4MBEA

Sac3:sus1:cdc31:nup1 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, transcription
molecule keywords Cell division control protein 31
total genus 51
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mbeA01
1G8IA 1FPWA 2JULA 5HKZA 2M7LA 1FI5A 1B47A 1WRLA 1M45A 2WC8A 4HRGA 4OR9B 4HREE 1C07A 4PHKA 1OSAA 1AJ5A 4USLA 1CFPA 1TTXA 1G33A 1PSRA 3JVTB 3VRRA 1QX2A 1CM1A 1OQPA 1ZMZA 1B7TZ 3OHMB 3D0YB 3SG2A 3AAJA 2K8MB 1R6PA 1J7QA 2JZIA 4GUKA 1KK8C 4OCIA 1DGUA 1H4BA 3HX4A 4ZCUA 2MBXA 4OVNF 3CTNA 2BL0B 4YRUA 4L9MA 1S5GZ 3A8RA 1CFCA 1FW4A 1SR6C 2KQYA 4YGBB 2K0JA 1YTZC 3LK0A 2PRUA 4YGEB 2MAZA 2K7DA 1M39A 1B9AA 2KDHA 4JWQA 2F2PA 2JOJA 3EK8A 5CSNA 4AQJA 2BE6A 1BODA 3O4YA 1YVHA 2BL0C 2O5GA 1NP8A 1BMOA 1DJGA 1KSOA 1K9PA 2ZKMX 1YURA 5JOLA 2I2RE 4GAOA 1CMGA 2BBNA 2EC6B 4PHNA 4MZLA 1M31A 1WLMA 1ALVA 2B1UA 2CXJA 2MA2A 1N65A 3SG6A 3QRXA 2WCEA 4GBAA 4ORCB 3AKAA 1DJHA 2MJWB 2KFGA 1QIVA 3EVVA 1MF8B 1Y0VH 5HYDA 2PVBA 1TNPA 2LVJA 3VGOA 2G9BA 1S1EA 1NCXA 2LNKA 2PSRA 1KSMA 1LKJA 1XFZO 2FCEA 1S6JA 4F0ZB 1GGZA 2LP2A 2V53A 4A4CA 1JFKA 1XFXO 1YUTA 5G08A 1QXPA 4MBEA 1U5IB 1NIWA 1JSAA 1SRAA 2KAVA 2ZN9A 4E68A 1SL7A 3FWBA 1U5IA 4ORAB 3I5FB 2QACA 2L0PA 3EKJA 1A29A 1RTP1 1UUSA 5HKWA 4C0KA 1SMGA 1TNQA 1WDCB 1Y1XA 1B4CA 2JC2A 3TDIA 4NQGA 1D1OA 2NCPA 1KFXS 1TCFA 2NZ0A 1A4PA 3CR4X 2TN4A 1MQ1A 5CSIA 4JQ0D 1B8CA 1NCYA 2ZNEA 2LMVA 2LVIA 3BUXB 1AJ4A 2K2AA 3TDUA 1EG4A 3JTDC 3OX5A 4I5LB 1CFFA 3SIBA 1SCMB 4CLNA 3H4SE 2WOSA 2R2IA 1UHIA 3KPXA 3D10A 3BUWB 3LCPC 1SNLA 2LLSA 2SCPA 3WHTB 2F2OA 1EH2A 1BR1B 1QV0A 5HLVA 1W7JB 1XFWO 4QJ5B 1OMVA 2ZN8A 3I5HC 3TUYB 1AHRA 5AANA 2KBMA 2KBIA 2M49B 1CLMA 5D7FA 1CDNA 3MSEB 1IH0A 5I2QA 1XA5A 2F3YA 1UHJA 2HETA 1L7ZA 3SJSA 1KFXL 2L51A 5BPJA 4OKHA 1QATA 1N2DA 1MHOA 1QTXA 1IKUA 2LP3A 1CM4A 1V1FA 4NDCA 5J3XA 4DRWA 2MHHA 4MRYA 1HQVA 3I5IC 3KEVA 3O78A 1CDMA 2LUXA 1J55A 1F4QA 5I2LA 1BT6A 4TNCA 1JFJA 1EJ3A 3F45A 1NSHA 4YGCB 3BUNB 1ZACA 3O2PA 1K94A 2OPOA 5KSZA 2BCAA 4YGAA 1WRZA 2L5XB 1Y1AA 2E6WA 3BOWB 1J1DA 1WY9A 2KHNA 4PE1A 1GQMA 3FS7A 4FTGA 4M2QA 1H8BA 1MR8A 2Q4UA 2HPSA 1PVAA 4PE0A 2M9GA 2WCFA 1JUOA 2JT8A 1TOPA 1RJVA 2I18A 3O6BA 1S6CA 4QJ3B 4DCKA 1F54A 2BCXA 1SL8A 3LL8B 1ODBA 2JNXA 3CLNA 4MEWA 3E3RA 5DKRA 3SG7A 1YX8A 2ZRSA 2WNDA 3NSKA 4YI8A 1TCOB 1BU3A 2LV7A 2M97A 1XK4C 2CT9A 2O60A 5B8IB 1UHKA 1S3PA 2WORA 1R2UA 4DIRA 4CIDA 2L4HA 4N5XA 4XJKA 2K7OA 4IL1A 1EXRA 3DVJA 1F4OA 2LANA 3JTDB 1ALWA 4PCWA 1YVLA 2LHLA 3C1VA 2H61A 3ICBA 1OMDA 2M3WA 3KHEA 5HKYA 1A03A 4MN0A 4MRXA 2EHBA 4PHMA 3CR2A 1G4YR 2M1KB 3M0WA 3K21A 5TNCA 3TZ1A 4U8DA 1SK6D 2JQ6A 2Y1NA 3I5IB 1J1EA 1IQ3A 1FF1A 4YBHB 2H61C 2AMIA 2PASA 2I94A 1BF5A 4MVFA 1A75A 4DS7A 1OZSA 2HQ8A 1LXFC 1PRWA 1PK0D 3DVMA 2F8PA 2Y4QA 2ZRTA 4PE4A 1XFUO 1XK4A 1XO5A 3DVKA 5KTYA 3RLZA 1OZOA 3EKHA 2VRGA 1JBAA 2JXCA 4XJKB 3TS5C 5DKQA 1DJXA 2A4JA 1UHHA 3CZTX 2GV5A 2CBLA 3NSIA 3OB1B 5CSJA 2KAXA 3GOFA 1QLSA 1AUIB 1PSBA 3EK7A 1B7TY 1TRFA 5HLOA 1DT7B 3EVRA 4HSZA 4I5JA 1CNPA 2DOQA 3PSRA 1J7PA 4QJ4B 1XYDA 2JXLA 3PATA 5ER4X 4OV2A 1X02A 3OB2B 2F3ZA 2GGZA 4DUQA 2SASA 3DVEA 2H2KA 2MLFC 3GK4X 1NUBA 1BG1A 1J7RA 1KQMC 1NYAA 1YR5A 2F33A 3NSLA 1CTRA 1OOJA 1NX0A 2PMYA 4GPLB 3ZWHA 1B1GA 2K2FA 1CLBA 1QX5B 1CB1A 1UWOA 5I8NA 1LA3A 2JRFA 4PE7A 2NLNA 2BECA 3KF9A 1BR4B 1SY9A 1MXLC 2M29A 4GFTA 1A2XA 1KWOB 5AEQA 1K2HA 3DD4A 5AFPA 1K90D 3VRPA 1IJ5A 1GJYA 2HF5A 2NCOA 3VRQA 2KFFA 2M0RA 2COLB 1RK9A 3LK1A 4ORBB 1F70A 1Y1UA 1YRTB 5F6TA 2CCMA 1CLLA 3GK1A 5IBWA 1DF0A 1SYMA 4GNKB 2I7AA 3FIAA 4GGNA 4ZCVA 1KQVA 4N1FA 1KK8B 3NXAA 2KI6C 1KQMB 1RROA 1IGVA 1M46A 3BYAA 4Q04A 1SBJA 2JT0A 3TDZA 1YUUA 1KFUL 2LMUA 3JVTC 1PALA 1QLKA 1BJFA 5CPVA 1JF2A 5FYXA 3BQ3A 2LM5A 1HT9A 4I5KA 2ISDA 1FI6A 1ZFSA 1MXEA 2KNEA 1K9KA 1MWNA 2JTTA 3AAKA 1QASA 4ICBA 1TNWA 3RM1A 1PVBA 3TS5B 2G2BA 3WXAA 2LCPA 2BCBA 4P2YB 1S5GY 4MZKA 3I5GC 1JF0A 1B8RA 3CWGA 2LVKA 4BY4A 1IJ6A 1V1GA 1RECA 2D8NA 3LLEA 2JTZA 2Y5IA 2K7CA 4C0LA 2PALA 1LINA 2JWWA 4BY5A 2KFHA 4GGFA 2RGIA 1F71A 1DJYA 2KGBC 2BBMA 1IG5A 1ZOTB 3IQQA 1KWOC 3PFVA 1C7WA 1NX2A 2ZFDA 2OTGB 4M2PA 1MUXA 4PHJA 3PN7C 2K7BA 4PDZA 1QVIZ 2QPTA 1KFUS 2IS9A 2KI6D 1L2OC 3EVUA 4A4BA 3ZNIA 3GK2A 1SKTA 2CNPA 1RWYA 4AQIA 5I2OA 2CTNA 4JPZB 3PALA 1K93D 2M8UA 3IF7A 3KO0A 1LA0A 4GGFC 1C7VA 4D1EA 2LLUA 1OE9B 3CR5X 4XYNA 2JT3A 5CSFA 1OMRA 4C0JA 5AERA 2AAOA 4MSPA 1SW8A 3SG4A 4YGDB 2HQWA 5D69A 1IWQA 1W7IB 1GGWA 1CDLA 1XFYO 1JWDA 2LLTA 5AXIA 1K9UA 1CMFA 2KAYA 2ZNDA 3BOWA 3DF0A 2OS8C 3HCMA 4WQ2A 3TUYC 2M7NA 1K95A 2Y1MA 1DJZA 2EGDA 4CFRA 3D0YA 4WRIA 2FCDA 3BUOB 4I5NB 2JU0A 2KI4C 2LVVA 1K8UA 1CKKA 1DVIA 1SPYA 5ER5A 1PULA 2FOTA 1CDPA 2LMTA 1SCMC 1XFVO 2BKIB 1NWDA 1FBVA 4NDDA 2MRDA 1K96A 3SG3A 2GGMA 1DF0B 1Q80A 1QJTA 2FJUB 3SG5A 2LUCA 1N0YA 2JPTA 1QS7A 2M1UA 1AVSA 1UHNA 1BOCA 1IRJA 1QIWA 4NDBA 1RFJA 4ETOA 1IQ5A 1QV1A 1ZUZA 2L4IA 1NX1A 3BUMB 2L2EA 2KYCA 4M2OA 3SIAA 1NCZA 1DJWA 2BKHB 1KCYA 3I5FC 5JJGA 1QVIY 2NXQA 4PALA 1DGVA 1YX7A 1AP4A 3WHUB 2LC5A 1A75B 4CPVA 2KOTA 4R1EA 2MLEC 1S36A 2LE9B 1F55A 3VRNA 2OS8B 3NSOA 1VRKA 1SL9A 3VROA 2LAPA 2LHIA 1WRKA 1LVCD 1BLQA 1QX7A 4WQ3A 2AUCA 1DMOA 3OX6A 3EK4A 4P5OE 2KQ6A 2KYFA 4FQOA 1KK7Y 5K89A 2WCBA 3OP0A 4UPGA 2L50A 4MZJA 4CFQA 4HRHA 3WNXB 1EG3A 1EL4A 1WLZA 1DJIA 1YRUB 5DKNA 4YI9A 2OTGC 2Q91A 2EC6C 4MLWA 3A4UB 3DF0B 1L2OB 1UP5A 2KGRA 1M63B 3PM8A 1CFDA 2JNFA 2KSPA 5KU1A 1WDCC 1TN4A 4N1GA 1JC2A 3PN7B 1DTLA 2KI4B 1S26D 4AOMA 3BXKA 3CS1A 1SCVA 1TNXA 2L98A 1TIZA 1B8LA 5GQQC 1UURA 1F8HA 1AK8A 1NPQA 3CGAA 1Y6WA 5PALA 3I5GB 3FWCA 1S6IA 1XVJA 2BE4A 3PLFB 1KK7Z 2P6BB 1SR6B 1YUSA 1E8AA 3AKBA 3I5HB 1NX3A 3IQOA 2E30A 1J7OA 2K61A
