HRGA 2PQLA 1MR8A 1KK8C 1OOIX 3CZTX 1A03A 2LP2A 3DZTA 3SG4A 1XFWO 1ZACA 1XK4A 1SL9A 2JT0A 4GGFA 4M2OA 3TDUA 2WC5A 3TDIA 4F7FA 1OSAA 2G9BA 4I5JA 4Q04A 1IQ3A 1SMGA 3PN7C 1BMOA 4P5OE 2PMYA 2LVJA 4R1EA 1Z4HA 4YI8A 3OBVA 5CPVA 5DKNA 4OVNF 1NWDA 1NX0A 2MBXA 5G08A 5I2LA 1XFUO 2FJUB 3DD4A 4F0ZB 4M2PA 4UPGA 2JXLA 2LM5A 3PALA 1EL4A 2LE9B 2JULA 2KYCA 3TUYC 4MZKA 1BF5A 2JPOA 2LC5A 1N2DA 2ZN8A 1RWYA 2MRDA 1S6CA 3WHTB 1DGUA 3L47A 3JVTC 2KGRA 2K7BA 5ER5A 1KFXL 1RROA 1JF0A 2VRGA 1TCOB 4N1FA 2LLUA 2LMTA 3EK7A 3S0EA 2V53A 5HLVA 3SG6A 1QX2A 3SG3A 2KFFA 2O5GA 1YUUA 5D69A 1J7QA 1VRKA 3BFHA 1LINA 1BLQA 1NYAA 1S5GZ 1GM0A 2BCAA 3DVEA 1UHKA 5I2QA 2BNXA 1SW8A 1XFZO 3L4LA 3KPXA 3LCPC 2K61A 3D73A 4JKTA 1Y1UA 2WC6A 4JPZB 2LVIA 3EVUA 3I5FC 5JOLA 3WNXB 2JNXA 2M1UA 1TNPA 1K95A 4PHMA 1BR1B 2ZNEA 3NSLA 3CZ0A 5I94A 1RECA 4PE1A 4FQOA 2K7OA 2M29A 3CR5X 3L4AA 5JJGA 3GK1A 1TUZA 4USLA 1JFJA 2JT8A 1KK7Z 1PULA 1A75A 1WDCB 3F45A 4ZCVA 3BJHA 3FS7A 3RLZA 2LP3A 4YRUA 1KWOC 3DY9A 4CFQA 4N5XA 4DRWA 5CSNA 1TN4A 1GGZA 1D1OA 5IBWA 2KI6D 2LLSA 2NXQA 1TRFA 3PM2A 1NX3A 4MEWA 5I2OA 3DVMA 1NX2A 2LHLA 5AANA 1B8RA 4ORCB 2JRFA 4GPLB 3S0BA 1AHRA 4JQ0D 1S1EA 4OKHA 5EL2A 1MUXA 1OOHA 1CMFA 1TOPA 2KDHA 1WRKA 2LUCA 1PVAA 1C7WA 1QX7A 2JZIA 2L5YA 3UO9A 3RM1A 1IIOA 1V1FA 4M2QA 2M0RA 3O4YA 1WLZA 4YBHB 1A75B 2OS8B 3EK4A 3ICBA 1PSRA 1S26D 2WNDA 1J55A 2L2CA 1CFDA 1DJYA 3M0WA 2COLB 1GQMA 1F4OA 3BFBA 3CTNA 3KEVA 1IJ6A 1KQMB 1M31A 4PE4A 5F6TA 2AMIA 2EC6B 4NDBA 2MLFC 1KFUS 2EGDA 2LV7A 3NSKA 5CSJA 3H4SE 1LVCD 3ZWHA 2I7AA 3I5FB 3SG5A 1FF1A 2MA2A 5HLOA 1FW4A 1XYDA 1H4BA 1NSHA 4MSPA 1NPQA 1SPYA 1OZOA 4HSZA 4NDDA 2KSPA 3DF0A 1X02A 1YRTB 3NSOA 3WHUB 3OP0A 1QTXA 1QIWA 2LANA 1NCZA 1NX1A 1YX7A 2ZKMX 3D78A 4ORAB 2JWWA 1Y0VH 3K1EA 4TNCA 1ZOTB 4HREE 2LLTA 1NIWA 3O6BA 3IF7A 4U8DA 4I5LB 1SR6B 3OX5A 5KSZA 1PALA 3B86A 4QJ5B 1WRLA 3IQOA 3JVTB 4CFRA 1CM1A 3OB2B 4INWA 3DYEA 2K60A 2Y5IA 1MQ1A 3EK8A 3QRXA 5ER4X 1DTLA 4FQTA 2ZNDA 1KSOA 3DF0B 3TS5C 1IQ5A 2IS9A 3B7AA 2MHHA 1U5IB 2AAOA 1SL7A 1N0YA 1S6JA 2LCPA 4GAOA 3TUYB 4GGFC 1B47A 4YI9A 3R1VA 2YGUA 1BODA 2L0PA 3BUOB 2G2BA 1ALWA 3CYZA 2M97A 2CTNA 1TUJA 1WLMA 2KPHA 1OMVA 1DT7B 3QMEA 1M45A 1J1DA 3GK2A 3I5IC 3D10A 2QACA 2Y4QA 1NCYA 2WCBA 1OW4A 2L50A 4YGEB 2KYFA 2KFGA 2WCHA 3PN7B 2WCLA 3BYAA 1QLKA 4OZDA 1FI6A 2E30A 1DJGA 1SRAA 1Q80A 2PALA 4WRIA 2M9GA 3B87A 3JTDC 1WY9A 4PHNA 2M8UA 1J7RA 1K2HA 5DKQA 1TNXA 3VRRA 5TNCA 1CLLA 2KHNA 1K9UA 2BL0C 2KI4B 2L98A 3PLFB 3WXAA 3NHIA 4AOMA 1U5IA 1KSMA 1K8UA 3I5HB 1LKJA 3CZ1A 5FYXA 1CLMA 1QV1A 1S6IA 2AUCA 1BR4B 1B9AA 2KLDA 2OTGC 1QATA 3RZSA 1SK6D 1QV0A 1EG3A 1EXRA 1M39A 3I5IB 4I5KA 3S0FA 1L2OC 1SKTA 2NZ0A 2BKIB 2QEHA 4MRXA 1JSAA 1JFKA 1CFCA 1XFVO 1S3PA 1ZMZA 4PT1A 1CFFA 2KGBC 4CIDA 3UNWA 3LK1A 2QDIA 1QASA 4D1EA 1IG5A 2K0JA 1UHJA 4PE7A 1SCMC 4YGCB 1KQVA 2EHBA 1XA5A 1W9ZA 1Y1XA 1BOCA 2KLEA 2LVKA 1N65A 2LMUA 3E3RA 1JF2A 1TIZA 2BE6A 1GJYA 3BUWB 2D8NA 2M3WA 1TTXA 3EG5B 1J1EA 1UWOA 4MZLA 5AXIA 4A4BA 1EG4A 1IH0A 1XFXO 2L51A 1OZSA 3OHMB 3A8RA 3FIAA 2MJWB 1XFYO 1QVIZ 1F4QA 3CWGA 2BKHB 5K89A 3I5HC 3VRNA 1OOGA 1Y1AA 2I18A 1OOJA 1YRUB 1DJZA 4DS7A 1DF0A 1YVLA 4WQ2A 3D0YB 1YVHA 3PATA 1YTZC 4GFTA 4DUQA 2ZRTA 3AAKA 2WC8A 5KU1A 2NCPA 2BAPA 3AKAA 2CBLA 1CDNA 2KQ6A 1QIVA 1AP4A 1F55A 2KOTA 1W7JB 1JBAA 1CMGA 1NCXA 2LAPA 2K8MB 1MXEA 2CCMA 1T14A 3LLEA 4PDZA 5HYDA 2F8PA 1YX8A 1G8IA 1J7PA 1MF8B 2I2RE 5FI2A 4MRYA 1OE9B 1CDPA 1KQMC 5FI6A 1MWNA 2JOJA 1AVSA 1ODBA 3S0GA 1WRZA 2JU0A 4PHKA 1B7TY 5FI7A 2HPSA 1CLBA 5B8IB 2OS8C 2FCDA 2WCMA 1KFXS 3CZ2A 3KF9A 2KAYA 4GBAA 5KTYA 3EKJA 3TS5B 4YGDB 1R2UA 1QXPA 1K9PA 3VROA 3Q8IA 2BECA 2LUXA 1CDLA 4N1GA 1S5GY 1R6PA 1B8LA 2JTZA 2P6BB 3O4XA 4A4CA 1F54A 1BJFA 2BBMA 1K96A 1K90D 2L4IA 2PRUA
chains in the Genus database with same CATH topology
