4MBEA

Sac3:sus1:cdc31:nup1 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, transcription
molecule keywords Cell division control protein 31
publication title Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mbeA01
1TN4A 4MBEA 5TNCA 1Y6WA 2KFHA 2FOTA 4JQ0D 5DKRA 1BT6A 1YUUA 1N2DA 2VRGA 2Y1MA 2BE4A 2BECA 3IQQA 1KK7Z 1PSBA 1TIZA 4GPLB 4PDZA 2LP2A 1TTXA 3AAKA 1N65A 1S6JA 1B47A 1IG5A 1YX7A 2QACA 3KEVA 1JWDA 1LA3A 1S6CA 1XFUO 2PRUA 1LVCD 1NWDA 1UURA 4AQIA 3SIBA 4GGFA 1ZUZA 1TNWA 2NXQA 2PMYA 1RECA 1UP5A 1WDCC 2KHNA 2PSRA 5IBWA 1QLSA 1QV0A 1J1EA 2WCBA 2F3ZA 1OE9B 3KHEA 4HREE 1SR6B 4Q04A 1F55A 3I5GC 4WQ2A 1QX5B 2M8UA 2KBMA 4N1GA 4GGNA 1Q80A 2JULA 1F71A 2LVIA 4DIRA 1A4PA 4TNCA 1XFZO 1YUSA 3O78A 1TCFA 2PASA 3PM8A 4U8DA 3EK4A 2DOQA 1IJ6A 4PE4A 3SIAA 2FCDA 1X02A 1BMOA 5FYXA 3H4SE 1S26D 4MN0A 1DVIA 5J3XA 5KSZA 1CDLA 1ZFSA 2LANA 3BOWA 2JWWA 2OS8B 1S6IA 2CNPA 1NP8A 1BG1A 4JWQA 3LCPC 1BJFA 1NX1A 1DJWA 3WHUB 1K96A 2F2PA 4A4BA 1AVSA 1W7IB 2JXLA 1MXLC 4YGCB 1IQ3A 2KYFA 3TDIA 1YX8A 2M9GA 1YURA 3RLZA 1NX2A 3CR5X 1JUOA 4QJ5B 3O4YA 2NZ0A 1DJHA 3FIAA 2JT0A 2L98A 4DS7A 1IGVA 4HSZA 1KK8C 3FS7A 2SCPA 2BL0B 1NX0A 2AAOA 1CFPA 1OMVA 1KSMA 1CFDA 4M2PA 1RWYA 2M7LA 4ICBA 2NLNA 2ZKMX 1RJVA 2JTTA 2F8PA 2PALA 2GV5A 4HRGA 1BR4B 1WY9A 2LLUA 4C0LA 5I8NA 3EK8A 4USLA 3ZNIA 4YI9A 4GFTA 3BUOB 5CSIA 1C7VA 1ODBA 4CLNA 1WLMA 5I2OA 1M63B 2JNFA 4CFRA 1OMRA 3OHMB 2ZN8A 1PVAA 1KWOC 2K2AA 3AKBA 4QJ4B 1PVBA 1NIWA 2E6WA 2JC2A 4A4CA 3BOWB 4MVFA 1A03A 5KU1A 2ISDA 2QPTA 3E3RA 5KTYA 3TDUA 2Q91A 3PFVA 1TNXA 2LLTA 1K2HA 4XJKA 3GK2A 2LUXA 3CR2A 1PSRA 2WNDA 2CCMA 2M1KB 3SG7A 1TRFA 4OV2A 3GOFA 1M39A 2BBMA 2BCAA 4ETOA 1W7JB 2OTGC 4PALA 5HLVA 2KBIA 1XA5A 1TCOB 2LV7A 1D1OA 2KFGA 1H4BA 5HKYA 2JT3A 1RK9A 3I5GB 2LE9B 2JPTA 2JQ6A 1SYMA 2E30A 1OZOA 3CLNA 2K7BA 1FBVA 1LA0A 3A8RA 1QASA 1Y1XA 5BPJA 1SW8A 2JOJA 2KOTA 3NXAA 2ZN9A 2WORA 1ZOTB 4BY4A 2FJUB 1K94A 3NSOA 3VGOA 1XO5A 1TNQA 2LHLA 2M3WA 4PE1A 1N0YA 2KYCA 1RROA 1SMGA 1R2UA 3TS5B 5AANA 4MSPA 2WOSA 3BQ3A 1OQPA 3PN7C 1AK8A 3CWGA 3OB1B 1J1DA 1UHIA 1V1FA 1XYDA 3PATA 3VRNA 1CFFA 1EJ3A 1PK0D 5CSJA 1YVHA 4R1EA 2BE6A 2FCEA 1B4CA 2MBXA 1CLBA 1S5GZ 4ORBB 1CTRA 2LMTA 1G8IA 1B8RA 2JT8A 2LVKA 5DKQA 5HKZA 1V1GA 4C0JA 1UHNA 4XJKB 4YGEB 1QTXA 2CT9A 1FW4A 2AUCA 2MLFC 5AEQA 1AHRA 1XFYO 2F33A 1J55A 2EC6C 3NSIA 3BUMB 1KK8B 1WRLA 2KI4B 2L5XB 1B9AA 3O6BA 2SASA 3QRXA 1C7WA 2Q4UA 1KFUS 4DCKA 2HPSA 1ALWA 1LXFC 3AKAA 3FWBA 3BUNB 4YBHB 1KQMC 2MAZA 1L2OC 2LLSA 2PVBA 3EVRA 3CS1A 2M7NA 2LCPA 1K8UA 4M2OA 2H61C 3KO0A 3TUYC 1NSHA 1MUXA 1Y1AA 2KI6D 3GK1A 4ORCB 2CBLA 1Y1UA 1K90D 2NCPA 1TNPA 2JXCA 2AMIA 2KFFA 1CLMA 1J7RA 4GAOA 3DVKA 1SKTA 1U5IA 2JRFA 5AFPA 2JZIA 2KQYA 3IF7A 1NCYA 4FQOA 5AERA 3VRQA 4E68A 1J7QA 1YVLA 2F2OA 2BBNA 2COLB 1IJ5A 3DD4A 3SG4A 1H8BA 4ORAB 3MSEB 1YRTB 3I5FC 4M2QA 3JVTC 3JTDC 2B1UA 2LHIA 4MZJA 3DVJA 1NPQA 1B1GA 3TDZA 1J7OA 1MXEA 1QJTA 1UWOA 4PCWA 1E8AA 2MA2A 4OVNF 3VROA 1JFKA 3DF0A 1QS7A 2K8MB 2R2IA 1F70A 1IQ5A 3NSKA 1A29A 1SCMB 2M49B 2O5GA 1WRKA 5I2LA 2KAVA 2M97A 2WCEA 5DKNA 2M29A 2KQ6A 1KFXS 2JTZA 2ZFDA 1DGUA 2KNEA 2ZNEA 4JPZB 5HKWA 1EG4A 4DUQA 1BOCA 1UHHA 1K95A 1ZACA 3K21A 3SG5A 2V53A 4PHKA 1BR1B 3PSRA 1DMOA 1MWNA 2OS8C 1SL8A 1DJIA 1FI6A 1QIWA 1IRJA 4ZCUA 1JBAA 4MRXA 4XYNA 2L0PA 1S5GY 1SK6D 1CLLA 4MZKA 1QV1A 4PHNA 1RFJA 1MF8B 1L7ZA 2EHBA 4MZLA 3PN7B 3KF9A 3WNXB 1YR5A 1WDCB 1U5IB 4IL1A 4N1FA 1BF5A 1ALVA 2MLEC 2I94A 1UHJA 4NDDA 1NCZA 3OX6A 1SRAA 1C07A 2BCXA 3LLEA 1PALA 2BL0C 4MEWA 4GGFC 1KFUL 1XFXO 1DF0B 1JC2A 4CFQA 2MJWB 5ER5A 2HQWA 3OP0A 4L9MA 1A2XA 3D0YB 2BKIB 2P6BB 1IH0A 2EC6B 1QX2A 5HLOA 4YRUA 3DF0B 2HF5A 4GBAA 4DRWA 3VRRA 2WCFA 4NDCA 1BODA 4D1EA 1CM4A 2G2BA 1MHOA 1GGZA 5F6TA 1EH2A 4PHJA 2EGDA 4P5OE 2O60A 3M0WA 1QX7A 2NCOA 1L2OB 1FPWA 2TN4A 1NCXA 1S36A 1G4YR 1AUIB 1XK4C 2K7OA 2L4IA 1DGVA 4BY5A 3I5IC 3I5HC 3TUYB 2LUCA 2LC5A 1CM1A 2K2FA 4I5JA 1OZSA 1KQVA 5GQQC 1S1EA 4FTGA 1M31A 1DJXA 4PE0A 3BYAA 1DJGA 2L51A 1QATA 4PHMA 2KAYA 3WHTB 2LP3A 1QVIY 4N5XA 1JSAA 1EXRA 3EVVA 5G08A 4GUKA 4ZCVA 2ZRSA 1GJYA 2WC8A 1BLQA 2MRDA 1K93D 1K9UA 3HX4A 3SG2A 1BU3A 4MLWA 1QLKA 1NYAA 1OMDA 1OOJA 1SBJA 1JF0A 3I5FB 3JVTB 3JTDB 1Y0VH 1RTP1 5CPVA 1K9KA 2K7CA 2LVJA 1CMGA 2KSPA 3LL8B 1WRZA 1B7TZ 1DJZA 1HQVA 1MQ1A 4YGBB 4I5NB 1VRKA 1KFXL 1UUSA 2OPOA 4C0KA 3PLFB 2HETA 1SY9A 3HCMA 2L2EA 1CMFA 2KGRA 3DVMA 4I5LB 3A4UB 1CDMA 3OX5A 3ZWHA 2I7AA 1SNLA 5HYDA 1DJYA 4YGAA 1WLZA 1SL9A 1XK4A 1OSAA 2IS9A 2JU0A 2KDHA 2KI6C 3IQOA 1KWOB 4PE7A 1J7PA 3KPXA 3SG3A 4WQ3A 1AJ4A 1CDNA 5AXIA 3TZ1A 1F8HA 3TS5C 1LINA 1GGWA 1TOPA 1DF0A 2I18A 2KGBC 1B8CA 3EKHA 2LMUA 1LKJA 2I2RE 1QVIZ 3D0YA 4CIDA 4YI8A 5CSFA 1SR6C 1SL7A 5I2QA 3VRPA 1M45A 2K61A 1ZMZA 2RGIA 4OR9B 2KAXA 3GK4X 5D7FA 2OTGB 2HQ8A 1AJ5A 1IWQA 1NUBA 2Y5IA 1JF2A 3CZTX 2G9BA 3LK0A 1A75A 1KCYA 2BKHB 5JJGA 3CTNA 1EG3A 2KI4C 1CKKA 3C1VA 2LNKA 3FWCA 4F0ZB 1S3PA 2H61A 2A4JA 3BUWB 2H2KA 1DT7B 4UPGA 1F54A 2ZRTA 5D69A 1YUTA 2F3YA 1YTZC 1UHKA 2D8NA 3SG6A 4AOMA 4HRHA 4WRIA 1F4OA 1PRWA 2LM5A 4GNKB 5JOLA 1MR8A 3ICBA 2M1UA 1JFJA 1K9PA 2Y4QA 2ZNDA 1HT9A 2M0RA 3F45A 1KK7Y 1CNPA 1GQMA 3O2PA 1F4QA 1QXPA 1G33A 1SPYA 4OCIA 4OKHA 1FI5A 3OB2B 2K0JA 3I5IB 3I5HB 3WXAA 3NSLA 2CTNA 2K7DA 1XFVO 1CDPA 1NX3A 1XFWO 2L50A 4QJ3B 5B8IB 5CSNA 1YRUB 1DTLA 3CGAA 5PALA 5K89A 1B7TY 1EL4A 2BCBA 4NQGA 1KSOA 1CFCA 2LVVA 4I5KA 1QIVA 3SJSA 1CB1A 3DVEA 2L4HA 2JNXA 3BXKA 2CXJA 5ER4X 3LK1A 1R6PA 4YGDB 2GGMA 2MHHA 4AQJA 2LAPA 2LMVA 1SCMC 2Y1NA 1SCVA 1AP4A 4NDBA 3BUXB 4MRYA 3EVUA 1IKUA 1FF1A 4P2YB 3PALA 1A75B 3D10A 1KQMB 1PULA 2GGZA 3CR4X 4CPVA 3EKJA 3RM1A 1M46A 3EK7A 1B8LA 1XVJA 3AAJA