chains in the Genus database with same CATH superfamily
1G8IA 5FI7A 1FPWA 2JULA 5HKZA 2M7LA 1FI5A 1B47A 1WRLA 1M45A 2WC8A 4HRGA 3S0AA 3DXLA 4HREE 4OR9B 3SS5A 1C07A 4PHKA 1OSAA 1AJ5A 4USLA 1CFPA 1TTXA 1G33A 1PSRA 3JVTB 3VRRA 1QX2A 2P70A 1CM1A 1OQPA 1ZMZA 1B7TZ 3OHMB 3D0YB 3SG2A 3AAJA 2K8MB 1C3YA 1R6PA 3R1OA 1J7QA 2JZIA 2FJYA 4GUKA 1KK8C 4OCIA 1XFRA 1DC1A 1DGUA 1H4BA 3HX4A 4ZCUA 3IVTA 2MBXA 4OVNF 3CTNA 2BL0B 3NHTA 4YRUA 4L9MA 1S5GZ 1DQEA 3A8RA 1CFCA 1FW4A 1SR6C 2KQYA 4YGBB 2K0JA 1YTZC 3LK0A 2PRUA 4YGEB 1DEKA 2MAZA 2K7DA 1M39A 1B9AA 2KDHA 4JWQA 2F2PA 2JOJA 3EK8A 5CSNA 4AQJA 2BE6A 1BODA 3O4YA 1YVHA 2BL0C 2O5GA 3FE8A 1NP8A 1BMOA 1DJGA 1KSOA 1K9PA 2ZKMX 1YURA 5JOLA 3L4LA 2I2RE 4GAOA 1CMGA 2BBNA 2EC6B 4JD9A 4MZLA 4PHNA 1M31A 1WLMA 1Z2CB 1ALVA 2B1UA 2CXJA 2MA2A 1N65A 3SG6A 3QRXA 2WCEA 4GBAA 4ORCB 3AKAA 1DJHA 2MJWB 2KFGA 1QIVA 2KPHA 3EVVA 1MF8B 2K60A 1Y0VH 2QEOA 5HYDA 2PVBA 1TNPA 2LVJA 3VGOA 2G9BA 1S1EA 1NCXA 1OOHA 3S0EA 2LNKA 2PSRA 1KSMA 3VB1A 1LKJA 1XFZO 2FCEA 1S6JA 4F0ZB 1GGZA 2LP2A 2V53A 4A4CA 1JFKA 1XFXO 1YUTA 3NHIA 1QXPA 3BFAA 3Q8IA 1U5IB 4MBEA 5G08A 1NIWA 1JSAA 3O4XA 1SRAA 2KAVA 2ZN9A 4E68A 1SL7A 3FWBA 1U5IA 4ORAB 3I5FB 2QACA 2L0PA 3EKJA 1A29A 1RTP1 2L5YA 1UUSA 5HKWA 4C0KA 1SMGA 1TNQA 1WDCB 1Y1XA 1B4CA 2QEBA 2JC2A 3TDIA 4NQGA 1D1OA 2NCPA 1KFXS 1TCFA 3NGVA 2NZ0A 1A4PA 3CR4X 2TN4A 1MQ1A 5CSIA 4JQ0D 1B8CA 1NCYA 2ZNEA 2LMVA 2LVIA 3BUXB 1AJ4A 2K2AA 3L4AA 3B86A 3TDUA 1EG4A 3JTDC 3OX5A 4I5LB 1CFFA 3SIBA 1SCMB 4CLNA 3H4SE 2WOSA 2R2IA 3V2LA 1UHIA 3D75A 3KPXA 3RZSA 4PT1A 3D10A 3BUWB 3LCPC 1SNLA 2LLSA 1ORGA 2SCPA 3D74A 3WHTB 2F2OA 1EH2A 1BR1B 1QV0A 5HLVA 1W7JB 1XFWO 3DY9A 4QJ5B 1OMVA 2ZN8A 3I5HC 3TUYB 1AHRA 2PYQA 5AANA 2KBMA 2KBIA 2M49B 5I94A 1GM0A 1CLMA 3D78A 5D7FA 1CDNA 3MSEB 1IH0A 4F7FA 5I2QA 1XA5A 2F3YA 1UHJA 3DYEA 2HETA 1L7ZA 3SJSA 1KFXL 2L51A 5BPJA 4OKHA 1QATA 1N2DA 1MHOA 1QTXA 1IKUA 2LP3A 1CM4A 1V1FA 3R1VA 4NDCA 2WCHA 5J3XA 4DRWA 3B88A 2MHHA 4MRYA 1HQVA 3I5IC 3KEVA 3O78A 1CDMA 2LUXA 1J55A 1F4QA 2KLEA 3OBVA 5I2LA 1BT6A 4TNCA 1JFJA 1EJ3A 3F45A 1NSHA 4YGCB 3BUNB 2H8VA 1ZACA 3O2PA 1K94A 3BJHA 2OPOA 5KSZA 2BCAA 1B1GA 4YGAA 1WRZA 2L5XB 1Y1AA 2E6WA 1TWOA 3BOWB 1J1DA 1WY9A 3BFHA 2KHNA 4PE1A 1GQMA 3FS7A 4FTGA 4M2QA 1H8BA 4KYNA 1MR8A 2Q4UA 2HPSA 1PVAA 4PE0A 2M9GA 2WCFA 1JUOA 2JT8A 3B7AA 1TOPA 1RJVA 2I18A 3O6BA 1S6CA 3R1PA 4QJ3B 4DCKA 1F54A 2QEHA 2BCXA 1SL8A 3LL8B 1ODBA 5D3OA 2JNXA 3CLNA 4MEWA 3E3RA 5DKRA 3SG7A 1YX8A 2ZRSA 2WNDA 3NSKA 4YI8A 1TCOB 1BU3A 2LV7A 2M97A 1XK4C 2CT9A 2O60A 5B8IB 1UHKA 1S3PA 2WORA 1R2UA 4DIRA 4CIDA 2L4HA 4N5XA 4XJKA 2K7OA 4IL1A 1EXRA 3DVJA 1F4OA 2LANA 3JTDB 1ALWA 4PCWA 2JPOA 1YVLA 2LHLA 3C1VA 2H61A 3ICBA 1OMDA 2M3WA 3KHEA 5HKYA 1A03A 3FE9A 4MN0A 4MRXA 2EHBA 4PHMA 3CR2A 3UO9A 1G4YR 2M1KB 3M0WA 3K21A 5TNCA 3TZ1A 4U8DA 1SK6D 2JQ6A 2Y1NA 3I5IB 1J1EA 3CDNA 1IQ3A 1FF1A 4YBHB 2H61C 2AMIA 2PASA 2I94A 1BF5A 4MVFA 1A75A 4DS7A 1OZSA 2HQ8A 1LXFC 1PRWA 1PK0D 2ERBA 3DVMA 3B87A 2F8PA 2Y4QA 2ZRTA 5HL1A 3B6XA 4PE4A 4INXA 1XFUO 1XK4A 1XO5A 2WCJA 3DVKA 5KTYA 3RLZA 1OZOA 3EKHA 2VRGA 1JBAA 2JXCA 4XJKB 3TS5C 5DKQA 1DJXA 3CZ0A 2A4JA 1OOIX 1UHHA 2GV5A 3CZTX 2CBLA 3NSIA 3OB1B 1LS8A 5CSJA 3DZTA 2KAXA 3GOFA 1QLSA 1AUIB 1PSBA 3EK7A 1B7TY 1TRFA 5HLOA 1DT7B 3EVRA 4HSZA 4I5JA 1CNPA 2DOQA 3PSRA 3SS4A 4QJ4B 1J7PA 1XYDA 2JXLA 3PATA 3R72A 5ER4X 4OV2A 1X02A 3OB2B 2F3ZA 2GGZA 4DUQA 2SASA 3DVEA 2H2KA 2MLFC 3GK4X 3N7HA 1NUBA 1BG1A 1J7RA 1KQMC 1NYAA 1YR5A 1Z4HA 2F33A 1CTRA 1OOJA 1NX0A 2PMYA 3NSLA 4GPLB 3ZWHA 2K2FA 1CLBA 1QX5B 1CB1A 1UWOA 5I8NA 2WCKA 1LA3A 2JRFA 4PE7A 2NLNA 2BECA 3KF9A 1BR4B 1SY9A 1MXLC 2M29A 4GFTA 1TUJA 1A2XA 1KWOB 5AEQA 1K2HA 3DD4A 5AFPA 1K90D 3VRPA 1IJ5A 1GJYA 2HF5A 2NCOA 3VRQA 2KFFA 2M0RA 2COLB 1RK9A 3LK1A 4ORBB 1F70A 1Y1UA 1YRTB 5F6TA 2P71A 2CCMA 1CLLA 3GK1A 2WCMA 5IBWA 1DF0A 1SYMA 4GNKB 2I7AA 3FIAA 4GGNA 4ZCVA 2KLDA 1KQVA 4N1FA 1KK8B 3NXAA 2KI6C 1KQMB 1RROA 1IGVA 1M46A 3BYAA 4Q04A 1SBJA 2JT0A 3TDZA 4IJ7A 1YUUA 1KFUL 2LMUA 3JVTC 1PALA 1QLKA 1BJFA 5CPVA 1JF2A 5FYXA 3BQ3A 3S0GA 2LM5A 1HT9A 4JKTA 3SS3A 4I5KA 2ISDA 1FI6A 1ZFSA 1MXEA 2KNEA 1K9KA 1MWNA 3CYZA 1IIOA 2JTTA 3AAKA 5FI2A 1QASA 4ICBA 1TNWA 3RM1A 1PVBA 3TS5B 1C3ZA 2G2BA 3WXAA 2LCPA 2BCBA 4P2YB 1S5GY 4MZKA 3I5GC 3S0BA 1JF0A 1B8RA 3CWGA 4OZDA 1QWVA 2LVKA 4BY4A 1IJ6A 1V1GA 1RECA 2D8NA 3LLEA 2WC5A 2JTZA 2Y5IA 2K7CA 4C0LA 2PALA 1LINA 2JWWA 4BY5A 2KFHA 4GGFA 2RGIA 1F71A 3EG5B 1DJYA 4INWA 2KGBC 2BBMA 1IG5A 1ZOTB 3IQQA 1KWOC 3PFVA 1C7WA 3D77A 1NX2A 2ZFDA 2OTGB 4M2PA 1MUXA 4PHJA 3PN7C 3S0FA 2K7BA 4PDZA 1QVIZ 2QPTA 1KFUS 2IS9A 2KI6D 1L2OC 3EVUA 4A4BA 3ZNIA 3GK2A 1SKTA 2L2CA 2CNPA 1RWYA 1DELA 1T14A 4AQIA 5I2OA 2CTNA 2GTEA 4JPZB 3PALA 1K93D 2M8UA 1OOGA 3IF7A 3KO0A 1LA0A 4GGFC 1C7VA 4D1EA 2LLUA 1OE9B 3UNWA 3CR5X 4XYNA 2JT3A 5CSFA 1OMRA 4C0JA 5AERA 2AAOA 4MSPA 1SW8A 3QMEA 3SG4A 4YGDB 2HQWA 5D69A 1IWQA 1W7IB 1GGWA 1CDLA 1XFYO 5FI6A 1JWDA 2LLTA 5AXIA 1K9UA 1CMFA 2KAYA 2ZNDA 3BOWA 3DF0A 2OS8C 3HCMA 4WQ2A 3TUYC 2M7NA 1K95A 2Y1MA 3S0DA 1DJZA 2EGDA 3PJIA 4CFRA 3D0YA 4WRIA 2FCDA 3BUOB 4I5NB 2JU0A 3K1EA 2KI4C 2LVVA 1K8UA 1CKKA 1DVIA 1SPYA 5ER5A 2PQLA 1PULA 2FOTA 1CDPA 