4MBEA

Sac3:sus1:cdc31:nup1 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, transcription
total genus 51
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mbeA01
3CR2A 1DGUA 2LHIA 2LP2A 2TN4A 2OPOA 1KK8C 2ZRTA 3PFVA 1K93D 3TDIA 2JC2A 2L4IA 3OHMB 2M3WA 2LC5A 5HYDA 2CNPA 1UHIA 2BBMA 1DT7B 1S5GZ 4GNKB 3I5GB 1XFVO 2WCFA 3FIAA 1NPQA 1K8UA 1F4QA 3TDUA 2BE4A 5AERA 2KFGA 3PSRA 2GGZA 3O4YA 2BCAA 1JFJA 3EK8A 2KOTA 1A29A 4P5OE 1PVBA 2M1UA 3BYAA 4TNCA 2LM5A 1A4PA 1NIWA 3ZNIA 1V1FA 1YUTA 1ODBA 1QVIZ 2JTTA 3JTDC 1CTRA 2ZNEA 4GGNA 4MEWA 4PCWA 4HREE 3SG2A 1SL8A 3VROA 2COLB 3F45A 3RM1A 1JUOA 1NCYA 2JULA 3TUYB 2H2KA 5D69A 3SIBA 1FW4A 3VRPA 1NUBA 3BOWB 3TS5C 2KI4B 4GGFA 1PSRA 5CPVA 5AXIA 2AUCA 3BUNB 1MXLC 1MWNA 1UURA 3AKAA 1PK0D 3IQOA 5PALA 1S26D 1NCZA 1F4OA 1XO5A 1A2XA 3WHUB 1IGVA 4GFTA 1SPYA 2H61C 1NP8A 3DVEA 1C7WA 3I5FB 5ER5A 4OR9B 3AAKA 1KWOC 1CDMA 4ORCB 1XYDA 3A4UB 1IJ6A 1QLSA 2L51A 1ZOTB 1L2OC 1TNWA 1B47A 2M49B 1UUSA 1JC2A 1B8CA 1WY9A 4DCKA 3D0YB 3EK7A 2PALA 2LVKA 2LMUA 1W7IB 1J55A 1DF0A 1SRAA 2AAOA 3JVTC 3LCPC 1OSAA 4WRIA 4MN0A 2K7DA 1AJ5A 1WDCB 3MSEB 1G33A 1QV0A 1TCFA 1NX0A 3O2PA 2BKIB 4MVFA 1EJ3A 3EKJA 3RLZA 4N1GA 2JNFA 1IRJA 1ZACA 4ZCVA 2Q4UA 1KK7Y 2NCOA 1BLQA 5HKZA 3IF7A 1TTXA 3QRXA 3CR4X 1OMVA 3OX6A 5I2OA 1AP4A 2K0JA 1MQ1A 1YVLA 3BQ3A 1KQMC 2K7OA 3CTNA 1MXEA 5D7FA 1CNPA 2Y1NA 4CLNA 3NSKA 2KAXA 1OE9B 1L7ZA 1WRLA 1MR8A 2L0PA 1QX7A 2L4HA 3FWBA 2CTNA 2FCEA 2M29A 1K94A 4OKHA 4IL1A 1BODA 1CMGA 2LANA 4MSPA 1B4CA 1IQ3A 1QV1A 1DJZA 1S6JA 1BJFA 2GGMA 1IJ5A 1SL9A 1KK8B 1NCXA 1FF1A 3NSLA 1TOPA 1XK4A 2LLTA 1QX5B 4QJ3B 2KFFA 2JXLA 5BPJA 1CDPA 5JOLA 1R2UA 3GK2A 2QACA 3E3RA 1RTP1 2JRFA 2M7NA 2KYFA 3CGAA 2HQWA 2KFHA 1SR6C 1JF2A 1QXPA 1TCOB 2L50A 2KSPA 2Y5IA 2K2FA 3JTDB 1AUIB 1N2DA 1G4YR 2EC6C 1J1EA 1K9KA 3DD4A 3PALA 5KSZA 1FPWA 2BL0C 4YGCB 3ICBA 4AQJA 1SY9A 4JQ0D 1YTZC 2CT9A 3TS5B 1AK8A 3LK1A 4YGEB 1B7TY 2NZ0A 2LVJA 3CZTX 3LK0A 1N65A 4YGAA 4NDDA 3OP0A 5CSIA 1A03A 2GV5A 3ZWHA 3AAJA 2HQ8A 4ZCUA 1KWOB 2MLEC 1C7VA 2KAVA 5HLOA 1UHKA 1L2OB 1SCMC 1UHNA 1S1EA 1M31A 2Y1MA 1QX2A 4MZJA 1J7QA 1IQ5A 1SK6D 5GQQC 2K61A 2LAPA 1RJVA 1ZFSA 4GGFC 2BKHB 1F55A 3DF0A 1HQVA 4PE4A 4XJKB 1B8RA 5AANA 1C07A 3JVTB 2BCXA 2JXCA 5I2LA 1DTLA 4UPGA 1Y1AA 1YUUA 1HT9A 1DJHA 4ORAB 1M39A 2FOTA 4NDBA 4M2QA 3BUMB 1LXFC 1XFZO 1K96A 1NX2A 2HETA 3KO0A 1JF0A 3PM8A 5F6TA 1ZMZA 3O6BA 3EVRA 1KQVA 1CDLA 1TNPA 3NSOA 1GGWA 1W7JB 5HLVA 3WXAA 1DGVA 4CIDA 3CS1A 4DIRA 4YGBB 2F2PA 2WCEA 1KQMB 3WHTB 1BU3A 1XFYO 2I94A 1B8LA 4WQ2A 3OB2B 4R1EA 2KGBC 1DJYA 2M0RA 3O78A 2P6BB 3I5IC 1NYAA 1KFXL 1PVAA 3VGOA 2LHLA 5I8NA 3WNXB 2M7LA 1YRUB 1WLZA 4HRGA 4E68A 2PRUA 1A75A 1AVSA 2M9GA 2MLFC 1UP5A 2HF5A 2LE9B 1BF5A 1XFUO 1H8BA 1U5IB 2LLSA 1Y6WA 1B1GA 3H4SE 2PSRA 1AHRA 1BOCA 2JOJA 3FS7A 1M63B 3KF9A 1F70A 2LMTA 4CFRA 4BY4A 1OMDA 1SR6B 3FWCA 2LV7A 2K2AA 1XFWO 1NX3A 4AOMA 1KSMA 1XK4C 2JT8A 2EC6B 2ZKMX 3BUOB 5DKRA 1SNLA 4A4CA 1BR4B 1QIWA 2I7AA 1EXRA 1TIZA 2BL0B 2K8MB 2ZN9A 1XVJA 1BMOA 1CM4A 1GGZA 2WC8A 3SG3A 4L9MA 2CBLA 1JFKA 5DKNA 1N0YA 2KAYA 3GK1A 4DUQA 1SKTA 2D8NA 2B1UA 4GPLB 4I5NB 1LA3A 2VRGA 5DKQA 4WQ3A 1QVIY 2WNDA 1EG4A 1SMGA 3BOWA 3LL8B 1BG1A 1S36A 1YUSA 3SG5A 2FCDA 1QASA 3OB1B 4C0KA 2ZFDA 4FTGA 4DS7A 1SCMB 4D1EA 3EVUA 1M46A 4OVNF 2F3ZA 1QLKA 1F8HA 1YR5A 2KQYA 1RWYA 2ZRSA 3EVVA 1D1OA 3I5HC 1UHHA 1WLMA 2MJWB 2QPTA 4PHMA 2BCBA 2KQ6A 2Q91A 1TRFA 3PN7C 2PASA 5G08A 1K90D 3D0YA 3DVKA 2MAZA 4I5JA 1TNQA 2NLNA 1E8AA 2A4JA 2KI6D 2LVIA 2JT3A 2OTGC 2KGRA 2M1KB 2FJUB 4MLWA 2PMYA 1DJIA 2JTZA 5CSFA 1RECA 5AFPA 1K9UA 3PLFB 2LLUA 4YGDB 2EGDA 2I2RE 5HKYA 1DF0B 5AEQA 1XFXO 1QJTA 1Y1XA 1QATA 2AMIA 1ALVA 2OS8C 3NSIA 4ORBB 1KK7Z 1TN4A 1SL7A 3LLEA 4PHNA 1X02A 4YBHB 1IWQA 1OOJA 4PE7A 2BECA 3SJSA 5CSJA 1G8IA 3BUXB 2LNKA 3EKHA 1PALA 4BY5A 3I5IB 1CFDA 3BUWB 1WRZA 3GOFA 1GJYA 2JZIA 4PDZA 3SIAA 4C0LA 1SCVA 3EK4A 2BBNA 4MZKA 3KHEA 2EHBA 1CFPA 2L2EA 2L5XB 2KHNA 1RFJA 2RGIA 3AKBA 2LUXA 3DVJA 4YI8A 1IH0A 1S6IA 2O5GA 4F0ZB 4NQGA 2KNEA 1FI6A 5J3XA 2Y4QA 3NXAA 3OX5A 4I5KA 1MF8B 2SASA 4MBEA 1QS7A 1QTXA 2KYCA 1YURA 2NXQA 4YI9A 1K9PA 4N5XA 2MRDA 4PALA 1OZOA 1XA5A 2JPTA 4HRHA 3VRRA 1CFFA 2BE6A 1LVCD 4GBAA 5ER4X 4JPZB 2WOSA 1MUXA 1LINA 1F71A 1GQMA 2JU0A 3KPXA 4OCIA 1CB1A 3IQQA 1CLLA 2MHHA 2JT0A 1OQPA 2M97A 1J1DA 2KI6C 1YX8A 5JJGA 1LA0A 2O60A 1J7RA 3CLNA 2ZNDA 5CSNA 4MRYA 2WORA 5TNCA 1UWOA 1NSHA 1CM1A 3I5GC 1KCYA 1LKJA 1IG5A 1VRKA 2LUCA 1CLBA 1NX1A 3A8RA 1FI5A 3HX4A 2G2BA 1PRWA 1R6PA 2CXJA 4GUKA 2WCBA 3TDZA 1CFCA 1B7TZ 4CFQA 1DJXA 1YX7A 1CMFA 1KFUL 4YRUA 5K89A 1JSAA 4FQOA 2R2IA 1DVIA 1RROA 2MBXA 4PHJA 1EG3A 4MZLA 1DMOA 5HKWA 1TNXA 1OMRA 2E30A 2H61A 1V1GA 3I5HB 1DJWA 2HPSA 3KEVA 2KBIA 1PULA 2DOQA 4M2OA 4QJ4B 3K21A 5IBWA 1S6CA 1YRTB 2MA2A 1CKKA 2IS9A 3PN7B 3TUYC 4XYNA 2F3YA 2F8PA 1S5GY 2OTGB 2KI4C 2NCPA 2JQ6A 1F54A 4XJKA 1M45A 2I18A 2KBMA 4QJ5B 3SG4A 2G9BA 4P2YB 2K7CA 1CDNA 3I5FC 3GK4X 4Q04A 1Q80A 4PE1A 4JWQA 3DF0B 4CPVA 5I2QA 3M0WA 4C0JA 5KTYA 1Y1UA 1J7PA 2K7BA 2LMVA 1JWDA 1CLMA 1KFXS 2V53A 2OS8B 4AQIA 1AJ4A 2LP3A 5FYXA 1ZUZA 2M8UA 1KSOA 1UHJA 2ISDA 1SYMA 4PE0A 1EL4A 2LCPA 2KDHA 4M2PA 2CCMA 3SG6A 1DJGA 1PSBA 2F2OA 2JWWA 3SG7A 1WDCC 1S3PA 2SCPA 3VRNA 4I5LB 2L98A 4GAOA 4A4BA 1YVHA 3C1VA 5B8IB 1KFUS 1RK9A 1BT6A 4U8DA 1SW8A 1NWDA 3BXKA 2PVBA 2F33A 3TZ1A 3CR5X 4OV2A 2JNXA 3VRQA 3PATA 1Y0VH 3D10A 4NDCA 1ALWA 4ICBA 1EH2A 1H4BA 1U5IA 4PHKA 1K95A 4DRWA 1BR1B 1A75B 3DVMA 4MRXA 4N1FA 4USLA 1J7OA 1K2HA 2E6WA 2ZN8A 1B9AA 1SBJA 2LVVA 4HSZA 5KU1A 1QIVA 4ETOA 3HCMA 1MHOA 1WRKA 1JBAA 3CWGA 1FBVA 1OZSA 1IKUA