chains in the Genus database with same CATH superfamily
1TN4A 4MBEA 5TNCA 1Y6WA 2KFHA 2FOTA 4JQ0D 5DKRA 1BT6A 1YUUA 1N2DA 2VRGA 4INXA 2Y1MA 2BE4A 2BECA 3D74A 1KK7Z 1PSBA 1TIZA 3IQQA 4GPLB 4PDZA 2LP2A 1TTXA 3AAKA 1N65A 1S6JA 3K1EA 5D3OA 1B47A 1IG5A 1YX7A 2QACA 3KEVA 1JWDA 1LA3A 1S6CA 1XFUO 2PRUA 1LVCD 1NWDA 1UURA 4AQIA 3SIBA 4GGFA 1ZUZA 1TNWA 2NXQA 2PMYA 1RECA 1UP5A 3FE9A 1WDCC 2KHNA 2PSRA 5IBWA 3R1PA 1QLSA 1QV0A 1J1EA 2WCBA 2F3ZA 1OE9B 3KHEA 4HREE 1SR6B 4Q04A 1F55A 3I5GC 4WQ2A 1QX5B 2M8UA 2KBMA 4N1GA 4GGNA 1Q80A 2JULA 3SS3A 3VB1A 3CZ0A 1F71A 2LVIA 1IIOA 4DIRA 1A4PA 4TNCA 1XFZO 3S0GA 1YUSA 3O78A 1TCFA 5EL2A 2PASA 3PM8A 4U8DA 3EK4A 2DOQA 1IJ6A 4PE4A 3SIAA 2FCDA 1X02A 1BMOA 3D76A 5FYXA 3H4SE 1S26D 4MN0A 1DVIA 5J3XA 5KSZA 3B87A 1CDLA 1ZFSA 2LANA 3BOWA 2JWWA 3V2LA 2OS8B 1S6IA 2CNPA 1NP8A 3FE8A 1BG1A 4JWQA 3LCPC 1BJFA 1NX1A 1DJWA 1T14A 3WHUB 3SS5A 1K96A 2F2PA 3CZ1A 4A4BA 1AVSA 2WCMA 1W7IB 2JXLA 2YGUA 1MXLC 4YGCB 1IQ3A 2KYFA 3TDIA 1YX8A 2M9GA 1YURA 3BFAA 3RLZA 1NX2A 3CR5X 1JUOA 4QJ5B 3O4YA 2NZ0A 1DJHA 3FIAA 2JT0A 2L98A 4DS7A 1IGVA 4HSZA 1KK8C 3FS7A 2SCPA 2BL0B 1NX0A 2AAOA 1CFPA 4PT1A 1OMVA 1KSMA 1CFDA 4M2PA 1RWYA 2M7LA 4ICBA 2NLNA 2ZKMX 1RJVA 2JTTA 2F8PA 1Z4HA 2PALA 2GV5A 4HRGA 1BR4B 1WY9A 2L2CA 2LLUA 4C0LA 5I8NA 3EK8A 1DQEA 4USLA 4YI9A 3ZNIA 1OOGA 3BUOB 4GFTA 5CSIA 1C7VA 1ODBA 4CLNA 1WLMA 5I2OA 1M63B 2JNFA 4CFRA 1OMRA 3OHMB 2ZN8A 1PVAA 1KWOC 2GTEA 2K2AA 3AKBA 4QJ4B 1GM0A 1PVBA 1NIWA 2E6WA 2JC2A 4A4CA 3BOWB 4MVFA 1A03A 5KU1A 2ISDA 3L4AA 2QPTA 3E3RA 5KTYA 3TDUA 2Q91A 3PFVA 1TNXA 5FI7A 2LLTA 1K2HA 2PQLA 4XJKA 3GK2A 2LUXA 3CR2A 1PSRA 2WCJA 1C3ZA 2WNDA 2CCMA 2M1KB 3SG7A 1TRFA 2P71A 4OV2A 3NHIA 3GOFA 3S0FA 1M39A 2BBMA 2BCAA 4ETOA 1W7JB 2OTGC 4PALA 5HLVA 2KBIA 1XA5A 1TCOB 2LV7A 1D1OA 2KFGA 1H4BA 5HKYA 2JT3A 1RK9A 3I5GB 2LE9B 4IJ7A 2JPTA 2JQ6A 2JPOA 1SYMA 2E30A 1OZOA 3CLNA 2K7BA 1FBVA 1LA0A 2KPHA 3S0EA 3A8RA 3S0AA 1QASA 1Y1XA 5BPJA 1SW8A 2JOJA 2KOTA 3NXAA 2ZN9A 2WORA 1ZOTB 4BY4A 2FJUB 1K94A 3NSOA 3VGOA 1XO5A 1TNQA 2LHLA 2M3WA 4PE1A 1N0YA 2KYCA 1RROA 1SMGA 1R2UA 3TS5B 5AANA 4MSPA 2WOSA 3BQ3A 1OQPA 3PN7C 1AK8A 3CWGA 3OB1B 1J1DA 1UHIA 1V1FA 1XYDA 3PATA 5DICA 3VRNA 1EJ3A 1PK0D 1CFFA 3DY9A 2WCHA 5CSJA 1YVHA 3L4LA 4R1EA 2BE6A 2FCEA 1B4CA 2MBXA 1CLBA 1S5GZ 4ORBB 1CTRA 2LMTA 1G8IA 1B8RA 3BFHA 2JT8A 3L47A 2LVKA 5DKQA 5HKZA 1V1GA 3R1VA 4C0JA 1UHNA 4XJKB 4YGEB 1QTXA 2CT9A 1FW4A 2AUCA 2MLFC 5AEQA 1AHRA 1XFYO 3DZTA 2F33A 1J55A 2EC6C 3FE6A 3BUMB 1KK8B 3NSIA 1WRLA 2KI4B 2L5XB 1B9AA 3O6BA 5FI6A 2SASA 3QRXA 1C7WA 2Q4UA 1KFUS 3O4XA 4DCKA 2HPSA 1ALWA 1LXFC 2L5YA 3AKAA 3FWBA 3BUNB 4YBHB 1KQMC 2MAZA 1L2OC 2KLEA 2LLSA 2PVBA 3EVRA 3EG5B 3CS1A 5FI2A 2M7NA 2LCPA 1K8UA 4M2OA 2H61C 3KO0A 3N7HA 5HL1A 3TUYC 1NSHA 1MUXA 1Y1AA 2KI6D 3GK1A 4ORCB 2CBLA 1Y1UA 1K90D 2NCPA 1TNPA 2JXCA 2AMIA 2KFFA 1CLMA 1J7RA 4GAOA 1TWOA 3DVKA 1SKTA 1U5IA 2JRFA 5AFPA 2JZIA 2KQYA 3IF7A 1NCYA 1OOHA 4FQOA 3VRQA 5AERA 4E68A 1J7QA 1Z2CB 1YVLA 2BBNA 2COLB 1IJ5A 2F2OA 3DD4A 3SG4A 1H8BA 4ORAB 3MSEB 1YRTB 3I5FC 4M2QA 3CDNA 4F7FA 3JVTC 3JTDC 2B1UA 2LHIA 4MZJA 3UO9A 3DVJA 1NPQA 1B1GA 3TDZA 1J7OA 1MXEA 1QJTA 1UWOA 4PCWA 1E8AA 2MA2A 4OVNF 3VROA 3D75A 1JFKA 3DF0A 1QS7A 2K8MB 2R2IA 1F70A 1IQ5A 3NSKA 1A29A 1SCMB 2M49B 2O5GA 1WRKA 3DYEA 5I2LA 2KAVA 4JD9A 2M97A 2WCEA 5DKNA 2M29A 2KQ6A 1KFXS 2JTZA 2ZFDA 1DGUA 2KNEA 2ZNEA 4JPZB 5HKWA 1EG4A 4DUQA 1BOCA 3IVTA 1UHHA 1K95A 1ZACA 3K21A 3SG5A 2V53A 4PHKA 1BR1B 3PSRA 1DMOA 1MWNA 2OS8C 1SL8A 3B86A 1DJIA 1SSEB 3D77A 2H8VA 1FI6A 1QIWA 1IRJA 4ZCUA 1JBAA 4MRXA 4XYNA 2WC5A 2L0PA 3S0DA 1S5GY 1SK6D 1CLLA 3QMEA 1QV1A 4MZKA 4PHNA 1RFJA 1MF8B 1L7ZA 2EHBA 4MZLA 3PN7B 3KF9A 3WNXB 1YR5A 2QEVA 1WDCB 3OBVA 1U5IB 4IL1A 4N1FA 1BF5A 1ALVA 2MLEC 2I94A 1UHJA 4NDDA 1NCZA 3OX6A 1SRAA 1C07A 2BCXA 3LLEA 1PALA 2BL0C 4MEWA 4GGFC 1KFUL 1XFXO 1DF0B 1JC2A 4CFQA 2MJWB 3R72A 5ER5A 2HQWA 3OP0A 4L9MA 1A2XA 3D0YB 2BKIB 2P6BB 1IH0A 2EC6B 1QX2A 5HLOA 4YRUA 3DF0B 2HF5A 4GBAA 4DRWA 3VRRA 2WCFA 4NDCA 1BODA 4D1EA 1CM4A 2G2BA 1MHOA 1GGZA 5F6TA 1EH2A 4PHJA 2EGDA 4P5OE 2O60A 3M0WA 1QX7A 2NCOA 1L2OB 3NGVA 1FPWA 2TN4A 1NCXA 1S36A 1G4YR 1AUIB 1XK4C 2K7OA 2L4IA 1DGVA 4BY5A 3I5IC 3I5HC 3TUYB 2LUCA 3DXLA 2LC5A 1CM1A 2K2FA 3B88A 4I5JA 3S0BA 1OZSA 1KQVA 2QEOA 5GQQC 1S1EA 4FTGA 1M31A 1DJXA 4PE0A 3BYAA 1DJGA 2L51A 1QATA 4PHMA 2KAYA 3WHTB 2LP3A 1QVIY 4N5XA 1JSAA 1EXRA 3EVVA 5G08A 4GUKA 3Q8IA 4ZCVA 2ZRSA 1GJYA 2WC8A 1BLQA 2MRDA 1K93D 1K9UA 3HX4A 3SG2A 3D73A 1BU3A 4MLWA 1QLKA 1NYAA 1OMDA 1OOJA 1SBJA 1JF0A 3I5FB 3JVTB 3JTDB 1Y0VH 1RTP1 5CPVA 1K9KA 2K7CA 2LVJA 2QEHA 2FJYA 2KSPA 3LL8B 1WRZA 1B7TZ 2QDIA 1DJZA 1CMGA 1HQVA 1MQ1A 4YGBB 4I5NB 1VRKA 1KFXL 1UUSA 2OPOA 4C0KA 3PLFB 2HETA 1SY9A 3HCMA 2L2EA 3OGNA 2KGRA 4KYNA 1CMFA 1W9ZA 3DVMA 4I5LB 2K60A 3A4UB 1CDMA 2P70A 3BFBA 3OX5A 3ZWHA 2I7AA 1SNLA 5HYDA 1DJYA 2WCKA 4YGAA 1WLZA 1SL9A 1XK4A 1OSAA 2IS9A 2JU0A 2KDHA 2KI6C 3IQOA 1KWOB 4PE7A 1J7PA 3KPXA 3SG3A 4WQ3A 1DELA 1AJ4A 1CDNA 5AXIA 3TZ1A 1F8HA 1C3YA 3TS5C 3D78A 1LINA 1GGWA 1TOPA 1DF0A 2WCLA 2I18A 2KGBC 3PM2A 1B8CA 3EKHA 2LMUA 1LKJA 1TUJA 2I2RE 1QVIZ 3D0YA 1QWVA 4CIDA 4YI8A 5I94A 5CSFA 1SR6C 1SL7A 