2ISDA 1B7TZ 2KNEA 3SIAA 2JC2A 2H61C 2KBIA 2LVVA 2MLEC 3HCMA 3AAJA 3GOFA 1KWOB 1CB1A 2JPTA 1K9KA 2KAXA 4L9MA 4MBEA 1EJ3A 2WCEA 4CLNA 1SYMA 2I94A 2K2AA 1FBVA 2MAZA 4PHJA 3ZNIA 2B1UA 1QJTA 4MLWA 5AERA 1M46A 3EVVA 1DMOA 4BY5A 2K7DA 1A2XA 3TZ1A 2LMVA 1HT9A 4ETOA 1IGVA 2PASA 2L4HA 1G33A 2JTTA 1MHOA 2GGZA 3DVJA 3CR4X 4QJ3B 1CKKA 1NP8A 2EC6C 1PRWA 2E6WA 5HKYA 4MVFA 1RJVA 3BUNB 1OMDA 5J3XA 1MXLC 1QX5B 3OB1B 4XJKA 2F2OA 3CGAA 1S36A 2BCBA 3CR2A 4GGNA 1TNWA 4MZJA 1OMRA 2KI6C 1Y6WA 5AFPA 1BT6A 3EVRA 3KO0A 1XO5A 3PFVA 1F70A 1J7OA 1SL8A 3BUMB 3O2PA 2PVBA 1RK9A 1NUBA 2K7CA 1CM4A 4JWQA 1LA0A 2M7NA 1IWQA 1OQPA 5DKRA 2FCEA 3BUXB 4MN0A 3KHEA 4OV2A 1KFUL 5AEQA 1WDCC 4AQJA 4XJKB 1YR5A 2NCOA 2JQ6A 3VGOA 4C0KA 2KBMA 3NSIA 3BXKA 3SJSA 4BY4A 1DGVA 4DCKA 2BBNA 4QJ4B 2GV5A 2JXCA 2HQWA 1AJ5A 1RTP1 1XVJA 1QLSA 3HX4A 5CSFA 1GGWA 4NDCA 5HKZA 1SBJA 5GQQC 1B8CA 1HQVA 1TNQA 3SG7A 1AJ4A 1LXFC 1C07A 4AQIA 1UUSA 3CLNA 2HF5A 2H2KA 2RGIA 1DVIA 1QS7A 3MSEB 1V1GA 1ZUZA 5PALA 1DF0B 2A4JA 1EH2A 1B4CA 3OX6A 2L2EA 3DVKA 1W7IB 2SASA 2M49B 3EKHA 4GUKA 4HRHA 1IRJA 3C1VA 5CSIA 1QVIY 2OPOA 3BOWB 3VRPA 4IL1A 1YURA 3SG2A 1KK7Y 2CNPA 4YGBB 2HETA 2WCFA 4P2YB 4CPVA 1YUTA 2BE4A 2ZFDA 2CT9A 1PSBA 1F71A 4PALA 1UHIA 2ZRSA 1SCMB 2CXJA 2M1KB 2O60A 2NLNA 1JC2A 3CS1A 3LL8B 2Y1NA 3GK4X 3I5GB 4XYNA 1PK0D 4GNKB 4C0JA 1L2OB 2DOQA 1AUIB 3PM8A 1BG1A 1CDMA 3LK0A 2Q4UA 3A4UB 3K21A 4NQGA 1KCYA 3FWCA 2LNKA 1G4YR 1CFPA 1RFJA 2PSRA 1AK8A 2F3YA 2H61A 4PCWA 1ALVA 2K2FA 2R2IA 4YGAA 1KK8B 4E68A 3BOWA 3JTDB 1B1GA 1A4PA 1TCFA 5D7FA 4PE0A 1L7ZA 1F8HA 4WQ3A 2Q91A 1CNPA 1BU3A 2WORA 3AKBA 3IQQA 1SCVA 4ZCUA 1UHHA 3SIBA 2KFHA 2TN4A 1SNLA 2F2PA 1YUSA 1DJHA 4I5NB 4C0LA 4OR9B 1M63B 3D0YA 2WOSA 2JT3A 1A29A 3I5GC 3VRQA 1FPWA 1UURA 3BQ3A 3FWBA 1XK4C 2M7LA 4ORBB 1H8BA 1E8AA 2QPTA 1C7VA 3TDZA 1CTRA 1UHNA 1DJWA 2JNFA 1LA3A 4OCIA 1K93D 2KAVA 1IKUA 5HKWA 2BCXA 2F3ZA 2F33A 1DJXA 1SY9A 1UP5A 1JWDA 2GGMA 1DJIA 1K94A 1SR6C 2OTGB 2Y1MA 2SCPA 2LHIA 1FI5A 1IJ5A 1JUOA 1ZFSA 2ZN9A 3O78A 3NXAA 4DIRA 2FOTA 3PSRA 2HQ8A 4FTGA 2L5XB 1PVBA 2KI4C 2BL0B 2KQYA 4ICBA 5I8NA 5BPJA 4HRGA 3CZTX 1MR8A 1KK8C 1A03A 2LP2A 3SG4A 1XFWO 1ZACA 1XK4A 1SL9A 2JT0A 4GGFA 4M2OA 3TDUA 3TDIA 1OSAA 2G9BA 4I5JA 4Q04A 1IQ3A 1SMGA 3PN7C 1BMOA 4P5OE 2PMYA 2LVJA 4R1EA 4YI8A 5CPVA 5DKNA 4OVNF 1NWDA 1NX0A 2MBXA 5G08A 5I2LA 1XFUO 2FJUB 3DD4A 4F0ZB 4M2PA 4UPGA 2JXLA 2LM5A 3PALA 1EL4A 2LE9B 2JULA 2KYCA 3TUYC 4MZKA 1BF5A 2LC5A 1N2DA 2ZN8A 1RWYA 2MRDA 1S6CA 3WHTB 1DGUA 3JVTC 2KGRA 2K7BA 5ER5A 1KFXL 1RROA 1JF0A 2VRGA 1TCOB 4N1FA 2LLUA 2LMTA 3EK7A 2V53A 5HLVA 3SG6A 1QX2A 3SG3A 2KFFA 2O5GA 1YUUA 5D69A 1J7QA 1VRKA 1LINA 1BLQA 1NYAA 1S5GZ 2BCAA 3DVEA 1UHKA 5I2QA 1SW8A 1XFZO 3KPXA 3LCPC 2K61A 1Y1UA 4JPZB 2LVIA 3EVUA 3I5FC 5JOLA 3WNXB 2JNXA 2M1UA 1TNPA 1K95A 4PHMA 1BR1B 2ZNEA 3NSLA 1RECA 4PE1A 4FQOA 2K7OA 2M29A 3CR5X 5JJGA 3GK1A 4USLA 1JFJA 2JT8A 1KK7Z 1PULA 1A75A 1WDCB 3F45A 4ZCVA 3FS7A 3RLZA 2LP3A 4YRUA 1KWOC 4CFQA 4N5XA 4DRWA 5CSNA 1TN4A 1GGZA 1D1OA 5IBWA 2KI6D 2LLSA 2NXQA 1TRFA 4MEWA 1NX3A 5I2OA 3DVMA 1NX2A 2LHLA 5AANA 1B8RA 4ORCB 2JRFA 4GPLB 1AHRA 4JQ0D 1S1EA 4OKHA 1MUXA 1CMFA 1TOPA 2KDHA 1WRKA 2LUCA 1PVAA 1C7WA 1QX7A 2JZIA 3RM1A 1V1FA 4M2QA 2M0RA 3O4YA 1WLZA 4YBHB 1A75B 2OS8B 3EK4A 3ICBA 1PSRA 1S26D 2WNDA 1J55A 3M0WA 1CFDA 1DJYA 2COLB 1GQMA 1F4OA 3CTNA 3KEVA 1IJ6A 1KQMB 1M31A 4PE4A 5F6TA 2AMIA 2EC6B 4NDBA 2MLFC 1KFUS 2EGDA 2LV7A 3NSKA 5CSJA 3H4SE 1LVCD 3ZWHA 2I7AA 3I5FB 3SG5A 1FF1A 2MA2A 5HLOA 1FW4A 1XYDA 1H4BA 1NSHA 4MSPA 1NPQA 1SPYA 1OZOA 4HSZA 4NDDA 2KSPA 3DF0A 1X02A 1YRTB 3NSOA 3WHUB 3OP0A 1QTXA 1QIWA 2LANA 1NCZA 1NX1A 1YX7A 2ZKMX 4ORAB 2JWWA 1Y0VH 4TNCA 1ZOTB 4HREE 2LLTA 1NIWA 3O6BA 3IF7A 4U8DA 4I5LB 1SR6B 3OX5A 5KSZA 1PALA 4QJ5B 1WRLA 3IQOA 3JVTB 4CFRA 1CM1A 3OB2B 5ER4X 2Y5IA 1MQ1A 3EK8A 3QRXA 1DTLA 2ZNDA 1KSOA 3DF0B 3TS5C 1IQ5A 2IS9A 2MHHA 1U5IB 2AAOA 1SL7A 1N0YA 1S6JA 2LCPA 4GAOA 3TUYB 4GGFC 1B47A 4YI9A 1BODA 2L0PA 3BUOB 2G2BA 1ALWA 2M97A 2CTNA 1WLMA 1OMVA 1DT7B 1M45A 1J1DA 3GK2A 3I5IC 3D10A 2QACA 2Y4QA 1NCYA 2WCBA 2L50A 4YGEB 2KYFA 2KFGA 3PN7B 3BYAA 1QLKA 1FI6A 2E30A 1DJGA 1SRAA 1Q80A 2PALA 4WRIA 2M9GA 3JTDC 1WY9A 4PHNA 2M8UA 1J7RA 1K2HA 5DKQA 1TNXA 3VRRA 5TNCA 1CLLA 2KHNA 1K9UA 2BL0C 2KI4B 2L98A 3PLFB 3WXAA 4AOMA 1U5IA 1KSMA 1K8UA 3I5HB 1LKJA 5FYXA 1CLMA 1QV1A 1S6IA 2AUCA 1BR4B 1B9AA 2OTGC 1QATA 1SK6D 1QV0A 1EG3A 1EXRA 1M39A 3I5IB 4I5KA 1JBAA 1L2OC 1SKTA 2NZ0A 2BKIB 4MRXA 1JSAA 1JFKA 1CFCA 1XFVO 1S3PA 1ZMZA 1CFFA 2KGBC 4CIDA 3LK1A 4D1EA 1QASA 1IG5A 2K0JA 1UHJA 4PE7A 1SCMC 4YGCB 1KQVA 2EHBA 1XA5A 1Y1XA 1BOCA 2LVKA 1N65A 2LMUA 3E3RA 1JF2A 1TIZA 2BE6A 1GJYA 3BUWB 2D8NA 2M3WA 1TTXA 1J1EA 1UWOA 4MZLA 5AXIA 4A4BA 1EG4A 1IH0A 1XFXO 2L51A 1OZSA 3OHMB 3A8RA 3FIAA 2MJWB 1XFYO 1QVIZ 1F4QA 3CWGA 2BKHB 5K89A 3I5HC 3VRNA 1Y1AA 2I18A 1OOJA 1YRUB 1DJZA 4DS7A 1DF0A 1YVLA 4WQ2A 3D0YB 1YVHA 3PATA 1YTZC 4GFTA 4DUQA 2ZRTA 3AAKA 2WC8A 5KU1A 