4MBEA

Sac3:sus1:cdc31:nup1 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
b'LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
molecule tags Protein transport, transcription
source organism Saccharomyces cerevisiae
publication title Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
pubmed doi rcsb
total genus 51
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mbeA01
3DVMA 4GGFA 1QVIZ 1RTP1 4MLWA 2F3YA 1TN4A 5I8NA 1F4QA 2K2AA 1NCXA 1ZOTB 2M8UA 3IQQA 4DIRA 1KQMB 2JU0A 3ZWHA 1K9KA 2BCXA 1A75A 2BCAA 1CFFA 2ZNDA 1DJIA 1KWOC 4MSPA 1A03A 1LA0A 1NUBA 3DD4A 1SL8A 4C0LA 3VROA 2BL0B 1TOPA 1IJ5A 2K7BA 4HRHA 4CFRA 1PRWA 1M39A 5CSJA 1SCVA 1IRJA 2GV5A 5CPVA 3PALA 2NCOA 2K61A 1TNPA 2KGRA 2TN4A 2KBIA 2QPTA 3SG6A 4BY4A 4WQ2A 1B7TY 3TDZA 1FF1A 1YURA 3LCPC 3TDUA 2IS9A 1FPWA 2H61A 3MSEB 1XK4A 1BF5A 1S6IA 2JULA 2NXQA 2OTGC 1DT7B 2FOTA 1JF0A 2BECA 1SNLA 4DCKA 1IWQA 2M49B 1R2UA 1SR6B 3ZNIA 2V53A 1AUIB 3D10A 5HKYA 2E30A 5CSFA 4TNCA 1X02A 3BUXB 1DF0B 1YX8A 3FS7A 4U8DA 5PALA 1UHJA 3VRRA 1BMOA 3NSOA 5IBWA 1AP4A 2WC8A 2KOTA 1CDLA 1PALA 3EK4A 3AKAA 4AOMA 1TTXA 1EXRA 2PALA 3RLZA 1CKKA 2LLUA 5I2LA 2JXLA 1MWNA 1ALVA 4N1FA 1LVCD 2LHLA 4PE1A 2JPTA 1DF0A 2FCDA 4ORBB 2NLNA 2JNFA 3FWBA 4MVFA 4C0JA 2EC6B 2LVKA 2I18A 2MA2A 2ISDA 5HYDA 1QASA 1KK8C 2LUCA 1C7VA 1RJVA 3I5HB 3I5FC 4NQGA 1S6CA 1F55A 4ZCVA 2G9BA 2MLFC 1E8AA 4OVNF 4PE4A 2L0PA 5GQQC 1MXEA 1JF2A 2KAXA 1FBVA 2G2BA 3CWGA 4F0ZB 1CLBA 3OHMB 2K7DA 2P6BB 2WOSA 2MAZA 3KF9A 4L9MA 1B8RA 1WLMA 2LMTA 1WRKA 2M7NA 2OS8C 5B8IB 1K96A 3PN7C 4FTGA 4P5OE 1SL9A 4C0KA 5DKQA 3E3RA 2JT0A 4OCIA 3I5HC 2KSPA 1UHKA 3EVVA 3I5IB 1OMVA 1JSAA 3IF7A 2L50A 3O6BA 4MN0A 2WCEA 2A4JA 2BCBA 2MBXA 2K8MB 3VRQA 3SG5A 4I5JA 3SIAA 1L2OB 1YRUB 1SBJA 3I5GB 2RGIA 1XA5A 3HCMA 2MLEC 1J55A 2CTNA 1BR4B 2AUCA 1MQ1A 2JZIA 4PE0A 1N2DA 3FWCA 2KHNA 3LK0A 1AJ4A 1XFUO 2LVIA 1Y6WA 2ZRTA 3QRXA 4YGCB 4QJ4B 1BOCA 1CFDA 1QLKA 3DF0A 4XJKA 3BOWA 1YX7A 1BLQA 1UHNA 3BOWB 2LNKA 2DOQA 1KK7Y 2KDHA 1SY9A 2KBMA 3PLFB 2LANA 1S1EA 3JTDB 2LUXA 3OX6A 4NDDA 1EH2A 5K89A 1KFXL 1TIZA 3TS5B 1KSOA 1BT6A 1KFUL 3D0YB 4GGNA 1FI5A 2K2FA 2FJUB 3BUWB 2LP2A 4USLA 3LK1A 2WCFA 1CFPA 1XFZO 4CFQA 1NX2A 4PHKA 1C7WA 1LKJA 2M3WA 4MZJA 3EK7A 2LC5A 1IH0A 1S3PA 1GGZA 2LM5A 1B9AA 2JT3A 3NSLA 4YRUA 3VRNA 2EHBA 1S36A 1K9UA 1S5GZ 1BODA 1DVIA 3O4YA 3I5FB 2L98A 4D1EA 1M46A 4JPZB 3DF0B 1DJXA 1IKUA 2MRDA 2F2PA 1AJ5A 4PHMA 1R6PA 3OB1B 1QX7A 1M31A 1CM1A 1OSAA 5HKWA 1IJ6A 1NCYA 1TCFA 3BXKA 2E6WA 1J7PA 2OS8B 2LCPA 4DUQA 1EG4A 1WY9A 2F8PA 2L5XB 2ZNEA 5AANA 3TDIA 1K95A 1DJGA 2ZN8A 1SPYA 1J1EA 2LLTA 1B8LA 4AQJA 2WNDA 1OQPA 2BL0C 5D7FA 2WCBA 2FCEA 3OX5A 4MZLA 2LMUA 4YGEB 1U5IB 1RROA 5AXIA 4HSZA 3GK2A 2AMIA 1CLLA 4HRGA 1QS7A 2QACA 4DRWA 1IQ5A 5HKZA 1D1OA 1LA3A 2M1UA 3TUYC 4ORAB 3ICBA 2M9GA 4PCWA 1IGVA 1PULA 1FW4A 2KAYA 2KQ6A 1MR8A 4OKHA 1Y1AA 3GOFA 2LMVA 