5I2QA 3VRPA 1M45A 2K61A 4JKTA 1ZMZA 2RGIA 3CZ2A 3SS4A 4OR9B 2KAXA 3GK4X 2PYQA 2OTGB 2HQ8A 5D7FA 1AJ5A 1IWQA 3B6XA 1NUBA 2Y5IA 1JF2A 3CZTX 2G9BA 1XFRA 2QEBA 3LK0A 1A75A 1KCYA 2BKHB 5JJGA 3CTNA 1EG3A 2KI4C 1CKKA 3C1VA 2LNKA 3FWCA 4F0ZB 1S3PA 2H61A 2A4JA 3BUWB 2H2KA 1DT7B 4UPGA 1F54A 2BAPA 2ZRTA 5D69A 1YUTA 2F3YA 1YTZC 1UHKA 2D8NA 4INWA 3SG6A 4AOMA 4HRHA 1OOIX 4WRIA 1F4OA 1PRWA 2LM5A 4GNKB 5JOLA 1MR8A 3ICBA 2M1UA 4FQTA 1JFJA 1K9PA 2Y4QA 2ZNDA 3BJHA 1HT9A 2KLDA 2M0RA 3F45A 1KK7Y 1OW4A 1CNPA 3CYZA 1GQMA 3O2PA 3R1OA 1DEKA 1F4QA 1QXPA 1G33A 1SPYA 3CABA 1DC1A 4OCIA 4OKHA 4OZDA 1FI5A 3OB2B 3RZSA 2K0JA 3I5IB 3I5HB 1OOFA 3NSLA 2CTNA 3WXAA 2K7DA 1TUZA 1XFVO 1CDPA 1P28A 1NX3A 1XFWO 2L50A 4QJ3B 5B8IB 5CSNA 1YRUB 3NHTA 1DTLA 3CGAA 5PALA 5K89A 1B7TY 1EL4A 2BCBA 4NQGA 1KSOA 2ERBA 1CFCA 2LVVA 4I5KA 1QIVA 3SJSA 1CB1A 3DVEA 1LS8A 3UNWA 2L4HA 2JNXA 3BXKA 2CXJA 5ER4X 3PJIA 3LK1A 1R6PA 4YGDB 2GGMA 2MHHA 1ORGA 4AQJA 2LAPA 2LMVA 1SCMC 2Y1NA 2BNXA 1SCVA 1AP4A 4NDBA 3BUXB 4MRYA 3EVUA 1IKUA 1FF1A 3B7AA 4P2YB 3PALA 1A75B 3D10A 1KQMB 1PULA 2GGZA 3CR4X 4CPVA 3EKJA 3RM1A 1M46A 2WC6A 3EK7A 1B8LA 1XVJA 3AAJA
chains in the Genus database with same CATH topology
1TN4A 4MBEA 5TNCA 1Y6WA 2KFHA 2FOTA 4JQ0D 5DKRA 1BT6A 1YUUA 1N2DA 2VRGA 2Y1MA 2BE4A 2BECA 3IQQA 1KK7Z 1PSBA 1TIZA 4GPLB 4PDZA 2LP2A 1TTXA 3AAKA 1N65A 1S6JA 1B47A 1IG5A 1YX7A 2QACA 3KEVA 1JWDA 1LA3A 1S6CA 1XFUO 2PRUA 1LVCD 1NWDA 1UURA 4AQIA 3SIBA 4GGFA 1ZUZA 1TNWA 2NXQA 2PMYA 1RECA 1UP5A 1WDCC 2KHNA 2PSRA 5IBWA 1QLSA 1QV0A 1J1EA 2WCBA 2F3ZA 1OE9B 3KHEA 4HREE 1SR6B 4Q04A 1F55A 3I5GC 4WQ2A 1QX5B 2M8UA 2KBMA 4N1GA 4GGNA 1Q80A 2JULA 1F71A 2LVIA 4DIRA 1A4PA 4TNCA 1XFZO 1YUSA 3O78A 1TCFA 2PASA 3PM8A 4U8DA 3EK4A 2DOQA 1IJ6A 4PE4A 3SIAA 2FCDA 1X02A 1BMOA 5FYXA 3H4SE 1S26D 4MN0A 1DVIA 5J3XA 5KSZA 1CDLA 1ZFSA 2LANA 3BOWA 2JWWA 2OS8B 1S6IA 2CNPA 1NP8A 1BG1A 4JWQA 3LCPC 1BJFA 1NX1A 1DJWA 3WHUB 1K96A 2F2PA 4A4BA 1AVSA 1W7IB 2JXLA 1MXLC 4YGCB 1IQ3A 2KYFA 3TDIA 1YX8A 2M9GA 1YURA 3RLZA 1NX2A 3CR5X 1JUOA 4QJ5B 3O4YA 2NZ0A 1DJHA 3FIAA 2JT0A 2L98A 4DS7A 1IGVA 4HSZA 1KK8C 3FS7A 2SCPA 2BL0B 1NX0A 2AAOA 1CFPA 1OMVA 1KSMA 1CFDA 4M2PA 1RWYA 2M7LA 4ICBA 2NLNA 2ZKMX 1RJVA 2JTTA 2F8PA 2PALA 2GV5A 4HRGA 1BR4B 1WY9A 2LLUA 4C0LA 5I8NA 3EK8A 4USLA 3ZNIA 4YI9A 4GFTA 3BUOB 5CSIA 1C7VA 1ODBA 4CLNA 1WLMA 5I2OA 1M63B 2JNFA 4CFRA 1OMRA 3OHMB 2ZN8A 1PVAA 1KWOC 2K2AA 3AKBA 4QJ4B 1PVBA 1NIWA 2E6WA 2JC2A 4A4CA 3BOWB 4MVFA 1A03A 5KU1A 2ISDA 2QPTA 3E3RA 5KTYA 3TDUA 2Q91A 3PFVA 1TNXA 2LLTA 1K2HA 4XJKA 3GK2A 2LUXA 3CR2A 1PSRA 2WNDA 2CCMA 2M1KB 3SG7A 1TRFA 4OV2A 3GOFA 1M39A 2BBMA 2BCAA 4ETOA 1W7JB 2OTGC 4PALA 5HLVA 2KBIA 1XA5A 1TCOB 2LV7A 1D1OA 2KFGA 1H4BA 5HKYA 2JT3A 1RK9A 3I5GB 2LE9B 2JPTA 2JQ6A 1SYMA 2E30A 1OZOA 3CLNA 2K7BA 1FBVA 1LA0A 3A8RA 1QASA 1Y1XA 5BPJA 1SW8A 2JOJA 2KOTA 3NXAA 2ZN9A 2WORA 1ZOTB 4BY4A 2FJUB 1K94A 3NSOA 3VGOA 1XO5A 1TNQA 2LHLA 2M3WA 4PE1A 1N0YA 2KYCA 1RROA 1SMGA 1R2UA 3TS5B 5AANA 4MSPA 2WOSA 3BQ3A 1OQPA 3PN7C 1AK8A 3CWGA 3OB1B 1J1DA 1UHIA 1V1FA 1XYDA 3PATA 3VRNA 1CFFA 1EJ3A 1PK0D 5CSJA 1YVHA 4R1EA 2BE6A 2FCEA 1B4CA 2MBXA 1CLBA 1S5GZ 4ORBB 1CTRA 2LMTA 1G8IA 1B8RA 2JT8A 2LVKA 5DKQA 5HKZA 1V1GA 4C0JA 1UHNA 4XJKB 4YGEB 1QTXA 2CT9A 1FW4A 2AUCA 2MLFC 5AEQA 1AHRA 1XFYO 2F33A 1J55A 2EC6C 3NSIA 3BUMB 1KK8B 1WRLA 2KI4B 2L5XB 1B9AA 3O6BA 2SASA 3QRXA 1C7WA 2Q4UA 1KFUS 4DCKA 2HPSA 1ALWA 1LXFC 3AKAA 3FWBA 3BUNB 4YBHB 1KQMC 2MAZA 1L2OC 2LLSA 2PVBA 3EVRA 3CS1A 2M7NA 2LCPA 1K8UA 4M2OA 2H61C 3KO0A 3TUYC 1NSHA 1MUXA 1Y1AA 2KI6D 3GK1A 4ORCB 2CBLA 1Y1UA 1K90D 2NCPA 1TNPA 2JXCA 2AMIA 2KFFA 1CLMA 1J7RA 4GAOA 3DVKA 1SKTA 1U5IA 2JRFA 5AFPA 2JZIA 2KQYA 3IF7A 1NCYA 4FQOA 5AERA 3VRQA 4E68A 1J7QA 1YVLA 2F2OA 2BBNA 2COLB 1IJ5A 3DD4A 3SG4A 1H8BA 4ORAB 3MSEB 1YRTB 3I5FC 4M2QA 3JVTC 3JTDC 2B1UA 2LHIA 4MZJA 3DVJA 1NPQA 1B1GA 3TDZA 1J7OA 1MXEA 1QJTA 1UWOA 4PCWA 1E8AA 2MA2A 4OVNF 3VROA 1JFKA 3DF0A 1QS7A 2K8MB 2R2IA 1F70A 1IQ5A 3NSKA 1A29A 1SCMB 2M49B 2O5GA 1WRKA 5I2LA 2KAVA 2M97A 2WCEA 5DKNA 2M29A 2KQ6A 1KFXS 2JTZA 2ZFDA 1DGUA 2KNEA 2ZNEA 4JPZB 5HKWA 1EG4A 4DUQA 1BOCA 1UHHA 1K95A 1ZACA 3K21A 3SG5A 2V53A 4PHKA 1BR1B 3PSRA 1DMOA 1MWNA 2OS8C 1SL8A 1DJIA 1FI6A 1QIWA 1IRJA 4ZCUA 1JBAA 4MRXA 4XYNA 2L0PA 1S5GY 1SK6D 1CLLA 4MZKA 1QV1A 4PHNA 1RFJA 1MF8B 1L7ZA 2EHBA 4MZLA 3PN7B 3KF9A 3WNXB 1YR5A 1WDCB 1U5IB 4IL1A 4N1FA 1BF5A 1ALVA 2MLEC 2I94A 1UHJA 4NDDA 1NCZA 3OX6A 1SRAA 1C07A 2BCXA 3LLEA 1PALA 2BL0C 4MEWA 4GGFC 1KFUL 1XFXO 1DF0B 1JC2A 4CFQA 2MJWB 5ER5A 2HQWA 3OP0A 4L9MA 1A2XA 3D0YB 2BKIB 2P6BB 1IH0A 2EC6B 1QX2A 5HLOA 4YRUA 3DF0B 2HF5A 4GBAA 4DRWA 3VRRA 2WCFA 4NDCA 1BODA 4D1EA 1CM4A 2G2BA 1MHOA 1GGZA 5F6TA 1EH2A 4PHJA 2EGDA 4P5OE 2O60A 3M0WA 1QX7A 2NCOA 1L2OB 1FPWA 2TN4A 1NCXA 1S36A 1G4YR 1AUIB 1XK4C 2K7OA 2L4IA 1DGVA 4BY5A 3I5IC 3I5HC 3TUYB 2LUCA 2LC5A 1CM1A 2K2FA 4I5JA 1OZSA 1KQVA 5GQQC 1S1EA 4FTGA 1M31A 1DJXA 4PE0A 3BYAA 1DJGA 2L51A 1QATA 4PHMA 2KAYA 3WHTB 2LP3A 1QVIY 4N5XA 1JSAA 1EXRA 3EVVA 5G08A 4GUKA 4ZCVA 2ZRSA 1GJYA 2WC8A 1BLQA 2MRDA 1K93D 1K9UA 3HX4A 3SG2A 1BU3A 4MLWA 1QLKA 1NYAA 1OMDA 1OOJA 1SBJA 1JF0A 3I5FB 3JVTB 3JTDB 1Y0VH 1RTP1 5CPVA 1K9KA 2K7CA 2LVJA 1CMGA 2KSPA 3LL8B 1WRZA 1B7TZ 1DJZA 1HQVA 1MQ1A 4YGBB 4I5NB 1VRKA 1KFXL 1UUSA 2OPOA 4C0KA 3PLFB 2HETA 1SY9A 3HCMA 2L2EA 1CMFA 2KGRA 3DVMA 4I5LB 3A4UB 1CDMA 3OX5A 3ZWHA 2I7AA 1SNLA 5HYDA 