2NCPA 3AKAA 2CBLA 1CDNA 2KQ6A 1QIVA 1AP4A 1F55A 2KOTA 1W7JB 1CMGA 1NCXA 2LAPA 2K8MB 1MXEA 2CCMA 3LLEA 4PDZA 5HYDA 2F8PA 1YX8A 1G8IA 1J7PA 1MF8B 2I2RE 4MRYA 1OE9B 1CDPA 1KQMC 1MWNA 2JOJA 1AVSA 1ODBA 1WRZA 2JU0A 4PHKA 1B7TY 1CLBA 2HPSA 5B8IB 2OS8C 2FCDA 1KFXS 3KF9A 2KAYA 4GBAA 5KTYA 3EKJA 3TS5B 4YGDB 1R2UA 1QXPA 1K9PA 3VROA 2BECA 2LUXA 1CDLA 4N1GA 1S5GY 1R6PA 1B8LA 2JTZA 2P6BB 4A4CA 1F54A 1BJFA 2BBMA 1K96A 1K90D 2L4IA 2PRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ISD A;  1B7T Z;  2KNE A;  3SIA A;  2JC2 A;  2H61 C;  2KBI A;  2LVV A;  2MLE C;  3HCM A;  3AAJ A;  3GOF A;  1KWO B;  1CB1 A;  2JPT A;  1K9K A;  2KAX A;  4L9M A;  4MBE A;  1EJ3 A;  2WCE A;  4CLN A;  1SYM A;  2I94 A;  2K2A A;  1FBV A;  2MAZ A;  4PHJ A;  3ZNI A;  2B1U A;  1QJT A;  4MLW A;  5AER A;  1M46 A;  3EVV A;  1DMO A;  4BY5 A;  2K7D A;  1A2X A;  3TZ1 A;  2LMV A;  1HT9 A;  4ETO A;  1IGV A;  2PAS A;  2L4H A;  1G33 A;  2JTT A;  1MHO A;  2GGZ A;  3DVJ A;  3CR4 X;  4QJ3 B;  1CKK A;  1NP8 A;  2EC6 C;  1PRW A;  2E6W A;  5HKY A;  4MVF A;  1RJV A;  3BUN B;  1OMD A;  5J3X A;  1MXL C;  1QX5 B;  3OB1 B;  4XJK A;  2F2O A;  3CGA A;  1S36 A;  2BCB A;  3CR2 A;  4GGN A;  1TNW A;  4MZJ A;  1OMR A;  2KI6 C;  1Y6W A;  5AFP A;  1BT6 A;  3EVR A;  3KO0 A;  1XO5 A;  3PFV A;  1F70 A;  1J7O A;  1SL8 A;  3BUM B;  3O2P A;  2PVB A;  1RK9 A;  1NUB A;  2K7C A;  1CM4 A;  4JWQ A;  1LA0 A;  2M7N A;  1IWQ A;  1OQP A;  5DKR A;  2FCE A;  3BUX B;  4MN0 A;  3KHE A;  4OV2 A;  1KFU L;  5AEQ A;  1WDC C;  4AQJ A;  4XJK B;  1YR5 A;  2NCO A;  2JQ6 A;  3VGO A;  4C0K A;  2KBM A;  3NSI A;  3BXK A;  3SJS A;  4BY4 A;  1DGV A;  4DCK A;  2BBN A;  4QJ4 B;  2GV5 A;  2JXC A;  2HQW A;  1AJ5 A;  1RTP 1;  1XVJ A;  1QLS A;  3HX4 A;  5CSF A;  1GGW A;  4NDC A;  5HKZ A;  1SBJ A;  5GQQ C;  1B8C A;  1HQV A;  1TNQ A;  3SG7 A;  1AJ4 A;  1LXF C;  1C07 A;  4AQI A;  1UUS A;  3CLN A;  2HF5 A;  2H2K A;  2RGI A;  1DVI A;  1QS7 A;  3MSE B;  1V1G A;  1ZUZ A;  5PAL A;  1DF0 B;  2A4J A;  1EH2 A;  1B4C A;  3OX6 A;  2L2E A;  3DVK A;  1W7I B;  2SAS A;  2M49 B;  3EKH A;  4GUK A;  4HRH A;  1IRJ A;  3C1V A;  5CSI A;  1QVI Y;  2OPO A;  3BOW B;  3VRP A;  4IL1 A;  1YUR A;  3SG2 A;  1KK7 Y;  2CNP A;  4YGB B;  2HET A;  2WCF A;  4P2Y B;  4CPV A;  1YUT A;  2BE4 A;  2ZFD A;  2CT9 A;  1PSB A;  1F71 A;  4PAL A;  1UHI A;  2ZRS A;  1SCM B;  2CXJ A;  2M1K B;  2O60 A;  2NLN A;  1JC2 A;  3CS1 A;  3LL8 B;  2Y1N A;  3GK4 X;  3I5G B;  4XYN A;  1PK0 D;  4GNK B;  4C0J A;  1L2O B;  2DOQ A;  1AUI B;  3PM8 A;  1BG1 A;  1CDM A;  3LK0 A;  2Q4U A;  3A4U B;  3K21 A;  4NQG A;  1KCY A;  3FWC A;  2LNK A;  1G4Y R;  1CFP A;  1RFJ A;  2PSR A;  1AK8 A;  2F3Y A;  2H61 A;  4PCW A;  1ALV A;  2K2F A;  2R2I A;  4YGA A;  1KK8 B;  4E68 A;  3BOW A;  3JTD B;  1B1G A;  1A4P A;  1TCF A;  5D7F A;  4PE0 A;  1L7Z A;  1F8H A;  4WQ3 A;  2Q91 A;  1CNP A;  1BU3 A;  2WOR A;  3AKB A;  3IQQ A;  1SCV A;  4ZCU A;  1UHH A;  3SIB A;  2KFH A;  2TN4 A;  1SNL A;  2F2P A;  1YUS A;  1DJH A;  4I5N B;  4C0L A;  4OR9 B;  1M63 B;  3D0Y A;  2WOS A;  2JT3 A;  1A29 A;  3I5G C;  3VRQ A;  1FPW A;  1UUR A;  3BQ3 A;  3FWB A;  1XK4 C;  2M7L A;  4ORB B;  1H8B A;  1E8A A;  2QPT A;  1C7V A;  3TDZ A;  1CTR A;  1UHN A;  1DJW A;  2JNF A;  1LA3 A;  4OCI A;  1K93 D;  2KAV A;  1IKU A;  5HKW A;  2BCX A;  2F3Z A;  2F33 A;  1DJX A;  1SY9 A;  1UP5 A;  1JWD A;  2GGM A;  1DJI A;  1K94 A;  1SR6 C;  2OTG B;  2Y1M A;  2SCP A;  2LHI A;  1FI5 A;  1IJ5 A;  1JUO A;  1ZFS A;  2ZN9 A;  3O78 A;  3NXA A;  4DIR A;  2FOT A;  3PSR A;  2HQ8 A;  4FTG A;  2L5X B;  1PVB A;  2KI4 C;  2BL0 B;  2KQY A;  4ICB A;  5I8N A;  5BPJ A;  4HRG A;  3CZT X;  1MR8 A;  1KK8 C;  1A03 A;  2LP2 A;  3SG4 A;  1XFW O;  1ZAC A;  1XK4 A;  1SL9 A;  2JT0 A;  4GGF A;  4M2O A;  3TDU A;  3TDI A;  1OSA A;  2G9B A;  4I5J A;  4Q04 A;  1IQ3 A;  1SMG A;  3PN7 C;  1BMO A;  4P5O E;  2PMY A;  2LVJ A;  4R1E A;  4YI8 A;  5CPV A;  5DKN A;  4OVN F;  1NWD A;  1NX0 A;  2MBX A;  5G08 A;  5I2L A;  1XFU O;  2FJU B;  3DD4 A;  4F0Z B;  4M2P A;  4UPG A;  2JXL A;  2LM5 A;  3PAL A;  1EL4 A;  2LE9 B;  2JUL A;  2KYC A;  3TUY C;  4MZK A;  1BF5 A;  2LC5 A;  1N2D A;  2ZN8 A;  1RWY A;  2MRD A;  1S6C A;  3WHT B;  1DGU A;  3JVT C;  2KGR A;  2K7B A;  5ER5 A;  1KFX L;  1RRO A;  1JF0 A;  2VRG A;  1TCO B;  4N1F A;  2LLU A;  2LMT A;  3EK7 