chains in the Genus database with same CATH superfamily
3CR2A 1DGUA 2L5YA 2LHIA 2LP2A 2TN4A 2OPOA 1KK8C 2ZRTA 3PFVA 1K93D 3TDIA 2JC2A 2L4IA 3OHMB 2M3WA 2LC5A 5HYDA 2CNPA 1UHIA 2BBMA 1DT7B 1S5GZ 3FE6A 2WCKA 4GNKB 1C3ZA 1Z2CB 3I5GB 1XFVO 2WCFA 3FIAA 1Z4HA 1NPQA 1K8UA 1F4QA 3TDUA 2BE4A 5AERA 2KFGA 3PSRA 2GGZA 3O4YA 2BCAA 1JFJA 3EK8A 2KOTA 1A29A 4P5OE 1PVBA 2M1UA 3BYAA 4TNCA 2LM5A 1A4PA 1NIWA 4INXA 1V1FA 1YUTA 2WCLA 3ZNIA 1ODBA 3SS5A 1QVIZ 1OOGA 2JTTA 3JTDC 1CTRA 2ZNEA 3NGVA 4GGNA 4MEWA 4HREE 4PCWA 3SG2A 1SL8A 3VROA 2COLB 2QEBA 3F45A 3RM1A 1DELA 1JUOA 1NCYA 3BFAA 2JULA 3TUYB 2H2KA 3IVTA 5D69A 3SIBA 1FW4A 3VRPA 1NUBA 3BOWB 3TS5C 2KI4B 4GGFA 3UNWA 1PSRA 5CPVA 5AXIA 3UO9A 2AUCA 3BUNB 1MXLC 1MWNA 1UURA 3AKAA 1PK0D 3IQOA 5PALA 1S26D 1NCZA 1ORGA 1F4OA 1XO5A 1TUZA 1A2XA 3WHUB 1IGVA 4GFTA 1SPYA 2H61C 1NP8A 3DVEA 1C7WA 3I5FB 5ER5A 4OR9B 3AAKA 1KWOC 1CDMA 2QEVA 1XYDA 3A4UB 4ORCB 1IJ6A 1QLSA 2L51A 3R1VA 1ZOTB 1L2OC 1TNWA 1B47A 2M49B 3B87A 1UUSA 1JC2A 1B8CA 1WY9A 4DCKA 3D0YB 3CZ2A 3EK7A 2PALA 2LVKA 2LMUA 1SSEB 1W7IB 2K60A 1J55A 1DF0A 1SRAA 2AAOA 3JVTC 3LCPC 1OSAA 3SS4A 4WRIA 4MN0A 2K7DA 1WDCB 1AJ5A 3MSEB 1G33A 1QV0A 1TCFA 1NX0A 3O2PA 2BKIB 4MVFA 1EJ3A 3EKJA 3R1OA 3RLZA 4N1GA 1GM0A 2JNFA 1IRJA 1ZACA 4ZCVA 2Q4UA 1KK7Y 2NCOA 4KYNA 5HKZA 3IF7A 1BLQA 1TTXA 3QRXA 3CR4X 1OMVA 3EG5B 3OX6A 5I2OA 1AP4A 2K0JA 1MQ1A 1YVLA 3BQ3A 1KQMC 3FE9A 2K7OA 3PJIA 3CTNA 1MXEA 5D7FA 1CNPA 2Y1NA 4CLNA 3NSKA 2KAXA 1OE9B 1L7ZA 2KPHA 1WRLA 1MR8A 2QEHA 2L0PA 1QX7A 2L4HA 3FWBA 2CTNA 2FCEA 2M29A 1K94A 4OKHA 1OOIX 3R72A 4IL1A 1BODA 3L47A 1CMGA 2LANA 4MSPA 1B4CA 1IQ3A 1QV1A 1DJZA 1S6JA 1BJFA 2GGMA 1IJ5A 1SL9A 1KK8B 1NCXA 1FF1A 3NSLA 4PT1A 1DC1A 1TOPA 1XK4A 2LLTA 2YGUA 1QX5B 4QJ3B 2KFFA 2JXLA 5BPJA 1CDPA 5JOLA 1R2UA 3GK2A 2QACA 3E3RA 1RTP1 2JRFA 2M7NA 2KYFA 3PM2A 3CGAA 2HQWA 3D75A 2KFHA 1SR6C 1JF2A 1QXPA 1TCOB 3BJHA 2L50A 2KSPA 2Y5IA 2K2FA 3D73A 3JTDB 1AUIB 5I94A 2GTEA 1N2DA 1G4YR 2EC6C 1J1EA 1K9KA 3DD4A 3PALA 5KSZA 2PYQA 1FPWA 2BL0C 4YGCB 3ICBA 4AQJA 1SY9A 4JQ0D 1YTZC 2CT9A 3S0DA 3TS5B 1AK8A 3LK1A 4YGEB 1B7TY 2NZ0A 2LVJA 3CZTX 3LK0A 1N65A 3BFBA 4YGAA 5FI2A 2H8VA 4NDDA 3OP0A 5CSIA 1A03A 2GV5A 3ZWHA 3AAJA 2HQ8A 2WCHA 4ZCUA 1KWOB 2MLEC 1C7VA 3CDNA 2KAVA 5HLOA 1UHKA 1L2OB 1SCMC 2WCMA 2PQLA 1UHNA 3N7HA 1S1EA 1M31A 2Y1MA 1QX2A 5EL2A 4MZJA 1J7QA 1IQ5A 1SK6D 5GQQC 2K61A 2LAPA 1RJVA 1ZFSA 3QMEA 4GGFC 2BKHB 1F55A 3DF0A 1HQVA 4PE4A 1DEKA 4XJKB 1B8RA 5AANA 1C07A 2P71A 3JVTB 2BCXA 2JXCA 5I2LA 1DTLA 3VB1A 1OOFA 1Y1AA 3SS3A 1YUUA 1HT9A 3DY9A 1DJHA 4ORAB 1M39A 2FOTA 4NDBA 4M2QA 3RZSA 3BUMB 1LXFC 1XFZO 1W9ZA 1K96A 1NX2A 2HETA 3KO0A 1JF0A 3PM8A 5F6TA 1ZMZA 3O6BA 3EVRA 1KQVA 1CDLA 1TNPA 3NSOA 1GGWA 1W7JB 5HLVA 3WXAA 1DGVA 4CIDA 3Q8IA 3CS1A 4DIRA 4YGBB 2F2PA 2WCEA 1KQMB 3WHTB 2FJYA 1BU3A 1XFYO 2I94A 3OBVA 1B8LA 4WQ2A 3DYEA 3OB2B 4R1EA 2KGBC 1DJYA 2M0RA 3DZTA 3O78A 5HL1A 2P6BB 3I5IC 1NYAA 2BAPA 1KFXL 1PVAA 3B6XA 3VGOA 4UPGA 3R1PA 2LHLA 4IJ7A 5I8NA 3WNXB 2M7LA 1YRUB 1WLZA 4HRGA 4E68A 2PRUA 1A75A 1AVSA 2M9GA 3BFHA 4JD9A 2MLFC 1UP5A 2HF5A 2LE9B 1BF5A 1DQEA 1XFUO 1H8BA 1U5IB 2LLSA 3V2LA 3S0AA 1Y6WA 1B1GA 3H4SE 3O4XA 2PSRA 3S0GA 1AHRA 3CZ1A 1BOCA 2JOJA 3FS7A 1M63B 3KF9A 1F70A 2LMTA 4CFRA 4BY4A 1OMDA 1OOHA 1SR6B 3FWCA 2LV7A 2K2AA 1XFWO 1NX3A 4AOMA 1KSMA 1XK4C 2JT8A 2EC6B 2ZKMX 3BUOB 5DKRA 1SNLA 4A4CA 1BR4B 1QIWA 2I7AA 1EXRA 1TIZA 2BL0B 2K8MB 2ZN9A 1XVJA 1BMOA 1CM4A 1GGZA 2WC8A 5DICA 3SG3A 4L9MA 2CBLA 1JFKA 5DKNA 1N0YA 1OW4A 2KAYA 3GK1A 4DUQA 1SKTA 2D8NA 2B1UA 4GPLB 4I5NB 1LA3A 2VRGA 5DKQA 4WQ3A 3CABA 1QVIY 2WNDA 3K1EA 1EG4A 1SMGA 3BOWA 3LL8B 1BG1A 1S36A 1YUSA 3SG5A 2FCDA 1QASA 3OB1B 4C0KA 2ZFDA 4FTGA 4DS7A 1SCMB 4D1EA 1C3YA 3EVUA 1M46A 3D78A 4OVNF 2F3ZA 1QLKA 1F8HA 1YR5A 2KQYA 1RWYA 2ZRSA 3EVVA 1D1OA 3I5HC 1UHHA 1WLMA 2MJWB 5FI7A 2QPTA 4PHMA 3CZ0A 2BCBA 2KQ6A 2Q91A 2ERBA 1TRFA 3PN7C 2PASA 5G08A 2JPOA 1K90D 3D0YA 3DVKA 2MAZA 4I5JA 1TNQA 2NLNA 1E8AA 2A4JA 2KI6D 2LVIA 2JT3A 2OTGC 2KGRA 2M1KB 2FJUB 4INWA 4MLWA 2PMYA 1DJIA 2JTZA 5CSFA 5D3OA 1RECA 3NHIA 5AFPA 1K9UA 3PLFB 2LLUA 4YGDB 2EGDA 2I2RE 5HKYA 1DF0B 5AEQA 1XFXO 1QJTA 1Y1XA 1QATA 2AMIA 1ALVA 2OS8C 3NSIA 3B86A 4ORBB 1KK7Z 1TN4A 1SL7A 3LLEA 4PHNA 1X02A 4YBHB 1IWQA 1OOJA 2P70A 2BECA 4PE7A 5FI6A 3SJSA 5CSJA 1G8IA 2WC5A 2LNKA 3BUXB 3EKHA 1PALA 3OGNA 4BY5A 3I5IB 1CFDA 3BUWB 1WRZA 3GOFA 1GJYA 2JZIA 4PDZA 3SIAA 4C0LA 1SCVA 3EK4A 2BBNA 4MZKA 3KHEA 2EHBA 3B88A 2L2EA 1CFPA 2L5XB 2KHNA 1RFJA 2RGIA 3AKBA 2LUXA 3DVJA 4YI8A 1IH0A 1S6IA 2O5GA 4F0ZB 4NQGA 2L2CA 2KNEA 3DXLA 1FI6A 5J3XA 2Y4QA 3NXAA 3OX5A 4I5KA 1MF8B 2SASA 4MBEA 1QS7A 3CYZA 1QTXA 2KYCA 2QEOA 1YURA 2NXQA 1QWVA 4YI9A 1K9PA 4N5XA 2MRDA 4PALA 1OZOA 1XA5A 2JPTA 4HRHA 3VRRA 1CFFA 2BE6A 1LVCD 4JKTA 4GBAA 1T14A 5ER4X 4JPZB 2WOSA 1MUXA 1P28A 1LINA 1F71A 1GQMA 2JU0A 3KPXA 4OCIA 1CB1A 3IQQA 3D77A 1CLLA 2MHHA 2BNXA 2JT0A 1OQPA 2M97A 1J1DA 2KI6C 1IIOA 1YX8A 5JJGA 1LA0A 2O60A 1J7RA 3CLNA 2ZNDA 3L4LA 5CSNA 4MRYA 2WORA 3B7AA 5TNCA 1UWOA 1NSHA 1CM1A 3I5GC 1KCYA 1LKJA 1IG5A 1VRKA 2LUCA 1CLBA 1NX1A 3A8RA 1FI5A 3HX4A 2G2BA 1PRWA 1R6PA 2CXJA 4GUKA 2WCBA 3S0EA 3TDZA 1CFCA 1B7TZ 4CFQA 1DJXA 1YX7A 1CMFA 1KFUL 2QDIA 3D74A 4YRUA 4FQOA 