1DJYA 4YGAA 1WLZA 1SL9A 1XK4A 1OSAA 2IS9A 2JU0A 2KDHA 2KI6C 3IQOA 1KWOB 4PE7A 1J7PA 3KPXA 3SG3A 4WQ3A 1AJ4A 1CDNA 5AXIA 3TZ1A 1F8HA 3TS5C 1LINA 1GGWA 1TOPA 1DF0A 2I18A 2KGBC 1B8CA 3EKHA 2LMUA 1LKJA 2I2RE 1QVIZ 3D0YA 4CIDA 4YI8A 5CSFA 1SR6C 1SL7A 5I2QA 3VRPA 1M45A 2K61A 1ZMZA 2RGIA 4OR9B 2KAXA 3GK4X 5D7FA 2OTGB 2HQ8A 1AJ5A 1IWQA 1NUBA 2Y5IA 1JF2A 3CZTX 2G9BA 3LK0A 1A75A 1KCYA 2BKHB 5JJGA 3CTNA 1EG3A 2KI4C 1CKKA 3C1VA 2LNKA 3FWCA 4F0ZB 1S3PA 2H61A 2A4JA 3BUWB 2H2KA 1DT7B 4UPGA 1F54A 2ZRTA 5D69A 1YUTA 2F3YA 1YTZC 1UHKA 2D8NA 3SG6A 4AOMA 4HRHA 4WRIA 1F4OA 1PRWA 2LM5A 4GNKB 5JOLA 1MR8A 3ICBA 2M1UA 1JFJA 1K9PA 2Y4QA 2ZNDA 1HT9A 2M0RA 3F45A 1KK7Y 1CNPA 1GQMA 3O2PA 1F4QA 1QXPA 1G33A 1SPYA 4OCIA 4OKHA 1FI5A 3OB2B 2K0JA 3I5IB 3I5HB 3WXAA 3NSLA 2CTNA 2K7DA 1XFVO 1CDPA 1NX3A 1XFWO 2L50A 4QJ3B 5B8IB 5CSNA 1YRUB 1DTLA 3CGAA 5PALA 5K89A 1B7TY 1EL4A 2BCBA 4NQGA 1KSOA 1CFCA 2LVVA 4I5KA 1QIVA 3SJSA 1CB1A 3DVEA 2L4HA 2JNXA 3BXKA 2CXJA 5ER4X 3LK1A 1R6PA 4YGDB 2GGMA 2MHHA 4AQJA 2LAPA 2LMVA 1SCMC 2Y1NA 1SCVA 1AP4A 4NDBA 3BUXB 4MRYA 3EVUA 1IKUA 1FF1A 4P2YB 3PALA 1A75B 3D10A 1KQMB 1PULA 2GGZA 3CR4X 4CPVA 3EKJA 3RM1A 1M46A 3EK7A 1B8LA 1XVJA 3AAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN4 A;  4MBE A;  5TNC A;  1Y6W A;  2KFH A;  2FOT A;  4JQ0 D;  5DKR A;  1BT6 A;  1YUU A;  1N2D A;  2VRG A;  2Y1M A;  2BE4 A;  2BEC A;  3IQQ A;  1KK7 Z;  1PSB A;  1TIZ A;  4GPL B;  4PDZ A;  2LP2 A;  1TTX A;  3AAK A;  1N65 A;  1S6J A;  1B47 A;  1IG5 A;  1YX7 A;  2QAC A;  3KEV A;  1JWD A;  1LA3 A;  1S6C A;  1XFU O;  2PRU A;  1LVC D;  1NWD A;  1UUR A;  4AQI A;  3SIB A;  4GGF A;  1ZUZ A;  1TNW A;  2NXQ A;  2PMY A;  1REC A;  1UP5 A;  1WDC C;  2KHN A;  2PSR A;  5IBW A;  1QLS A;  1QV0 A;  1J1E A;  2WCB A;  2F3Z A;  1OE9 B;  3KHE A;  4HRE E;  1SR6 B;  4Q04 A;  1F55 A;  3I5G C;  4WQ2 A;  1QX5 B;  2M8U A;  2KBM A;  4N1G A;  4GGN A;  1Q80 A;  2JUL A;  1F71 A;  2LVI A;  4DIR A;  1A4P A;  4TNC A;  1XFZ O;  1YUS A;  3O78 A;  1TCF A;  2PAS A;  3PM8 A;  4U8D A;  3EK4 A;  2DOQ A;  1IJ6 A;  4PE4 A;  3SIA A;  2FCD A;  1X02 A;  1BMO A;  5FYX A;  3H4S E;  1S26 D;  4MN0 A;  1DVI A;  5J3X A;  5KSZ A;  1CDL A;  1ZFS A;  2LAN A;  3BOW A;  2JWW A;  2OS8 B;  1S6I A;  2CNP A;  1NP8 A;  1BG1 A;  4JWQ A;  3LCP C;  1BJF A;  1NX1 A;  1DJW A;  3WHU B;  1K96 A;  2F2P A;  4A4B A;  1AVS A;  1W7I B;  2JXL A;  1MXL C;  4YGC B;  1IQ3 A;  2KYF A;  3TDI A;  1YX8 A;  2M9G A;  1YUR A;  3RLZ A;  1NX2 A;  3CR5 X;  1JUO A;  4QJ5 B;  3O4Y A;  2NZ0 A;  1DJH A;  3FIA A;  2JT0 A;  2L98 A;  4DS7 A;  1IGV A;  4HSZ A;  1KK8 C;  3FS7 A;  2SCP A;  2BL0 B;  1NX0 A;  2AAO A;  1CFP A;  1OMV A;  1KSM A;  1CFD A;  4M2P A;  1RWY A;  2M7L A;  4ICB A;  2NLN A;  2ZKM X;  1RJV A;  2JTT A;  2F8P A;  2PAL A;  2GV5 A;  4HRG A;  1BR4 B;  1WY9 A;  2LLU A;  4C0L A;  5I8N A;  3EK8 A;  4USL A;  3ZNI A;  4YI9 A;  4GFT A;  3BUO B;  5CSI A;  1C7V A;  1ODB A;  4CLN A;  1WLM A;  5I2O A;  1M63 B;  2JNF A;  4CFR A;  1OMR A;  3OHM B;  2ZN8 A;  1PVA A;  1KWO C;  2K2A A;  3AKB A;  4QJ4 B;  1PVB A;  1NIW A;  2E6W A;  2JC2 A;  4A4C A;  3BOW B;  4MVF A;  1A03 A;  5KU1 A;  2ISD A;  2QPT A;  3E3R A;  5KTY A;  3TDU A;  2Q91 A;  3PFV A;  1TNX A;  2LLT A;  1K2H A;  4XJK A;  3GK2 A;  2LUX A;  3CR2 A;  1PSR A;  2WND A;  2CCM A;  2M1K B;  3SG7 A;  1TRF A;  4OV2 A;  3GOF A;  1M39 A;  2BBM A;  2BCA A;  4ETO A;  1W7J B;  2OTG C;  4PAL A;  5HLV A;  2KBI A;  1XA5 A;  1TCO B;  2LV7 A;  1D1O A;  2KFG A;  1H4B A;  5HKY A;  2JT3 A;  1RK9 A;  3I5G B;  2LE9 B;  2JPT A;  2JQ6 A;  1SYM A;  2E30 A;  1OZO A;  3CLN A;  2K7B A;  1FBV A;  1LA0 A;  3A8R A;  1QAS A;  1Y1X A;  5BPJ A;  1SW8 A;  2JOJ A;  2KOT A;  3NXA A;  2ZN9 A;  2WOR A;  1ZOT B;  4BY4 A;  2FJU B;  1K94 A;  3NSO A;  3VGO A;  1XO5 A;  1TNQ A;  2LHL A;  2M3W A;  4PE1 A;  1N0Y A;  2KYC A;  1RRO A;  1SMG A;  1R2U A;  3TS5 B;  5AAN A;  4MSP A;  2WOS A;  3BQ3 A;  1OQP A;  3PN7 C;  1AK8 A;  3CWG A;  3OB1 B;  1J1D A;  1UHI A;  1V1F A;  1XYD A;  3PAT A;  3VRN A;  1CFF A;  1EJ3 A;  1PK0 D;  5CSJ A;  1YVH A;  4R1E A;  2BE6 A;  2FCE A;  1B4C A;  2MBX A;  1CLB A;  1S5G Z;  4ORB B;  1CTR A;  2LMT A;  1G8I A;  1B8R A;  2JT8 A;  2LVK A;  5DKQ A;  5HKZ A;  1V1G A;  4C0J A;  1UHN A;  4XJK B;  4YGE B;  1QTX A;  2CT9 A;  1FW4 A;  2AUC A;  2MLF C;  5AEQ A;  1AHR A;  1XFY O;  2F33 A;  1J55 A;  2EC6 C;  3NSI A;  3BUM B;  1KK8 B;  1WRL A;  2KI4 B;  2L5X B;  1B9A A;  3O6B A;  2SAS A;  3QRX A;  1C7W A;  2Q4U A;  1KFU S;  4DCK A;  2HPS A;  1ALW A;  1LXF C;  3AKA A;  3FWB A;  3BUN B;  4YBH B;  1KQM C;  2MAZ A;  1L2O C;  2LLS A;  2PVB A;  3EVR A;  3CS1 A;  2M7N A;  2LCP A;  1K8U A;  4M2O A;  2H61 C;  3KO0 A;  3TUY C;  1NSH A;  1MUX A;  1Y1A A;  2KI6 D;  3GK1 A;  4ORC B;  2CBL A;  1Y1U A;  1K90 D;  2NCP A;  1TNP A;  2JXC A;  2AMI A;  2KFF A;  1CLM A;  1J7R A;  4GAO A;  3DVK A;  1SKT A;  1U5I A;  2JRF A;  5AFP A;  2JZI A;  2KQY A;  3IF7 A;  1NCY A;  4FQO A;  5AER A;  3VRQ A;  4E68 A;  1J7Q A;  1YVL A;  2F2O A;  2BBN A;  2COL B;  1IJ5 A;  3DD4 A;  3SG4 A;  1H8B A;  4ORA B;  3MSE B;  1YRT B;  3I5F C;  4M2Q A;  3JVT C;  3JTD C;  2B1U A;  2LHI A;  4MZJ A;  3DVJ A;  1NPQ A;  1B1G A;  3TDZ A;  1J7O A;  1MXE A;  1QJT A;  1UWO A;  4PCW A;  1E8A A;  2MA2 A;  4OVN F;  3VRO A;  1JFK A;  3DF0 A;  1QS7 A;  2K8M B;  2R2I A;  1F70 A;  