A;  2V53 A;  5HLV A;  3SG6 A;  1QX2 A;  3SG3 A;  2KFF A;  2O5G A;  1YUU A;  5D69 A;  1J7Q A;  1VRK A;  1LIN A;  1BLQ A;  1NYA A;  1S5G Z;  2BCA A;  3DVE A;  1UHK A;  5I2Q A;  1SW8 A;  1XFZ O;  3KPX A;  3LCP C;  2K61 A;  1Y1U A;  4JPZ B;  2LVI A;  3EVU A;  3I5F C;  5JOL A;  3WNX B;  2JNX A;  2M1U A;  1TNP A;  1K95 A;  4PHM A;  1BR1 B;  2ZNE A;  3NSL A;  1REC A;  4PE1 A;  4FQO A;  2K7O A;  2M29 A;  3CR5 X;  5JJG A;  3GK1 A;  4USL A;  1JFJ A;  2JT8 A;  1KK7 Z;  1PUL A;  1A75 A;  1WDC B;  3F45 A;  4ZCV A;  3FS7 A;  3RLZ A;  2LP3 A;  4YRU A;  1KWO C;  4CFQ A;  4N5X A;  4DRW A;  5CSN A;  1TN4 A;  1GGZ A;  1D1O A;  5IBW A;  2KI6 D;  2LLS A;  2NXQ A;  1TRF A;  4MEW A;  1NX3 A;  5I2O A;  3DVM A;  1NX2 A;  2LHL A;  5AAN A;  1B8R A;  4ORC B;  2JRF A;  4GPL B;  1AHR A;  4JQ0 D;  1S1E A;  4OKH A;  1MUX A;  1CMF A;  1TOP A;  2KDH A;  1WRK A;  2LUC A;  1PVA A;  1C7W A;  1QX7 A;  2JZI A;  3RM1 A;  1V1F A;  4M2Q A;  2M0R A;  3O4Y A;  1WLZ A;  4YBH B;  1A75 B;  2OS8 B;  3EK4 A;  3ICB A;  1PSR A;  1S26 D;  2WND A;  1J55 A;  3M0W A;  1CFD A;  1DJY A;  2COL B;  1GQM A;  1F4O A;  3CTN A;  3KEV A;  1IJ6 A;  1KQM B;  1M31 A;  4PE4 A;  5F6T A;  2AMI A;  2EC6 B;  4NDB A;  2MLF C;  1KFU S;  2EGD A;  2LV7 A;  3NSK A;  5CSJ A;  3H4S E;  1LVC D;  3ZWH A;  2I7A A;  3I5F B;  3SG5 A;  1FF1 A;  2MA2 A;  5HLO A;  1FW4 A;  1XYD A;  1H4B A;  1NSH A;  4MSP A;  1NPQ A;  1SPY A;  1OZO A;  4HSZ A;  4NDD A;  2KSP A;  3DF0 A;  1X02 A;  1YRT B;  3NSO A;  3WHU B;  3OP0 A;  1QTX A;  1QIW A;  2LAN A;  1NCZ A;  1NX1 A;  1YX7 A;  2ZKM X;  4ORA B;  2JWW A;  1Y0V H;  4TNC A;  1ZOT B;  4HRE E;  2LLT A;  1NIW A;  3O6B A;  3IF7 A;  4U8D A;  4I5L B;  1SR6 B;  3OX5 A;  5KSZ A;  1PAL A;  4QJ5 B;  1WRL A;  3IQO A;  3JVT B;  4CFR A;  1CM1 A;  3OB2 B;  5ER4 X;  2Y5I A;  1MQ1 A;  3EK8 A;  3QRX A;  1DTL A;  2ZND A;  1KSO A;  3DF0 B;  3TS5 C;  1IQ5 A;  2IS9 A;  2MHH A;  1U5I B;  2AAO A;  1SL7 A;  1N0Y A;  1S6J A;  2LCP A;  4GAO A;  3TUY B;  4GGF C;  1B47 A;  4YI9 A;  1BOD A;  2L0P A;  3BUO B;  2G2B A;  1ALW A;  2M97 A;  2CTN A;  1WLM A;  1OMV A;  1DT7 B;  1M45 A;  1J1D A;  3GK2 A;  3I5I C;  3D10 A;  2QAC A;  2Y4Q A;  1NCY A;  2WCB A;  2L50 A;  4YGE B;  2KYF A;  2KFG A;  3PN7 B;  3BYA A;  1QLK A;  1FI6 A;  2E30 A;  1DJG A;  1SRA A;  1Q80 A;  2PAL A;  4WRI A;  2M9G A;  3JTD C;  1WY9 A;  4PHN A;  2M8U A;  1J7R A;  1K2H A;  5DKQ A;  1TNX A;  3VRR A;  5TNC A;  1CLL A;  2KHN A;  1K9U A;  2BL0 C;  2KI4 B;  2L98 A;  3PLF B;  3WXA A;  4AOM A;  1U5I A;  1KSM A;  1K8U A;  3I5H B;  1LKJ A;  5FYX A;  1CLM A;  1QV1 A;  1S6I A;  2AUC A;  1BR4 B;  1B9A A;  2OTG C;  1QAT A;  1SK6 D;  1QV0 A;  1EG3 A;  1EXR A;  1M39 A;  3I5I B;  4I5K A;  1JBA A;  1L2O C;  1SKT A;  2NZ0 A;  2BKI B;  4MRX A;  1JSA A;  1JFK A;  1CFC A;  1XFV O;  1S3P A;  1ZMZ A;  1CFF A;  2KGB C;  4CID A;  3LK1 A;  4D1E A;  1QAS A;  1IG5 A;  2K0J A;  1UHJ A;  4PE7 A;  1SCM C;  4YGC B;  1KQV A;  2EHB A;  1XA5 A;  1Y1X A;  1BOC A;  2LVK A;  1N65 A;  2LMU A;  3E3R A;  1JF2 A;  1TIZ A;  2BE6 A;  1GJY A;  3BUW B;  2D8N A;  2M3W A;  1TTX A;  1J1E A;  1UWO A;  4MZL A;  5AXI A;  4A4B A;  1EG4 A;  1IH0 A;  1XFX O;  2L51 A;  1OZS A;  3OHM B;  3A8R A;  3FIA A;  2MJW B;  1XFY O;  1QVI Z;  1F4Q A;  3CWG A;  2BKH B;  5K89 A;  3I5H C;  3VRN A;  1Y1A A;  2I18 A;  1OOJ A;  1YRU B;  1DJZ A;  4DS7 A;  1DF0 A;  1YVL A;  4WQ2 A;  3D0Y B;  1YVH A;  3PAT A;  1YTZ C;  4GFT A;  4DUQ A;  2ZRT A;  3AAK A;  2WC8 A;  5KU1 A;  2NCP A;  3AKA A;  2CBL A;  1CDN A;  2KQ6 A;  1QIV A;  1AP4 A;  1F55 A;  2KOT A;  1W7J B;  1CMG A;  1NCX A;  2LAP A;  2K8M B;  1MXE A;  2CCM A;  3LLE A;  4PDZ A;  5HYD A;  2F8P A;  1YX8 A;  1G8I A;  1J7P A;  1MF8 B;  2I2R E;  4MRY A;  1OE9 B;  1CDP A;  1KQM C;  1MWN A;  2JOJ A;  1AVS A;  1ODB A;  1WRZ A;  2JU0 A;  4PHK A;  1B7T Y;  1CLB A;  2HPS A;  5B8I B;  2OS8 C;  2FCD A;  1KFX S;  3KF9 A;  2KAY A;  4GBA A;  5KTY A;  3EKJ A;  3TS5 B;  4YGD B;  1R2U A;  1QXP A;  1K9P A;  3VRO A;  2BEC A;  2LUX A;  1CDL A;  4N1G A;  1S5G Y;  1R6P A;  1B8L A;  2JTZ A;  2P6B B;  4A4C A;  1F54 A;  1BJF A;  2BBM A;  1K96 A;  1K90 D;  2L4I A;  2PRU A; 
#chains in the Genus database with same CATH topology