3SJSA 1ALWA 4JWQA 5F6TA 5BPJA 2KFGA 2COLB 1CMFA 1OZSA 1CLMA 1QV0A 1W7JB 1K2HA 1TNXA 1UP5A 1CNPA 3CR4X 3CR5X 2Y1NA 3C1VA 1M63B 1PSRA 2JXCA 5KU1A 1XK4C 1AHRA 1NSHA 1MF8B 1Q80A 1QIVA 1A75B 1ZACA 3BUMB 1TNQA 4HREE 4PALA 3WHTB 4E68A 1XFWO 3EVUA 3SG2A 3SG4A 1KFUS 1JBAA 2KNEA 2L4HA 1HQVA 2BE4A 3NXAA 4PDZA 1BJFA 1PSBA 2JRFA 1RK9A 5J3XA 2EC6C 1GJYA 4MEWA 4NDBA 4DS7A 3BQ3A 1MXLC 1Y0VH 2Y1MA 5KTYA 1CMGA 3JVTC 1QIWA 1DJYA 2GGZA 2Q91A 3A4UB 2KI6C 3AAJA 1K9PA 2ZN9A 3F45A 3M0WA 4PHJA 5DKNA 4ETOA 1PK0D 3KO0A 1U5IA 2CNPA 1SKTA 2Q4UA 4R1EA 1UHIA 3NSKA 1LXFC 1B4CA 2KFHA 3IQOA 1JFJA 1SCMB 3DVEA 3EKHA 1QVIY 3BYAA 1SMGA 1UWOA 1JC2A 3PATA 4GNKB 1J7OA 1JUOA 1QJTA 1G33A 2HQWA 3CGAA 3CR2A 4QJ5B 4N5XA 1BU3A 2CT9A 1Y1XA 1GQMA 1QX2A 1H4BA 1YR5A 5JOLA 3CZTX 3AKBA 2HF5A 2R2IA 2M7LA 1QTXA 2PVBA 1XVJA 2Y5IA 4BY5A 2HQ8A 3AAKA 2L4IA 4NDCA 1J1DA 2CCMA 1ZUZA 4MBEA 1K94A 1NPQA 3BUNB 5HLOA 3HX4A 1YVLA 5DKRA 1C07A 1WDCB 1IQ3A 2HETA 3OB2B 5FYXA 1XFVO 1NWDA 1OE9B 2KGBC 2EGDA 4YGBB 1V1FA 2ZRSA 2PRUA 5I2OA 1NX1A 2H61C 1EJ3A 3H4SE 3KHEA 1QXPA 2KI4B 2K0JA 1JWDA 4GAOA 4P2YB 4GFTA 1L7ZA 1SCMC 2PSRA 1H8BA 4QJ3B 1V1GA 1QX5B 2JTZA 4YBHB 3LL8B 1CDMA 2KFFA 2I94A 3RM1A 1KK7Z 1CTRA 3GK1A 1M45A 1SYMA 1TNWA 1YTZC 1N0YA 4FQOA 5ER5A 1BG1A 2JT8A 5TNCA 3DVJA 1JFKA 1TCOB 1CM4A 1ZFSA 3WXAA 4I5KA 4AQIA 1BR1B 3TS5C 2NZ0A 1KK8B 3PFVA 5AFPA 2SASA 2LV7A 1WLZA 3VRPA 1B7TZ 1KQMC 1CFCA 2O5GA 1VRKA 4ZCUA 2OTGB 1KWOB 4I5NB 3KPXA 3VGOA 2I7AA 1DMOA 1A4PA 2LVJA 2B1UA 3EK8A 1XO5A 1CDPA 3TZ1A 1SRAA 4M2PA 2BE6A 4UPGA 4MRYA 2KYFA 1YRTB 2NCPA 1NX0A 3I5IC 4IL1A 2JC2A 1NP8A 3TUYB 1B1GA 2CBLA 1XYDA 2BBMA 4GPLB 4WRIA 1YVHA 5CSIA 4N1GA 4PE7A 1OMDA 2GGMA 3BUOB 1WRLA 2H2KA 1J7RA 1NIWA 1DTLA 5KSZA 1K90D 5AERA 2KYCA 1LINA 1WDCC 3DVKA 4GGFC 4CIDA 5HLVA 2D8NA 1AK8A 3SG3A 1NYAA 3GK4X 2F3ZA 4MZKA 1OOJA 1DGUA 1FI6A 2LP3A 2MJWB 1NX3A 1RFJA 2JWWA 3PSRA 1RECA 2SCPA 3O78A 1G8IA 4OV2A 3WHUB 5JJGA 2KAVA 4A4BA 1K93D 1F8HA 1YUUA 2LE9B 3A8RA 5AEQA 1KCYA 1W7IB 3SG7A 2L51A 4XYNA 4PHNA 2MHHA 4ICBA 1DJZA 1K8UA 2O60A 3K21A 1A29A 3NSIA 3OP0A 4WQ3A 4XJKB 2PASA 4A4CA 1UURA 1CB1A 3CLNA 1GGWA 1MHOA 5CSNA 2LVVA 1PVAA 1F71A 1G4YR 4M2OA 3PN7B 1YUSA 1B8CA 2LHIA 1SW8A 1EG3A 1MUXA 2CXJA 2Y4QA 2OPOA 4YGAA 4JQ0D 2BBNA 3EVRA 1NCZA 1HT9A 1KSMA 2AAOA 3O2PA 1L2OC 1ZMZA 2HPSA 3I5GC 4M2QA 2LAPA 5D69A 2M97A 1SR6C 1SK6D 2F33A 3JTDC 1QLSA 3D0YA 4YI8A 3FIAA 3CTNA 3EKJA 4I5LB 4CPVA 1A2XA 4ORCB 1J7QA 3WNXB 3CS1A 1DGVA 2LLSA 1N65A 3LLEA 1OMRA 1QV1A 1TRFA 5I2QA 2KQYA 1AVSA 1EL4A 1ODBA 1WRZA 2JQ6A 1UUSA 1KQVA 2PMYA 4Q04A 1XFXO 2JNXA 1F70A 1DJWA 3SIBA 2L2EA 2I2RE 1F4OA 2K7OA 2JTTA 4GBAA 3PM8A 1CDNA 2M29A 4CLNA 1OZOA 2F2OA 2M1KB 2VRGA 1PVBA 2BKHB 1YUTA 2K7CA 4OR9B 1S26D 2ZKMX 1SL7A 4MRXA 5ER4X 1RWYA 2JOJA 2KI6D 1S5GY 1F54A 1IG5A 1B47A 2BKIB 3JVTB 4YI9A 2M0RA 2ZFDA 1Y1UA 3KEVA 2WORA 5G08A 1XFYO 1S6JA 2KI4C 4YGDB 1KFXS 1DJHA 1UHHA 4GUKA 1QATA