1IQ5 A;  3NSK A;  1A29 A;  1SCM B;  2M49 B;  2O5G A;  1WRK A;  5I2L A;  2KAV A;  2M97 A;  2WCE A;  5DKN A;  2M29 A;  2KQ6 A;  1KFX S;  2JTZ A;  2ZFD A;  1DGU A;  2KNE A;  2ZNE A;  4JPZ B;  5HKW A;  1EG4 A;  4DUQ A;  1BOC A;  1UHH A;  1K95 A;  1ZAC A;  3K21 A;  3SG5 A;  2V53 A;  4PHK A;  1BR1 B;  3PSR A;  1DMO A;  1MWN A;  2OS8 C;  1SL8 A;  1DJI A;  1FI6 A;  1QIW A;  1IRJ A;  4ZCU A;  1JBA A;  4MRX A;  4XYN A;  2L0P A;  1S5G Y;  1SK6 D;  1CLL A;  4MZK A;  1QV1 A;  4PHN A;  1RFJ A;  1MF8 B;  1L7Z A;  2EHB A;  4MZL A;  3PN7 B;  3KF9 A;  3WNX B;  1YR5 A;  1WDC B;  1U5I B;  4IL1 A;  4N1F A;  1BF5 A;  1ALV A;  2MLE C;  2I94 A;  1UHJ A;  4NDD A;  1NCZ A;  3OX6 A;  1SRA A;  1C07 A;  2BCX A;  3LLE A;  1PAL A;  2BL0 C;  4MEW A;  4GGF C;  1KFU L;  1XFX O;  1DF0 B;  1JC2 A;  4CFQ A;  2MJW B;  5ER5 A;  2HQW A;  3OP0 A;  4L9M A;  1A2X A;  3D0Y B;  2BKI B;  2P6B B;  1IH0 A;  2EC6 B;  1QX2 A;  5HLO A;  4YRU A;  3DF0 B;  2HF5 A;  4GBA A;  4DRW A;  3VRR A;  2WCF A;  4NDC A;  1BOD A;  4D1E A;  1CM4 A;  2G2B A;  1MHO A;  1GGZ A;  5F6T A;  1EH2 A;  4PHJ A;  2EGD A;  4P5O E;  2O60 A;  3M0W A;  1QX7 A;  2NCO A;  1L2O B;  1FPW A;  2TN4 A;  1NCX A;  1S36 A;  1G4Y R;  1AUI B;  1XK4 C;  2K7O A;  2L4I A;  1DGV A;  4BY5 A;  3I5I C;  3I5H C;  3TUY B;  2LUC A;  2LC5 A;  1CM1 A;  2K2F A;  4I5J A;  1OZS A;  1KQV A;  5GQQ C;  1S1E A;  4FTG A;  1M31 A;  1DJX A;  4PE0 A;  3BYA A;  1DJG A;  2L51 A;  1QAT A;  4PHM A;  2KAY A;  3WHT B;  2LP3 A;  1QVI Y;  4N5X A;  1JSA A;  1EXR A;  3EVV A;  5G08 A;  4GUK A;  4ZCV A;  2ZRS A;  1GJY A;  2WC8 A;  1BLQ A;  2MRD A;  1K93 D;  1K9U A;  3HX4 A;  3SG2 A;  1BU3 A;  4MLW A;  1QLK A;  1NYA A;  1OMD A;  1OOJ A;  1SBJ A;  1JF0 A;  3I5F B;  3JVT B;  3JTD B;  1Y0V H;  1RTP 1;  5CPV A;  1K9K A;  2K7C A;  2LVJ A;  1CMG A;  2KSP A;  3LL8 B;  1WRZ A;  1B7T Z;  1DJZ A;  1HQV A;  1MQ1 A;  4YGB B;  4I5N B;  1VRK A;  1KFX L;  1UUS A;  2OPO A;  4C0K A;  3PLF B;  2HET A;  1SY9 A;  3HCM A;  2L2E A;  1CMF A;  2KGR A;  3DVM A;  4I5L B;  3A4U B;  1CDM A;  3OX5 A;  3ZWH A;  2I7A A;  1SNL A;  5HYD A;  1DJY A;  4YGA A;  1WLZ A;  1SL9 A;  1XK4 A;  1OSA A;  2IS9 A;  2JU0 A;  2KDH A;  2KI6 C;  3IQO A;  1KWO B;  4PE7 A;  1J7P A;  3KPX A;  3SG3 A;  4WQ3 A;  1AJ4 A;  1CDN A;  5AXI A;  3TZ1 A;  1F8H A;  3TS5 C;  1LIN A;  1GGW A;  1TOP A;  1DF0 A;  2I18 A;  2KGB C;  1B8C A;  3EKH A;  2LMU A;  1LKJ A;  2I2R E;  1QVI Z;  3D0Y A;  4CID A;  4YI8 A;  5CSF A;  1SR6 C;  1SL7 A;  5I2Q A;  3VRP A;  1M45 A;  2K61 A;  1ZMZ A;  2RGI A;  4OR9 B;  2KAX A;  3GK4 X;  5D7F A;  2OTG B;  2HQ8 A;  1AJ5 A;  1IWQ A;  1NUB A;  2Y5I A;  1JF2 A;  3CZT X;  2G9B A;  3LK0 A;  1A75 A;  1KCY A;  2BKH B;  5JJG A;  3CTN A;  1EG3 A;  2KI4 C;  1CKK A;  3C1V A;  2LNK A;  3FWC A;  4F0Z B;  1S3P A;  2H61 A;  2A4J A;  3BUW B;  2H2K A;  1DT7 B;  4UPG A;  1F54 A;  2ZRT A;  5D69 A;  1YUT A;  2F3Y A;  1YTZ C;  1UHK A;  2D8N A;  3SG6 A;  4AOM A;  4HRH A;  4WRI A;  1F4O A;  1PRW A;  2LM5 A;  4GNK B;  5JOL A;  1MR8 A;  3ICB A;  2M1U A;  1JFJ A;  1K9P A;  2Y4Q A;  2ZND A;  1HT9 A;  2M0R A;  3F45 A;  1KK7 Y;  1CNP A;  1GQM A;  3O2P A;  1F4Q A;  1QXP A;  1G33 A;  1SPY A;  4OCI A;  4OKH A;  1FI5 A;  3OB2 B;  2K0J A;  3I5I B;  3I5H B;  3WXA A;  3NSL A;  2CTN A;  2K7D A;  1XFV O;  1CDP A;  1NX3 A;  1XFW O;  2L50 A;  4QJ3 B;  5B8I B;  5CSN A;  1YRU B;  1DTL A;  3CGA A;  5PAL A;  5K89 A;  1B7T Y;  1EL4 A;  2BCB A;  4NQG A;  1KSO A;  1CFC A;  2LVV A;  4I5K A;  1QIV A;  3SJS A;  1CB1 A;  3DVE A;  2L4H A;  2JNX A;  3BXK A;  2CXJ A;  5ER4 X;  3LK1 A;  1R6P A;  4YGD B;  2GGM A;  2MHH A;  4AQJ A;  2LAP A;  2LMV A;  1SCM C;  2Y1N A;  1SCV A;  1AP4 A;  4NDB A;  3BUX B;  4MRY A;  3EVU A;  1IKU A;  1FF1 A;  4P2Y B;  3PAL A;  1A75 B;  3D10 A;  1KQM B;  1PUL A;  2GGZ A;  3CR4 X;  4CPV A;  3EKJ A;  3RM1 A;  1M46 A;  3EK7 A;  1B8L A;  1XVJ A;  3AAJ A; 
#chains in the Genus database with same CATH topology
 1TN4 A;  4MBE A;  5TNC A;  1Y6W A;  2KFH A;  2FOT A;  4JQ0 D;  5DKR A;  1BT6 A;  1YUU A;  1N2D A;  2VRG A;  4INX A;  2Y1M A;  2BE4 A;  2BEC A;  3D74 A;  1KK7 Z;  1PSB A;  1TIZ A;  3IQQ A;  4GPL B;  4PDZ A;  2LP2 A;  1TTX A;  3AAK A;  1N65 A;  1S6J A;  3K1E A;  5D3O A;  1B47 A;  1IG5 A;  1YX7 A;  2QAC A;  3KEV A;  1JWD A;  1LA3 A;  1S6C A;  1XFU O;  2PRU A;  1LVC D;  1NWD A;  1UUR A;  4AQI A;  3SIB A;  4GGF A;  1ZUZ A;  1TNW A;  2NXQ A;  2PMY A;  1REC A;  1UP5 A;  3FE9 A;  1WDC C;  2KHN A;  2PSR A;  5IBW A;  3R1P A;  1QLS A;  1QV0 A;  1J1E A;  2WCB A;  2F3Z A;  1OE9 B;  3KHE A;  4HRE E;  1SR6 B;  4Q04 A;  1F55 A;  3I5G C;  4WQ2 A;  1QX5 B;  2M8U A;  2KBM A;  4N1G A;  4GGN A;  1Q80 A;  2JUL A;  3SS3 A;  3VB1 A;  3CZ0 A;  1F71 A;  2LVI A;  1IIO A;  4DIR A;  1A4P A;  4TNC A;  1XFZ O;  3S0G A;  1YUS A;  3O78 A;  1TCF A;  5EL2 A;  2PAS A;  3PM8 A;  4U8D A;  3EK4 A;  2DOQ A;  1IJ6 A;  4PE4 A;  3SIA A;  2FCD A;  1X02 A;  1BMO A;  3D76 A;  5FYX A;  3H4S E;  1S26 D;  4MN0 A;  1DVI A;  5J3X A;  5KSZ A;  3B87 A;  1CDL A;  1ZFS A;  2LAN A;  3BOW A;  2JWW A;  3V2L A;  2OS8 B;  1S6I A;  2CNP A;  1NP8 A;  3FE8 A;  1BG1 A;  4JWQ A;  3LCP C;  1BJF A;  1NX1 A;  1DJW A;  1T14 A;  3WHU B;  3SS5 A;  1K96 A;  2F2P A;  3CZ1 A;  4A4B A;  1AVS A;  2WCM A;  1W7I B;  2JXL A;  2YGU A;  1MXL C;  4YGC B;  1IQ3 A;  2KYF A;  3TDI