 2ISD A;  3CAB A;  1B7T Z;  2KNE A;  1ORG A;  3SIA A;  2JC2 A;  2H61 C;  3N7H A;  2KBI A;  2LVV A;  2MLE C;  3HCM A;  3FE8 A;  3AAJ A;  3GOF A;  1KWO B;  4IJ7 A;  1CB1 A;  2JPT A;  1K9K A;  2KAX A;  4L9M A;  4MBE A;  1EJ3 A;  2WCE A;  3OGN A;  3DXL A;  4CLN A;  1SYM A;  2I94 A;  2K2A A;  1FBV A;  2MAZ A;  4PHJ A;  3ZNI A;  2B1U A;  1QJT A;  3BFA A;  4MLW A;  5AER A;  1M46 A;  3EVV A;  1DMO A;  4BY5 A;  2K7D A;  1A2X A;  3TZ1 A;  2LMV A;  1HT9 A;  4ETO A;  1IGV A;  2PAS A;  2L4H A;  1G33 A;  2JTT A;  1MHO A;  2P70 A;  2GGZ A;  3DVJ A;  3CR4 X;  4QJ3 B;  1CKK A;  1NP8 A;  2EC6 C;  1PRW A;  3B6X A;  2E6W A;  5HKY A;  3NHT A;  1RJV A;  4MVF A;  3BUN B;  1OMD A;  5J3X A;  1MXL C;  1QX5 B;  3OB1 B;  4XJK A;  2F2O A;  3CGA A;  1S36 A;  2BCB A;  3CR2 A;  4GGN A;  1TNW A;  2WCK A;  5D3O A;  4MZJ A;  1OMR A;  2KI6 C;  1Y6W A;  5AFP A;  2PYQ A;  5HL1 A;  1BT6 A;  1DEK A;  1C3Z A;  3EVR A;  1XO5 A;  3IVT A;  3KO0 A;  3PFV A;  1F70 A;  1J7O A;  1SL8 A;  3BUM B;  3O2P A;  2PVB A;  1RK9 A;  1NUB A;  2K7C A;  1CM4 A;  4JWQ A;  1XFR A;  1LA0 A;  2M7N A;  1IWQ A;  1OQP A;  5DKR A;  1DQE A;  2FCE A;  3BUX B;  4MN0 A;  3KHE A;  4OV2 A;  1KFU L;  5AEQ A;  1WDC C;  4AQJ A;  4XJK B;  1YR5 A;  2NCO A;  2JQ6 A;  3VGO A;  4C0K A;  2KBM A;  3NSI A;  3BXK A;  3SJS A;  4BY4 A;  3D75 A;  1DGV A;  4DCK A;  2BBN A;  2QEB A;  4QJ4 B;  2GV5 A;  2JXC A;  2HQW A;  2P71 A;  1AJ5 A;  1RTP 1;  1XVJ A;  1QLS A;  3HX4 A;  5CSF A;  1GGW A;  3D77 A;  3FE6 A;  4NDC A;  5HKZ A;  1SBJ A;  5GQQ C;  1B8C A;  1HQV A;  1TNQ A;  3SG7 A;  1AJ4 A;  1LXF C;  2WCJ A;  3NGV A;  1C07 A;  1QWV A;  4AQI A;  1UUS A;  3CLN A;  2HF5 A;  2H2K A;  2RGI A;  1DVI A;  1QS7 A;  3MSE B;  1V1G A;  1ZUZ A;  5PAL A;  1DF0 B;  2A4J A;  4KYN A;  1B4C A;  3OX6 A;  1EH2 A;  3S0A A;  1P28 A;  2L2E A;  3DVK A;  5DIC A;  1W7I B;  2ERB A;  2SAS A;  4INX A;  2M49 B;  2QEV A;  3EKH A;  4GUK A;  4HRH A;  1IRJ A;  1OOF A;  3C1V A;  1C3Y A;  5CSI A;  1QVI Y;  1LS8 A;  2OPO A;  3BOW B;  3VRP A;  3S0D A;  4IL1 A;  1YUR A;  3SG2 A;  3V2L A;  1KK7 Y;  2CNP A;  4YGB B;  2HET A;  2WCF A;  3R1P A;  4P2Y B;  4CPV A;  1YUT A;  2BE4 A;  2ZFD A;  2CT9 A;  1PSB A;  1F71 A;  4PAL A;  2QEO A;  1UHI A;  2ZRS A;  1SCM B;  3CDN A;  2H8V A;  2CXJ A;  2M1K B;  2O60 A;  3B88 A;  2NLN A;  1JC2 A;  3CS1 A;  3FE9 A;  3LL8 B;  2Y1N A;  3GK4 X;  3I5G B;  4XYN A;  1PK0 D;  4GNK B;  4C0J A;  1DEL A;  1L2O B;  2DOQ A;  1AUI B;  3PM8 A;  1BG1 A;  1CDM A;  3LK0 A;  2Q4U A;  3A4U B;  3K21 A;  2GTE A;  4NQG A;  3PJI A;  1KCY A;  3FWC A;  2LNK A;  3D76 A;  1G4Y R;  1CFP A;  1RFJ A;  2PSR A;  1AK8 A;  1SSE B;  2F3Y A;  2H61 A;  4PCW A;  1ALV A;  2K2F A;  2R2I A;  4YGA A;  1KK8 B;  4E68 A;  3BOW A;  3JTD B;  2FJY A;  1A4P A;  1TCF A;  1B1G A;  5D7F A;  4PE0 A;  1L7Z A;  1F8H A;  4WQ3 A;  2Q91 A;  1CNP A;  1BU3 A;  2WOR A;  3AKB A;  3IQQ A;  1SCV A;  4ZCU A;  1UHH A;  3SIB A;  2KFH A;  3SS5 A;  2TN4 A;  1SNL A;  2F2P A;  1YUS A;  1DJH A;  1DC1 A;  4I5N B;  4C0L A;  4OR9 B;  1M63 B;  3D0Y A;  2WOS A;  2JT3 A;  1A29 A;  3I5G C;  3VRQ A;  1FPW A;  1UUR A;  3BQ3 A;  3FWB A;  1XK4 C;  2M7L A;  4ORB B;  1H8B A;  1E8A A;  2QPT A;  1C7V A;  3VB1 A;  3TDZ A;  1CTR A;  1UHN A;  1DJW A;  2JNF A;  1LA3 A;  4OCI A;  1K93 D;  2KAV A;  1IKU A;  3R1O A;  3SS4 A;  5HKW A;  2BCX A;  2F3Z A;  2F33 A;  1DJX A;  3D74 A;  1SY9 A;  1UP5 A;  4JD9 A;  1JWD A;  2GGM A;  3SS3 A;  1DJI A;  1K94 A;  1SR6 C;  2OTG B;  2Y1M A;  2SCP A;  2LHI A;  1FI5 A;  1IJ5 A;  1JUO A;  1Z2C B;  1ZFS A;  2ZN9 A;  3O78 A;  3NXA A;  4DIR A;  2FOT A;  3PSR A;  2HQ8 A;  4FTG A;  2L5X B;  3R72 A;  1PVB A;  2KI4 C;  2BL0 B;  2KQY A;  4ICB A;  5I8N A;  5BPJ A;  1TWO A;  4HRG A;  2PQL A;  1MR8 A;  1KK8 C;  1OOI X;  3CZT X;  1A03 A;  2LP2 A;  3DZT A;  3SG4 A;  1XFW O;  1ZAC A;  1XK4 A;  1SL9 A;  2JT0 A;  4GGF A;  4M2O A;  3TDU A;  2WC5 A;  3TDI A;  4F7F A;  1OSA A;  2G9B A;  4I5J A;  4Q04 A;  1IQ3 A;  1SMG A;  3PN7 C;  1BMO A;  4P5O E;  2PMY A;  2LVJ A;  4R1E A;  1Z4H A;  4YI8 A;  3OBV A;  5CPV A;  5DKN A;  4OVN F;  1NWD A;  1NX0 A;  2MBX A;  5G08 A;  5I2L A;  1XFU O;  2FJU B;  3DD4 A;  4F0Z B;  4M2P A;  4UPG A;  2JXL A;  2LM5 A;  3PAL A;  1EL4 A;  2LE9 B;  2JUL A;  2KYC A;  3TUY C;  4MZK A;  1BF5 A;  2JPO A;  2LC5 A;  1N2D A;  2ZN8 A;  1RWY A;  2MRD A;  1S6C A;  3WHT B;  1DGU A;  3L47 A;  3JVT C;  2KGR A;  2K7B A;  5ER5 