2R2IA 5K89A 1JSAA 1DVIA 1RROA 2MBXA 4PHJA 1EG3A 4MZLA 1DMOA 5HKWA 1TNXA 1OMRA 2E30A 2H61A 1V1GA 3I5HB 1DJWA 2HPSA 3KEVA 2KBIA 1PULA 2DOQA 4M2OA 4QJ4B 3K21A 5IBWA 1S6CA 1YRTB 2MA2A 1CKKA 2IS9A 3PN7B 3TUYC 2WCJA 2F3YA 4XYNA 2F8PA 1S5GY 2OTGB 2KI4C 2NCPA 2JQ6A 1F54A 4XJKA 1M45A 2I18A 2KBMA 4QJ5B 3SG4A 2G9BA 4P2YB 2K7CA 1CDNA 3I5FC 4FQTA 3GK4X 4Q04A 1Q80A 4PE1A 4JWQA 3DF0B 4CPVA 5I2QA 3M0WA 4C0JA 5KTYA 1Y1UA 1J7PA 2K7BA 2LMVA 1JWDA 1CLMA 1KFXS 2V53A 2OS8B 4AQIA 1AJ4A 1XFRA 2LP3A 5FYXA 1ZUZA 2M8UA 1KSOA 1UHJA 2ISDA 1SYMA 4PE0A 1EL4A 2LCPA 2KDHA 4M2PA 2CCMA 3SG6A 1DJGA 4OZDA 1PSBA 2F2OA 2JWWA 3S0BA 1WDCC 1S3PA 3SG7A 2SCPA 1LS8A 3VRNA 4I5LB 2L98A 4GAOA 4A4BA 3S0FA 1YVHA 3C1VA 5B8IB 1KFUS 1RK9A 2KLEA 2KLDA 1BT6A 4U8DA 1SW8A 1NWDA 3BXKA 3L4AA 2PVBA 3NHTA 1JBAA 2F33A 3TZ1A 3CR5X 4OV2A 2JNXA 3VRQA 3PATA 1Y0VH 3D10A 4NDCA 1ALWA 1TUJA 4ICBA 1EH2A 1H4BA 1U5IA 4PHKA 1K95A 4DRWA 4F7FA 1BR1B 1A75B 3DVMA 4MRXA 4N1FA 4USLA 1J7OA 1K2HA 2E6WA 1TWOA 2ZN8A 1B9AA 1SBJA 2LVVA 4HSZA 5KU1A 1QIVA 3FE8A 4ETOA 3HCMA 1MHOA 1WRKA 2WC6A 3CWGA 1FBVA 1OZSA 3D76A 1IKUA
chains in the Genus database with same CATH topology
3CR2A 1DGUA 2LHIA 2LP2A 2TN4A 2OPOA 1KK8C 2ZRTA 3PFVA 1K93D 3TDIA 2JC2A 2L4IA 3OHMB 2M3WA 2LC5A 5HYDA 2CNPA 1UHIA 2BBMA 1DT7B 1S5GZ 4GNKB 3I5GB 1XFVO 2WCFA 3FIAA 1NPQA 1K8UA 1F4QA 3TDUA 2BE4A 5AERA 2KFGA 3PSRA 2GGZA 3O4YA 2BCAA 1JFJA 3EK8A 2KOTA 1A29A 4P5OE 1PVBA 2M1UA 3BYAA 4TNCA 2LM5A 1A4PA 1NIWA 3ZNIA 1V1FA 1YUTA 1ODBA 1QVIZ 2JTTA 3JTDC 1CTRA 2ZNEA 4GGNA 4MEWA 4PCWA 4HREE 3SG2A 1SL8A 3VROA 2COLB 3F45A 3RM1A 1JUOA 1NCYA 2JULA 3TUYB 2H2KA 5D69A 3SIBA 1FW4A 3VRPA 1NUBA 3BOWB 3TS5C 2KI4B 4GGFA 1PSRA 5CPVA 5AXIA 2AUCA 3BUNB 1MXLC 1MWNA 1UURA 3AKAA 1PK0D 3IQOA 5PALA 1S26D 1NCZA 1F4OA 1XO5A 1A2XA 3WHUB 1IGVA 4GFTA 1SPYA 2H61C 1NP8A 3DVEA 1C7WA 3I5FB 5ER5A 4OR9B 3AAKA 1KWOC 1CDMA 4ORCB 1XYDA 3A4UB 1IJ6A 1QLSA 2L51A 1ZOTB 1L2OC 1TNWA 1B47A 2M49B 1UUSA 1JC2A 1B8CA 1WY9A 4DCKA 3D0YB 3EK7A 2PALA 2LVKA 2LMUA 1W7IB 1J55A 1DF0A 1SRAA 2AAOA 3JVTC 3LCPC 1OSAA 4WRIA 4MN0A 2K7DA 1AJ5A 1WDCB 3MSEB 1G33A 1QV0A 1TCFA 1NX0A 3O2PA 2BKIB 4MVFA 1EJ3A 3EKJA 3RLZA 4N1GA 2JNFA 1IRJA 1ZACA 4ZCVA 2Q4UA 1KK7Y 2NCOA 1BLQA 5HKZA 3IF7A 1TTXA 3QRXA 3CR4X 1OMVA 3OX6A 5I2OA 1AP4A 2K0JA 1MQ1A 1YVLA 3BQ3A 1KQMC 2K7OA 3CTNA 1MXEA 5D7FA 1CNPA 2Y1NA 4CLNA 3NSKA 2KAXA 1OE9B 1L7ZA 1WRLA 1MR8A 2L0PA 1QX7A 2L4HA 3FWBA 2CTNA 2FCEA 2M29A 1K94A 4OKHA 4IL1A 1BODA 1CMGA 2LANA 4MSPA 1B4CA 1IQ3A 1QV1A 1DJZA 1S6JA 1BJFA 2GGMA 1IJ5A 1SL9A 1KK8B 1NCXA 1FF1A 3NSLA 1TOPA 1XK4A 2LLTA 1QX5B 4QJ3B 2KFFA 2JXLA 5BPJA 1CDPA 5JOLA 1R2UA 3GK2A 2QACA 3E3RA 1RTP1 2JRFA 2M7NA 2KYFA 3CGAA 2HQWA 2KFHA 1SR6C 1JF2A 1QXPA 1TCOB 2L50A 2KSPA 2Y5IA 2K2FA 3JTDB 1AUIB 1N2DA 1G4YR 2EC6C 1J1EA 1K9KA 3DD4A 3PALA 5KSZA 1FPWA 2BL0C 4YGCB 3ICBA 4AQJA 1SY9A 4JQ0D 1YTZC 2CT9A 3TS5B 1AK8A 3LK1A 4YGEB 1B7TY 2NZ0A 2LVJA 3CZTX 3LK0A 1N65A 4YGAA 4NDDA 3OP0A 5CSIA 1A03A 2GV5A 3ZWHA 3AAJA 2HQ8A 4ZCUA 1KWOB 2MLEC 1C7VA 2KAVA 5HLOA 1UHKA 1L2OB 1SCMC 1UHNA 1S1EA 1M31A 2Y1MA 1QX2A 4MZJA 1J7QA 1IQ5A 1SK6D 5GQQC 2K61A 2LAPA 1RJVA 1ZFSA 4GGFC 2BKHB 1F55A 3DF0A 1HQVA 4PE4A 4XJKB 1B8RA 5AANA 1C07A 3JVTB 2BCXA 2JXCA 5I2LA 1DTLA 4UPGA 1Y1AA 1YUUA 1HT9A 1DJHA 4ORAB 1M39A 2FOTA 4NDBA 4M2QA 3BUMB 1LXFC 1XFZO 1K96A 1NX2A 2HETA 3KO0A 1JF0A 3PM8A 5F6TA 1ZMZA 3O6BA 3EVRA 1KQVA 1CDLA 1TNPA 3NSOA 1GGWA 1W7JB 5HLVA 3WXAA 1DGVA 4CIDA 3CS1A 4DIRA 4YGBB 2F2PA 2WCEA 1KQMB 3WHTB 1BU3A 1XFYO 2I94A 1B8LA 4WQ2A 3OB2B 4R1EA 2KGBC 1DJYA 2M0RA 3O78A 2P6BB 3I5IC 1NYAA 1KFXL 1PVAA 3VGOA 2LHLA 5I8NA 3WNXB 2M7LA 1YRUB 1WLZA 4HRGA 4E68A 2PRUA 1A75A 1AVSA 2M9GA 2MLFC 1UP5A 2HF5A 2LE9B 1BF5A 1XFUO 1H8BA 1U5IB 2LLSA 1Y6WA 1B1GA 3H4SE 2PSRA 1AHRA 1BOCA 2JOJA 3FS7A 1M63B 3KF9A 1F70A 2LMTA 4CFRA 4BY4A 1OMDA 1SR6B 3FWCA 2LV7A 2K2AA 1XFWO 1NX3A 4AOMA 1KSMA 1XK4C 2JT8A 2EC6B 2ZKMX 3BUOB 5DKRA 1SNLA 4A4CA 1BR4B 1QIWA 2I7AA 1EXRA 1TIZA 2BL0B 2K8MB 2ZN9A 1XVJA 1BMOA 1CM4A 1GGZA 2WC8A 3SG3A 4L9MA 2CBLA 1JFKA 5DKNA 1N0YA 2KAYA 3GK1A 4DUQA 1SKTA 2D8NA 2B1UA 4GPLB 4I5NB 1LA3A 2VRGA 5DKQA 4WQ3A 1QVIY 2WNDA 1EG4A 1SMGA 3BOWA 3LL8B 1BG1A 1S36A 1YUSA 3SG5A 2FCDA 1QASA 3OB1B 4C0KA 2ZFDA 4FTGA 4DS7A 1SCMB 4D1EA 3EVUA 1M46A 4OVNF 2F3ZA 1QLKA 1F8HA 1YR5A 2KQYA 1RWYA 2ZRSA 3EVVA 1D1OA 3I5HC 1UHHA 1WLMA 2MJWB 2QPTA 4PHMA 2BCBA 2KQ6A 2Q91A 1TRFA 3PN7C 2PASA 5G08A 1K90D 3D0YA 3DVKA 2MAZA 4I5JA 1TNQA 2NLNA 1E8AA 2A4JA 2KI6D 2LVIA 2JT3A 2OTGC 2KGRA 2M1KB 2FJUB 4MLWA 2PMYA 1DJIA 2JTZA 5CSFA 1RECA 5AFPA 1K9UA 3PLFB 2LLUA 4YGDB 2EGDA 2I2RE 5HKYA 1DF0B 5AEQA 1XFXO 1QJTA 1Y1XA 1QATA 2AMIA 1ALVA 2OS8C 3NSIA 4ORBB 1KK7Z 1TN4A 1SL7A 3LLEA 4PHNA 1X02A 4YBHB 1IWQA 1OOJA 4PE7A 2BECA 3SJSA 5CSJA 1G8IA 3BUXB 2LNKA 3EKHA 1PALA 4BY5A 3I5IB 1CFDA 3BUWB 1WRZA 3GOFA 1GJYA 2JZIA 4PDZA 3SIAA 4C0LA 1SCVA 3EK4A 2BBNA 4MZKA 3KHEA 2EHBA 1CFPA 2L2EA 2L5XB 2KHNA 1RFJA 2RGIA 3AKBA 2LUXA 3DVJA 4YI8A 1IH0A 1S6IA 2O5GA 4F0ZB 4NQGA 2KNEA 1FI6A 5J3XA 2Y4QA 3NXAA 3OX5A 4I5KA 1MF8B 2SASA 4MBEA 1QS7A 1QTXA 2KYCA 1YURA 2NXQA 4YI9A 1K9PA 4N5XA 2MRDA 4PALA 1OZOA 1XA5A 2JPTA 4HRHA 3VRRA 1CFFA 2BE6A 1LVCD 4GBAA 5ER4X 4JPZB 2WOSA 1MUXA 1LINA 1F71A 1GQMA 2JU0A 3KPXA 4OCIA 1CB1A 3IQQA 1CLLA 2MHHA 2JT0A 1OQPA 2M97A 1J1DA 2KI6C 1YX8A 5JJGA 1LA0A 2O60A 1J7RA 3CLNA 2ZNDA 5CSNA 4MRYA 2WORA 5TNCA 1UWOA 1NSHA 1CM1A 3I5GC 