A;  1YX8 A;  2M9G A;  1YUR A;  3BFA A;  3RLZ A;  1NX2 A;  3CR5 X;  1JUO A;  4QJ5 B;  3O4Y A;  2NZ0 A;  1DJH A;  3FIA A;  2JT0 A;  2L98 A;  4DS7 A;  1IGV A;  4HSZ A;  1KK8 C;  3FS7 A;  2SCP A;  2BL0 B;  1NX0 A;  2AAO A;  1CFP A;  4PT1 A;  1OMV A;  1KSM A;  1CFD A;  4M2P A;  1RWY A;  2M7L A;  4ICB A;  2NLN A;  2ZKM X;  1RJV A;  2JTT A;  2F8P A;  1Z4H A;  2PAL A;  2GV5 A;  4HRG A;  1BR4 B;  1WY9 A;  2L2C A;  2LLU A;  4C0L A;  5I8N A;  3EK8 A;  1DQE A;  4USL A;  4YI9 A;  3ZNI A;  1OOG A;  3BUO B;  4GFT A;  5CSI A;  1C7V A;  1ODB A;  4CLN A;  1WLM A;  5I2O A;  1M63 B;  2JNF A;  4CFR A;  1OMR A;  3OHM B;  2ZN8 A;  1PVA A;  1KWO C;  2GTE A;  2K2A A;  3AKB A;  4QJ4 B;  1GM0 A;  1PVB A;  1NIW A;  2E6W A;  2JC2 A;  4A4C A;  3BOW B;  4MVF A;  1A03 A;  5KU1 A;  2ISD A;  3L4A A;  2QPT A;  3E3R A;  5KTY A;  3TDU A;  2Q91 A;  3PFV A;  1TNX A;  5FI7 A;  2LLT A;  1K2H A;  2PQL A;  4XJK A;  3GK2 A;  2LUX A;  3CR2 A;  1PSR A;  2WCJ A;  1C3Z A;  2WND A;  2CCM A;  2M1K B;  3SG7 A;  1TRF A;  2P71 A;  4OV2 A;  3NHI A;  3GOF A;  3S0F A;  1M39 A;  2BBM A;  2BCA A;  4ETO A;  1W7J B;  2OTG C;  4PAL A;  5HLV A;  2KBI A;  1XA5 A;  1TCO B;  2LV7 A;  1D1O A;  2KFG A;  1H4B A;  5HKY A;  2JT3 A;  1RK9 A;  3I5G B;  2LE9 B;  4IJ7 A;  2JPT A;  2JQ6 A;  2JPO A;  1SYM A;  2E30 A;  1OZO A;  3CLN A;  2K7B A;  1FBV A;  1LA0 A;  2KPH A;  3S0E A;  3A8R A;  3S0A A;  1QAS A;  1Y1X A;  5BPJ A;  1SW8 A;  2JOJ A;  2KOT A;  3NXA A;  2ZN9 A;  2WOR A;  1ZOT B;  4BY4 A;  2FJU B;  1K94 A;  3NSO A;  3VGO A;  1XO5 A;  1TNQ A;  2LHL A;  2M3W A;  4PE1 A;  1N0Y A;  2KYC A;  1RRO A;  1SMG A;  1R2U A;  3TS5 B;  5AAN A;  4MSP A;  2WOS A;  3BQ3 A;  1OQP A;  3PN7 C;  1AK8 A;  3CWG A;  3OB1 B;  1J1D A;  1UHI A;  1V1F A;  1XYD A;  3PAT A;  5DIC A;  3VRN A;  1EJ3 A;  1PK0 D;  1CFF A;  3DY9 A;  2WCH A;  5CSJ A;  1YVH A;  3L4L A;  4R1E A;  2BE6 A;  2FCE A;  1B4C A;  2MBX A;  1CLB A;  1S5G Z;  4ORB B;  1CTR A;  2LMT A;  1G8I A;  1B8R A;  3BFH A;  2JT8 A;  3L47 A;  2LVK A;  5DKQ A;  5HKZ A;  1V1G A;  3R1V A;  4C0J A;  1UHN A;  4XJK B;  4YGE B;  1QTX A;  2CT9 A;  1FW4 A;  2AUC A;  2MLF C;  5AEQ A;  1AHR A;  1XFY O;  3DZT A;  2F33 A;  1J55 A;  2EC6 C;  3FE6 A;  3BUM B;  1KK8 B;  3NSI A;  1WRL A;  2KI4 B;  2L5X B;  1B9A A;  3O6B A;  5FI6 A;  2SAS A;  3QRX A;  1C7W A;  2Q4U A;  1KFU S;  3O4X A;  4DCK A;  2HPS A;  1ALW A;  1LXF C;  2L5Y A;  3AKA A;  3FWB A;  3BUN B;  4YBH B;  1KQM C;  2MAZ A;  1L2O C;  2KLE A;  2LLS A;  2PVB A;  3EVR A;  3EG5 B;  3CS1 A;  5FI2 A;  2M7N A;  2LCP A;  1K8U A;  4M2O A;  2H61 C;  3KO0 A;  3N7H A;  5HL1 A;  3TUY C;  1NSH A;  1MUX A;  1Y1A A;  2KI6 D;  3GK1 A;  4ORC B;  2CBL A;  1Y1U A;  1K90 D;  2NCP A;  1TNP A;  2JXC A;  2AMI A;  2KFF A;  1CLM A;  1J7R A;  4GAO A;  1TWO A;  3DVK A;  1SKT A;  1U5I A;  2JRF A;  5AFP A;  2JZI A;  2KQY A;  3IF7 A;  1NCY A;  1OOH A;  4FQO A;  3VRQ A;  5AER A;  4E68 A;  1J7Q A;  1Z2C B;  1YVL A;  2BBN A;  2COL B;  1IJ5 A;  2F2O A;  3DD4 A;  3SG4 A;  1H8B A;  4ORA B;  3MSE B;  1YRT B;  3I5F C;  4M2Q A;  3CDN A;  4F7F A;  3JVT C;  3JTD C;  2B1U A;  2LHI A;  4MZJ A;  3UO9 A;  3DVJ A;  1NPQ A;  1B1G A;  3TDZ A;  1J7O A;  1MXE A;  1QJT A;  1UWO A;  4PCW A;  1E8A A;  2MA2 A;  4OVN F;  3VRO A;  3D75 A;  1JFK A;  3DF0 A;  1QS7 A;  2K8M B;  2R2I A;  1F70 A;  1IQ5 A;  3NSK A;  1A29 A;  1SCM B;  2M49 B;  2O5G A;  1WRK A;  3DYE A;  5I2L A;  2KAV A;  4JD9 A;  2M97 A;  2WCE A;  5DKN A;  2M29 A;  2KQ6 A;  1KFX S;  2JTZ A;  2ZFD A;  1DGU A;  2KNE A;  2ZNE A;  4JPZ B;  5HKW A;  1EG4 A;  4DUQ A;  1BOC A;  3IVT A;  1UHH A;  1K95 A;  1ZAC A;  3K21 A;  3SG5 A;  2V53 A;  4PHK A;  1BR1 B;  3PSR A;  1DMO A;  1MWN A;  2OS8 C;  1SL8 A;  3B86 A;  1DJI A;  1SSE B;  3D77 A;  2H8V A;  1FI6 A;  1QIW A;  1IRJ A;  4ZCU A;  1JBA A;  4MRX A;  4XYN A;  2WC5 A;  2L0P A;  3S0D A;  1S5G Y;  1SK6 D;  1CLL A;  3QME A;  1QV1 A;  4MZK A;  4PHN A;  1RFJ A;  1MF8 B;  1L7Z A;  2EHB A;  4MZL A;  3PN7 B;  3KF9 A;  3WNX B;  1YR5 A;  2QEV A;  1WDC B;  3OBV A;  1U5I B;  4IL1 A;  4N1F A;  1BF5 A;  1ALV A;  2MLE C;  2I94 A;  1UHJ A;  4NDD A;  1NCZ A;  3OX6 A;  1SRA A;  1C07 A;  2BCX A;  3LLE A;  1PAL A;  2BL0 C;  4MEW A;  4GGF C;  1KFU L;  1XFX O;  1DF0 B;  1JC2 A;  4CFQ A;  2MJW B;  3R72 A;  5ER5 A;  2HQW A;  3OP0 A;  4L9M A;  1A2X A;  3D0Y B;  2BKI B;  2P6B B;  1IH0 A;  2EC6 B;  1QX2 A;  5HLO A;  4YRU A;  3DF0 B;  2HF5 A;  4GBA A;  4DRW A;  3VRR A;  2WCF A;  4NDC A;  1BOD A;  4D1E A;  1CM4 A;  2G2B A;  1MHO A;  1GGZ A;  5F6T A;  1EH2 A;  4PHJ A;  2EGD A;  4P5O E;  2O60 A;  3M0W A;  1QX7 A;  2NCO A;  1L2O B;  3NGV A;  1FPW A;  2TN4 A;  1NCX A;  1S36 A;  1G4Y R;  1AUI B;  1XK4 C;  2K7O A;  2L4I A;  1DGV A;  4BY5 A;  3I5I C;  3I5H C;  3TUY B;  2LUC A;  3DXL A;  2LC5 A;  1CM1 A;  2K2F A;  3B88 A;  4I5J A;  3S0B A;  1OZS A;  1KQV A;  2QEO A;  5GQQ C;  1S1E A;  4FTG A;  1M31 A;  1DJX A;  4PE0 A;  3BYA A;  1DJG A;  2L51 A;  1QAT A;  4PHM A;  2KAY A;  3WHT B;  2LP3 A;  1QVI Y;  4N5X A;  1JSA A;  1EXR A;  3EVV A;  5G08 A;  4GUK A;  3Q8I A;  4ZCV A;  2ZRS A;  1GJY A;  2WC8 A;  1BLQ A;  2MRD A;  1K93 D;  1K9U A;  3HX4 A;  3SG2 A;  3D73 A;  1BU3 A;  4MLW A;  1QLK A;  1NYA A;  1OMD A;  1OOJ A;  1SBJ A;  1JF0 A;  3I5F B;  3JVT B;  3JTD B;  1Y0V H;  1RTP 1;  5CPV A;  1K9K A;  2K7C A;  