chains in the Genus database with same CATH superfamily
3DVMA 4GGFA 1QVIZ 1RTP1 4MLWA 2F3YA 1TN4A 5I8NA 1F4QA 2K2AA 1NCXA 3BFAA 1ZOTB 2M8UA 3B86A 3N7HA 3IQQA 4DIRA 1KQMB 2JU0A 3ZWHA 1K9KA 2BCXA 1A75A 2BCAA 1CFFA 2ZNDA 3CZ1A 1DJIA 1KWOC 4MSPA 1A03A 1LA0A 1NUBA 3DD4A 1SL8A 2KLDA 4C0LA 3VROA 2BL0B 1TOPA 1IJ5A 3S0AA 2K7BA 4HRHA 4CFRA 1PRWA 1M39A 5CSJA 3S0GA 1SCVA 1IRJA 2GV5A 5CPVA 3PALA 2NCOA 2K61A 1TNPA 2KGRA 2TN4A 2KBIA 2QPTA 3SG6A 4BY4A 4WQ2A 1B7TY 3TDZA 1SSEB 1FF1A 1YURA 1IIOA 3LCPC 3PM2A 2IS9A 3TDUA 1FPWA 2H61A 3MSEB 1XK4A 1BF5A 1S6IA 2QEBA 2JULA 2NXQA 2OTGC 1DT7B 2FOTA 1JF0A 2WCJA 2BECA 1SNLA 2WCMA 4DCKA 1QWVA 1IWQA 2M49B 1R2UA 1SR6B 2H8VA 3ZNIA 2V53A 1AUIB 3D10A 5HKYA 2E30A 5CSFA 4TNCA 2YGUA 1X02A 3BUXB 1DF0B 1YX8A 3FS7A 4U8DA 5PALA 1UHJA 3VRRA 1BMOA 3NSOA 5IBWA 1AP4A 2WC8A 2KOTA 1CDLA 1PALA 3EK4A 3AKAA 4AOMA 1TTXA 1EXRA 2PALA 3RLZA 1CKKA 2LLUA 5I2LA 2JXLA 1MWNA 3D76A 1ALVA 4N1FA 1LVCD 2LHLA 4PE1A 2KLEA 2L5YA 2JPTA 1DF0A 2FCDA 4ORBB 2NLNA 2JNFA 3FWBA 4MVFA 4C0JA 2EC6B 2LVKA 2I18A 2MA2A 2ISDA 5HYDA 1QASA 1KK8C 2LUCA 1C7VA 3S0DA 1RJVA 3I5HB 3I5FC 4NQGA 1S6CA 3D78A 3CABA 1F55A 4ZCVA 2G9BA 2MLFC 1E8AA 4OVNF 1DELA 4PE4A 2L0PA 2QEHA 1MXEA 1JF2A 2KAXA 1FBVA 5GQQC 2G2BA 3CWGA 4F0ZB 1CLBA 3OHMB 2K7DA 1GM0A 2P6BB 2WOSA 5EL2A 2MAZA 3KF9A 4L9MA 1B8RA 1WLMA 2LMTA 1WRKA 2M7NA 2OS8C 5B8IB 1K96A 3PN7C 4FTGA 4P5OE 1SL9A 4C0KA 5DKQA 3E3RA 2JT0A 4OCIA 3I5HC 2KSPA 3L47A 1UHKA 2PYQA 3EVVA 3I5IB 1OMVA 1JSAA 2PQLA 3IF7A 2L50A 3O6BA 4MN0A 2WCEA 2A4JA 2BCBA 2MBXA 2K8MB 3R72A 3VRQA 3SG5A 4I5JA 3SIAA 1L2OB 1YRUB 1SBJA 3I5GB 1Z4HA 2ERBA 2RGIA 3S0FA 1XA5A 3HCMA 2MLEC 1J55A 4F7FA 3IVTA 2CTNA 1BR4B 2AUCA 1MQ1A 2JZIA 4PE0A 1N2DA 2WCKA 3FWCA 2KHNA 3LK0A 1AJ4A 1XFUO 2LVIA 1Y6WA 2ZRTA 3QRXA 4YGCB 4QJ4B 1BOCA 2QEVA 1CFDA 1QLKA 3DF0A 3D73A 4XJKA 3BOWA 1YX7A 1BLQA 1UHNA 3BOWB 3K1EA 2LNKA 2DOQA 1KK7Y 2KDHA 1SY9A 2KBMA 3PLFB 2LANA 1S1EA 3JTDB 3RZSA 2LUXA 3OX6A 1C3ZA 4NDDA 1C3YA 1EH2A 5K89A 1KFXL 1TIZA 1TUJA 1KSOA 1BT6A 1KFUL 1OOGA 1Z2CB 3D0YB 4GGNA 3TS5B 2K2FA 1FI5A 2FJUB 3BUWB 3SS3A 2LP2A 4USLA 3B88A 3LK1A 2WCFA 3BFHA 1CFPA 1XFZO 4CFQA 1DEKA 1NX2A 4PHKA 1C7WA 1LKJA 1TUZA 2M3WA 4MZJA 3EK7A 2LC5A 1IH0A 1S3PA 1GGZA 2LM5A 1B9AA 2JT3A 3NSLA 2L2CA 5D3OA 2WCLA 3VRNA 2EHBA 4YRUA 1S36A 1K9UA 1S5GZ 1BODA 1DVIA 4JD9A 3O4YA 2KPHA 3I5FB 2L98A 4D1EA 1M46A 4JPZB 3DF0B 1DJXA 1IKUA 2MRDA 2F2PA 1AJ5A 4PHMA 1R6PA 3OB1B 1QX7A 1M31A 1CM1A 1OSAA 3O4XA 5HKWA 1IJ6A 1NCYA 1TCFA 3BXKA 2E6WA 1J7PA 2OS8B 2LCPA 4DUQA 3SS4A 1EG4A 1WY9A 2F8PA 2L5XB 2ZNEA 5AANA 3TDIA 1K95A 1W9ZA 1DJGA 2ZN8A 1SPYA 1J1EA 1OOHA 1DQEA 2LLTA 1B8LA 4AQJA 2WNDA 1OQPA 3R1OA 2BL0C 5D7FA 2WCBA 2FCEA 3OX5A 4MZLA 5FI2A 2LMUA 4YGEB 1U5IB 3NHTA 2WC5A 1RROA 5AXIA 4HSZA 3GK2A 2AMIA 1CLLA 4HRGA 1QS7A 2QACA 3CDNA 4DRWA 1IQ5A 5HKZA 1D1OA 1LA3A 2M1UA 3TUYC 