A;  1KFX L;  1RRO A;  1JF0 A;  2VRG A;  1TCO B;  4N1F A;  2LLU A;  2LMT A;  3EK7 A;  3S0E A;  2V53 A;  5HLV A;  3SG6 A;  1QX2 A;  3SG3 A;  2KFF A;  2O5G A;  1YUU A;  5D69 A;  1J7Q A;  1VRK A;  3BFH A;  1LIN A;  1BLQ A;  1NYA A;  1S5G Z;  1GM0 A;  2BCA A;  3DVE A;  1UHK A;  5I2Q A;  2BNX A;  1SW8 A;  1XFZ O;  3L4L A;  3KPX A;  3LCP C;  2K61 A;  3D73 A;  4JKT A;  1Y1U A;  2WC6 A;  4JPZ B;  2LVI A;  3EVU A;  3I5F C;  5JOL A;  3WNX B;  2JNX A;  2M1U A;  1TNP A;  1K95 A;  4PHM A;  1BR1 B;  2ZNE A;  3NSL A;  3CZ0 A;  5I94 A;  1REC A;  4PE1 A;  4FQO A;  2K7O A;  2M29 A;  3CR5 X;  3L4A A;  5JJG A;  3GK1 A;  1TUZ A;  4USL A;  1JFJ A;  2JT8 A;  1KK7 Z;  1PUL A;  1A75 A;  1WDC B;  3F45 A;  4ZCV A;  3BJH A;  3FS7 A;  3RLZ A;  2LP3 A;  4YRU A;  1KWO C;  3DY9 A;  4CFQ A;  4N5X A;  4DRW A;  5CSN A;  1TN4 A;  1GGZ A;  1D1O A;  5IBW A;  2KI6 D;  2LLS A;  2NXQ A;  1TRF A;  3PM2 A;  1NX3 A;  4MEW A;  5I2O A;  3DVM A;  1NX2 A;  2LHL A;  5AAN A;  1B8R A;  4ORC B;  2JRF A;  4GPL B;  3S0B A;  1AHR A;  4JQ0 D;  1S1E A;  4OKH A;  5EL2 A;  1MUX A;  1OOH A;  1CMF A;  1TOP A;  2KDH A;  1WRK A;  2LUC A;  1PVA A;  1C7W A;  1QX7 A;  2JZI A;  2L5Y A;  3UO9 A;  3RM1 A;  1IIO A;  1V1F A;  4M2Q A;  2M0R A;  3O4Y A;  1WLZ A;  4YBH B;  1A75 B;  2OS8 B;  3EK4 A;  3ICB A;  1PSR A;  1S26 D;  2WND A;  1J55 A;  2L2C A;  1CFD A;  1DJY A;  3M0W A;  2COL B;  1GQM A;  1F4O A;  3BFB A;  3CTN A;  3KEV A;  1IJ6 A;  1KQM B;  1M31 A;  4PE4 A;  5F6T A;  2AMI A;  2EC6 B;  4NDB A;  2MLF C;  1KFU S;  2EGD A;  2LV7 A;  3NSK A;  5CSJ A;  3H4S E;  1LVC D;  3ZWH A;  2I7A A;  3I5F B;  3SG5 A;  1FF1 A;  2MA2 A;  5HLO A;  1FW4 A;  1XYD A;  1H4B A;  1NSH A;  4MSP A;  1NPQ A;  1SPY A;  1OZO A;  4HSZ A;  4NDD A;  2KSP A;  3DF0 A;  1X02 A;  1YRT B;  3NSO A;  3WHU B;  3OP0 A;  1QTX A;  1QIW A;  2LAN A;  1NCZ A;  1NX1 A;  1YX7 A;  2ZKM X;  3D78 A;  4ORA B;  2JWW A;  1Y0V H;  3K1E A;  4TNC A;  1ZOT B;  4HRE E;  2LLT A;  1NIW A;  3O6B A;  3IF7 A;  4U8D A;  4I5L B;  1SR6 B;  3OX5 A;  5KSZ A;  1PAL A;  3B86 A;  4QJ5 B;  1WRL A;  3IQO A;  3JVT B;  4CFR A;  1CM1 A;  3OB2 B;  4INW A;  3DYE A;  2K60 A;  2Y5I A;  1MQ1 A;  3EK8 A;  3QRX A;  5ER4 X;  1DTL A;  4FQT A;  2ZND A;  1KSO A;  3DF0 B;  3TS5 C;  1IQ5 A;  2IS9 A;  3B7A A;  2MHH A;  1U5I B;  2AAO A;  1SL7 A;  1N0Y A;  1S6J A;  2LCP A;  4GAO A;  3TUY B;  4GGF C;  1B47 A;  4YI9 A;  3R1V A;  2YGU A;  1BOD A;  2L0P A;  3BUO B;  2G2B A;  1ALW A;  3CYZ A;  2M97 A;  2CTN A;  1TUJ A;  1WLM A;  2KPH A;  1OMV A;  1DT7 B;  3QME A;  1M45 A;  1J1D A;  3GK2 A;  3I5I C;  3D10 A;  2QAC A;  2Y4Q A;  1NCY A;  2WCB A;  1OW4 A;  2L50 A;  4YGE B;  2KYF A;  2KFG A;  2WCH A;  3PN7 B;  2WCL A;  3BYA A;  1QLK A;  4OZD A;  1FI6 A;  2E30 A;  1DJG A;  1SRA A;  1Q80 A;  2PAL A;  4WRI A;  2M9G A;  3B87 A;  3JTD C;  1WY9 A;  4PHN A;  2M8U A;  1J7R A;  1K2H A;  5DKQ A;  1TNX A;  3VRR A;  5TNC A;  1CLL A;  2KHN A;  1K9U A;  2BL0 C;  2KI4 B;  2L98 A;  3PLF B;  3WXA A;  3NHI A;  4AOM A;  1U5I A;  1KSM A;  1K8U A;  3I5H B;  1LKJ A;  3CZ1 A;  5FYX A;  1CLM A;  1QV1 A;  1S6I A;  2AUC A;  1BR4 B;  1B9A A;  2KLD A;  2OTG C;  1QAT A;  3RZS A;  1SK6 D;  1QV0 A;  1EG3 A;  1EXR A;  1M39 A;  3I5I B;  4I5K A;  3S0F A;  1L2O C;  1SKT A;  2NZ0 A;  2BKI B;  2QEH A;  4MRX A;  1JSA A;  1JFK A;  1CFC A;  1XFV O;  1S3P A;  1ZMZ A;  4PT1 A;  1CFF A;  2KGB C;  4CID A;  3UNW A;  3LK1 A;  2QDI A;  1QAS A;  4D1E A;  1IG5 A;  2K0J A;  1UHJ A;  4PE7 A;  1SCM C;  4YGC B;  1KQV A;  2EHB A;  1XA5 A;  1W9Z A;  1Y1X A;  1BOC A;  2KLE A;  2LVK A;  1N65 A;  2LMU A;  3E3R A;  1JF2 A;  1TIZ A;  2BE6 A;  1GJY A;  3BUW B;  2D8N A;  2M3W A;  1TTX A;  3EG5 B;  1J1E A;  1UWO A;  4MZL A;  5AXI A;  4A4B A;  1EG4 A;  1IH0 A;  1XFX O;  2L51 A;  1OZS A;  3OHM B;  3A8R A;  3FIA A;  2MJW B;  1XFY O;  1QVI Z;  1F4Q A;  3CWG A;  2BKH B;  5K89 A;  3I5H C;  3VRN A;  1OOG A;  1Y1A A;  2I18 A;  1OOJ A;  1YRU B;  1DJZ A;  4DS7 A;  1DF0 A;  1YVL A;  4WQ2 A;  3D0Y B;  1YVH A;  3PAT A;  1YTZ C;  4GFT A;  4DUQ A;  2ZRT A;  3AAK A;  2WC8 A;  5KU1 A;  2NCP A;  2BAP A;  3AKA A;  2CBL A;  1CDN A;  2KQ6 A;  1QIV A;  1AP4 A;  1F55 A;  2KOT A;  1W7J B;  1JBA A;  1CMG A;  1NCX A;  2LAP A;  2K8M B;  1MXE A;  2CCM A;  1T14 A;  3LLE A;  4PDZ A;  5HYD A;  2F8P A;  1YX8 A;  1G8I A;  1J7P A;  1MF8 B;  2I2R E;  5FI2 A;  4MRY A;  1OE9 B;  1CDP A;  1KQM C;  5FI6 A;  1MWN A;  2JOJ A;  1AVS A;  1ODB A;  3S0G A;  1WRZ A;  2JU0 A;  4PHK A;  1B7T Y;  5FI7 A;  2HPS A;  1CLB A;  5B8I B;  2OS8 C;  2FCD A;  2WCM A;  1KFX S;  3CZ2 A;  3KF9 A;  2KAY A;  4GBA A;  5KTY A;  3EKJ A;  3TS5 B;  4YGD B;  1R2U A;  1QXP A;  1K9P A;  3VRO A;  3Q8I A;  2BEC A;  2LUX A;  1CDL A;  4N1G A;  1S5G Y;  1R6P A;  1B8L A;  2JTZ A;  2P6B B;  3O4X A;  4A4C A;  1F54 A;  1BJF A;  2BBM A;  1K96 A;  1K90 D;  2L4I A;  2PRU A; 