2LVJ A;  2QEH A;  2FJY A;  2KSP A;  3LL8 B;  1WRZ A;  1B7T Z;  2QDI A;  1DJZ A;  1CMG A;  1HQV A;  1MQ1 A;  4YGB B;  4I5N B;  1VRK A;  1KFX L;  1UUS A;  2OPO A;  4C0K A;  3PLF B;  2HET A;  1SY9 A;  3HCM A;  2L2E A;  3OGN A;  2KGR A;  4KYN A;  1CMF A;  1W9Z A;  3DVM A;  4I5L B;  2K60 A;  3A4U B;  1CDM A;  2P70 A;  3BFB A;  3OX5 A;  3ZWH A;  2I7A A;  1SNL A;  5HYD A;  1DJY A;  2WCK A;  4YGA A;  1WLZ A;  1SL9 A;  1XK4 A;  1OSA A;  2IS9 A;  2JU0 A;  2KDH A;  2KI6 C;  3IQO A;  1KWO B;  4PE7 A;  1J7P A;  3KPX A;  3SG3 A;  4WQ3 A;  1DEL A;  1AJ4 A;  1CDN A;  5AXI A;  3TZ1 A;  1F8H A;  1C3Y A;  3TS5 C;  3D78 A;  1LIN A;  1GGW A;  1TOP A;  1DF0 A;  2WCL A;  2I18 A;  2KGB C;  3PM2 A;  1B8C A;  3EKH A;  2LMU A;  1LKJ A;  1TUJ A;  2I2R E;  1QVI Z;  3D0Y A;  1QWV A;  4CID A;  4YI8 A;  5I94 A;  5CSF A;  1SR6 C;  1SL7 A;  5I2Q A;  3VRP A;  1M45 A;  2K61 A;  4JKT A;  1ZMZ A;  2RGI A;  3CZ2 A;  3SS4 A;  4OR9 B;  2KAX A;  3GK4 X;  2PYQ A;  2OTG B;  2HQ8 A;  5D7F A;  1AJ5 A;  1IWQ A;  3B6X A;  1NUB A;  2Y5I A;  1JF2 A;  3CZT X;  2G9B A;  1XFR A;  2QEB A;  3LK0 A;  1A75 A;  1KCY A;  2BKH B;  5JJG A;  3CTN A;  1EG3 A;  2KI4 C;  1CKK A;  3C1V A;  2LNK A;  3FWC A;  4F0Z B;  1S3P A;  2H61 A;  2A4J A;  3BUW B;  2H2K A;  1DT7 B;  4UPG A;  1F54 A;  2BAP A;  2ZRT A;  5D69 A;  1YUT A;  2F3Y A;  1YTZ C;  1UHK A;  2D8N A;  4INW A;  3SG6 A;  4AOM A;  4HRH A;  1OOI X;  4WRI A;  1F4O A;  1PRW A;  2LM5 A;  4GNK B;  5JOL A;  1MR8 A;  3ICB A;  2M1U A;  4FQT A;  1JFJ A;  1K9P A;  2Y4Q A;  2ZND A;  3BJH A;  1HT9 A;  2KLD A;  2M0R A;  3F45 A;  1KK7 Y;  1OW4 A;  1CNP A;  3CYZ A;  1GQM A;  3O2P A;  3R1O A;  1DEK A;  1F4Q A;  1QXP A;  1G33 A;  1SPY A;  3CAB A;  1DC1 A;  4OCI A;  4OKH A;  4OZD A;  1FI5 A;  3OB2 B;  3RZS A;  2K0J A;  3I5I B;  3I5H B;  1OOF A;  3NSL A;  2CTN A;  3WXA A;  2K7D A;  1TUZ A;  1XFV O;  1CDP A;  1P28 A;  1NX3 A;  1XFW O;  2L50 A;  4QJ3 B;  5B8I B;  5CSN A;  1YRU B;  3NHT A;  1DTL A;  3CGA A;  5PAL A;  5K89 A;  1B7T Y;  1EL4 A;  2BCB A;  4NQG A;  1KSO A;  2ERB A;  1CFC A;  2LVV A;  4I5K A;  1QIV A;  3SJS A;  1CB1 A;  3DVE A;  1LS8 A;  3UNW A;  2L4H A;  2JNX A;  3BXK A;  2CXJ A;  5ER4 X;  3PJI A;  3LK1 A;  1R6P A;  4YGD B;  2GGM A;  2MHH A;  1ORG A;  4AQJ A;  2LAP A;  2LMV A;  1SCM C;  2Y1N A;  2BNX A;  1SCV A;  1AP4 A;  4NDB A;  3BUX B;  4MRY A;  3EVU A;  1IKU A;  1FF1 A;  3B7A A;  4P2Y B;  3PAL A;  1A75 B;  3D10 A;  1KQM B;  1PUL A;  2GGZ A;  3CR4 X;  4CPV A;  3EKJ A;  3RM1 A;  1M46 A;  2WC6 A;  3EK7 A;  1B8L A;  1XVJ A;  3AAJ A; 
#chains in the Genus database with same CATH homology
 1TN4 A;  4MBE A;  5TNC A;  1Y6W A;  2KFH A;  2FOT A;  4JQ0 D;  5DKR A;  1BT6 A;  1YUU A;  1N2D A;  2VRG A;  2Y1M A;  2BE4 A;  2BEC A;  3IQQ A;  1KK7 Z;  1PSB A;  1TIZ A;  4GPL B;  4PDZ A;  2LP2 A;  1TTX A;  3AAK A;  1N65 A;  1S6J A;  1B47 A;  1IG5 A;  1YX7 A;  2QAC A;  3KEV A;  1JWD A;  1LA3 A;  1S6C A;  1XFU O;  2PRU A;  1LVC D;  1NWD A;  1UUR A;  4AQI A;  3SIB A;  4GGF A;  1ZUZ A;  1TNW A;  2NXQ A;  2PMY A;  1REC A;  1UP5 A;  1WDC C;  2KHN A;  2PSR A;  5IBW A;  1QLS A;  1QV0 A;  1J1E A;  2WCB A;  2F3Z A;  1OE9 B;  3KHE A;  4HRE E;  1SR6 B;  4Q04 A;  1F55 A;  3I5G C;  4WQ2 A;  1QX5 B;  2M8U A;  2KBM A;  4N1G A;  4GGN A;  1Q80 A;  2JUL A;  1F71 A;  2LVI A;  4DIR A;  1A4P A;  4TNC A;  1XFZ O;  1YUS A;  3O78 A;  1TCF A;  2PAS A;  3PM8 A;  4U8D A;  3EK4 A;  2DOQ A;  1IJ6 A;  4PE4 A;  3SIA A;  2FCD A;  1X02 A;  1BMO A;  5FYX A;  3H4S E;  1S26 D;  4MN0 A;  1DVI A;  5J3X A;  5KSZ A;  1CDL A;  1ZFS A;  2LAN A;  3BOW A;  2JWW A;  2OS8 B;  1S6I A;  2CNP A;  1NP8 A;  1BG1 A;  4JWQ A;  3LCP C;  1BJF A;  1NX1 A;  1DJW A;  3WHU B;  1K96 A;  2F2P A;  4A4B A;  1AVS A;  1W7I B;  2JXL A;  1MXL C;  4YGC B;  1IQ3 A;  2KYF A;  3TDI A;  1YX8 A;  2M9G A;  1YUR A;  3RLZ A;  1NX2 A;  3CR5 X;  1JUO A;  4QJ5 B;  3O4Y A;  2NZ0 A;  1DJH A;  3FIA A;  2JT0 A;  2L98 A;  4DS7 A;  1IGV A;  4HSZ A;  1KK8 C;  3FS7 A;  2SCP A;  2BL0 B;  1NX0 A;  2AAO A;  1CFP A;  1OMV A;  1KSM A;  1CFD A;  4M2P A;  1RWY A;  2M7L A;  4ICB A;  2NLN A;  2ZKM X;  1RJV A;  2JTT A;  2F8P A;  2PAL A;  2GV5 A;  4HRG A;  1BR4 B;  1WY9 A;  2LLU A;  4C0L A;  5I8N A;  3EK8 A;  4USL A;  3ZNI A;  4YI9 A;  4GFT A;  3BUO B;  5CSI A;  1C7V A;  1ODB A;  4CLN A;  1WLM A;  5I2O A;  1M63 B;  2JNF A;  4CFR A;  1OMR A;  3OHM B;  2ZN8 A;  1PVA A;  1KWO C;  2K2A A;  3AKB A;  4QJ4 B;  1PVB A;  1NIW A;  2E6W A;  2JC2 A;  4A4C A;  3BOW B;  4MVF A;  1A03 A;  5KU1 A;  2ISD A;  2QPT A;  3E3R A;  5KTY A;  3TDU A;  2Q91 A;  3PFV A;  1TNX A;  2LLT A;  1K2H A;  4XJK A;  3GK2 A;  2LUX A;  3CR2 A;  1PSR A;  2WND A;  2CCM A;  2M1K B;  3SG7 A;  1TRF A;  4OV2 A;  3GOF A;  1M39 A;  2BBM A;  2BCA A;  4ETO A;  1W7J B;  2OTG C;  4PAL A;  5HLV A;  2KBI A;  1XA5 A;  1TCO B;  2LV7 A;  1D1O A;  2KFG A;  1H4B A;  5HKY A;  2JT3 A;  1RK9 A;  3I5G B;  2LE9 B;  2JPT A;  2JQ6 A;  1SYM A;  2E30 A;  1OZO A;  3CLN A;  2K7B A;  1FBV A;  1LA0 A;  3A8R A;  1QAS A;  1Y1X A;  5BPJ A;  1SW8 A;  2JOJ A;  2KOT A;  3NXA A;  2ZN9 A;  2WOR A;  1ZOT B;  4BY4 A;  2FJU B;  1K94 A;  3NSO A;  3VGO A;  1XO5 A;  1TNQ A;  2LHL A;  2M3W A;  4PE1 A;  1N0Y A;  2KYC A;  1RRO A;  1SMG A;  1R2U A;  3TS5 B;  5AAN A;  4MSP A;  2WOS A;  3BQ3 A;  1OQP A;  3PN7 C;  1AK8 A;  3CWG A;  