4ORAB 3ICBA 2M9GA 4PCWA 1IGVA 4FQTA 1PULA 1FW4A 2KAYA 2KQ6A 2FJYA 1MR8A 4OKHA 3NHIA 1Y1AA 3GOFA 2LMVA 3SJSA 1ALWA 4JWQA 5F6TA 5BPJA 2KFGA 2COLB 3R1PA 4PT1A 1OZSA 1CMFA 1CLMA 1QV0A 1W7JB 1K2HA 1TNXA 1UP5A 1CNPA 3CR4X 3CR5X 2Y1NA 3C1VA 1M63B 1PSRA 2JXCA 5KU1A 1XK4C 1AHRA 1NSHA 1MF8B 1Q80A 1QIVA 1A75B 1ZACA 3BUMB 1TNQA 4HREE 4PALA 3WHTB 4E68A 1XFWO 3EVUA 3SG2A 3SG4A 1KFUS 1JBAA 2KNEA 2L4HA 1HQVA 2BE4A 3NXAA 4PDZA 1BJFA 3S0EA 1PSBA 2JRFA 1RK9A 3FE6A 5J3XA 2EC6C 1GJYA 4MEWA 4NDBA 4DS7A 3BQ3A 1MXLC 1Y0VH 2Y1MA 5KTYA 1CMGA 3JVTC 1QIWA 1DJYA 2GGZA 2Q91A 3A4UB 2KI6C 3AAJA 1K9PA 2ZN9A 3F45A 3M0WA 4PHJA 5DKNA 4ETOA 1PK0D 3KO0A 1U5IA 2CNPA 2BNXA 1SKTA 1P28A 2Q4UA 4R1EA 1UHIA 3NSKA 1LXFC 3L4AA 1B4CA 2P71A 2KFHA 3IQOA 1JFJA 1SCMB 3DVEA 3EKHA 1QVIY 3BYAA 1SMGA 1UWOA 1JC2A 3PATA 4GNKB 1J7OA 1JUOA 1QJTA 1G33A 2HQWA 3CGAA 3CR2A 4QJ5B 4KYNA 4N5XA 1BU3A 2CT9A 1Y1XA 1GQMA 1QX2A 1H4BA 1YR5A 5JOLA 3CZTX 3QMEA 3AKBA 2HF5A 2R2IA 2M7LA 1QTXA 2PVBA 1XVJA 2Y5IA 4BY5A 2HQ8A 3AAKA 2L4IA 4NDCA 1J1DA 2CCMA 1ZUZA 4MBEA 1K94A 1NPQA 3BUNB 5HLOA 3HX4A 5FI7A 1YVLA 5DKRA 1C07A 1WDCB 2P70A 1IQ3A 2HETA 3OB2B 1ORGA 3DZTA 5FYXA 1XFVO 1NWDA 1OE9B 2KGBC 2QDIA 2EGDA 4YGBB 1V1FA 2ZRSA 2PRUA 5I2OA 2JPOA 1NX1A 2H61C 1EJ3A 3H4SE 3KHEA 1QXPA 2KI4B 2K0JA 1JWDA 4GAOA 4P2YB 4GFTA 1L7ZA 1SCMC 2PSRA 4JKTA 1H8BA 4QJ3B 1V1GA 1QX5B 2JTZA 4YBHB 3LL8B 1CDMA 2KFFA 2I94A 3RM1A 1T14A 1KK7Z 5DICA 1CTRA 3S0BA 3EG5B 3GK1A 1M45A 1SYMA 1TNWA 1YTZC 1N0YA 4FQOA 5ER5A 1BG1A 2JT8A 5TNCA 3DVJA 3UNWA 5HL1A 1JFKA 1TCOB 1CM4A 3L4LA 1ZFSA 2QEOA 3WXAA 4I5KA 4INWA 4AQIA 1BR1B 3TS5C 2NZ0A 1KK8B 3CYZA 3PFVA 5AFPA 2SASA 2LV7A 1WLZA 3VRPA 1B7TZ 1KQMC 1CFCA 2O5GA 3VB1A 1VRKA 4ZCUA 2OTGB 1KWOB 4I5NB 3KPXA 3DXLA 3VGOA 2I7AA 1DMOA 1A4PA 2LVJA 2B1UA 3D77A 3EK8A 1XFRA 3UO9A 5I94A 1XO5A 1CDPA 3TZ1A 3FE9A 1SRAA 4M2PA 3B6XA 2BE6A 4UPGA 4MRYA 2KYFA 1YRTB 2NCPA 1NX0A 3I5IC 4IL1A 2JC2A 1NP8A 3PJIA 3TUYB 1B1GA 2CBLA 1XYDA 2BBMA 4GPLB 4INXA 4WRIA 1YVHA 2WC6A 5FI6A 5CSIA 4N1GA 4PE7A 1OMDA 2GGMA 3BUOB 1WRLA 3DYEA 2H2KA 1J7RA 1NIWA 1DTLA 5KSZA 1K90D 5AERA 2KYCA 1LINA 1WDCC 3DVKA 4GGFC 4CIDA 5HLVA 2D8NA 2GTEA 1AK8A 3SG3A 1NYAA 2BAPA 3GK4X 3OGNA 2F3ZA 4MZKA 1OOJA 1DGUA 3B7AA 1FI6A 2LP3A 2MJWB 1NX3A 1RFJA 2JWWA 3PSRA 1RECA 2SCPA 3O78A 1G8IA 4OV2A 3WHUB 5JJGA 2KAVA 4A4BA 1K93D 2K60A 1F8HA 1OOIX 1YUUA 2LE9B 3A8RA 3OBVA 5AEQA 1W7IB 3SG7A 1KCYA 3CZ0A 2L51A 4XYNA 4PHNA 2MHHA 4ICBA 1DJZA 1K8UA 2O60A 3SS5A 3K21A 1A29A 3NSIA 3OP0A 4WQ3A 4OZDA 1OW4A 1OOFA 3R1VA 4XJKB 2PASA 4A4CA 1UURA 1CB1A 3CLNA 1GGWA 1MHOA 5CSNA 2LVVA 3D75A 3BJHA 1PVAA 1F71A 1G4YR 4M2OA 3V2LA 3PN7B 3CZ2A 1YUSA 1B8CA 2LHIA 1SW8A 1EG3A 1MUXA 2CXJA 2Y4QA 2OPOA 4YGAA 4JQ0D 2WCHA 2BBNA 3EVRA 3FE8A 1NCZA 3Q8IA 1HT9A 1KSMA 2AAOA 3O2PA 1L2OC 1ZMZA 2HPSA 3I5GC 4IJ7A 2LAPA 4M2QA 2M97A 1SR6C 1SK6D 2F33A 3JTDC 1QLSA 3D0YA 4YI8A 3FIAA 