#chains in the Genus database with same CATH homology
 2ISD A;  1B7T Z;  2KNE A;  3SIA A;  2JC2 A;  2H61 C;  2KBI A;  2LVV A;  2MLE C;  3HCM A;  3AAJ A;  3GOF A;  1KWO B;  1CB1 A;  2JPT A;  1K9K A;  2KAX A;  4L9M A;  4MBE A;  1EJ3 A;  2WCE A;  4CLN A;  1SYM A;  2I94 A;  2K2A A;  1FBV A;  2MAZ A;  4PHJ A;  3ZNI A;  2B1U A;  1QJT A;  4MLW A;  5AER A;  1M46 A;  3EVV A;  1DMO A;  4BY5 A;  2K7D A;  1A2X A;  3TZ1 A;  2LMV A;  1HT9 A;  4ETO A;  1IGV A;  2PAS A;  2L4H A;  1G33 A;  2JTT A;  1MHO A;  2GGZ A;  3DVJ A;  3CR4 X;  4QJ3 B;  1CKK A;  1NP8 A;  2EC6 C;  1PRW A;  2E6W A;  5HKY A;  4MVF A;  1RJV A;  3BUN B;  1OMD A;  5J3X A;  1MXL C;  1QX5 B;  3OB1 B;  4XJK A;  2F2O A;  3CGA A;  1S36 A;  2BCB A;  3CR2 A;  4GGN A;  1TNW A;  4MZJ A;  1OMR A;  2KI6 C;  1Y6W A;  5AFP A;  1BT6 A;  3EVR A;  3KO0 A;  1XO5 A;  3PFV A;  1F70 A;  1J7O A;  1SL8 A;  3BUM B;  3O2P A;  2PVB A;  1RK9 A;  1NUB A;  2K7C A;  1CM4 A;  4JWQ A;  1LA0 A;  2M7N A;  1IWQ A;  1OQP A;  5DKR A;  2FCE A;  3BUX B;  4MN0 A;  3KHE A;  4OV2 A;  1KFU L;  5AEQ A;  1WDC C;  4AQJ A;  4XJK B;  1YR5 A;  2NCO A;  2JQ6 A;  3VGO A;  4C0K A;  2KBM A;  3NSI A;  3BXK A;  3SJS A;  4BY4 A;  1DGV A;  4DCK A;  2BBN A;  4QJ4 B;  2GV5 A;  2JXC A;  2HQW A;  1AJ5 A;  1RTP 1;  1XVJ A;  1QLS A;  3HX4 A;  5CSF A;  1GGW A;  4NDC A;  5HKZ A;  1SBJ A;  5GQQ C;  1B8C A;  1HQV A;  1TNQ A;  3SG7 A;  1AJ4 A;  1LXF C;  1C07 A;  4AQI A;  1UUS A;  3CLN A;  2HF5 A;  2H2K A;  2RGI A;  1DVI A;  1QS7 A;  3MSE B;  1V1G A;  1ZUZ A;  5PAL A;  1DF0 B;  2A4J A;  1EH2 A;  1B4C A;  3OX6 A;  2L2E A;  3DVK A;  1W7I B;  2SAS A;  2M49 B;  3EKH A;  4GUK A;  4HRH A;  1IRJ A;  3C1V A;  5CSI A;  1QVI Y;  2OPO A;  3BOW B;  3VRP A;  4IL1 A;  1YUR A;  3SG2 A;  1KK7 Y;  2CNP A;  4YGB B;  2HET A;  2WCF A;  4P2Y B;  4CPV A;  1YUT A;  2BE4 A;  2ZFD A;  2CT9 A;  1PSB A;  1F71 A;  4PAL A;  1UHI A;  2ZRS A;  1SCM B;  2CXJ A;  2M1K B;  2O60 A;  2NLN A;  1JC2 A;  3CS1 A;  3LL8 B;  2Y1N A;  3GK4 X;  3I5G B;  4XYN A;  1PK0 D;  4GNK B;  4C0J A;  1L2O B;  2DOQ A;  1AUI B;  3PM8 A;  1BG1 A;  1CDM A;  3LK0 A;  2Q4U A;  3A4U B;  3K21 A;  4NQG A;  1KCY A;  3FWC A;  2LNK A;  1G4Y R;  1CFP A;  1RFJ A;  2PSR A;  1AK8 A;  2F3Y A;  2H61 A;  4PCW A;  1ALV A;  2K2F A;  2R2I A;  4YGA A;  1KK8 B;  4E68 A;  3BOW A;  3JTD B;  1B1G A;  1A4P A;  1TCF A;  5D7F A;  4PE0 A;  1L7Z A;  1F8H A;  4WQ3 A;  2Q91 A;  1CNP A;  1BU3 A;  2WOR A;  3AKB A;  3IQQ A;  1SCV A;  4ZCU A;  1UHH A;  3SIB A;  2KFH A;  2TN4 A;  1SNL A;  2F2P A;  1YUS A;  1DJH A;  4I5N B;  4C0L A;  4OR9 B;  1M63 B;  3D0Y A;  2WOS A;  2JT3 A;  1A29 A;  3I5G C;  3VRQ A;  1FPW A;  1UUR A;  3BQ3 A;  3FWB A;  1XK4 C;  2M7L A;  4ORB B;  1H8B A;  1E8A A;  2QPT A;  1C7V A;  3TDZ A;  1CTR A;  1UHN A;  1DJW A;  2JNF A;  1LA3 A;  4OCI A;  1K93 D;  2KAV A;  1IKU A;  5HKW A;  2BCX A;  2F3Z A;  2F33 A;  1DJX A;  1SY9 A;  1UP5 A;  1JWD A;  2GGM A;  1DJI A;  1K94 A;  1SR6 C;  2OTG B;  2Y1M A;  2SCP A;  2LHI A;  1FI5 A;  1IJ5 A;  1JUO A;  1ZFS A;  2ZN9 A;  3O78 A;  3NXA A;  4DIR A;  2FOT A;  3PSR A;  2HQ8 A;  4FTG A;  2L5X B;  1PVB A;  2KI4 C;  2BL0 B;  2KQY A;  4ICB A;  5I8N A;  5BPJ A;  4HRG A;  3CZT X;  1MR8 A;  1KK8 C;  1A03 A;  2LP2 A;  3SG4 A;  1XFW O;  1ZAC A;  1XK4 A;  1SL9 A;  2JT0 A;  4GGF A;  4M2O A;  3TDU A;  3TDI A;  1OSA A;  2G9B A;  4I5J A;  4Q04 A;  1IQ3 A;  1SMG A;  3PN7 C;  1BMO A;  4P5O E;  2PMY A;  2LVJ A;  4R1E A;  4YI8 A;  5CPV A;  5DKN A;  4OVN F;  1NWD A;  1NX0 A;  2MBX A;  5G08 A;  5I2L A;  1XFU O;  2FJU B;  3DD4 A;  4F0Z B;  4M2P A;  4UPG A;  2JXL A;  2LM5 A;  3PAL A;  1EL4 A;  2LE9 B;  2JUL A;  2KYC A;  3TUY C;  4MZK A;  1BF5 A;  2LC5 A;  1N2D A;  2ZN8 A;  1RWY A;  2MRD A;  1S6C A;  3WHT B;  1DGU A;  3JVT C;  2KGR