1KCYA 1LKJA 1IG5A 1VRKA 2LUCA 1CLBA 1NX1A 3A8RA 1FI5A 3HX4A 2G2BA 1PRWA 1R6PA 2CXJA 4GUKA 2WCBA 3TDZA 1CFCA 1B7TZ 4CFQA 1DJXA 1YX7A 1CMFA 1KFUL 4YRUA 5K89A 1JSAA 4FQOA 2R2IA 1DVIA 1RROA 2MBXA 4PHJA 1EG3A 4MZLA 1DMOA 5HKWA 1TNXA 1OMRA 2E30A 2H61A 1V1GA 3I5HB 1DJWA 2HPSA 3KEVA 2KBIA 1PULA 2DOQA 4M2OA 4QJ4B 3K21A 5IBWA 1S6CA 1YRTB 2MA2A 1CKKA 2IS9A 3PN7B 3TUYC 4XYNA 2F3YA 2F8PA 1S5GY 2OTGB 2KI4C 2NCPA 2JQ6A 1F54A 4XJKA 1M45A 2I18A 2KBMA 4QJ5B 3SG4A 2G9BA 4P2YB 2K7CA 1CDNA 3I5FC 3GK4X 4Q04A 1Q80A 4PE1A 4JWQA 3DF0B 4CPVA 5I2QA 3M0WA 4C0JA 5KTYA 1Y1UA 1J7PA 2K7BA 2LMVA 1JWDA 1CLMA 1KFXS 2V53A 2OS8B 4AQIA 1AJ4A 2LP3A 5FYXA 1ZUZA 2M8UA 1KSOA 1UHJA 2ISDA 1SYMA 4PE0A 1EL4A 2LCPA 2KDHA 4M2PA 2CCMA 3SG6A 1DJGA 1PSBA 2F2OA 2JWWA 3SG7A 1WDCC 1S3PA 2SCPA 3VRNA 4I5LB 2L98A 4GAOA 4A4BA 1YVHA 3C1VA 5B8IB 1KFUS 1RK9A 1BT6A 4U8DA 1SW8A 1NWDA 3BXKA 2PVBA 2F33A 3TZ1A 3CR5X 4OV2A 2JNXA 3VRQA 3PATA 1Y0VH 3D10A 4NDCA 1ALWA 4ICBA 1EH2A 1H4BA 1U5IA 4PHKA 1K95A 4DRWA 1BR1B 1A75B 3DVMA 4MRXA 4N1FA 4USLA 1J7OA 1K2HA 2E6WA 2ZN8A 1B9AA 1SBJA 2LVVA 4HSZA 5KU1A 1QIVA 4ETOA 3HCMA 1MHOA 1WRKA 1JBAA 3CWGA 1FBVA 1OZSA 1IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR2 A;  1DGU A;  2LHI A;  2LP2 A;  2TN4 A;  2OPO A;  1KK8 C;  2ZRT A;  3PFV A;  1K93 D;  3TDI A;  2JC2 A;  2L4I A;  3OHM B;  2M3W A;  2LC5 A;  5HYD A;  2CNP A;  1UHI A;  2BBM A;  1DT7 B;  1S5G Z;  4GNK B;  3I5G B;  1XFV O;  2WCF A;  3FIA A;  1NPQ A;  1K8U A;  1F4Q A;  3TDU A;  2BE4 A;  5AER A;  2KFG A;  3PSR A;  2GGZ A;  3O4Y A;  2BCA A;  1JFJ A;  3EK8 A;  2KOT A;  1A29 A;  4P5O E;  1PVB A;  2M1U A;  3BYA A;  4TNC A;  2LM5 A;  1A4P A;  1NIW A;  3ZNI A;  1V1F A;  1YUT A;  1ODB A;  1QVI Z;  2JTT A;  3JTD C;  1CTR A;  2ZNE A;  4GGN A;  4MEW A;  4PCW A;  4HRE E;  3SG2 A;  1SL8 A;  3VRO A;  2COL B;  3F45 A;  3RM1 A;  1JUO A;  1NCY A;  2JUL A;  3TUY B;  2H2K A;  5D69 A;  3SIB A;  1FW4 A;  3VRP A;  1NUB A;  3BOW B;  3TS5 C;  2KI4 B;  4GGF A;  1PSR A;  5CPV A;  5AXI A;  2AUC A;  3BUN B;  1MXL C;  1MWN A;  1UUR A;  3AKA A;  1PK0 D;  3IQO A;  5PAL A;  1S26 D;  1NCZ A;  1F4O A;  1XO5 A;  1A2X A;  3WHU B;  1IGV A;  4GFT A;  1SPY A;  2H61 C;  1NP8 A;  3DVE A;  1C7W A;  3I5F B;  5ER5 A;  4OR9 B;  3AAK A;  1KWO C;  1CDM A;  4ORC B;  1XYD A;  3A4U B;  1IJ6 A;  1QLS A;  2L51 A;  1ZOT B;  1L2O C;  1TNW A;  1B47 A;  2M49 B;  1UUS A;  1JC2 A;  1B8C A;  1WY9 A;  4DCK A;  3D0Y B;  3EK7 A;  2PAL A;  2LVK A;  2LMU A;  1W7I B;  1J55 A;  1DF0 A;  1SRA A;  2AAO A;  3JVT C;  3LCP C;  1OSA A;  4WRI A;  4MN0 A;  2K7D A;  1AJ5 A;  1WDC B;  3MSE B;  1G33 A;  1QV0 A;  1TCF A;  1NX0 A;  3O2P A;  2BKI B;  4MVF A;  1EJ3 A;  3EKJ A;  3RLZ A;  4N1G A;  2JNF A;  1IRJ A;  1ZAC A;  4ZCV A;  2Q4U A;  1KK7 Y;  2NCO A;  1BLQ A;  5HKZ A;  3IF7 A;  1TTX A;  3QRX A;  3CR4 X;  1OMV A;  3OX6 A;  5I2O A;  1AP4 A;  2K0J A;  1MQ1 A;  1YVL A;  3BQ3 A;  1KQM C;  2K7O A;  3CTN A;  1MXE A;  5D7F A;  1CNP A;  2Y1N A;  4CLN A;  3NSK A;  2KAX A;  1OE9 B;  1L7Z A;  1WRL A;  1MR8 A;  2L0P A;  1QX7 A;  2L4H A;  3FWB A;  2CTN A;  2FCE A;  2M29 A;  1K94 A;  4OKH A;  4IL1 A;  1BOD A;  1CMG A;  2LAN A;  4MSP A;  1B4C A;  1IQ3 A;  1QV1 A;  1DJZ A;  1S6J A;  1BJF A;  2GGM A;  1IJ5 A;  1SL9 A;  1KK8 B;  1NCX A;  1FF1 A;  3NSL A;  1TOP A;  1XK4 A;  2LLT A;  1QX5 B;  4QJ3 B;  2KFF A;  2JXL A;  5BPJ A;  1CDP A;  5JOL A;  1R2U A;  3GK2 A;  2QAC A;  3E3R A;  1RTP 1;  2JRF A;  2M7N A;  2KYF A;  3CGA A;  2HQW A;  2KFH A;  1SR6 C;  1JF2 A;  1QXP A;  1TCO B;  2L50 A;  2KSP A;  2Y5I A;  2K2F A;  3JTD B;  1AUI B;  1N2D A;  1G4Y R;  2EC6 C;  1J1E A;  1K9K A;  3DD4 A;  3PAL A;  5KSZ A;  1FPW A;  2BL0 C;  4YGC B;  3ICB A;  4AQJ A;  1SY9 A;  4JQ0 D;  1YTZ C;  2CT9 A;  3TS5 B;  1AK8 A;  3LK1 A;  4YGE B;  1B7T Y;  2NZ0 A;  2LVJ A;  3CZT X;  3LK0 A;  1N65 A;  4YGA A;  4NDD A;  3OP0 A;  5CSI A;  1A03 A;  2GV5 A;  3ZWH A;  3AAJ A;  2HQ8 A;  4ZCU A;  1KWO B;  2MLE C;  1C7V A;  2KAV A;  5HLO A;  1UHK A;  1L2O B;  1SCM C;  1UHN A;  1S1E A;  1M31 A;  2Y1M A;  1QX2 A;  4MZJ A;  1J7Q A;  1IQ5 A;  1SK6 D;  5GQQ C;  2K61 A;  2LAP A;  1RJV A;  1ZFS A;  4GGF C;  2BKH B;  1F55 A;  3DF0 A;  1HQV A;  4PE4 A;  4XJK B;  1B8R A;  5AAN A;  1C07 A;  3JVT B;  2BCX A;  2JXC A;  5I2L A;  1DTL A;  4UPG A;  1Y1A A;  1YUU A;  1HT9 A;  1DJH A;  4ORA B;  1M39 A;  2FOT A;  4NDB A;  4M2Q A;  3BUM B;  1LXF C;  1XFZ O;  1K96 A;  1NX2 A;  2HET A;  3KO0 A;  1JF0 A;  3PM8 A;  5F6T A;  1ZMZ A;  3O6B A;  3EVR A;  1KQV A;  1CDL A;  1TNP A;  3NSO A;  1GGW A;  1W7J B;  5HLV A;  3WXA A;  1DGV A;  4CID A;  3CS1 A;  4DIR A;  4YGB B;  2F2P A;  2WCE A;  1KQM B;  3WHT B;  1BU3 A;  1XFY O;  2I94 A;  1B8L A;  4WQ2 A;  3OB2 B;  4R1E A;  2KGB C;  1DJY A;  2M0R A;  3O78 A;  2P6B B;  3I5I C;  1NYA A;  1KFX L;  1PVA A;  3VGO A;  2LHL A;  5I8N A;  3WNX B;  2M7L A;  1YRU B;  1WLZ A;  4HRG A;  4E68 A;  2PRU A;  1A75 A;  1AVS A;  2M9G A;  2MLF C;  1UP5 A;  2HF5 A;  2LE9 B;  1BF5 A;  1XFU O;  1H8B A;  1U5I B;  2LLS A;  1Y6W A;  1B1G A;  3H4S E;  2PSR A;  1AHR A;  1BOC A;  2JOJ A;  3FS7 A;  1M63 B;  3KF9 A;  1F70 A;  2LMT A;  4CFR A;  4BY4 A;  1OMD A;  1SR6 B;  3FWC A;  2LV7 A;  2K2A A;  1XFW O;  1NX3 A;  4AOM A;  1KSM A;  1XK4 C;  2JT8 A;  2EC6 B;  2ZKM X;  3BUO B;  5DKR A;  1SNL A;  4A4C A;  1BR4 B;  1QIW A;  