2LMTA 1SCMC 1W9ZA 1XFVO 2BKIB 1NWDA 1FBVA 4NDDA 2MRDA 2QDIA 3FE6A 3CZ1A 1K96A 3SG3A 2GGMA 1DF0B 1Q80A 1QJTA 2FJUB 3SG5A 2LUCA 1N0YA 2JPTA 1QS7A 2M1UA 3D73A 2WCLA 3CZ2A 1AVSA 1UHNA 1BOCA 1IRJA 4FQTA 1QIWA 4NDBA 1RFJA 4ETOA 1IQ5A 1QV1A 1ZUZA 2L4IA 1NX1A 2YGUA 3BUMB 5EL2A 2L2EA 2KYCA 4M2OA 3SIAA 1NCZA 1DJWA 2WC6A 2BKHB 1KCYA 3I5FC 5JJGA 1QVIY 2NXQA 4PALA 1DGVA 1YX7A 1AP4A 3WHUB 2LC5A 1A75B 3BFBA 4CPVA 2BAPA 2KOTA 4R1EA 2MLEC 1S36A 2LE9B 1F55A 1P28A 1TUZA 3VRNA 2OS8B 3NSOA 1VRKA 1SL9A 3VROA 1OW4A 2LAPA 1SSEB 2LHIA 1WRKA 1LVCD 1BLQA 1QX7A 4WQ3A 2AUCA 1DMOA 3OX6A 3EK4A 3PM2A 4P5OE 2KQ6A 2KYFA 4FQOA 1KK7Y 5K89A 2WCBA 3OP0A 1OOFA 4UPGA 2L50A 4MZJA 4CFQA 4HRHA 3WNXB 1EG3A 2BNXA 1EL4A 1WLZA 1DJIA 1YRUB 5DKNA 4YI9A 3D76A 2OTGC 2Q91A 2EC6C 4MLWA 3A4UB 3DF0B 1L2OB 1UP5A 2KGRA 1M63B 3PM8A 1CFDA 2JNFA 2KSPA 5KU1A 1WDCC 1TN4A 4N1GA 1JC2A 3PN7B 1DTLA 2KI4B 1S26D 4AOMA 3BXKA 3CS1A 1SCVA 1TNXA 2L98A 3CABA 1TIZA 1B8LA 5GQQC 1UURA 1F8HA 1AK8A 2QEVA 1NPQA 3CGAA 5DICA 1Y6WA 5PALA 3I5GB 3FWCA 1S6IA 1XVJA 2BE4A 3PLFB 1KK7Z 2P6BB 1SR6B 1YUSA 1E8AA 3AKBA 3I5HB 1NX3A 3IQOA 3L47A 2E30A 3OGNA 1J7OA 2K61A
chains in the Genus database with same CATH topology
1G8IA 1FPWA 2JULA 5HKZA 2M7LA 1FI5A 1B47A 1WRLA 1M45A 2WC8A 4HRGA 4OR9B 4HREE 1C07A 4PHKA 1OSAA 1AJ5A 4USLA 1CFPA 1TTXA 1G33A 1PSRA 3JVTB 3VRRA 1QX2A 1CM1A 1OQPA 1ZMZA 1B7TZ 3OHMB 3D0YB 3SG2A 3AAJA 2K8MB 1R6PA 1J7QA 2JZIA 4GUKA 1KK8C 4OCIA 1DGUA 1H4BA 3HX4A 4ZCUA 2MBXA 4OVNF 3CTNA 2BL0B 4YRUA 4L9MA 1S5GZ 3A8RA 1CFCA 1FW4A 1SR6C 2KQYA 4YGBB 2K0JA 1YTZC 3LK0A 2PRUA 4YGEB 2MAZA 2K7DA 1M39A 1B9AA 2KDHA 4JWQA 2F2PA 2JOJA 3EK8A 5CSNA 4AQJA 2BE6A 1BODA 3O4YA 1YVHA 2BL0C 2O5GA 1NP8A 1BMOA 1DJGA 1KSOA 1K9PA 2ZKMX 1YURA 5JOLA 2I2RE 4GAOA 1CMGA 2BBNA 2EC6B 4PHNA 4MZLA 1M31A 1WLMA 1ALVA 2B1UA 2CXJA 2MA2A 1N65A 3SG6A 3QRXA 2WCEA 4GBAA 4ORCB 3AKAA 1DJHA 2MJWB 2KFGA 1QIVA 3EVVA 1MF8B 1Y0VH 5HYDA 2PVBA 1TNPA 2LVJA 3VGOA 2G9BA 1S1EA 1NCXA 2LNKA 2PSRA 1KSMA 1LKJA 1XFZO 2FCEA 1S6JA 4F0ZB 1GGZA 2LP2A 2V53A 4A4CA 1JFKA 1XFXO 1YUTA 5G08A 1QXPA 4MBEA 1U5IB 1NIWA 1JSAA 1SRAA 2KAVA 2ZN9A 4E68A 1SL7A 3FWBA 1U5IA 4ORAB 3I5FB 2QACA 2L0PA 3EKJA 1A29A 1RTP1 1UUSA 5HKWA 4C0KA 1SMGA 1TNQA 1WDCB 1Y1XA 1B4CA 2JC2A 3TDIA 4NQGA 1D1OA 2NCPA 1KFXS 1TCFA 2NZ0A 1A4PA 3CR4X 2TN4A 1MQ1A 5CSIA 4JQ0D 1B8CA 1NCYA 2ZNEA 2LMVA 2LVIA 3BUXB 1AJ4A 2K2AA 3TDUA 1EG4A 3JTDC 3OX5A 4I5LB 1CFFA 3SIBA 1SCMB 4CLNA 3H4SE 2WOSA 2R2IA 1UHIA 3KPXA 3D10A 3BUWB 3LCPC 1SNLA 2LLSA 2SCPA 3WHTB 2F2OA 1EH2A 1BR1B 1QV0A 5HLVA 1W7JB 1XFWO 4QJ5B 1OMVA 2ZN8A 3I5HC 3TUYB 1AHRA 5AANA 2KBMA 2KBIA 2M49B 1CLMA 5D7FA 1CDNA 3MSEB 1IH0A 5I2QA 1XA5A 2F3YA 1UHJA 2HETA 1L7ZA 3SJSA 1KFXL 2L51A 5BPJA 4OKHA 1QATA 1N2DA 1MHOA 1QTXA 1IKUA 2LP3A 1CM4A 1V1FA 4NDCA 5J3XA 4DRWA 2MHHA 4MRYA 1HQVA 3I5IC 3KEVA 3O78A 1CDMA 2LUXA 1J55A 1F4QA 5I2LA 1BT6A 4TNCA 1JFJA 1EJ3A 3F45A 1NSHA 4YGCB 3BUNB 1ZACA 3O2PA 1K94A 2OPOA 5KSZA 2BCAA 4YGAA 1WRZA 2L5XB 1Y1AA 2E6WA 3BOWB 1J1DA 1WY9A 2KHNA 4PE1A 1GQMA 3FS7A 4FTGA 4M2QA 1H8BA 1MR8A 2Q4UA 2HPSA 1PVAA 4PE0A 2M9GA 2WCFA 1JUOA 2JT8A 1TOPA 1RJVA 2I18A 3O6BA 1S6CA 4QJ3B 4DCKA 1F54A 2BCXA 1SL8A 3LL8B 1ODBA 2JNXA 3CLNA 4MEWA 3E3RA 5DKRA 3SG7A 1YX8A 2ZRSA 2WNDA 3NSKA 4YI8A 1TCOB 1BU3A 2LV7A 2M97A 1XK4C 2CT9A 2O60A 5B8IB 1UHKA 1S3PA 2WORA 1R2UA 4DIRA 4CIDA 2L4HA 4N5XA 4XJKA 2K7OA 4IL1A 1EXRA 3DVJA 1F4OA 2LANA 3JTDB 1ALWA 4PCWA 1YVLA 2LHLA 3C1VA 2H61A 3ICBA 1OMDA 2M3WA 3KHEA 5HKYA 1A03A 4MN0A 4MRXA 2EHBA 4PHMA 3CR2A 1G4YR 2M1KB 3M0WA 3K21A 5TNCA 3TZ1A 4U8DA 1SK6D 2JQ6A 2Y1NA 3I5IB 1J1EA 1IQ3A 1FF1A 4YBHB 2H61C 2AMIA 2PASA 2I94A 1BF5A 4MVFA 1A75A 4DS7A 1OZSA 2HQ8A 1LXFC 1PRWA 1PK0D 3DVMA 2F8PA 2Y4QA 2ZRTA 4PE4A 1XFUO 1XK4A 1XO5A 3DVKA 5KTYA 3RLZA 1OZOA 3EKHA 2VRGA 1JBAA 2JXCA 4XJKB 3TS5C 5DKQA 1DJXA 2A4JA 1UHHA 3CZTX 2GV5A 2CBLA 3NSIA 3OB1B 5CSJA 2KAXA 3GOFA 1QLSA 1AUIB 1PSBA 3EK7A 1B7TY 1TRFA 5HLOA 1DT7B 3EVRA 4HSZA 4I5JA 1CNPA 2DOQA 3PSRA 1J7PA 4QJ4B 1XYDA 2JXLA 3PATA 5ER4X 4OV2A 1X02A 3OB2B 2F3ZA 2GGZA 4DUQA 2SASA 3DVEA 2H2KA 2MLFC 3GK4X 1NUBA 1BG1A 1J7RA 1KQMC 1NYAA 1YR5A 2F33A 3NSLA 1CTRA 1OOJA 1NX0A 2PMYA 4GPLB 3ZWHA 1B1GA 2K2FA 1CLBA 1QX5B 1CB1A 1UWOA 5I8NA 1LA3A 2JRFA 4PE7A 2NLNA 2BECA 3KF9A 1BR4B 1SY9A 1MXLC 2M29A 4GFTA 1A2XA 1KWOB 5AEQA 1K2HA 3DD4A 5AFPA 1K90D 3VRPA 1IJ5A 1GJYA 2HF5A 2NCOA 3VRQA 2KFFA 2M0RA 2COLB 1RK9A 3LK1A 4ORBB 1F70A 1Y1UA 1YRTB 5F6TA 2CCMA 1CLLA 3GK1A 5IBWA 1DF0A 1SYMA 4GNKB 2I7AA 3FIAA 4GGNA 4ZCVA 1KQVA 4N1FA 1KK8B 3NXAA 2KI6C 1KQMB 1RROA 1IGVA 1M46A 3BYAA 4Q04A 1SBJA 2JT0A 3TDZA 1YUUA 1KFUL 2LMUA 3JVTC 1PALA 1QLKA 1BJFA 5CPVA 1JF2A 5FYXA 3BQ3A 2LM5A 1HT9A 4I5KA 2ISDA 1FI6A 1ZFSA 1MXEA 2KNEA 1K9KA 1MWNA 2JTTA 3AAKA 1QASA 4ICBA 1TNWA 3RM1A 1PVBA 3TS5B 2G2BA 3WXAA 2LCPA 2BCBA 4P2YB 1S5GY 4MZKA 3I5GC 1JF0A 1B8RA 3CWGA 2LVKA 4BY4A 1IJ6A 1V1GA 1RECA 2D8NA 3LLEA 2JTZA 2Y5IA 2K7CA 4C0LA 2PALA 1LINA 2JWWA 4BY5A 2KFHA 4GGFA 2RGIA 1F71A 1DJYA 2KGBC 2BBMA 1IG5A 1ZOTB 3IQQA 1KWOC 3PFVA 1C7WA 1NX2A 2ZFDA 2OTGB 4M2PA 1MUXA 4PHJA 3PN7C 2K7BA 4PDZA 1QVIZ 2QPTA 1KFUS 2IS9A 2KI6D 1L2OC 3EVUA 4A4BA 3ZNIA 3GK2A 1SKTA 2CNPA 1RWYA 4AQIA 5I2OA 2CTNA 4JPZB 3PALA 1K93D 2M8UA 3IF7A 3KO0A 1LA0A 4GGFC 1C7VA 4D1EA 2LLUA 1OE9B 3CR5X 4XYNA 2JT3A 5CSFA 1OMRA 4C0JA 5AERA 2AAOA 4MSPA 1SW8A 3SG4A 4YGDB 2HQWA 5D69A 1IWQA 1W7IB 1GGWA 1CDLA 1XFYO 1JWDA 2LLTA 