A;  2K7B A;  5ER5 A;  1KFX L;  1RRO A;  1JF0 A;  2VRG A;  1TCO B;  4N1F A;  2LLU A;  2LMT A;  3EK7 A;  2V53 A;  5HLV A;  3SG6 A;  1QX2 A;  3SG3 A;  2KFF A;  2O5G A;  1YUU A;  5D69 A;  1J7Q A;  1VRK A;  1LIN A;  1BLQ A;  1NYA A;  1S5G Z;  2BCA A;  3DVE A;  1UHK A;  5I2Q A;  1SW8 A;  1XFZ O;  3KPX A;  3LCP C;  2K61 A;  1Y1U A;  4JPZ B;  2LVI A;  3EVU A;  3I5F C;  5JOL A;  3WNX B;  2JNX A;  2M1U A;  1TNP A;  1K95 A;  4PHM A;  1BR1 B;  2ZNE A;  3NSL A;  1REC A;  4PE1 A;  4FQO A;  2K7O A;  2M29 A;  3CR5 X;  5JJG A;  3GK1 A;  4USL A;  1JFJ A;  2JT8 A;  1KK7 Z;  1PUL A;  1A75 A;  1WDC B;  3F45 A;  4ZCV A;  3FS7 A;  3RLZ A;  2LP3 A;  4YRU A;  1KWO C;  4CFQ A;  4N5X A;  4DRW A;  5CSN A;  1TN4 A;  1GGZ A;  1D1O A;  5IBW A;  2KI6 D;  2LLS A;  2NXQ A;  1TRF A;  4MEW A;  1NX3 A;  5I2O A;  3DVM A;  1NX2 A;  2LHL A;  5AAN A;  1B8R A;  4ORC B;  2JRF A;  4GPL B;  1AHR A;  4JQ0 D;  1S1E A;  4OKH A;  1MUX A;  1CMF A;  1TOP A;  2KDH A;  1WRK A;  2LUC A;  1PVA A;  1C7W A;  1QX7 A;  2JZI A;  3RM1 A;  1V1F A;  4M2Q A;  2M0R A;  3O4Y A;  1WLZ A;  4YBH B;  1A75 B;  2OS8 B;  3EK4 A;  3ICB A;  1PSR A;  1S26 D;  2WND A;  1J55 A;  3M0W A;  1CFD A;  1DJY A;  2COL B;  1GQM A;  1F4O A;  3CTN A;  3KEV A;  1IJ6 A;  1KQM B;  1M31 A;  4PE4 A;  5F6T A;  2AMI A;  2EC6 B;  4NDB A;  2MLF C;  1KFU S;  2EGD A;  2LV7 A;  3NSK A;  5CSJ A;  3H4S E;  1LVC D;  3ZWH A;  2I7A A;  3I5F B;  3SG5 A;  1FF1 A;  2MA2 A;  5HLO A;  1FW4 A;  1XYD A;  1H4B A;  1NSH A;  4MSP A;  1NPQ A;  1SPY A;  1OZO A;  4HSZ A;  4NDD A;  2KSP A;  3DF0 A;  1X02 A;  1YRT B;  3NSO A;  3WHU B;  3OP0 A;  1QTX A;  1QIW A;  2LAN A;  1NCZ A;  1NX1 A;  1YX7 A;  2ZKM X;  4ORA B;  2JWW A;  1Y0V H;  4TNC A;  1ZOT B;  4HRE E;  2LLT A;  1NIW A;  3O6B A;  3IF7 A;  4U8D A;  4I5L B;  1SR6 B;  3OX5 A;  5KSZ A;  1PAL A;  4QJ5 B;  1WRL A;  3IQO A;  3JVT B;  4CFR A;  1CM1 A;  3OB2 B;  5ER4 X;  2Y5I A;  1MQ1 A;  3EK8 A;  3QRX A;  1DTL A;  2ZND A;  1KSO A;  3DF0 B;  3TS5 C;  1IQ5 A;  2IS9 A;  2MHH A;  1U5I B;  2AAO A;  1SL7 A;  1N0Y A;  1S6J A;  2LCP A;  4GAO A;  3TUY B;  4GGF C;  1B47 A;  4YI9 A;  1BOD A;  2L0P A;  3BUO B;  2G2B A;  1ALW A;  2M97 A;  2CTN A;  1WLM A;  1OMV A;  1DT7 B;  1M45 A;  1J1D A;  3GK2 A;  3I5I C;  3D10 A;  2QAC A;  2Y4Q A;  1NCY A;  2WCB A;  2L50 A;  4YGE B;  2KYF A;  2KFG A;  3PN7 B;  3BYA A;  1QLK A;  1FI6 A;  2E30 A;  1DJG A;  1SRA A;  1Q80 A;  2PAL A;  4WRI A;  2M9G A;  3JTD C;  1WY9 A;  4PHN A;  2M8U A;  1J7R A;  1K2H A;  5DKQ A;  1TNX A;  3VRR A;  5TNC A;  1CLL A;  2KHN A;  1K9U A;  2BL0 C;  2KI4 B;  2L98 A;  3PLF B;  3WXA A;  4AOM A;  1U5I A;  1KSM A;  1K8U A;  3I5H B;  1LKJ A;  5FYX A;  1CLM A;  1QV1 A;  1S6I A;  2AUC A;  1BR4 B;  1B9A A;  2OTG C;  1QAT A;  1SK6 D;  1QV0 A;  1EG3 A;  1EXR A;  1M39 A;  3I5I B;  4I5K A;  1JBA A;  1L2O C;  1SKT A;  2NZ0 A;  2BKI B;  4MRX A;  1JSA A;  1JFK A;  1CFC A;  1XFV O;  1S3P A;  1ZMZ A;  1CFF A;  2KGB C;  4CID A;  3LK1 A;  4D1E A;  1QAS A;  1IG5 A;  2K0J A;  1UHJ A;  4PE7 A;  1SCM C;  4YGC B;  1KQV A;  2EHB A;  1XA5 A;  1Y1X A;  1BOC A;  2LVK A;  1N65 A;  2LMU A;  3E3R A;  1JF2 A;  1TIZ A;  2BE6 A;  1GJY A;  3BUW B;  2D8N A;  2M3W A;  1TTX A;  1J1E A;  1UWO A;  4MZL A;  5AXI A;  4A4B A;  1EG4 A;  1IH0 A;  1XFX O;  2L51 A;  1OZS A;  3OHM B;  3A8R A;  3FIA A;  2MJW B;  1XFY O;  1QVI Z;  1F4Q A;  3CWG A;  2BKH B;  5K89 A;  3I5H C;  3VRN A;  1Y1A A;  2I18 A;  1OOJ A;  1YRU B;  1DJZ A;  4DS7 A;  1DF0 A;  1YVL A;  4WQ2 A;  3D0Y B;  1YVH A;  3PAT A;  1YTZ C;  4GFT A;  4DUQ A;  2ZRT A;  3AAK A;  2WC8 A;  5KU1 A;  2NCP A;  3AKA A;  2CBL A;  1CDN A;  2KQ6 A;  1QIV A;  1AP4 A;  1F55 A;  2KOT A;  1W7J B;  1CMG A;  1NCX A;  2LAP A;  2K8M B;  1MXE A;  2CCM A;  3LLE A;  4PDZ A;  5HYD A;  2F8P A;  1YX8 A;  1G8I A;  1J7P A;  1MF8 B;  2I2R E;  4MRY A;  1OE9 B;  1CDP A;  1KQM C;  1MWN A;  2JOJ A;  1AVS A;  1ODB A;  1WRZ A;  2JU0 A;  4PHK A;  1B7T Y;  1CLB A;  2HPS A;  5B8I B;  2OS8 C;  2FCD A;  1KFX S;  3KF9 A;  2KAY A;  4GBA A;  5KTY A;  3EKJ A;  3TS5 B;  4YGD B;  1R2U A;  1QXP A;  1K9P A;  3VRO A;  2BEC A;  2LUX A;  1CDL A;  4N1G A;  1S5G Y;  1R6P A;  1B8L A;  2JTZ A;  2P6B B;  4A4C A;  1F54 A;  1BJF A;  2BBM A;  1K96 A;  1K90 D;  2L4I A;  2PRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...