2I7A A;  1EXR A;  1TIZ A;  2BL0 B;  2K8M B;  2ZN9 A;  1XVJ A;  1BMO A;  1CM4 A;  1GGZ A;  2WC8 A;  3SG3 A;  4L9M A;  2CBL A;  1JFK A;  5DKN A;  1N0Y A;  2KAY A;  3GK1 A;  4DUQ A;  1SKT A;  2D8N A;  2B1U A;  4GPL B;  4I5N B;  1LA3 A;  2VRG A;  5DKQ A;  4WQ3 A;  1QVI Y;  2WND A;  1EG4 A;  1SMG A;  3BOW A;  3LL8 B;  1BG1 A;  1S36 A;  1YUS A;  3SG5 A;  2FCD A;  1QAS A;  3OB1 B;  4C0K A;  2ZFD A;  4FTG A;  4DS7 A;  1SCM B;  4D1E A;  3EVU A;  1M46 A;  4OVN F;  2F3Z A;  1QLK A;  1F8H A;  1YR5 A;  2KQY A;  1RWY A;  2ZRS A;  3EVV A;  1D1O A;  3I5H C;  1UHH A;  1WLM A;  2MJW B;  2QPT A;  4PHM A;  2BCB A;  2KQ6 A;  2Q91 A;  1TRF A;  3PN7 C;  2PAS A;  5G08 A;  1K90 D;  3D0Y A;  3DVK A;  2MAZ A;  4I5J A;  1TNQ A;  2NLN A;  1E8A A;  2A4J A;  2KI6 D;  2LVI A;  2JT3 A;  2OTG C;  2KGR A;  2M1K B;  2FJU B;  4MLW A;  2PMY A;  1DJI A;  2JTZ A;  5CSF A;  1REC A;  5AFP A;  1K9U A;  3PLF B;  2LLU A;  4YGD B;  2EGD A;  2I2R E;  5HKY A;  1DF0 B;  5AEQ A;  1XFX O;  1QJT A;  1Y1X A;  1QAT A;  2AMI A;  1ALV A;  2OS8 C;  3NSI A;  4ORB B;  1KK7 Z;  1TN4 A;  1SL7 A;  3LLE A;  4PHN A;  1X02 A;  4YBH B;  1IWQ A;  1OOJ A;  4PE7 A;  2BEC A;  3SJS A;  5CSJ A;  1G8I A;  3BUX B;  2LNK A;  3EKH A;  1PAL A;  4BY5 A;  3I5I B;  1CFD A;  3BUW B;  1WRZ A;  3GOF A;  1GJY A;  2JZI A;  4PDZ A;  3SIA A;  4C0L A;  1SCV A;  3EK4 A;  2BBN A;  4MZK A;  3KHE A;  2EHB A;  1CFP A;  2L2E A;  2L5X B;  2KHN A;  1RFJ A;  2RGI A;  3AKB A;  2LUX A;  3DVJ A;  4YI8 A;  1IH0 A;  1S6I A;  2O5G A;  4F0Z B;  4NQG A;  2KNE A;  1FI6 A;  5J3X A;  2Y4Q A;  3NXA A;  3OX5 A;  4I5K A;  1MF8 B;  2SAS A;  4MBE A;  1QS7 A;  1QTX A;  2KYC A;  1YUR A;  2NXQ A;  4YI9 A;  1K9P A;  4N5X A;  2MRD A;  4PAL A;  1OZO A;  1XA5 A;  2JPT A;  4HRH A;  3VRR A;  1CFF A;  2BE6 A;  1LVC D;  4GBA A;  5ER4 X;  4JPZ B;  2WOS A;  1MUX A;  1LIN A;  1F71 A;  1GQM A;  2JU0 A;  3KPX A;  4OCI A;  1CB1 A;  3IQQ A;  1CLL A;  2MHH A;  2JT0 A;  1OQP A;  2M97 A;  1J1D A;  2KI6 C;  1YX8 A;  5JJG A;  1LA0 A;  2O60 A;  1J7R A;  3CLN A;  2ZND A;  5CSN A;  4MRY A;  2WOR A;  5TNC A;  1UWO A;  1NSH A;  1CM1 A;  3I5G C;  1KCY A;  1LKJ A;  1IG5 A;  1VRK A;  2LUC A;  1CLB A;  1NX1 A;  3A8R A;  1FI5 A;  3HX4 A;  2G2B A;  1PRW A;  1R6P A;  2CXJ A;  4GUK A;  2WCB A;  3TDZ A;  1CFC A;  1B7T Z;  4CFQ A;  1DJX A;  1YX7 A;  1CMF A;  1KFU L;  4YRU A;  5K89 A;  1JSA A;  4FQO A;  2R2I A;  1DVI A;  1RRO A;  2MBX A;  4PHJ A;  1EG3 A;  4MZL A;  1DMO A;  5HKW A;  1TNX A;  1OMR A;  2E30 A;  2H61 A;  1V1G A;  3I5H B;  1DJW A;  2HPS A;  3KEV A;  2KBI A;  1PUL A;  2DOQ A;  4M2O A;  4QJ4 B;  3K21 A;  5IBW A;  1S6C A;  1YRT B;  2MA2 A;  1CKK A;  2IS9 A;  3PN7 B;  3TUY C;  4XYN A;  2F3Y A;  2F8P A;  1S5G Y;  2OTG B;  2KI4 C;  2NCP A;  2JQ6 A;  1F54 A;  4XJK A;  1M45 A;  2I18 A;  2KBM A;  4QJ5 B;  3SG4 A;  2G9B A;  4P2Y B;  2K7C A;  1CDN A;  3I5F C;  3GK4 X;  4Q04 A;  1Q80 A;  4PE1 A;  4JWQ A;  3DF0 B;  4CPV A;  5I2Q A;  3M0W A;  4C0J A;  5KTY A;  1Y1U A;  1J7P A;  2K7B A;  2LMV A;  1JWD A;  1CLM A;  1KFX S;  2V53 A;  2OS8 B;  4AQI A;  1AJ4 A;  2LP3 A;  5FYX A;  1ZUZ A;  2M8U A;  1KSO A;  1UHJ A;  2ISD A;  1SYM A;  4PE0 A;  1EL4 A;  2LCP A;  2KDH A;  4M2P A;  2CCM A;  3SG6 A;  1DJG A;  1PSB A;  2F2O A;  2JWW A;  3SG7 A;  1WDC C;  1S3P A;  2SCP A;  3VRN A;  4I5L B;  2L98 A;  4GAO A;  4A4B A;  1YVH A;  3C1V A;  5B8I B;  1KFU S;  1RK9 A;  1BT6 A;  4U8D A;  1SW8 A;  1NWD A;  3BXK A;  2PVB A;  2F33 A;  3TZ1 A;  3CR5 X;  4OV2 A;  2JNX A;  3VRQ A;  3PAT A;  1Y0V H;  3D10 A;  4NDC A;  1ALW A;  4ICB A;  1EH2 A;  1H4B A;  1U5I A;  4PHK A;  1K95 A;  4DRW A;  1BR1 B;  1A75 B;  3DVM A;  4MRX A;  4N1F A;  4USL A;  1J7O A;  1K2H A;  2E6W A;  2ZN8 A;  1B9A A;  1SBJ A;  2LVV A;  4HSZ A;  5KU1 A;  1QIV A;  4ETO A;  3HCM A;  1MHO A;  1WRK A;  1JBA A;  3CWG A;  1FBV A;  1OZS A;  1IKU A; 
#chains in the Genus database with same CATH topology
 3CR2 A;  1DGU A;  2L5Y A;  2LHI A;  2LP2 A;  2TN4 A;  2OPO A;  1KK8 C;  2ZRT A;  3PFV A;  1K93 D;  3TDI A;  2JC2 A;  2L4I A;  3OHM B;  2M3W A;  2LC5 A;  5HYD A;  2CNP A;  1UHI A;  2BBM A;  1DT7 B;  1S5G Z;  3FE6 A;  2WCK A;  4GNK B;  1C3Z A;  1Z2C B;  3I5G B;  1XFV O;  2WCF A;  3FIA A;  1Z4H A;  1NPQ A;  1K8U A;  1F4Q A;  3TDU A;  2BE4 A;  5AER A;  2KFG A;  3PSR A;  2GGZ A;  3O4Y A;  2BCA A;  1JFJ A;  3EK8 A;  2KOT A;  1A29 A;  4P5O E;  1PVB A;  2M1U A;  3BYA A;  4TNC A;  2LM5 A;  1A4P A;  1NIW A;  4INX A;  1V1F A;  1YUT A;  2WCL A;  3ZNI A;  1ODB A;  3SS5 A;  1QVI Z;  1OOG A;  2JTT A;  3JTD C;  1CTR A;  2ZNE A;  3NGV A;  4GGN A;  4MEW A;  4HRE E;  4PCW A;  3SG2 A;  1SL8 A;  3VRO A;  2COL B;  2QEB A;  3F45 A;  3RM1 A;  1DEL A;  1JUO A;  1NCY A;  3BFA A;  2JUL A;  3TUY B;  2H2K A;  3IVT A;  5D69 A;  3SIB A;  1FW4 A;  3VRP A;  1NUB A;  3BOW B;  3TS5 C;  2KI4 B;  4GGF A;  3UNW A;  1PSR A;  5CPV A;  5AXI A;  3UO9 A;  2AUC A;  3BUN B;  1MXL C;  1MWN A;  1UUR A;  3AKA A;  1PK0 D;  3IQO A;  5PAL A;  1S26 D;  1NCZ A;  1ORG A;  1F4O A;  1XO5 A;  1TUZ A;  1A2X A;  3WHU B;  1IGV A;  4GFT A;  1SPY A;  2H61 C;  1NP8 A;  3DVE A;  1C7W A;  3I5F B;  5ER5 A;  4OR9 B;  3AAK A;  1KWO C;  1CDM A;  2QEV A;  1XYD A;  3A4U B;  4ORC B;  1IJ6 A;  1QLS A;  2L51 A;  3R1V A;  1ZOT B;  1L2O C;  1TNW A;  1B47 A;  2M49 B;  3B87 A;  1UUS A;  1JC2 