5AXIA 1K9UA 1CMFA 2KAYA 2ZNDA 3BOWA 3DF0A 2OS8C 3HCMA 4WQ2A 3TUYC 2M7NA 1K95A 2Y1MA 1DJZA 2EGDA 4CFRA 3D0YA 4WRIA 2FCDA 3BUOB 4I5NB 2JU0A 2KI4C 2LVVA 1K8UA 1CKKA 1DVIA 1SPYA 5ER5A 1PULA 2FOTA 1CDPA 2LMTA 1SCMC 1XFVO 2BKIB 1NWDA 1FBVA 4NDDA 2MRDA 1K96A 3SG3A 2GGMA 1DF0B 1Q80A 1QJTA 2FJUB 3SG5A 2LUCA 1N0YA 2JPTA 1QS7A 2M1UA 1AVSA 1UHNA 1BOCA 1IRJA 1QIWA 4NDBA 1RFJA 4ETOA 1IQ5A 1QV1A 1ZUZA 2L4IA 1NX1A 3BUMB 2L2EA 2KYCA 4M2OA 3SIAA 1NCZA 1DJWA 2BKHB 1KCYA 3I5FC 5JJGA 1QVIY 2NXQA 4PALA 1DGVA 1YX7A 1AP4A 3WHUB 2LC5A 1A75B 4CPVA 2KOTA 4R1EA 2MLEC 1S36A 2LE9B 1F55A 3VRNA 2OS8B 3NSOA 1VRKA 1SL9A 3VROA 2LAPA 2LHIA 1WRKA 1LVCD 1BLQA 1QX7A 4WQ3A 2AUCA 1DMOA 3OX6A 3EK4A 4P5OE 2KQ6A 2KYFA 4FQOA 1KK7Y 5K89A 2WCBA 3OP0A 4UPGA 2L50A 4MZJA 4CFQA 4HRHA 3WNXB 1EG3A 1EL4A 1WLZA 1DJIA 1YRUB 5DKNA 4YI9A 2OTGC 2Q91A 2EC6C 4MLWA 3A4UB 3DF0B 1L2OB 1UP5A 2KGRA 1M63B 3PM8A 1CFDA 2JNFA 2KSPA 5KU1A 1WDCC 1TN4A 4N1GA 1JC2A 3PN7B 1DTLA 2KI4B 1S26D 4AOMA 3BXKA 3CS1A 1SCVA 1TNXA 2L98A 1TIZA 1B8LA 5GQQC 1UURA 1F8HA 1AK8A 1NPQA 3CGAA 1Y6WA 5PALA 3I5GB 3FWCA 1S6IA 1XVJA 2BE4A 3PLFB 1KK7Z 2P6BB 1SR6B 1YUSA 1E8AA 3AKBA 3I5HB 1NX3A 3IQOA 2E30A 1J7OA 2K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8I A;  1FPW A;  2JUL A;  5HKZ A;  2M7L A;  1FI5 A;  1B47 A;  1WRL A;  1M45 A;  2WC8 A;  4HRG A;  4OR9 B;  4HRE E;  1C07 A;  4PHK A;  1OSA A;  1AJ5 A;  4USL A;  1CFP A;  1TTX A;  1G33 A;  1PSR A;  3JVT B;  3VRR A;  1QX2 A;  1CM1 A;  1OQP A;  1ZMZ A;  1B7T Z;  3OHM B;  3D0Y B;  3SG2 A;  3AAJ A;  2K8M B;  1R6P A;  1J7Q A;  2JZI A;  4GUK A;  1KK8 C;  4OCI A;  1DGU A;  1H4B A;  3HX4 A;  4ZCU A;  2MBX A;  4OVN F;  3CTN A;  2BL0 B;  4YRU A;  4L9M A;  1S5G Z;  3A8R A;  1CFC A;  1FW4 A;  1SR6 C;  2KQY A;  4YGB B;  2K0J A;  1YTZ C;  3LK0 A;  2PRU A;  4YGE B;  2MAZ A;  2K7D A;  1M39 A;  1B9A A;  2KDH A;  4JWQ A;  2F2P A;  2JOJ A;  3EK8 A;  5CSN A;  4AQJ A;  2BE6 A;  1BOD A;  3O4Y A;  1YVH A;  2BL0 C;  2O5G A;  1NP8 A;  1BMO A;  1DJG A;  1KSO A;  1K9P A;  2ZKM X;  1YUR A;  5JOL A;  2I2R E;  4GAO A;  1CMG A;  2BBN A;  2EC6 B;  4PHN A;  4MZL A;  1M31 A;  1WLM A;  1ALV A;  2B1U A;  2CXJ A;  2MA2 A;  1N65 A;  3SG6 A;  3QRX A;  2WCE A;  4GBA A;  4ORC B;  3AKA A;  1DJH A;  2MJW B;  2KFG A;  1QIV A;  3EVV A;  1MF8 B;  1Y0V H;  5HYD A;  2PVB A;  1TNP A;  2LVJ A;  3VGO A;  2G9B A;  1S1E A;  1NCX A;  2LNK A;  2PSR A;  1KSM A;  1LKJ A;  1XFZ O;  2FCE A;  1S6J A;  4F0Z B;  1GGZ A;  2LP2 A;  2V53 A;  4A4C A;  1JFK A;  1XFX O;  1YUT A;  5G08 A;  1QXP A;  4MBE A;  1U5I B;  1NIW A;  1JSA A;  1SRA A;  2KAV A;  2ZN9 A;  4E68 A;  1SL7 A;  3FWB A;  1U5I A;  4ORA B;  3I5F B;  2QAC A;  2L0P A;  3EKJ A;  1A29 A;  1RTP 1;  1UUS A;  5HKW A;  4C0K A;  1SMG A;  1TNQ A;  1WDC B;  1Y1X A;  1B4C A;  2JC2 A;  3TDI A;  4NQG A;  1D1O A;  2NCP A;  1KFX S;  1TCF A;  2NZ0 A;  1A4P A;  3CR4 X;  2TN4 A;  1MQ1 A;  5CSI A;  4JQ0 D;  1B8C A;  1NCY A;  2ZNE A;  2LMV A;  2LVI A;  3BUX B;  1AJ4 A;  2K2A A;  3TDU A;  1EG4 A;  3JTD C;  3OX5 A;  4I5L B;  1CFF A;  3SIB A;  1SCM B;  4CLN A;  3H4S E;  2WOS A;  2R2I A;  1UHI A;  3KPX A;  3D10 A;  3BUW B;  3LCP C;  1SNL A;  2LLS A;  2SCP A;  3WHT B;  2F2O A;  1EH2 A;  1BR1 B;  1QV0 A;  5HLV A;  1W7J B;  1XFW O;  4QJ5 B;  1OMV A;  2ZN8 A;  3I5H C;  3TUY B;  1AHR A;  5AAN A;  2KBM A;  2KBI A;  2M49 B;  1CLM A;  5D7F A;  1CDN A;  3MSE B;  1IH0 A;  5I2Q A;  1XA5 A;  2F3Y A;  1UHJ A;  2HET A;  1L7Z A;  3SJS A;  1KFX L;  2L51 A;  5BPJ A;  4OKH A;  1QAT A;  1N2D A;  1MHO A;  1QTX A;  1IKU A;  2LP3 A;  1CM4 A;  1V1F A;  4NDC A;  5J3X A;  4DRW A;  2MHH A;  4MRY A;  1HQV A;  3I5I C;  3KEV A;  3O78 A;  1CDM A;  2LUX A;  1J55 A;  1F4Q A;  5I2L A;  1BT6 A;  4TNC A;  1JFJ A;  1EJ3 A;  3F45 A;  1NSH A;  4YGC B;  3BUN B;  1ZAC A;  3O2P A;  1K94 A;  2OPO A;  5KSZ A;  2BCA A;  4YGA A;  1WRZ A;  2L5X B;  1Y1A A;  2E6W A;  3BOW B;  1J1D A;  1WY9 A;  2KHN A;  4PE1 A;  1GQM A;  3FS7 A;  4FTG A;  4M2Q A;  1H8B A;  1MR8 A;  2Q4U A;  2HPS A;  1PVA A;  4PE0 A;  2M9G A;  2WCF A;  1JUO A;  2JT8 A;  1TOP A;  1RJV A;  2I18 A;  3O6B A;  1S6C A;  4QJ3 B;  4DCK A;  1F54 A;  2BCX A;  1SL8 A;  3LL8 B;  1ODB A;  2JNX A;  3CLN A;  4MEW A;  3E3R A;  5DKR A;  3SG7 A;  1YX8 A;  2ZRS A;  2WND A;  3NSK A;  4YI8 A;  1TCO B;  1BU3 A;  2LV7 A;  2M97 A;  1XK4 C;  2CT9 A;  2O60 A;  5B8I B;  1UHK A;  1S3P A;  2WOR A;  1R2U A;  4DIR A;  4CID A;  2L4H A;  4N5X A;  4XJK A;  2K7O A;  4IL1 A;  1EXR A;  3DVJ A;  1F4O A;  2LAN A;  3JTD B;  1ALW A;  4PCW A;  1YVL A;  2LHL A;  3C1V A;  2H61 A;  3ICB A;  1OMD A;  2M3W A;  3KHE A;  5HKY A;  1A03 A;  4MN0 A;  4MRX A;  2EHB A;  4PHM A;  3CR2 A;  1G4Y R;  2M1K B;  3M0W A;  3K21 A;  5TNC A;  3TZ1 A;  4U8D A;  1SK6 D;  2JQ6 A;  2Y1N A;  3I5I B;  1J1E A;  1IQ3 A;  1FF1 A;  4YBH B;  2H61 C;  2AMI A;  2PAS A;  2I94 A;  1BF5 A;  4MVF A;  1A75 A;  4DS7 A;  1OZS A;  2HQ8 A;  1LXF C;  1PRW A;  1PK0 D;  3DVM A;  2F8P A;  2Y4Q A;  2ZRT A;  4PE4 A;  1XFU O;  1XK4 A;  1XO5 A;  3DVK A;  5KTY A;  3RLZ A;  1OZO A;  3EKH A;  2VRG A;  1JBA A;  2JXC A;  4XJK B;  3TS5 C;  5DKQ A;  1DJX A;  2A4J A;  1UHH A;  3CZT X;  2GV5 A;  2CBL A;  3NSI A;  3OB1 B;  5CSJ A;  2KAX A;  3GOF A;  1QLS A;  1AUI B;  1PSB A;  3EK7 A;  1B7T Y;  1TRF A;  5HLO A;  1DT7 B;  3EVR A;  4HSZ A;  4I5J A;  1CNP A;  