3OB1 B;  1J1D A;  1UHI A;  1V1F A;  1XYD A;  3PAT A;  3VRN A;  1CFF A;  1EJ3 A;  1PK0 D;  5CSJ A;  1YVH A;  4R1E A;  2BE6 A;  2FCE A;  1B4C A;  2MBX A;  1CLB A;  1S5G Z;  4ORB B;  1CTR A;  2LMT A;  1G8I A;  1B8R A;  2JT8 A;  2LVK A;  5DKQ A;  5HKZ A;  1V1G A;  4C0J A;  1UHN A;  4XJK B;  4YGE B;  1QTX A;  2CT9 A;  1FW4 A;  2AUC A;  2MLF C;  5AEQ A;  1AHR A;  1XFY O;  2F33 A;  1J55 A;  2EC6 C;  3NSI A;  3BUM B;  1KK8 B;  1WRL A;  2KI4 B;  2L5X B;  1B9A A;  3O6B A;  2SAS A;  3QRX A;  1C7W A;  2Q4U A;  1KFU S;  4DCK A;  2HPS A;  1ALW A;  1LXF C;  3AKA A;  3FWB A;  3BUN B;  4YBH B;  1KQM C;  2MAZ A;  1L2O C;  2LLS A;  2PVB A;  3EVR A;  3CS1 A;  2M7N A;  2LCP A;  1K8U A;  4M2O A;  2H61 C;  3KO0 A;  3TUY C;  1NSH A;  1MUX A;  1Y1A A;  2KI6 D;  3GK1 A;  4ORC B;  2CBL A;  1Y1U A;  1K90 D;  2NCP A;  1TNP A;  2JXC A;  2AMI A;  2KFF A;  1CLM A;  1J7R A;  4GAO A;  3DVK A;  1SKT A;  1U5I A;  2JRF A;  5AFP A;  2JZI A;  2KQY A;  3IF7 A;  1NCY A;  4FQO A;  5AER A;  3VRQ A;  4E68 A;  1J7Q A;  1YVL A;  2F2O A;  2BBN A;  2COL B;  1IJ5 A;  3DD4 A;  3SG4 A;  1H8B A;  4ORA B;  3MSE B;  1YRT B;  3I5F C;  4M2Q A;  3JVT C;  3JTD C;  2B1U A;  2LHI A;  4MZJ A;  3DVJ A;  1NPQ A;  1B1G A;  3TDZ A;  1J7O A;  1MXE A;  1QJT A;  1UWO A;  4PCW A;  1E8A A;  2MA2 A;  4OVN F;  3VRO A;  1JFK A;  3DF0 A;  1QS7 A;  2K8M B;  2R2I A;  1F70 A;  1IQ5 A;  3NSK A;  1A29 A;  1SCM B;  2M49 B;  2O5G A;  1WRK A;  5I2L A;  2KAV A;  2M97 A;  2WCE A;  5DKN A;  2M29 A;  2KQ6 A;  1KFX S;  2JTZ A;  2ZFD A;  1DGU A;  2KNE A;  2ZNE A;  4JPZ B;  5HKW A;  1EG4 A;  4DUQ A;  1BOC A;  1UHH A;  1K95 A;  1ZAC A;  3K21 A;  3SG5 A;  2V53 A;  4PHK A;  1BR1 B;  3PSR A;  1DMO A;  1MWN A;  2OS8 C;  1SL8 A;  1DJI A;  1FI6 A;  1QIW A;  1IRJ A;  4ZCU A;  1JBA A;  4MRX A;  4XYN A;  2L0P A;  1S5G Y;  1SK6 D;  1CLL A;  4MZK A;  1QV1 A;  4PHN A;  1RFJ A;  1MF8 B;  1L7Z A;  2EHB A;  4MZL A;  3PN7 B;  3KF9 A;  3WNX B;  1YR5 A;  1WDC B;  1U5I B;  4IL1 A;  4N1F A;  1BF5 A;  1ALV A;  2MLE C;  2I94 A;  1UHJ A;  4NDD A;  1NCZ A;  3OX6 A;  1SRA A;  1C07 A;  2BCX A;  3LLE A;  1PAL A;  2BL0 C;  4MEW A;  4GGF C;  1KFU L;  1XFX O;  1DF0 B;  1JC2 A;  4CFQ A;  2MJW B;  5ER5 A;  2HQW A;  3OP0 A;  4L9M A;  1A2X A;  3D0Y B;  2BKI B;  2P6B B;  1IH0 A;  2EC6 B;  1QX2 A;  5HLO A;  4YRU A;  3DF0 B;  2HF5 A;  4GBA A;  4DRW A;  3VRR A;  2WCF A;  4NDC A;  1BOD A;  4D1E A;  1CM4 A;  2G2B A;  1MHO A;  1GGZ A;  5F6T A;  1EH2 A;  4PHJ A;  2EGD A;  4P5O E;  2O60 A;  3M0W A;  1QX7 A;  2NCO A;  1L2O B;  1FPW A;  2TN4 A;  1NCX A;  1S36 A;  1G4Y R;  1AUI B;  1XK4 C;  2K7O A;  2L4I A;  1DGV A;  4BY5 A;  3I5I C;  3I5H C;  3TUY B;  2LUC A;  2LC5 A;  1CM1 A;  2K2F A;  4I5J A;  1OZS A;  1KQV A;  5GQQ C;  1S1E A;  4FTG A;  1M31 A;  1DJX A;  4PE0 A;  3BYA A;  1DJG A;  2L51 A;  1QAT A;  4PHM A;  2KAY A;  3WHT B;  2LP3 A;  1QVI Y;  4N5X A;  1JSA A;  1EXR A;  3EVV A;  5G08 A;  4GUK A;  4ZCV A;  2ZRS A;  1GJY A;  2WC8 A;  1BLQ A;  2MRD A;  1K93 D;  1K9U A;  3HX4 A;  3SG2 A;  1BU3 A;  4MLW A;  1QLK A;  1NYA A;  1OMD A;  1OOJ A;  1SBJ A;  1JF0 A;  3I5F B;  3JVT B;  3JTD B;  1Y0V H;  1RTP 1;  5CPV A;  1K9K A;  2K7C A;  2LVJ A;  1CMG A;  2KSP A;  3LL8 B;  1WRZ A;  1B7T Z;  1DJZ A;  1HQV A;  1MQ1 A;  4YGB B;  4I5N B;  1VRK A;  1KFX L;  1UUS A;  2OPO A;  4C0K A;  3PLF B;  2HET A;  1SY9 A;  3HCM A;  2L2E A;  1CMF A;  2KGR A;  3DVM A;  4I5L B;  3A4U B;  1CDM A;  3OX5 A;  3ZWH A;  2I7A A;  1SNL A;  5HYD A;  1DJY A;  4YGA A;  1WLZ A;  1SL9 A;  1XK4 A;  1OSA A;  2IS9 A;  2JU0 A;  2KDH A;  2KI6 C;  3IQO A;  1KWO B;  4PE7 A;  1J7P A;  3KPX A;  3SG3 A;  4WQ3 A;  1AJ4 A;  1CDN A;  5AXI A;  3TZ1 A;  1F8H A;  3TS5 C;  1LIN A;  1GGW A;  1TOP A;  1DF0 A;  2I18 A;  2KGB C;  1B8C A;  3EKH A;  2LMU A;  1LKJ A;  2I2R E;  1QVI Z;  3D0Y A;  4CID A;  4YI8 A;  5CSF A;  1SR6 C;  1SL7 A;  5I2Q A;  3VRP A;  1M45 A;  2K61 A;  1ZMZ A;  2RGI A;  4OR9 B;  2KAX A;  3GK4 X;  5D7F A;  2OTG B;  2HQ8 A;  1AJ5 A;  1IWQ A;  1NUB A;  2Y5I A;  1JF2 A;  3CZT X;  2G9B A;  3LK0 A;  1A75 A;  1KCY A;  2BKH B;  5JJG A;  3CTN A;  1EG3 A;  2KI4 C;  1CKK A;  3C1V A;  2LNK A;  3FWC A;  4F0Z B;  1S3P A;  2H61 A;  2A4J A;  3BUW B;  2H2K A;  1DT7 B;  4UPG A;  1F54 A;  2ZRT A;  5D69 A;  1YUT A;  2F3Y A;  1YTZ C;  1UHK A;  2D8N A;  3SG6 A;  4AOM A;  4HRH A;  4WRI A;  1F4O A;  1PRW A;  2LM5 A;  4GNK B;  5JOL A;  1MR8 A;  3ICB A;  2M1U A;  1JFJ A;  1K9P A;  2Y4Q A;  2ZND A;  1HT9 A;  2M0R A;  3F45 A;  1KK7 Y;  1CNP A;  1GQM A;  3O2P A;  1F4Q A;  1QXP A;  1G33 A;  1SPY A;  4OCI A;  4OKH A;  1FI5 A;  3OB2 B;  2K0J A;  3I5I B;  3I5H B;  3WXA A;  3NSL A;  2CTN A;  2K7D A;  1XFV O;  1CDP A;  1NX3 A;  1XFW O;  2L50 A;  4QJ3 B;  5B8I B;  5CSN A;  1YRU B;  1DTL A;  3CGA A;  5PAL A;  5K89 A;  1B7T Y;  1EL4 A;  2BCB A;  4NQG A;  1KSO A;  1CFC A;  2LVV A;  4I5K A;  1QIV A;  3SJS A;  1CB1 A;  3DVE A;  2L4H A;  2JNX A;  3BXK A;  2CXJ A;  5ER4 X;  3LK1 A;  1R6P A;  4YGD B;  2GGM A;  2MHH A;  4AQJ A;  2LAP A;  2LMV A;  1SCM C;  2Y1N A;  1SCV A;  1AP4 A;  4NDB A;  3BUX B;  4MRY A;  3EVU A;  1IKU A;  1FF1 A;  4P2Y B;  3PAL A;  1A75 B;  3D10 A;  1KQM B;  1PUL A;  2GGZ A;  3CR4 X;  4CPV A;  3EKJ A;  3RM1 A;  1M46 A;  3EK7 A;  1B8L A;  1XVJ A;  3AAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...