3CTNA 3EKJA 4I5LB 4CPVA 1A2XA 4ORCB 1J7QA 3WNXB 3CS1A 1DGVA 2LLSA 1N65A 1DC1A 3LLEA 1OMRA 1QV1A 1TRFA 5I2QA 2KQYA 1AVSA 1EL4A 1ODBA 1WRZA 2JQ6A 1UUSA 3BFBA 1KQVA 2PMYA 4Q04A 1XFXO 3DY9A 2JNXA 1F70A 1DJWA 3SIBA 2L2EA 2I2RE 1F4OA 1LS8A 2JTTA 2K7OA 4GBAA 5D69A 3PM8A 3B87A 1CDNA 2M29A 4CLNA 1OZOA 2F2OA 2M1KB 2VRGA 1PVBA 2BKHB 1YUTA 2K7CA 4OR9B 1S26D 2ZKMX 1SL7A 4MRXA 5ER4X 1RWYA 2JOJA 2KI6D 1S5GY 1F54A 1IG5A 1B47A 2BKIB 3JVTB 3NGVA 4YI9A 1TWOA 2M0RA 2ZFDA 1Y1UA 3KEVA 2WORA 5G08A 1XFYO 1S6JA 2KI4C 4YGDB 1KFXS 1DJHA 3D74A 1UHHA 4GUKA 1QATA
chains in the Genus database with same CATH topology
3DVMA 4GGFA 1QVIZ 1RTP1 4MLWA 2F3YA 1TN4A 5I8NA 1F4QA 2K2AA 1NCXA 1ZOTB 2M8UA 3IQQA 4DIRA 1KQMB 2JU0A 3ZWHA 1K9KA 2BCXA 1A75A 2BCAA 1CFFA 2ZNDA 1DJIA 1KWOC 4MSPA 1A03A 1LA0A 1NUBA 3DD4A 1SL8A 4C0LA 3VROA 2BL0B 1TOPA 1IJ5A 2K7BA 4HRHA 4CFRA 1PRWA 1M39A 5CSJA 1SCVA 1IRJA 2GV5A 5CPVA 3PALA 2NCOA 2K61A 1TNPA 2KGRA 2TN4A 2KBIA 2QPTA 3SG6A 4BY4A 4WQ2A 1B7TY 3TDZA 1FF1A 1YURA 3LCPC 3TDUA 2IS9A 1FPWA 2H61A 3MSEB 1XK4A 1BF5A 1S6IA 2JULA 2NXQA 2OTGC 1DT7B 2FOTA 1JF0A 2BECA 1SNLA 4DCKA 1IWQA 2M49B 1R2UA 1SR6B 3ZNIA 2V53A 1AUIB 3D10A 5HKYA 2E30A 5CSFA 4TNCA 1X02A 3BUXB 1DF0B 1YX8A 3FS7A 4U8DA 5PALA 1UHJA 3VRRA 1BMOA 3NSOA 5IBWA 1AP4A 2WC8A 2KOTA 1CDLA 1PALA 3EK4A 3AKAA 4AOMA 1TTXA 1EXRA 2PALA 3RLZA 1CKKA 2LLUA 5I2LA 2JXLA 1MWNA 1ALVA 4N1FA 1LVCD 2LHLA 4PE1A 2JPTA 1DF0A 2FCDA 4ORBB 2NLNA 2JNFA 3FWBA 4MVFA 4C0JA 2EC6B 2LVKA 2I18A 2MA2A 2ISDA 5HYDA 1QASA 1KK8C 2LUCA 1C7VA 1RJVA 3I5HB 3I5FC 4NQGA 1S6CA 1F55A 4ZCVA 2G9BA 2MLFC 1E8AA 4OVNF 4PE4A 2L0PA 5GQQC 1MXEA 1JF2A 2KAXA 1FBVA 2G2BA 3CWGA 4F0ZB 1CLBA 3OHMB 2K7DA 2P6BB 2WOSA 2MAZA 3KF9A 4L9MA 1B8RA 1WLMA 2LMTA 1WRKA 2M7NA 2OS8C 5B8IB 1K96A 3PN7C 4FTGA 4P5OE 1SL9A 4C0KA 5DKQA 3E3RA 2JT0A 4OCIA 3I5HC 2KSPA 1UHKA 3EVVA 3I5IB 1OMVA 1JSAA 3IF7A 2L50A 3O6BA 4MN0A 2WCEA 2A4JA 2BCBA 2MBXA 2K8MB 3VRQA 3SG5A 4I5JA 3SIAA 1L2OB 1YRUB 1SBJA 3I5GB 2RGIA 1XA5A 3HCMA 2MLEC 1J55A 2CTNA 1BR4B 2AUCA 1MQ1A 2JZIA 4PE0A 1N2DA 3FWCA 2KHNA 3LK0A 1AJ4A 1XFUO 2LVIA 1Y6WA 2ZRTA 3QRXA 4YGCB 4QJ4B 1BOCA 1CFDA 1QLKA 3DF0A 4XJKA 3BOWA 1YX7A 1BLQA 1UHNA 3BOWB 2LNKA 2DOQA 1KK7Y 2KDHA 1SY9A 2KBMA 3PLFB 2LANA 1S1EA 3JTDB 2LUXA 3OX6A 4NDDA 1EH2A 5K89A 1KFXL 1TIZA 3TS5B 1KSOA 1BT6A 1KFUL 3D0YB 4GGNA 1FI5A 2K2FA 2FJUB 3BUWB 2LP2A 4USLA 3LK1A 2WCFA 1CFPA 1XFZO 4CFQA 1NX2A 4PHKA 1C7WA 1LKJA 2M3WA 4MZJA 3EK7A 2LC5A 1IH0A 1S3PA 1GGZA 2LM5A 1B9AA 2JT3A 3NSLA 4YRUA 3VRNA 2EHBA 1S36A 1K9UA 1S5GZ 1BODA 1DVIA 3O4YA 3I5FB 2L98A 4D1EA 1M46A 4JPZB 3DF0B 1DJXA 1IKUA 2MRDA 2F2PA 1AJ5A 4PHMA 1R6PA 3OB1B 1QX7A 1M31A 1CM1A 1OSAA 5HKWA 1IJ6A 1NCYA 1TCFA 3BXKA 2E6WA 1J7PA 2OS8B 2LCPA 4DUQA 1EG4A 1WY9A 2F8PA 2L5XB 2ZNEA 5AANA 3TDIA 1K95A 1DJGA 2ZN8A 1SPYA 1J1EA 2LLTA 1B8LA 4AQJA 2WNDA 1OQPA 2BL0C 5D7FA 2WCBA 2FCEA 3OX5A 