2DOQ A;  3PSR A;  1J7P A;  4QJ4 B;  1XYD A;  2JXL A;  3PAT A;  5ER4 X;  4OV2 A;  1X02 A;  3OB2 B;  2F3Z A;  2GGZ A;  4DUQ A;  2SAS A;  3DVE A;  2H2K A;  2MLF C;  3GK4 X;  1NUB A;  1BG1 A;  1J7R A;  1KQM C;  1NYA A;  1YR5 A;  2F33 A;  3NSL A;  1CTR A;  1OOJ A;  1NX0 A;  2PMY A;  4GPL B;  3ZWH A;  1B1G A;  2K2F A;  1CLB A;  1QX5 B;  1CB1 A;  1UWO A;  5I8N A;  1LA3 A;  2JRF A;  4PE7 A;  2NLN A;  2BEC A;  3KF9 A;  1BR4 B;  1SY9 A;  1MXL C;  2M29 A;  4GFT A;  1A2X A;  1KWO B;  5AEQ A;  1K2H A;  3DD4 A;  5AFP A;  1K90 D;  3VRP A;  1IJ5 A;  1GJY A;  2HF5 A;  2NCO A;  3VRQ A;  2KFF A;  2M0R A;  2COL B;  1RK9 A;  3LK1 A;  4ORB B;  1F70 A;  1Y1U A;  1YRT B;  5F6T A;  2CCM A;  1CLL A;  3GK1 A;  5IBW A;  1DF0 A;  1SYM A;  4GNK B;  2I7A A;  3FIA A;  4GGN A;  4ZCV A;  1KQV A;  4N1F A;  1KK8 B;  3NXA A;  2KI6 C;  1KQM B;  1RRO A;  1IGV A;  1M46 A;  3BYA A;  4Q04 A;  1SBJ A;  2JT0 A;  3TDZ A;  1YUU A;  1KFU L;  2LMU A;  3JVT C;  1PAL A;  1QLK A;  1BJF A;  5CPV A;  1JF2 A;  5FYX A;  3BQ3 A;  2LM5 A;  1HT9 A;  4I5K A;  2ISD A;  1FI6 A;  1ZFS A;  1MXE A;  2KNE A;  1K9K A;  1MWN A;  2JTT A;  3AAK A;  1QAS A;  4ICB A;  1TNW A;  3RM1 A;  1PVB A;  3TS5 B;  2G2B A;  3WXA A;  2LCP A;  2BCB A;  4P2Y B;  1S5G Y;  4MZK A;  3I5G C;  1JF0 A;  1B8R A;  3CWG A;  2LVK A;  4BY4 A;  1IJ6 A;  1V1G A;  1REC A;  2D8N A;  3LLE A;  2JTZ A;  2Y5I A;  2K7C A;  4C0L A;  2PAL A;  1LIN A;  2JWW A;  4BY5 A;  2KFH A;  4GGF A;  2RGI A;  1F71 A;  1DJY A;  2KGB C;  2BBM A;  1IG5 A;  1ZOT B;  3IQQ A;  1KWO C;  3PFV A;  1C7W A;  1NX2 A;  2ZFD A;  2OTG B;  4M2P A;  1MUX A;  4PHJ A;  3PN7 C;  2K7B A;  4PDZ A;  1QVI Z;  2QPT A;  1KFU S;  2IS9 A;  2KI6 D;  1L2O C;  3EVU A;  4A4B A;  3ZNI A;  3GK2 A;  1SKT A;  2CNP A;  1RWY A;  4AQI A;  5I2O A;  2CTN A;  4JPZ B;  3PAL A;  1K93 D;  2M8U A;  3IF7 A;  3KO0 A;  1LA0 A;  4GGF C;  1C7V A;  4D1E A;  2LLU A;  1OE9 B;  3CR5 X;  4XYN A;  2JT3 A;  5CSF A;  1OMR A;  4C0J A;  5AER A;  2AAO A;  4MSP A;  1SW8 A;  3SG4 A;  4YGD B;  2HQW A;  5D69 A;  1IWQ A;  1W7I B;  1GGW A;  1CDL A;  1XFY O;  1JWD A;  2LLT A;  5AXI A;  1K9U A;  1CMF A;  2KAY A;  2ZND A;  3BOW A;  3DF0 A;  2OS8 C;  3HCM A;  4WQ2 A;  3TUY C;  2M7N A;  1K95 A;  2Y1M A;  1DJZ A;  2EGD A;  4CFR A;  3D0Y A;  4WRI A;  2FCD A;  3BUO B;  4I5N B;  2JU0 A;  2KI4 C;  2LVV A;  1K8U A;  1CKK A;  1DVI A;  1SPY A;  5ER5 A;  1PUL A;  2FOT A;  1CDP A;  2LMT A;  1SCM C;  1XFV O;  2BKI B;  1NWD A;  1FBV A;  4NDD A;  2MRD A;  1K96 A;  3SG3 A;  2GGM A;  1DF0 B;  1Q80 A;  1QJT A;  2FJU B;  3SG5 A;  2LUC A;  1N0Y A;  2JPT A;  1QS7 A;  2M1U A;  1AVS A;  1UHN A;  1BOC A;  1IRJ A;  1QIW A;  4NDB A;  1RFJ A;  4ETO A;  1IQ5 A;  1QV1 A;  1ZUZ A;  2L4I A;  1NX1 A;  3BUM B;  2L2E A;  2KYC A;  4M2O A;  3SIA A;  1NCZ A;  1DJW A;  2BKH B;  1KCY A;  3I5F C;  5JJG A;  1QVI Y;  2NXQ A;  4PAL A;  1DGV A;  1YX7 A;  1AP4 A;  3WHU B;  2LC5 A;  1A75 B;  4CPV A;  2KOT A;  4R1E A;  2MLE C;  1S36 A;  2LE9 B;  1F55 A;  3VRN A;  2OS8 B;  3NSO A;  1VRK A;  1SL9 A;  3VRO A;  2LAP A;  2LHI A;  1WRK A;  1LVC D;  1BLQ A;  1QX7 A;  4WQ3 A;  2AUC A;  1DMO A;  3OX6 A;  3EK4 A;  4P5O E;  2KQ6 A;  2KYF A;  4FQO A;  1KK7 Y;  5K89 A;  2WCB A;  3OP0 A;  4UPG A;  2L50 A;  4MZJ A;  4CFQ A;  4HRH A;  3WNX B;  1EG3 A;  1EL4 A;  1WLZ A;  1DJI A;  1YRU B;  5DKN A;  4YI9 A;  2OTG C;  2Q91 A;  2EC6 C;  4MLW A;  3A4U B;  3DF0 B;  1L2O B;  1UP5 A;  2KGR A;  1M63 B;  3PM8 A;  1CFD A;  2JNF A;  2KSP A;  5KU1 A;  1WDC C;  1TN4 A;  4N1G A;  1JC2 A;  3PN7 B;  1DTL A;  2KI4 B;  1S26 D;  4AOM A;  3BXK A;  3CS1 A;  1SCV A;  1TNX A;  2L98 A;  1TIZ A;  1B8L A;  5GQQ C;  1UUR A;  1F8H A;  1AK8 A;  1NPQ A;  3CGA A;  1Y6W A;  5PAL A;  3I5G B;  3FWC A;  1S6I A;  1XVJ A;  2BE4 A;  3PLF B;  1KK7 Z;  2P6B B;  1SR6 B;  1YUS A;  1E8A A;  3AKB A;  3I5H B;  1NX3 A;  3IQO A;  2E30 A;  1J7O A;  2K61 A; 
#chains in the Genus database with same CATH topology
 1G8I A;  5FI7 A;  1FPW A;  2JUL A;  5HKZ A;  2M7L A;  1FI5 A;  1B47 A;  1WRL A;  1M45 A;  2WC8 A;  4HRG A;  3S0A A;  3DXL A;  4HRE E;  4OR9 B;  3SS5 A;  1C07 A;  4PHK A;  1OSA A;  1AJ5 A;  4USL A;  1CFP A;  1TTX A;  1G33 A;  1PSR A;  3JVT B;  3VRR A;  1QX2 A;  2P70 A;  1CM1 A;  1OQP A;  1ZMZ A;  1B7T Z;  3OHM B;  3D0Y B;  3SG2 A;  3AAJ A;  2K8M B;  1C3Y A;  1R6P A;  3R1O A;  1J7Q A;  2JZI A;  2FJY A;  4GUK A;  1KK8 C;  4OCI A;  1XFR A;  1DC1 A;  1DGU A;  1H4B A;  3HX4 A;  4ZCU A;  3IVT A;  2MBX A;  4OVN F;  3CTN A;  2BL0 B;  3NHT A;  4YRU A;  4L9M A;  1S5G Z;  1DQE A;  3A8R A;  1CFC A;  1FW4 A;  1SR6 C;  2KQY A;  4YGB B;  2K0J A;  1YTZ C;  3LK0 A;  2PRU A;  4YGE B;  1DEK A;  2MAZ A;  2K7D A;  1M39 A;  1B9A A;  2KDH A;  4JWQ A;  2F2P A;  2JOJ A;  3EK8 A;  5CSN A;  4AQJ A;  2BE6 A;  1BOD A;  3O4Y A;  1YVH A;  2BL0 C;  2O5G A;  3FE8 A;  1NP8 A;  1BMO A;  1DJG A;  1KSO A;  1K9P A;  2ZKM X;  1YUR A;  5JOL A;  3L4L A;  2I2R E;  4GAO A;  1CMG A;  2BBN A;  2EC6 B;  4JD9 A;  4MZL A;  4PHN A;  1M31 A;  1WLM A;  1Z2C B;  1ALV A;  2B1U A;  2CXJ A;  2MA2 A;  1N65 A;  3SG6 A;  3QRX A;  2WCE A;  4GBA A;  4ORC B;  3AKA A;  1DJH A;  2MJW B;  2KFG A;  1QIV A;  2KPH A;  3EVV A;  1MF8 B;  2K60 A;  1Y0V H;  2QEO A;  5HYD A;  2PVB A;  1TNP A;  2LVJ A;  3VGO A;  2G9B A;  1S1E A;  1NCX A;  1OOH A;  3S0E A;  2LNK A;  2PSR