A;  1B8C A;  1WY9 A;  4DCK A;  3D0Y B;  3CZ2 A;  3EK7 A;  2PAL A;  2LVK A;  2LMU A;  1SSE B;  1W7I B;  2K60 A;  1J55 A;  1DF0 A;  1SRA A;  2AAO A;  3JVT C;  3LCP C;  1OSA A;  3SS4 A;  4WRI A;  4MN0 A;  2K7D A;  1WDC B;  1AJ5 A;  3MSE B;  1G33 A;  1QV0 A;  1TCF A;  1NX0 A;  3O2P A;  2BKI B;  4MVF A;  1EJ3 A;  3EKJ A;  3R1O A;  3RLZ A;  4N1G A;  1GM0 A;  2JNF A;  1IRJ A;  1ZAC A;  4ZCV A;  2Q4U A;  1KK7 Y;  2NCO A;  4KYN A;  5HKZ A;  3IF7 A;  1BLQ A;  1TTX A;  3QRX A;  3CR4 X;  1OMV A;  3EG5 B;  3OX6 A;  5I2O A;  1AP4 A;  2K0J A;  1MQ1 A;  1YVL A;  3BQ3 A;  1KQM C;  3FE9 A;  2K7O A;  3PJI A;  3CTN A;  1MXE A;  5D7F A;  1CNP A;  2Y1N A;  4CLN A;  3NSK A;  2KAX A;  1OE9 B;  1L7Z A;  2KPH A;  1WRL A;  1MR8 A;  2QEH A;  2L0P A;  1QX7 A;  2L4H A;  3FWB A;  2CTN A;  2FCE A;  2M29 A;  1K94 A;  4OKH A;  1OOI X;  3R72 A;  4IL1 A;  1BOD A;  3L47 A;  1CMG A;  2LAN A;  4MSP A;  1B4C A;  1IQ3 A;  1QV1 A;  1DJZ A;  1S6J A;  1BJF A;  2GGM A;  1IJ5 A;  1SL9 A;  1KK8 B;  1NCX A;  1FF1 A;  3NSL A;  4PT1 A;  1DC1 A;  1TOP A;  1XK4 A;  2LLT A;  2YGU A;  1QX5 B;  4QJ3 B;  2KFF A;  2JXL A;  5BPJ A;  1CDP A;  5JOL A;  1R2U A;  3GK2 A;  2QAC A;  3E3R A;  1RTP 1;  2JRF A;  2M7N A;  2KYF A;  3PM2 A;  3CGA A;  2HQW A;  3D75 A;  2KFH A;  1SR6 C;  1JF2 A;  1QXP A;  1TCO B;  3BJH A;  2L50 A;  2KSP A;  2Y5I A;  2K2F A;  3D73 A;  3JTD B;  1AUI B;  5I94 A;  2GTE A;  1N2D A;  1G4Y R;  2EC6 C;  1J1E A;  1K9K A;  3DD4 A;  3PAL A;  5KSZ A;  2PYQ A;  1FPW A;  2BL0 C;  4YGC B;  3ICB A;  4AQJ A;  1SY9 A;  4JQ0 D;  1YTZ C;  2CT9 A;  3S0D A;  3TS5 B;  1AK8 A;  3LK1 A;  4YGE B;  1B7T Y;  2NZ0 A;  2LVJ A;  3CZT X;  3LK0 A;  1N65 A;  3BFB A;  4YGA A;  5FI2 A;  2H8V A;  4NDD A;  3OP0 A;  5CSI A;  1A03 A;  2GV5 A;  3ZWH A;  3AAJ A;  2HQ8 A;  2WCH A;  4ZCU A;  1KWO B;  2MLE C;  1C7V A;  3CDN A;  2KAV A;  5HLO A;  1UHK A;  1L2O B;  1SCM C;  2WCM A;  2PQL A;  1UHN A;  3N7H A;  1S1E A;  1M31 A;  2Y1M A;  1QX2 A;  5EL2 A;  4MZJ A;  1J7Q A;  1IQ5 A;  1SK6 D;  5GQQ C;  2K61 A;  2LAP A;  1RJV A;  1ZFS A;  3QME A;  4GGF C;  2BKH B;  1F55 A;  3DF0 A;  1HQV A;  4PE4 A;  1DEK A;  4XJK B;  1B8R A;  5AAN A;  1C07 A;  2P71 A;  3JVT B;  2BCX A;  2JXC A;  5I2L A;  1DTL A;  3VB1 A;  1OOF A;  1Y1A A;  3SS3 A;  1YUU A;  1HT9 A;  3DY9 A;  1DJH A;  4ORA B;  1M39 A;  2FOT A;  4NDB A;  4M2Q A;  3RZS A;  3BUM B;  1LXF C;  1XFZ O;  1W9Z A;  1K96 A;  1NX2 A;  2HET A;  3KO0 A;  1JF0 A;  3PM8 A;  5F6T A;  1ZMZ A;  3O6B A;  3EVR A;  1KQV A;  1CDL A;  1TNP A;  3NSO A;  1GGW A;  1W7J B;  5HLV A;  3WXA A;  1DGV A;  4CID A;  3Q8I A;  3CS1 A;  4DIR A;  4YGB B;  2F2P A;  2WCE A;  1KQM B;  3WHT B;  2FJY A;  1BU3 A;  1XFY O;  2I94 A;  3OBV A;  1B8L A;  4WQ2 A;  3DYE A;  3OB2 B;  4R1E A;  2KGB C;  1DJY A;  2M0R A;  3DZT A;  3O78 A;  5HL1 A;  2P6B B;  3I5I C;  1NYA A;  2BAP A;  1KFX L;  1PVA A;  3B6X A;  3VGO A;  4UPG A;  3R1P A;  2LHL A;  4IJ7 A;  5I8N A;  3WNX B;  2M7L A;  1YRU B;  1WLZ A;  4HRG A;  4E68 A;  2PRU A;  1A75 A;  1AVS A;  2M9G A;  3BFH A;  4JD9 A;  2MLF C;  1UP5 A;  2HF5 A;  2LE9 B;  1BF5 A;  1DQE A;  1XFU O;  1H8B A;  1U5I B;  2LLS A;  3V2L A;  3S0A A;  1Y6W A;  1B1G A;  3H4S E;  3O4X A;  2PSR A;  3S0G A;  1AHR A;  3CZ1 A;  1BOC A;  2JOJ A;  3FS7 A;  1M63 B;  3KF9 A;  1F70 A;  2LMT A;  4CFR A;  4BY4 A;  1OMD A;  1OOH A;  1SR6 B;  3FWC A;  2LV7 A;  2K2A A;  1XFW O;  1NX3 A;  4AOM A;  1KSM A;  1XK4 C;  2JT8 A;  2EC6 B;  2ZKM X;  3BUO B;  5DKR A;  1SNL A;  4A4C A;  1BR4 B;  1QIW A;  2I7A A;  1EXR A;  1TIZ A;  2BL0 B;  2K8M B;  2ZN9 A;  1XVJ A;  1BMO A;  1CM4 A;  1GGZ A;  2WC8 A;  5DIC A;  3SG3 A;  4L9M A;  2CBL A;  1JFK A;  5DKN A;  1N0Y A;  1OW4 A;  2KAY A;  3GK1 A;  4DUQ A;  1SKT A;  2D8N A;  2B1U A;  4GPL B;  4I5N B;  1LA3 A;  2VRG A;  5DKQ A;  4WQ3 A;  3CAB A;  1QVI Y;  2WND A;  3K1E A;  1EG4 A;  1SMG A;  3BOW A;  3LL8 B;  1BG1 A;  1S36 A;  1YUS A;  3SG5 A;  2FCD A;  1QAS A;  3OB1 B;  4C0K A;  2ZFD A;  4FTG A;  4DS7 A;  1SCM B;  4D1E A;  1C3Y A;  3EVU A;  1M46 A;  3D78 A;  4OVN F;  2F3Z A;  1QLK A;  1F8H A;  1YR5 A;  2KQY A;  1RWY A;  2ZRS A;  3EVV A;  1D1O A;  3I5H C;  1UHH A;  1WLM A;  2MJW B;  5FI7 A;  2QPT A;  4PHM A;  3CZ0 A;  2BCB A;  2KQ6 A;  2Q91 A;  2ERB A;  1TRF A;  3PN7 C;  2PAS A;  5G08 A;  2JPO A;  1K90 D;  3D0Y A;  3DVK A;  2MAZ A;  4I5J A;  1TNQ A;  2NLN A;  1E8A A;  2A4J A;  2KI6 D;  2LVI A;  2JT3 A;  2OTG C;  2KGR A;  2M1K B;  2FJU B;  4INW A;  4MLW A;  2PMY A;  1DJI A;  2JTZ A;  5CSF A;  5D3O A;  1REC A;  3NHI A;  5AFP A;  1K9U A;  3PLF B;  2LLU A;  4YGD B;  2EGD A;  2I2R E;  5HKY A;  1DF0 B;  5AEQ A;  1XFX O;  1QJT A;  1Y1X A;  1QAT A;  2AMI A;  1ALV A;  2OS8 C;  3NSI A;  3B86 A;  4ORB B;  1KK7 Z;  1TN4 A;  1SL7 A;  3LLE A;  4PHN A;  1X02 A;  4YBH B;  1IWQ A;  1OOJ A;  2P70 A;  2BEC A;  4PE7 A;  5FI6 A;  3SJS A;  5CSJ A;  1G8I A;  2WC5 A;  2LNK A;  3BUX B;  3EKH A;  1PAL A;  3OGN A;  4BY5 A;  3I5I B;  1CFD A;  3BUW B;  1WRZ A;  3GOF A;  1GJY A;  2JZI A;  4PDZ A;  3SIA A;  4C0L A;  1SCV A;  3EK4 A;  2BBN A;  4MZK A;  3KHE A;  2EHB A;  3B88 A;  2L2E A;  1CFP A;  2L5X B;  2KHN A;  1RFJ A;  2RGI A;  3AKB A;  2LUX A;  3DVJ A;  4YI8 A;  1IH0 A;  1S6I A;  2O5G A;  4F0Z B;  4NQG A;  2L2C A;  2KNE A;  3DXL A;  1FI6 A;  5J3X A;  2Y4Q A;  3NXA A;  3OX5 A;  4I5K