4MZLA 2LMUA 4YGEB 1U5IB 1RROA 5AXIA 4HSZA 3GK2A 2AMIA 1CLLA 4HRGA 1QS7A 2QACA 4DRWA 1IQ5A 5HKZA 1D1OA 1LA3A 2M1UA 3TUYC 4ORAB 3ICBA 2M9GA 4PCWA 1IGVA 1PULA 1FW4A 2KAYA 2KQ6A 1MR8A 4OKHA 1Y1AA 3GOFA 2LMVA 3SJSA 1ALWA 4JWQA 5F6TA 5BPJA 2KFGA 2COLB 1CMFA 1OZSA 1CLMA 1QV0A 1W7JB 1K2HA 1TNXA 1UP5A 1CNPA 3CR4X 3CR5X 2Y1NA 3C1VA 1M63B 1PSRA 2JXCA 5KU1A 1XK4C 1AHRA 1NSHA 1MF8B 1Q80A 1QIVA 1A75B 1ZACA 3BUMB 1TNQA 4HREE 4PALA 3WHTB 4E68A 1XFWO 3EVUA 3SG2A 3SG4A 1KFUS 1JBAA 2KNEA 2L4HA 1HQVA 2BE4A 3NXAA 4PDZA 1BJFA 1PSBA 2JRFA 1RK9A 5J3XA 2EC6C 1GJYA 4MEWA 4NDBA 4DS7A 3BQ3A 1MXLC 1Y0VH 2Y1MA 5KTYA 1CMGA 3JVTC 1QIWA 1DJYA 2GGZA 2Q91A 3A4UB 2KI6C 3AAJA 1K9PA 2ZN9A 3F45A 3M0WA 4PHJA 5DKNA 4ETOA 1PK0D 3KO0A 1U5IA 2CNPA 1SKTA 2Q4UA 4R1EA 1UHIA 3NSKA 1LXFC 1B4CA 2KFHA 3IQOA 1JFJA 1SCMB 3DVEA 3EKHA 1QVIY 3BYAA 1SMGA 1UWOA 1JC2A 3PATA 4GNKB 1J7OA 1JUOA 1QJTA 1G33A 2HQWA 3CGAA 3CR2A 4QJ5B 4N5XA 1BU3A 2CT9A 1Y1XA 1GQMA 1QX2A 1H4BA 1YR5A 5JOLA 3CZTX 3AKBA 2HF5A 2R2IA 2M7LA 1QTXA 2PVBA 1XVJA 2Y5IA 4BY5A 2HQ8A 3AAKA 2L4IA 4NDCA 1J1DA 2CCMA 1ZUZA 4MBEA 1K94A 1NPQA 3BUNB 5HLOA 3HX4A 1YVLA 5DKRA 1C07A 1WDCB 1IQ3A 2HETA 3OB2B 5FYXA 1XFVO 1NWDA 1OE9B 2KGBC 2EGDA 4YGBB 1V1FA 2ZRSA 2PRUA 5I2OA 1NX1A 2H61C 1EJ3A 3H4SE 3KHEA 1QXPA 2KI4B 2K0JA 1JWDA 4GAOA 4P2YB 4GFTA 1L7ZA 1SCMC 2PSRA 1H8BA 4QJ3B 1V1GA 1QX5B 2JTZA 4YBHB 3LL8B 1CDMA 2KFFA 2I94A 3RM1A 1KK7Z 1CTRA 3GK1A 1M45A 1SYMA 1TNWA 1YTZC 1N0YA 4FQOA 5ER5A 1BG1A 2JT8A 5TNCA 3DVJA 1JFKA 1TCOB 1CM4A 1ZFSA 3WXAA 4I5KA 4AQIA 1BR1B 3TS5C 2NZ0A 1KK8B 3PFVA 5AFPA 2SASA 2LV7A 1WLZA 3VRPA 1B7TZ 1KQMC 1CFCA 2O5GA 1VRKA 4ZCUA 2OTGB 1KWOB 4I5NB 3KPXA 3VGOA 2I7AA 1DMOA 1A4PA 2LVJA 2B1UA 3EK8A 1XO5A 1CDPA 3TZ1A 1SRAA 4M2PA 2BE6A 4UPGA 4MRYA 2KYFA 1YRTB 2NCPA 1NX0A 3I5IC 4IL1A 2JC2A 1NP8A 3TUYB 1B1GA 2CBLA 1XYDA 2BBMA 4GPLB 4WRIA 1YVHA 5CSIA 4N1GA 4PE7A 1OMDA 2GGMA 3BUOB 1WRLA 2H2KA 1J7RA 1NIWA 1DTLA 5KSZA 1K90D 5AERA 2KYCA 1LINA 1WDCC 3DVKA 4GGFC 4CIDA 5HLVA 2D8NA 1AK8A 3SG3A 1NYAA 3GK4X 2F3ZA 4MZKA 1OOJA 1DGUA 1FI6A 2LP3A 2MJWB 1NX3A 1RFJA 2JWWA 3PSRA 1RECA 2SCPA 3O78A 1G8IA 4OV2A 3WHUB 5JJGA 2KAVA 4A4BA 1K93D 1F8HA 1YUUA 2LE9B 3A8RA 5AEQA 1KCYA 1W7IB 3SG7A 2L51A 4XYNA 4PHNA 2MHHA 4ICBA 1DJZA 1K8UA 2O60A 3K21A 1A29A 3NSIA 3OP0A 4WQ3A 4XJKB 2PASA 4A4CA 1UURA 1CB1A 3CLNA 1GGWA 1MHOA 5CSNA 2LVVA 1PVAA 1F71A 1G4YR 4M2OA 3PN7B 1YUSA 1B8CA 2LHIA 1SW8A 1EG3A 1MUXA 2CXJA 2Y4QA 2OPOA 4YGAA 4JQ0D 2BBNA 3EVRA 1NCZA 1HT9A 1KSMA 2AAOA 3O2PA 1L2OC 1ZMZA 2HPSA 3I5GC 4M2QA 2LAPA 5D69A 2M97A 1SR6C 1SK6D 2F33A 3JTDC 1QLSA 3D0YA 4YI8A 3FIAA 3CTNA 3EKJA 4I5LB 4CPVA 1A2XA 4ORCB 1J7QA 3WNXB 3CS1A 1DGVA 2LLSA 1N65A 3LLEA 1OMRA 1QV1A 1TRFA 5I2QA 2KQYA 1AVSA 1EL4A 1ODBA 1WRZA 2JQ6A 1UUSA 1KQVA 2PMYA 4Q04A 1XFXO 2JNXA 1F70A 1DJWA 3SIBA 2L2EA 2I2RE 1F4OA 2K7OA 2JTTA 4GBAA 3PM8A 1CDNA 2M29A 4CLNA 1OZOA 