A;  1KSM A;  3VB1 A;  1LKJ A;  1XFZ O;  2FCE A;  1S6J A;  4F0Z B;  1GGZ A;  2LP2 A;  2V53 A;  4A4C A;  1JFK A;  1XFX O;  1YUT A;  3NHI A;  1QXP A;  3BFA A;  3Q8I A;  1U5I B;  4MBE A;  5G08 A;  1NIW A;  1JSA A;  3O4X A;  1SRA A;  2KAV A;  2ZN9 A;  4E68 A;  1SL7 A;  3FWB A;  1U5I A;  4ORA B;  3I5F B;  2QAC A;  2L0P A;  3EKJ A;  1A29 A;  1RTP 1;  2L5Y A;  1UUS A;  5HKW A;  4C0K A;  1SMG A;  1TNQ A;  1WDC B;  1Y1X A;  1B4C A;  2QEB A;  2JC2 A;  3TDI A;  4NQG A;  1D1O A;  2NCP A;  1KFX S;  1TCF A;  3NGV A;  2NZ0 A;  1A4P A;  3CR4 X;  2TN4 A;  1MQ1 A;  5CSI A;  4JQ0 D;  1B8C A;  1NCY A;  2ZNE A;  2LMV A;  2LVI A;  3BUX B;  1AJ4 A;  2K2A A;  3L4A A;  3B86 A;  3TDU A;  1EG4 A;  3JTD C;  3OX5 A;  4I5L B;  1CFF A;  3SIB A;  1SCM B;  4CLN A;  3H4S E;  2WOS A;  2R2I A;  3V2L A;  1UHI A;  3D75 A;  3KPX A;  3RZS A;  4PT1 A;  3D10 A;  3BUW B;  3LCP C;  1SNL A;  2LLS A;  1ORG A;  2SCP A;  3D74 A;  3WHT B;  2F2O A;  1EH2 A;  1BR1 B;  1QV0 A;  5HLV A;  1W7J B;  1XFW O;  3DY9 A;  4QJ5 B;  1OMV A;  2ZN8 A;  3I5H C;  3TUY B;  1AHR A;  2PYQ A;  5AAN A;  2KBM A;  2KBI A;  2M49 B;  5I94 A;  1GM0 A;  1CLM A;  3D78 A;  5D7F A;  1CDN A;  3MSE B;  1IH0 A;  4F7F A;  5I2Q A;  1XA5 A;  2F3Y A;  1UHJ A;  3DYE A;  2HET A;  1L7Z A;  3SJS A;  1KFX L;  2L51 A;  5BPJ A;  4OKH A;  1QAT A;  1N2D A;  1MHO A;  1QTX A;  1IKU A;  2LP3 A;  1CM4 A;  1V1F A;  3R1V A;  4NDC A;  2WCH A;  5J3X A;  4DRW A;  3B88 A;  2MHH A;  4MRY A;  1HQV A;  3I5I C;  3KEV A;  3O78 A;  1CDM A;  2LUX A;  1J55 A;  1F4Q A;  2KLE A;  3OBV A;  5I2L A;  1BT6 A;  4TNC A;  1JFJ A;  1EJ3 A;  3F45 A;  1NSH A;  4YGC B;  3BUN B;  2H8V A;  1ZAC A;  3O2P A;  1K94 A;  3BJH A;  2OPO A;  5KSZ A;  2BCA A;  1B1G A;  4YGA A;  1WRZ A;  2L5X B;  1Y1A A;  2E6W A;  1TWO A;  3BOW B;  1J1D A;  1WY9 A;  3BFH A;  2KHN A;  4PE1 A;  1GQM A;  3FS7 A;  4FTG A;  4M2Q A;  1H8B A;  4KYN A;  1MR8 A;  2Q4U A;  2HPS A;  1PVA A;  4PE0 A;  2M9G A;  2WCF A;  1JUO A;  2JT8 A;  3B7A A;  1TOP A;  1RJV A;  2I18 A;  3O6B A;  1S6C A;  3R1P A;  4QJ3 B;  4DCK A;  1F54 A;  2QEH A;  2BCX A;  1SL8 A;  3LL8 B;  1ODB A;  5D3O A;  2JNX A;  3CLN A;  4MEW A;  3E3R A;  5DKR A;  3SG7 A;  1YX8 A;  2ZRS A;  2WND A;  3NSK A;  4YI8 A;  1TCO B;  1BU3 A;  2LV7 A;  2M97 A;  1XK4 C;  2CT9 A;  2O60 A;  5B8I B;  1UHK A;  1S3P A;  2WOR A;  1R2U A;  4DIR A;  4CID A;  2L4H A;  4N5X A;  4XJK A;  2K7O A;  4IL1 A;  1EXR A;  3DVJ A;  1F4O A;  2LAN A;  3JTD B;  1ALW A;  4PCW A;  2JPO A;  1YVL A;  2LHL A;  3C1V A;  2H61 A;  3ICB A;  1OMD A;  2M3W A;  3KHE A;  5HKY A;  1A03 A;  3FE9 A;  4MN0 A;  4MRX A;  2EHB A;  4PHM A;  3CR2 A;  3UO9 A;  1G4Y R;  2M1K B;  3M0W A;  3K21 A;  5TNC A;  3TZ1 A;  4U8D A;  1SK6 D;  2JQ6 A;  2Y1N A;  3I5I B;  1J1E A;  3CDN A;  1IQ3 A;  1FF1 A;  4YBH B;  2H61 C;  2AMI A;  2PAS A;  2I94 A;  1BF5 A;  4MVF A;  1A75 A;  4DS7 A;  1OZS A;  2HQ8 A;  1LXF C;  1PRW A;  1PK0 D;  2ERB A;  3DVM A;  3B87 A;  2F8P A;  2Y4Q A;  2ZRT A;  5HL1 A;  3B6X A;  4PE4 A;  4INX A;  1XFU O;  1XK4 A;  1XO5 A;  2WCJ A;  3DVK A;  5KTY A;  3RLZ A;  1OZO A;  3EKH A;  2VRG A;  1JBA A;  2JXC A;  4XJK B;  3TS5 C;  5DKQ A;  1DJX A;  3CZ0 A;  2A4J A;  1OOI X;  1UHH A;  2GV5 A;  3CZT X;  2CBL A;  3NSI A;  3OB1 B;  1LS8 A;  5CSJ A;  3DZT A;  2KAX A;  3GOF A;  1QLS A;  1AUI B;  1PSB A;  3EK7 A;  1B7T Y;  1TRF A;  5HLO A;  1DT7 B;  3EVR A;  4HSZ A;  4I5J A;  1CNP A;  2DOQ A;  3PSR A;  3SS4 A;  4QJ4 B;  1J7P A;  1XYD A;  2JXL A;  3PAT A;  3R72 A;  5ER4 X;  4OV2 A;  1X02 A;  3OB2 B;  2F3Z A;  2GGZ A;  4DUQ A;  2SAS A;  3DVE A;  2H2K A;  2MLF C;  3GK4 X;  3N7H A;  1NUB A;  1BG1 A;  1J7R A;  1KQM C;  1NYA A;  1YR5 A;  1Z4H A;  2F33 A;  1CTR A;  1OOJ A;  1NX0 A;  2PMY A;  3NSL A;  4GPL B;  3ZWH A;  2K2F A;  1CLB A;  1QX5 B;  1CB1 A;  1UWO A;  5I8N A;  2WCK A;  1LA3 A;  2JRF A;  4PE7 A;  2NLN A;  2BEC A;  3KF9 A;  1BR4 B;  1SY9 A;  1MXL C;  2M29 A;  4GFT A;  1TUJ A;  1A2X A;  1KWO B;  5AEQ A;  1K2H A;  3DD4 A;  5AFP A;  1K90 D;  3VRP A;  1IJ5 A;  1GJY A;  2HF5 A;  2NCO A;  3VRQ A;  2KFF A;  2M0R A;  2COL B;  1RK9 A;  3LK1 A;  4ORB B;  1F70 A;  1Y1U A;  1YRT B;  5F6T A;  2P71 A;  2CCM A;  1CLL A;  3GK1 A;  2WCM A;  5IBW A;  1DF0 A;  1SYM A;  4GNK B;  2I7A A;  3FIA A;  4GGN A;  4ZCV A;  2KLD A;  1KQV A;  4N1F A;  1KK8 B;  3NXA A;  2KI6 C;  1KQM B;  1RRO A;  1IGV A;  1M46 A;  3BYA A;  4Q04 A;  1SBJ A;  2JT0 A;  3TDZ A;  4IJ7 A;  1YUU A;  1KFU L;  2LMU A;  3JVT C;  1PAL A;  1QLK A;  1BJF A;  5CPV A;  1JF2 A;  5FYX A;  3BQ3 A;  3S0G A;  2LM5 A;  1HT9 A;  4JKT A;  3SS3 A;  4I5K A;  2ISD A;  1FI6 A;  1ZFS A;  1MXE A;  2KNE A;  1K9K A;  1MWN A;  3CYZ A;  1IIO A;  2JTT A;  3AAK A;  5FI2 A;  1QAS A;  4ICB A;  1TNW A;  3RM1 A;  1PVB A;  3TS5 B;  1C3Z A;  2G2B A;  3WXA A;  2LCP A;  2BCB A;  4P2Y B;  1S5G Y;  4MZK A;  3I5G C;  3S0B A;  1JF0 A;  1B8R A;  3CWG A;  4OZD A;  1QWV A;  2LVK A;  4BY4 A;  1IJ6 A;  1V1G A;  1REC A;  2D8N A;  3LLE A;  2WC5 A;  2JTZ A;  2Y5I A;  2K7C A;  4C0L A;  2PAL A;  1LIN A;  2JWW A;  4BY5 A;  2KFH A;  4GGF A;  2RGI A;  1F71 A;  3EG5 B;  1DJY A;  4INW A;  2KGB C;  2BBM A;  1IG5 A;  1ZOT B;  3IQQ A;  1KWO C;  3PFV A;  1C7W A;  3D77 A;  1NX2 A;  2ZFD A;  2OTG B;  4M2P A;  1MUX A;  4PHJ A;  3PN7 C;  3S0F A;  2K7B A;  4PDZ A;  1QVI Z;  2QPT A;  1KFU S;  