A;  1MF8 B;  2SAS A;  4MBE A;  1QS7 A;  3CYZ A;  1QTX A;  2KYC A;  2QEO A;  1YUR A;  2NXQ A;  1QWV A;  4YI9 A;  1K9P A;  4N5X A;  2MRD A;  4PAL A;  1OZO A;  1XA5 A;  2JPT A;  4HRH A;  3VRR A;  1CFF A;  2BE6 A;  1LVC D;  4JKT A;  4GBA A;  1T14 A;  5ER4 X;  4JPZ B;  2WOS A;  1MUX A;  1P28 A;  1LIN A;  1F71 A;  1GQM A;  2JU0 A;  3KPX A;  4OCI A;  1CB1 A;  3IQQ A;  3D77 A;  1CLL A;  2MHH A;  2BNX A;  2JT0 A;  1OQP A;  2M97 A;  1J1D A;  2KI6 C;  1IIO A;  1YX8 A;  5JJG A;  1LA0 A;  2O60 A;  1J7R A;  3CLN A;  2ZND A;  3L4L A;  5CSN A;  4MRY A;  2WOR A;  3B7A A;  5TNC A;  1UWO A;  1NSH A;  1CM1 A;  3I5G C;  1KCY A;  1LKJ A;  1IG5 A;  1VRK A;  2LUC A;  1CLB A;  1NX1 A;  3A8R A;  1FI5 A;  3HX4 A;  2G2B A;  1PRW A;  1R6P A;  2CXJ A;  4GUK A;  2WCB A;  3S0E A;  3TDZ A;  1CFC A;  1B7T Z;  4CFQ A;  1DJX A;  1YX7 A;  1CMF A;  1KFU L;  2QDI A;  3D74 A;  4YRU A;  4FQO A;  2R2I A;  5K89 A;  1JSA A;  1DVI A;  1RRO A;  2MBX A;  4PHJ A;  1EG3 A;  4MZL A;  1DMO A;  5HKW A;  1TNX A;  1OMR A;  2E30 A;  2H61 A;  1V1G A;  3I5H B;  1DJW A;  2HPS A;  3KEV A;  2KBI A;  1PUL A;  2DOQ A;  4M2O A;  4QJ4 B;  3K21 A;  5IBW A;  1S6C A;  1YRT B;  2MA2 A;  1CKK A;  2IS9 A;  3PN7 B;  3TUY C;  2WCJ A;  2F3Y A;  4XYN A;  2F8P A;  1S5G Y;  2OTG B;  2KI4 C;  2NCP A;  2JQ6 A;  1F54 A;  4XJK A;  1M45 A;  2I18 A;  2KBM A;  4QJ5 B;  3SG4 A;  2G9B A;  4P2Y B;  2K7C A;  1CDN A;  3I5F C;  4FQT A;  3GK4 X;  4Q04 A;  1Q80 A;  4PE1 A;  4JWQ A;  3DF0 B;  4CPV A;  5I2Q A;  3M0W A;  4C0J A;  5KTY A;  1Y1U A;  1J7P A;  2K7B A;  2LMV A;  1JWD A;  1CLM A;  1KFX S;  2V53 A;  2OS8 B;  4AQI A;  1AJ4 A;  1XFR A;  2LP3 A;  5FYX A;  1ZUZ A;  2M8U A;  1KSO A;  1UHJ A;  2ISD A;  1SYM A;  4PE0 A;  1EL4 A;  2LCP A;  2KDH A;  4M2P A;  2CCM A;  3SG6 A;  1DJG A;  4OZD A;  1PSB A;  2F2O A;  2JWW A;  3S0B A;  1WDC C;  1S3P A;  3SG7 A;  2SCP A;  1LS8 A;  3VRN A;  4I5L B;  2L98 A;  4GAO A;  4A4B A;  3S0F A;  1YVH A;  3C1V A;  5B8I B;  1KFU S;  1RK9 A;  2KLE A;  2KLD A;  1BT6 A;  4U8D A;  1SW8 A;  1NWD A;  3BXK A;  3L4A A;  2PVB A;  3NHT A;  1JBA A;  2F33 A;  3TZ1 A;  3CR5 X;  4OV2 A;  2JNX A;  3VRQ A;  3PAT A;  1Y0V H;  3D10 A;  4NDC A;  1ALW A;  1TUJ A;  4ICB A;  1EH2 A;  1H4B A;  1U5I A;  4PHK A;  1K95 A;  4DRW A;  4F7F A;  1BR1 B;  1A75 B;  3DVM A;  4MRX A;  4N1F A;  4USL A;  1J7O A;  1K2H A;  2E6W A;  1TWO A;  2ZN8 A;  1B9A A;  1SBJ A;  2LVV A;  4HSZ A;  5KU1 A;  1QIV A;  3FE8 A;  4ETO A;  3HCM A;  1MHO A;  1WRK A;  2WC6 A;  3CWG A;  1FBV A;  1OZS A;  3D76 A;  1IKU A; 
#chains in the Genus database with same CATH homology
 3CR2 A;  1DGU A;  2LHI A;  2LP2 A;  2TN4 A;  2OPO A;  1KK8 C;  2ZRT A;  3PFV A;  1K93 D;  3TDI A;  2JC2 A;  2L4I A;  3OHM B;  2M3W A;  2LC5 A;  5HYD A;  2CNP A;  1UHI A;  2BBM A;  1DT7 B;  1S5G Z;  4GNK B;  3I5G B;  1XFV O;  2WCF A;  3FIA A;  1NPQ A;  1K8U A;  1F4Q A;  3TDU A;  2BE4 A;  5AER A;  2KFG A;  3PSR A;  2GGZ A;  3O4Y A;  2BCA A;  1JFJ A;  3EK8 A;  2KOT A;  1A29 A;  4P5O E;  1PVB A;  2M1U A;  3BYA A;  4TNC A;  2LM5 A;  1A4P A;  1NIW A;  3ZNI A;  1V1F A;  1YUT A;  1ODB A;  1QVI Z;  2JTT A;  3JTD C;  1CTR A;  2ZNE A;  4GGN A;  4MEW A;  4PCW A;  4HRE E;  3SG2 A;  1SL8 A;  3VRO A;  2COL B;  3F45 A;  3RM1 A;  1JUO A;  1NCY A;  2JUL A;  3TUY B;  2H2K A;  5D69 A;  3SIB A;  1FW4 A;  3VRP A;  1NUB A;  3BOW B;  3TS5 C;  2KI4 B;  4GGF A;  1PSR A;  5CPV A;  5AXI A;  2AUC A;  3BUN B;  1MXL C;  1MWN A;  1UUR A;  3AKA A;  1PK0 D;  3IQO A;  5PAL A;  1S26 D;  1NCZ A;  1F4O A;  1XO5 A;  1A2X A;  3WHU B;  1IGV A;  4GFT A;  1SPY A;  2H61 C;  1NP8 A;  3DVE A;  1C7W A;  3I5F B;  5ER5 A;  4OR9 B;  3AAK A;  1KWO C;  1CDM A;  4ORC B;  1XYD A;  3A4U B;  1IJ6 A;  1QLS A;  2L51 A;  1ZOT B;  1L2O C;  1TNW A;  1B47 A;  2M49 B;  1UUS A;  1JC2 A;  1B8C A;  1WY9 A;  4DCK A;  3D0Y B;  3EK7 A;  2PAL A;  2LVK A;  2LMU A;  1W7I B;  1J55 A;  1DF0 A;  1SRA A;  2AAO A;  3JVT C;  3LCP C;  1OSA A;  4WRI A;  4MN0 A;  2K7D A;  1AJ5 A;  1WDC B;  3MSE B;  1G33 A;  1QV0 A;  1TCF A;  1NX0 A;  3O2P A;  2BKI B;  4MVF A;  1EJ3 A;  3EKJ A;  3RLZ A;  4N1G A;  2JNF A;  1IRJ A;  1ZAC A;  4ZCV A;  2Q4U A;  1KK7 Y;  2NCO A;  1BLQ A;  5HKZ A;  3IF7 A;  1TTX A;  3QRX A;  3CR4 X;  1OMV A;  3OX6 A;  5I2O A;  1AP4 A;  2K0J A;  1MQ1 A;  1YVL A;  3BQ3 A;  1KQM C;  2K7O A;  3CTN A;  1MXE A;  5D7F A;  1CNP A;  2Y1N A;  4CLN A;  3NSK A;  2KAX A;  1OE9 B;  1L7Z A;  1WRL A;  1MR8 A;  2L0P A;  1QX7 A;  2L4H A;  3FWB A;  2CTN A;  2FCE A;  2M29 A;  1K94 A;  4OKH A;  4IL1 A;  1BOD A;  1CMG A;  2LAN A;  4MSP A;  1B4C A;  1IQ3 A;  1QV1 A;  1DJZ A;  1S6J A;  1BJF A;  2GGM A;  1IJ5 A;  1SL9 A;  1KK8 B;  1NCX A;  1FF1 A;  3NSL A;  1TOP A;  1XK4 A;  2LLT A;  1QX5 B;  4QJ3 B;  2KFF A;  2JXL A;  5BPJ A;  1CDP A;  5JOL A;  1R2U A;  3GK2 A;  2QAC A;  3E3R A;  1RTP 1;  2JRF A;  2M7N A;  2KYF A;  3CGA A;  2HQW A;  2KFH A;  1SR6 C;  1JF2 A;  1QXP A;  1TCO B;  2L50 A;  2KSP A;  2Y5I A;  2K2F A;  3JTD B;  1AUI B;  1N2D A;  1G4Y R;  2EC6 C;  1J1E A;  1K9K A;  3DD4 A;  3PAL A;  5KSZ A;  1FPW A;  2BL0 C;  4YGC B;  3ICB A;  4AQJ A;  1SY9 A;  4JQ0 D;  1YTZ C;  2CT9 A;  3TS5 B;  1AK8 A;  3LK1 A;  4YGE B;  1B7T Y;  2NZ0 A;  2LVJ A;  3CZT X;  3LK0 A;  1N65 A;  4YGA A;  4NDD A;  3OP0 A;  5CSI A;  1A03 A;  2GV5 A;  3ZWH A;  3AAJ A;  2HQ8 