2F2OA 2M1KB 2VRGA 1PVBA 2BKHB 1YUTA 2K7CA 4OR9B 1S26D 2ZKMX 1SL7A 4MRXA 5ER4X 1RWYA 2JOJA 2KI6D 1S5GY 1F54A 1IG5A 1B47A 2BKIB 3JVTB 4YI9A 2M0RA 2ZFDA 1Y1UA 3KEVA 2WORA 5G08A 1XFYO 1S6JA 2KI4C 4YGDB 1KFXS 1DJHA 1UHHA 4GUKA 1QATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVM A;  4GGF A;  1QVI Z;  1RTP 1;  4MLW A;  2F3Y A;  1TN4 A;  5I8N A;  1F4Q A;  2K2A A;  1NCX A;  1ZOT B;  2M8U A;  3IQQ A;  4DIR A;  1KQM B;  2JU0 A;  3ZWH A;  1K9K A;  2BCX A;  1A75 A;  2BCA A;  1CFF A;  2ZND A;  1DJI A;  1KWO C;  4MSP A;  1A03 A;  1LA0 A;  1NUB A;  3DD4 A;  1SL8 A;  4C0L A;  3VRO A;  2BL0 B;  1TOP A;  1IJ5 A;  2K7B A;  4HRH A;  4CFR A;  1PRW A;  1M39 A;  5CSJ A;  1SCV A;  1IRJ A;  2GV5 A;  5CPV A;  3PAL A;  2NCO A;  2K61 A;  1TNP A;  2KGR A;  2TN4 A;  2KBI A;  2QPT A;  3SG6 A;  4BY4 A;  4WQ2 A;  1B7T Y;  3TDZ A;  1FF1 A;  1YUR A;  3LCP C;  3TDU A;  2IS9 A;  1FPW A;  2H61 A;  3MSE B;  1XK4 A;  1BF5 A;  1S6I A;  2JUL A;  2NXQ A;  2OTG C;  1DT7 B;  2FOT A;  1JF0 A;  2BEC A;  1SNL A;  4DCK A;  1IWQ A;  2M49 B;  1R2U A;  1SR6 B;  3ZNI A;  2V53 A;  1AUI B;  3D10 A;  5HKY A;  2E30 A;  5CSF A;  4TNC A;  1X02 A;  3BUX B;  1DF0 B;  1YX8 A;  3FS7 A;  4U8D A;  5PAL A;  1UHJ A;  3VRR A;  1BMO A;  3NSO A;  5IBW A;  1AP4 A;  2WC8 A;  2KOT A;  1CDL A;  1PAL A;  3EK4 A;  3AKA A;  4AOM A;  1TTX A;  1EXR A;  2PAL A;  3RLZ A;  1CKK A;  2LLU A;  5I2L A;  2JXL A;  1MWN A;  1ALV A;  4N1F A;  1LVC D;  2LHL A;  4PE1 A;  2JPT A;  1DF0 A;  2FCD A;  4ORB B;  2NLN A;  2JNF A;  3FWB A;  4MVF A;  4C0J A;  2EC6 B;  2LVK A;  2I18 A;  2MA2 A;  2ISD A;  5HYD A;  1QAS A;  1KK8 C;  2LUC A;  1C7V A;  1RJV A;  3I5H B;  3I5F C;  4NQG A;  1S6C A;  1F55 A;  4ZCV A;  2G9B A;  2MLF C;  1E8A A;  4OVN F;  4PE4 A;  2L0P A;  5GQQ C;  1MXE A;  1JF2 A;  2KAX A;  1FBV A;  2G2B A;  3CWG A;  4F0Z B;  1CLB A;  3OHM B;  2K7D A;  2P6B B;  2WOS A;  2MAZ A;  3KF9 A;  4L9M A;  1B8R A;  1WLM A;  2LMT A;  1WRK A;  2M7N A;  2OS8 C;  5B8I B;  1K96 A;  3PN7 C;  4FTG A;  4P5O E;  1SL9 A;  4C0K A;  5DKQ A;  3E3R A;  2JT0 A;  4OCI A;  3I5H C;  2KSP A;  1UHK A;  3EVV A;  3I5I B;  1OMV A;  1JSA A;  3IF7 A;  2L50 A;  3O6B A;  4MN0 A;  2WCE A;  2A4J A;  2BCB A;  2MBX A;  2K8M B;  3VRQ A;  3SG5 A;  4I5J A;  3SIA A;  1L2O B;  1YRU B;  1SBJ A;  3I5G B;  2RGI A;  1XA5 A;  3HCM A;  2MLE C;  1J55 A;  2CTN A;  1BR4 B;  2AUC A;  1MQ1 A;  2JZI A;  4PE0 A;  1N2D A;  3FWC A;  2KHN A;  3LK0 A;  1AJ4 A;  1XFU O;  2LVI A;  1Y6W A;  2ZRT A;  3QRX A;  4YGC B;  4QJ4 B;  1BOC A;  1CFD A;  1QLK A;  3DF0 A;  4XJK A;  3BOW A;  1YX7 A;  1BLQ A;  1UHN A;  3BOW B;  2LNK A;  2DOQ A;  1KK7 Y;  2KDH A;  1SY9 A;  2KBM A;  3PLF B;  2LAN A;  1S1E A;  3JTD B;  2LUX A;  3OX6 A;  4NDD A;  1EH2 A;  5K89 A;  1KFX L;  1TIZ A;  3TS5 B;  1KSO A;  1BT6 A;  1KFU L;  3D0Y B;  4GGN A;  1FI5 A;  2K2F