2IS9 A;  2KI6 D;  1L2O C;  3EVU A;  4A4B A;  3ZNI A;  3GK2 A;  1SKT A;  2L2C A;  2CNP A;  1RWY A;  1DEL A;  1T14 A;  4AQI A;  5I2O A;  2CTN A;  2GTE A;  4JPZ B;  3PAL A;  1K93 D;  2M8U A;  1OOG A;  3IF7 A;  3KO0 A;  1LA0 A;  4GGF C;  1C7V A;  4D1E A;  2LLU A;  1OE9 B;  3UNW A;  3CR5 X;  4XYN A;  2JT3 A;  5CSF A;  1OMR A;  4C0J A;  5AER A;  2AAO A;  4MSP A;  1SW8 A;  3QME A;  3SG4 A;  4YGD B;  2HQW A;  5D69 A;  1IWQ A;  1W7I B;  1GGW A;  1CDL A;  1XFY O;  5FI6 A;  1JWD A;  2LLT A;  5AXI A;  1K9U A;  1CMF A;  2KAY A;  2ZND A;  3BOW A;  3DF0 A;  2OS8 C;  3HCM A;  4WQ2 A;  3TUY C;  2M7N A;  1K95 A;  2Y1M A;  3S0D A;  1DJZ A;  2EGD A;  3PJI A;  4CFR A;  3D0Y A;  4WRI A;  2FCD A;  3BUO B;  4I5N B;  2JU0 A;  3K1E A;  2KI4 C;  2LVV A;  1K8U A;  1CKK A;  1DVI A;  1SPY A;  5ER5 A;  2PQL A;  1PUL A;  2FOT A;  1CDP A;  2LMT A;  1SCM C;  1W9Z A;  1XFV O;  2BKI B;  1NWD A;  1FBV A;  4NDD A;  2MRD A;  2QDI A;  3FE6 A;  3CZ1 A;  1K96 A;  3SG3 A;  2GGM A;  1DF0 B;  1Q80 A;  1QJT A;  2FJU B;  3SG5 A;  2LUC A;  1N0Y A;  2JPT A;  1QS7 A;  2M1U A;  3D73 A;  2WCL A;  3CZ2 A;  1AVS A;  1UHN A;  1BOC A;  1IRJ A;  4FQT A;  1QIW A;  4NDB A;  1RFJ A;  4ETO A;  1IQ5 A;  1QV1 A;  1ZUZ A;  2L4I A;  1NX1 A;  2YGU A;  3BUM B;  5EL2 A;  2L2E A;  2KYC A;  4M2O A;  3SIA A;  1NCZ A;  1DJW A;  2WC6 A;  2BKH B;  1KCY A;  3I5F C;  5JJG A;  1QVI Y;  2NXQ A;  4PAL A;  1DGV A;  1YX7 A;  1AP4 A;  3WHU B;  2LC5 A;  1A75 B;  3BFB A;  4CPV A;  2BAP A;  2KOT A;  4R1E A;  2MLE C;  1S36 A;  2LE9 B;  1F55 A;  1P28 A;  1TUZ A;  3VRN A;  2OS8 B;  3NSO A;  1VRK A;  1SL9 A;  3VRO A;  1OW4 A;  2LAP A;  1SSE B;  2LHI A;  1WRK A;  1LVC D;  1BLQ A;  1QX7 A;  4WQ3 A;  2AUC A;  1DMO A;  3OX6 A;  3EK4 A;  3PM2 A;  4P5O E;  2KQ6 A;  2KYF A;  4FQO A;  1KK7 Y;  5K89 A;  2WCB A;  3OP0 A;  1OOF A;  4UPG A;  2L50 A;  4MZJ A;  4CFQ A;  4HRH A;  3WNX B;  1EG3 A;  2BNX A;  1EL4 A;  1WLZ A;  1DJI A;  1YRU B;  5DKN A;  4YI9 A;  3D76 A;  2OTG C;  2Q91 A;  2EC6 C;  4MLW A;  3A4U B;  3DF0 B;  1L2O B;  1UP5 A;  2KGR A;  1M63 B;  3PM8 A;  1CFD A;  2JNF A;  2KSP A;  5KU1 A;  1WDC C;  1TN4 A;  4N1G A;  1JC2 A;  3PN7 B;  1DTL A;  2KI4 B;  1S26 D;  4AOM A;  3BXK A;  3CS1 A;  1SCV A;  1TNX A;  2L98 A;  3CAB A;  1TIZ A;  1B8L A;  5GQQ C;  1UUR A;  1F8H A;  1AK8 A;  2QEV A;  1NPQ A;  3CGA A;  5DIC A;  1Y6W A;  5PAL A;  3I5G B;  3FWC A;  1S6I A;  1XVJ A;  2BE4 A;  3PLF B;  1KK7 Z;  2P6B B;  1SR6 B;  1YUS A;  1E8A A;  3AKB A;  3I5H B;  1NX3 A;  3IQO A;  3L47 A;  2E30 A;  3OGN A;  1J7O A;  2K61 A; 
#chains in the Genus database with same CATH homology
 1G8I A;  1FPW A;  2JUL A;  5HKZ A;  2M7L A;  1FI5 A;  1B47 A;  1WRL A;  1M45 A;  2WC8 A;  4HRG A;  4OR9 B;  4HRE E;  1C07 A;  4PHK A;  1OSA A;  1AJ5 A;  4USL A;  1CFP A;  1TTX A;  1G33 A;  1PSR A;  3JVT B;  3VRR A;  1QX2 A;  1CM1 A;  1OQP A;  1ZMZ A;  1B7T Z;  3OHM B;  3D0Y B;  3SG2 A;  3AAJ A;  2K8M B;  1R6P A;  1J7Q A;  2JZI A;  4GUK A;  1KK8 C;  4OCI A;  1DGU A;  1H4B A;  3HX4 A;  4ZCU A;  2MBX A;  4OVN F;  3CTN A;  2BL0 B;  4YRU A;  4L9M A;  1S5G Z;  3A8R A;  1CFC A;  1FW4 A;  1SR6 C;  2KQY A;  4YGB B;  2K0J A;  1YTZ C;  3LK0 A;  2PRU A;  4YGE B;  2MAZ A;  2K7D A;  1M39 A;  1B9A A;  2KDH A;  4JWQ A;  2F2P A;  2JOJ A;  3EK8 A;  5CSN A;  4AQJ A;  2BE6 A;  1BOD A;  3O4Y A;  1YVH A;  2BL0 C;  2O5G A;  1NP8 A;  1BMO A;  1DJG A;  1KSO A;  1K9P A;  2ZKM X;  1YUR A;  5JOL A;  2I2R E;  4GAO A;  1CMG A;  2BBN A;  2EC6 B;  4PHN A;  4MZL A;  1M31 A;  1WLM A;  1ALV A;  2B1U A;  2CXJ A;  2MA2 A;  1N65 A;  3SG6 A;  3QRX A;  2WCE A;  4GBA A;  4ORC B;  3AKA A;  1DJH A;  2MJW B;  2KFG A;  1QIV A;  3EVV A;  1MF8 B;  1Y0V H;  5HYD A;  2PVB A;  1TNP A;  2LVJ A;  3VGO A;  2G9B A;  1S1E A;  1NCX A;  2LNK A;  2PSR A;  1KSM A;  1LKJ A;  1XFZ O;  2FCE A;  1S6J A;  4F0Z B;  1GGZ A;  2LP2 A;  2V53 A;  4A4C A;  1JFK A;  1XFX O;  1YUT A;  5G08 A;  1QXP A;  4MBE A;  1U5I B;  1NIW A;  1JSA A;  1SRA A;  2KAV A;  2ZN9 A;  4E68 A;  1SL7 A;  3FWB A;  1U5I A;  4ORA B;  3I5F B;  2QAC A;  2L0P A;  3EKJ A;  1A29 A;  1RTP 1;  1UUS A;  5HKW A;  4C0K A;  1SMG A;  1TNQ A;  1WDC B;  1Y1X A;  1B4C A;  2JC2 A;  3TDI A;  4NQG A;  1D1O A;  2NCP A;  1KFX S;  1TCF A;  2NZ0 A;  1A4P A;  3CR4 X;  2TN4 A;  1MQ1 A;  5CSI A;  4JQ0 D;  1B8C A;  1NCY A;  2ZNE A;  2LMV A;  2LVI A;  3BUX B;  1AJ4 A;  2K2A A;  3TDU A;  1EG4 A;  3JTD C;  3OX5 A;  4I5L B;  1CFF A;  3SIB A;  1SCM B;  4CLN A;  3H4S E;  2WOS A;  2R2I A;  1UHI A;  3KPX A;  3D10 A;  3BUW B;  3LCP C;  1SNL A;  2LLS A;  2SCP A;  3WHT B;  2F2O A;  1EH2 A;  1BR1 B;  1QV0 A;  5HLV A;  1W7J B;  1XFW O;  4QJ5 B;  1OMV A;  2ZN8 A;  3I5H C;  3TUY B;  1AHR A;  5AAN A;  2KBM A;  2KBI A;  2M49 B;  1CLM A;  5D7F A;  1CDN A;  3MSE B;  1IH0 A;  5I2Q A;  1XA5 A;  2F3Y A;  1UHJ A;  2HET A;  1L7Z A;  3SJS A;  1KFX L;  2L51 A;  5BPJ A;  4OKH A;  1QAT A;  1N2D A;  1MHO A;  1QTX A;  1IKU A;  2LP3 A;  1CM4 A;  1V1F A;  4NDC A;  5J3X A;  4DRW A;  2MHH A;  4MRY A;  1HQV A;  3I5I C;  3KEV A;  3O78 A;  1CDM A;  2LUX A;  1J55 A;  1F4Q A;  5I2L A;  1BT6 A;  4TNC A;  1JFJ A;  1EJ3 A;  3F45 A;  1NSH A;  4YGC B;  3BUN B;  1ZAC A;  3O2P A;  1K94 A;  2OPO A;  5KSZ A;  2BCA A;  4YGA A;  1WRZ A;  2L5X B;  1Y1A A;  2E6W A;  3BOW B;  1J1D A;  1WY9 A;  2KHN A;  4PE1 A;  1GQM A;  