A;  4ZCU A;  1KWO B;  2MLE C;  1C7V A;  2KAV A;  5HLO A;  1UHK A;  1L2O B;  1SCM C;  1UHN A;  1S1E A;  1M31 A;  2Y1M A;  1QX2 A;  4MZJ A;  1J7Q A;  1IQ5 A;  1SK6 D;  5GQQ C;  2K61 A;  2LAP A;  1RJV A;  1ZFS A;  4GGF C;  2BKH B;  1F55 A;  3DF0 A;  1HQV A;  4PE4 A;  4XJK B;  1B8R A;  5AAN A;  1C07 A;  3JVT B;  2BCX A;  2JXC A;  5I2L A;  1DTL A;  4UPG A;  1Y1A A;  1YUU A;  1HT9 A;  1DJH A;  4ORA B;  1M39 A;  2FOT A;  4NDB A;  4M2Q A;  3BUM B;  1LXF C;  1XFZ O;  1K96 A;  1NX2 A;  2HET A;  3KO0 A;  1JF0 A;  3PM8 A;  5F6T A;  1ZMZ A;  3O6B A;  3EVR A;  1KQV A;  1CDL A;  1TNP A;  3NSO A;  1GGW A;  1W7J B;  5HLV A;  3WXA A;  1DGV A;  4CID A;  3CS1 A;  4DIR A;  4YGB B;  2F2P A;  2WCE A;  1KQM B;  3WHT B;  1BU3 A;  1XFY O;  2I94 A;  1B8L A;  4WQ2 A;  3OB2 B;  4R1E A;  2KGB C;  1DJY A;  2M0R A;  3O78 A;  2P6B B;  3I5I C;  1NYA A;  1KFX L;  1PVA A;  3VGO A;  2LHL A;  5I8N A;  3WNX B;  2M7L A;  1YRU B;  1WLZ A;  4HRG A;  4E68 A;  2PRU A;  1A75 A;  1AVS A;  2M9G A;  2MLF C;  1UP5 A;  2HF5 A;  2LE9 B;  1BF5 A;  1XFU O;  1H8B A;  1U5I B;  2LLS A;  1Y6W A;  1B1G A;  3H4S E;  2PSR A;  1AHR A;  1BOC A;  2JOJ A;  3FS7 A;  1M63 B;  3KF9 A;  1F70 A;  2LMT A;  4CFR A;  4BY4 A;  1OMD A;  1SR6 B;  3FWC A;  2LV7 A;  2K2A A;  1XFW O;  1NX3 A;  4AOM A;  1KSM A;  1XK4 C;  2JT8 A;  2EC6 B;  2ZKM X;  3BUO B;  5DKR A;  1SNL A;  4A4C A;  1BR4 B;  1QIW A;  2I7A A;  1EXR A;  1TIZ A;  2BL0 B;  2K8M B;  2ZN9 A;  1XVJ A;  1BMO A;  1CM4 A;  1GGZ A;  2WC8 A;  3SG3 A;  4L9M A;  2CBL A;  1JFK A;  5DKN A;  1N0Y A;  2KAY A;  3GK1 A;  4DUQ A;  1SKT A;  2D8N A;  2B1U A;  4GPL B;  4I5N B;  1LA3 A;  2VRG A;  5DKQ A;  4WQ3 A;  1QVI Y;  2WND A;  1EG4 A;  1SMG A;  3BOW A;  3LL8 B;  1BG1 A;  1S36 A;  1YUS A;  3SG5 A;  2FCD A;  1QAS A;  3OB1 B;  4C0K A;  2ZFD A;  4FTG A;  4DS7 A;  1SCM B;  4D1E A;  3EVU A;  1M46 A;  4OVN F;  2F3Z A;  1QLK A;  1F8H A;  1YR5 A;  2KQY A;  1RWY A;  2ZRS A;  3EVV A;  1D1O A;  3I5H C;  1UHH A;  1WLM A;  2MJW B;  2QPT A;  4PHM A;  2BCB A;  2KQ6 A;  2Q91 A;  1TRF A;  3PN7 C;  2PAS A;  5G08 A;  1K90 D;  3D0Y A;  3DVK A;  2MAZ A;  4I5J A;  1TNQ A;  2NLN A;  1E8A A;  2A4J A;  2KI6 D;  2LVI A;  2JT3 A;  2OTG C;  2KGR A;  2M1K B;  2FJU B;  4MLW A;  2PMY A;  1DJI A;  2JTZ A;  5CSF A;  1REC A;  5AFP A;  1K9U A;  3PLF B;  2LLU A;  4YGD B;  2EGD A;  2I2R E;  5HKY A;  1DF0 B;  5AEQ A;  1XFX O;  1QJT A;  1Y1X A;  1QAT A;  2AMI A;  1ALV A;  2OS8 C;  3NSI A;  4ORB B;  1KK7 Z;  1TN4 A;  1SL7 A;  3LLE A;  4PHN A;  1X02 A;  4YBH B;  1IWQ A;  1OOJ A;  4PE7 A;  2BEC A;  3SJS A;  5CSJ A;  1G8I A;  3BUX B;  2LNK A;  3EKH A;  1PAL A;  4BY5 A;  3I5I B;  1CFD A;  3BUW B;  1WRZ A;  3GOF A;  1GJY A;  2JZI A;  4PDZ A;  3SIA A;  4C0L A;  1SCV A;  3EK4 A;  2BBN A;  4MZK A;  3KHE A;  2EHB A;  1CFP A;  2L2E A;  2L5X B;  2KHN A;  1RFJ A;  2RGI A;  3AKB A;  2LUX A;  3DVJ A;  4YI8 A;  1IH0 A;  1S6I A;  2O5G A;  4F0Z B;  4NQG A;  2KNE A;  1FI6 A;  5J3X A;  2Y4Q A;  3NXA A;  3OX5 A;  4I5K A;  1MF8 B;  2SAS A;  4MBE A;  1QS7 A;  1QTX A;  2KYC A;  1YUR A;  2NXQ A;  4YI9 A;  1K9P A;  4N5X A;  2MRD A;  4PAL A;  1OZO A;  1XA5 A;  2JPT A;  4HRH A;  3VRR A;  1CFF A;  2BE6 A;  1LVC D;  4GBA A;  5ER4 X;  4JPZ B;  2WOS A;  1MUX A;  1LIN A;  1F71 A;  1GQM A;  2JU0 A;  3KPX A;  4OCI A;  1CB1 A;  3IQQ A;  1CLL A;  2MHH A;  2JT0 A;  1OQP A;  2M97 A;  1J1D A;  2KI6 C;  1YX8 A;  5JJG A;  1LA0 A;  2O60 A;  1J7R A;  3CLN A;  2ZND A;  5CSN A;  4MRY A;  2WOR A;  5TNC A;  1UWO A;  1NSH A;  1CM1 A;  3I5G C;  1KCY A;  1LKJ A;  1IG5 A;  1VRK A;  2LUC A;  1CLB A;  1NX1 A;  3A8R A;  1FI5 A;  3HX4 A;  2G2B A;  1PRW A;  1R6P A;  2CXJ A;  4GUK A;  2WCB A;  3TDZ A;  1CFC A;  1B7T Z;  4CFQ A;  1DJX A;  1YX7 A;  1CMF A;  1KFU L;  4YRU A;  5K89 A;  1JSA A;  4FQO A;  2R2I A;  1DVI A;  1RRO A;  2MBX A;  4PHJ A;  1EG3 A;  4MZL A;  1DMO A;  5HKW A;  1TNX A;  1OMR A;  2E30 A;  2H61 A;  1V1G A;  3I5H B;  1DJW A;  2HPS A;  3KEV A;  2KBI A;  1PUL A;  2DOQ A;  4M2O A;  4QJ4 B;  3K21 A;  5IBW A;  1S6C A;  1YRT B;  2MA2 A;  1CKK A;  2IS9 A;  3PN7 B;  3TUY C;  4XYN A;  2F3Y A;  2F8P A;  1S5G Y;  2OTG B;  2KI4 C;  2NCP A;  2JQ6 A;  1F54 A;  4XJK A;  1M45 A;  2I18 A;  2KBM A;  4QJ5 B;  3SG4 A;  2G9B A;  4P2Y B;  2K7C A;  1CDN A;  3I5F C;  3GK4 X;  4Q04 A;  1Q80 A;  4PE1 A;  4JWQ A;  3DF0 B;  4CPV A;  5I2Q A;  3M0W A;  4C0J A;  5KTY A;  1Y1U A;  1J7P A;  2K7B A;  2LMV A;  1JWD A;  1CLM A;  1KFX S;  2V53 A;  2OS8 B;  4AQI A;  1AJ4 A;  2LP3 A;  5FYX A;  1ZUZ A;  2M8U A;  1KSO A;  1UHJ A;  2ISD A;  1SYM A;  4PE0 A;  1EL4 A;  2LCP A;  2KDH A;  4M2P A;  2CCM A;  3SG6 A;  1DJG A;  1PSB A;  2F2O A;  2JWW A;  3SG7 A;  1WDC C;  1S3P A;  2SCP A;  3VRN A;  4I5L B;  2L98 A;  4GAO A;  4A4B A;  1YVH A;  3C1V A;  5B8I B;  1KFU S;  1RK9 A;  1BT6 A;  4U8D A;  1SW8 A;  1NWD A;  3BXK A;  2PVB A;  2F33 A;  3TZ1 A;  3CR5 X;  4OV2 A;  2JNX A;  3VRQ A;  3PAT A;  1Y0V H;  3D10 A;  4NDC A;  1ALW A;  4ICB A;  1EH2 A;  1H4B A;  1U5I A;  4PHK A;  1K95 A;  4DRW A;  1BR1 B;  1A75 B;  3DVM A;  4MRX A;  4N1F A;  4USL A;  1J7O A;  1K2H A;  2E6W A;  2ZN8 A;  1B9A A;  1SBJ A;  2LVV A;  4HSZ A;  5KU1 A;  1QIV A;  4ETO A;  3HCM A;  1MHO A;  1WRK A;  1JBA A;  3CWG A;  1FBV A;  1OZS A;  1IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...