3FS7 A;  4FTG A;  4M2Q A;  1H8B A;  1MR8 A;  2Q4U A;  2HPS A;  1PVA A;  4PE0 A;  2M9G A;  2WCF A;  1JUO A;  2JT8 A;  1TOP A;  1RJV A;  2I18 A;  3O6B A;  1S6C A;  4QJ3 B;  4DCK A;  1F54 A;  2BCX A;  1SL8 A;  3LL8 B;  1ODB A;  2JNX A;  3CLN A;  4MEW A;  3E3R A;  5DKR A;  3SG7 A;  1YX8 A;  2ZRS A;  2WND A;  3NSK A;  4YI8 A;  1TCO B;  1BU3 A;  2LV7 A;  2M97 A;  1XK4 C;  2CT9 A;  2O60 A;  5B8I B;  1UHK A;  1S3P A;  2WOR A;  1R2U A;  4DIR A;  4CID A;  2L4H A;  4N5X A;  4XJK A;  2K7O A;  4IL1 A;  1EXR A;  3DVJ A;  1F4O A;  2LAN A;  3JTD B;  1ALW A;  4PCW A;  1YVL A;  2LHL A;  3C1V A;  2H61 A;  3ICB A;  1OMD A;  2M3W A;  3KHE A;  5HKY A;  1A03 A;  4MN0 A;  4MRX A;  2EHB A;  4PHM A;  3CR2 A;  1G4Y R;  2M1K B;  3M0W A;  3K21 A;  5TNC A;  3TZ1 A;  4U8D A;  1SK6 D;  2JQ6 A;  2Y1N A;  3I5I B;  1J1E A;  1IQ3 A;  1FF1 A;  4YBH B;  2H61 C;  2AMI A;  2PAS A;  2I94 A;  1BF5 A;  4MVF A;  1A75 A;  4DS7 A;  1OZS A;  2HQ8 A;  1LXF C;  1PRW A;  1PK0 D;  3DVM A;  2F8P A;  2Y4Q A;  2ZRT A;  4PE4 A;  1XFU O;  1XK4 A;  1XO5 A;  3DVK A;  5KTY A;  3RLZ A;  1OZO A;  3EKH A;  2VRG A;  1JBA A;  2JXC A;  4XJK B;  3TS5 C;  5DKQ A;  1DJX A;  2A4J A;  1UHH A;  3CZT X;  2GV5 A;  2CBL A;  3NSI A;  3OB1 B;  5CSJ A;  2KAX A;  3GOF A;  1QLS A;  1AUI B;  1PSB A;  3EK7 A;  1B7T Y;  1TRF A;  5HLO A;  1DT7 B;  3EVR A;  4HSZ A;  4I5J A;  1CNP A;  2DOQ A;  3PSR A;  1J7P A;  4QJ4 B;  1XYD A;  2JXL A;  3PAT A;  5ER4 X;  4OV2 A;  1X02 A;  3OB2 B;  2F3Z A;  2GGZ A;  4DUQ A;  2SAS A;  3DVE A;  2H2K A;  2MLF C;  3GK4 X;  1NUB A;  1BG1 A;  1J7R A;  1KQM C;  1NYA A;  1YR5 A;  2F33 A;  3NSL A;  1CTR A;  1OOJ A;  1NX0 A;  2PMY A;  4GPL B;  3ZWH A;  1B1G A;  2K2F A;  1CLB A;  1QX5 B;  1CB1 A;  1UWO A;  5I8N A;  1LA3 A;  2JRF A;  4PE7 A;  2NLN A;  2BEC A;  3KF9 A;  1BR4 B;  1SY9 A;  1MXL C;  2M29 A;  4GFT A;  1A2X A;  1KWO B;  5AEQ A;  1K2H A;  3DD4 A;  5AFP A;  1K90 D;  3VRP A;  1IJ5 A;  1GJY A;  2HF5 A;  2NCO A;  3VRQ A;  2KFF A;  2M0R A;  2COL B;  1RK9 A;  3LK1 A;  4ORB B;  1F70 A;  1Y1U A;  1YRT B;  5F6T A;  2CCM A;  1CLL A;  3GK1 A;  5IBW A;  1DF0 A;  1SYM A;  4GNK B;  2I7A A;  3FIA A;  4GGN A;  4ZCV A;  1KQV A;  4N1F A;  1KK8 B;  3NXA A;  2KI6 C;  1KQM B;  1RRO A;  1IGV A;  1M46 A;  3BYA A;  4Q04 A;  1SBJ A;  2JT0 A;  3TDZ A;  1YUU A;  1KFU L;  2LMU A;  3JVT C;  1PAL A;  1QLK A;  1BJF A;  5CPV A;  1JF2 A;  5FYX A;  3BQ3 A;  2LM5 A;  1HT9 A;  4I5K A;  2ISD A;  1FI6 A;  1ZFS A;  1MXE A;  2KNE A;  1K9K A;  1MWN A;  2JTT A;  3AAK A;  1QAS A;  4ICB A;  1TNW A;  3RM1 A;  1PVB A;  3TS5 B;  2G2B A;  3WXA A;  2LCP A;  2BCB A;  4P2Y B;  1S5G Y;  4MZK A;  3I5G C;  1JF0 A;  1B8R A;  3CWG A;  2LVK A;  4BY4 A;  1IJ6 A;  1V1G A;  1REC A;  2D8N A;  3LLE A;  2JTZ A;  2Y5I A;  2K7C A;  4C0L A;  2PAL A;  1LIN A;  2JWW A;  4BY5 A;  2KFH A;  4GGF A;  2RGI A;  1F71 A;  1DJY A;  2KGB C;  2BBM A;  1IG5 A;  1ZOT B;  3IQQ A;  1KWO C;  3PFV A;  1C7W A;  1NX2 A;  2ZFD A;  2OTG B;  4M2P A;  1MUX A;  4PHJ A;  3PN7 C;  2K7B A;  4PDZ A;  1QVI Z;  2QPT A;  1KFU S;  2IS9 A;  2KI6 D;  1L2O C;  3EVU A;  4A4B A;  3ZNI A;  3GK2 A;  1SKT A;  2CNP A;  1RWY A;  4AQI A;  5I2O A;  2CTN A;  4JPZ B;  3PAL A;  1K93 D;  2M8U A;  3IF7 A;  3KO0 A;  1LA0 A;  4GGF C;  1C7V A;  4D1E A;  2LLU A;  1OE9 B;  3CR5 X;  4XYN A;  2JT3 A;  5CSF A;  1OMR A;  4C0J A;  5AER A;  2AAO A;  4MSP A;  1SW8 A;  3SG4 A;  4YGD B;  2HQW A;  5D69 A;  1IWQ A;  1W7I B;  1GGW A;  1CDL A;  1XFY O;  1JWD A;  2LLT A;  5AXI A;  1K9U A;  1CMF A;  2KAY A;  2ZND A;  3BOW A;  3DF0 A;  2OS8 C;  3HCM A;  4WQ2 A;  3TUY C;  2M7N A;  1K95 A;  2Y1M A;  1DJZ A;  2EGD A;  4CFR A;  3D0Y A;  4WRI A;  2FCD A;  3BUO B;  4I5N B;  2JU0 A;  2KI4 C;  2LVV A;  1K8U A;  1CKK A;  1DVI A;  1SPY A;  5ER5 A;  1PUL A;  2FOT A;  1CDP A;  2LMT A;  1SCM C;  1XFV O;  2BKI B;  1NWD A;  1FBV A;  4NDD A;  2MRD A;  1K96 A;  3SG3 A;  2GGM A;  1DF0 B;  1Q80 A;  1QJT A;  2FJU B;  3SG5 A;  2LUC A;  1N0Y A;  2JPT A;  1QS7 A;  2M1U A;  1AVS A;  1UHN A;  1BOC A;  1IRJ A;  1QIW A;  4NDB A;  1RFJ A;  4ETO A;  1IQ5 A;  1QV1 A;  1ZUZ A;  2L4I A;  1NX1 A;  3BUM B;  2L2E A;  2KYC A;  4M2O A;  3SIA A;  1NCZ A;  1DJW A;  2BKH B;  1KCY A;  3I5F C;  5JJG A;  1QVI Y;  2NXQ A;  4PAL A;  1DGV A;  1YX7 A;  1AP4 A;  3WHU B;  2LC5 A;  1A75 B;  4CPV A;  2KOT A;  4R1E A;  2MLE C;  1S36 A;  2LE9 B;  1F55 A;  3VRN A;  2OS8 B;  3NSO A;  1VRK A;  1SL9 A;  3VRO A;  2LAP A;  2LHI A;  1WRK A;  1LVC D;  1BLQ A;  1QX7 A;  4WQ3 A;  2AUC A;  1DMO A;  3OX6 A;  3EK4 A;  4P5O E;  2KQ6 A;  2KYF A;  4FQO A;  1KK7 Y;  5K89 A;  2WCB A;  3OP0 A;  4UPG A;  2L50 A;  4MZJ A;  4CFQ A;  4HRH A;  3WNX B;  1EG3 A;  1EL4 A;  1WLZ A;  1DJI A;  1YRU B;  5DKN A;  4YI9 A;  2OTG C;  2Q91 A;  2EC6 C;  4MLW A;  3A4U B;  3DF0 B;  1L2O B;  1UP5 A;  2KGR A;  1M63 B;  3PM8 A;  1CFD A;  2JNF A;  2KSP A;  5KU1 A;  1WDC C;  1TN4 A;  4N1G A;  1JC2 A;  3PN7 B;  1DTL A;  2KI4 B;  1S26 D;  4AOM A;  3BXK A;  3CS1 A;  1SCV A;  1TNX A;  2L98 A;  1TIZ A;  1B8L A;  5GQQ C;  1UUR A;  1F8H A;  1AK8 A;  1NPQ A;  3CGA A;  1Y6W A;  5PAL A;  3I5G B;  3FWC A;  1S6I A;  1XVJ A;  2BE4 A;  3PLF B;  1KK7 Z;  2P6B B;  1SR6 B;  1YUS A;  1E8A A;  3AKB A;  3I5H B;  1NX3 A;  3IQO A;  2E30 A;  1J7O A;  2K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...