A;  2FJU B;  3BUW B;  2LP2 A;  4USL A;  3LK1 A;  2WCF A;  1CFP A;  1XFZ O;  4CFQ A;  1NX2 A;  4PHK A;  1C7W A;  1LKJ A;  2M3W A;  4MZJ A;  3EK7 A;  2LC5 A;  1IH0 A;  1S3P A;  1GGZ A;  2LM5 A;  1B9A A;  2JT3 A;  3NSL A;  4YRU A;  3VRN A;  2EHB A;  1S36 A;  1K9U A;  1S5G Z;  1BOD A;  1DVI A;  3O4Y A;  3I5F B;  2L98 A;  4D1E A;  1M46 A;  4JPZ B;  3DF0 B;  1DJX A;  1IKU A;  2MRD A;  2F2P A;  1AJ5 A;  4PHM A;  1R6P A;  3OB1 B;  1QX7 A;  1M31 A;  1CM1 A;  1OSA A;  5HKW A;  1IJ6 A;  1NCY A;  1TCF A;  3BXK A;  2E6W A;  1J7P A;  2OS8 B;  2LCP A;  4DUQ A;  1EG4 A;  1WY9 A;  2F8P A;  2L5X B;  2ZNE A;  5AAN A;  3TDI A;  1K95 A;  1DJG A;  2ZN8 A;  1SPY A;  1J1E A;  2LLT A;  1B8L A;  4AQJ A;  2WND A;  1OQP A;  2BL0 C;  5D7F A;  2WCB A;  2FCE A;  3OX5 A;  4MZL A;  2LMU A;  4YGE B;  1U5I B;  1RRO A;  5AXI A;  4HSZ A;  3GK2 A;  2AMI A;  1CLL A;  4HRG A;  1QS7 A;  2QAC A;  4DRW A;  1IQ5 A;  5HKZ A;  1D1O A;  1LA3 A;  2M1U A;  3TUY C;  4ORA B;  3ICB A;  2M9G A;  4PCW A;  1IGV A;  1PUL A;  1FW4 A;  2KAY A;  2KQ6 A;  1MR8 A;  4OKH A;  1Y1A A;  3GOF A;  2LMV A;  3SJS A;  1ALW A;  4JWQ A;  5F6T A;  5BPJ A;  2KFG A;  2COL B;  1CMF A;  1OZS A;  1CLM A;  1QV0 A;  1W7J B;  1K2H A;  1TNX A;  1UP5 A;  1CNP A;  3CR4 X;  3CR5 X;  2Y1N A;  3C1V A;  1M63 B;  1PSR A;  2JXC A;  5KU1 A;  1XK4 C;  1AHR A;  1NSH A;  1MF8 B;  1Q80 A;  1QIV A;  1A75 B;  1ZAC A;  3BUM B;  1TNQ A;  4HRE E;  4PAL A;  3WHT B;  4E68 A;  1XFW O;  3EVU A;  3SG2 A;  3SG4 A;  1KFU S;  1JBA A;  2KNE A;  2L4H A;  1HQV A;  2BE4 A;  3NXA A;  4PDZ A;  1BJF A;  1PSB A;  2JRF A;  1RK9 A;  5J3X A;  2EC6 C;  1GJY A;  4MEW A;  4NDB A;  4DS7 A;  3BQ3 A;  1MXL C;  1Y0V H;  2Y1M A;  5KTY A;  1CMG A;  3JVT C;  1QIW A;  1DJY A;  2GGZ A;  2Q91 A;  3A4U B;  2KI6 C;  3AAJ A;  1K9P A;  2ZN9 A;  3F45 A;  3M0W A;  4PHJ A;  5DKN A;  4ETO A;  1PK0 D;  3KO0 A;  1U5I A;  2CNP A;  1SKT A;  2Q4U A;  4R1E A;  1UHI A;  3NSK A;  1LXF C;  1B4C A;  2KFH A;  3IQO A;  1JFJ A;  1SCM B;  3DVE A;  3EKH A;  1QVI Y;  3BYA A;  1SMG A;  1UWO A;  1JC2 A;  3PAT A;  4GNK B;  1J7O A;  1JUO A;  1QJT A;  1G33 A;  2HQW A;  3CGA A;  3CR2 A;  4QJ5 B;  4N5X A;  1BU3 A;  2CT9 A;  1Y1X A;  1GQM A;  1QX2 A;  1H4B A;  1YR5 A;  5JOL A;  3CZT X;  3AKB A;  2HF5 A;  2R2I A;  2M7L A;  1QTX A;  2PVB A;  1XVJ A;  2Y5I A;  4BY5 A;  2HQ8 A;  3AAK A;  2L4I A;  4NDC A;  1J1D A;  2CCM A;  1ZUZ A;  4MBE A;  1K94 A;  1NPQ A;  3BUN B;  5HLO A;  3HX4 A;  1YVL A;  5DKR A;  1C07 A;  1WDC B;  1IQ3 A;  2HET A;  3OB2 B;  5FYX A;  1XFV O;  1NWD A;  1OE9 B;  2KGB C;  2EGD A;  4YGB B;  1V1F A;  2ZRS A;  2PRU A;  5I2O A;  1NX1 A;  2H61 C;  1EJ3 A;  3H4S E;  3KHE A;  1QXP A;  2KI4 B;  2K0J A;  1JWD A;  4GAO A;  4P2Y B;  4GFT A;  1L7Z A;  1SCM C;  2PSR A;  1H8B A;  4QJ3 B;  1V1G A;  1QX5 B;  2JTZ A;  4YBH B;  3LL8 B;  1CDM A;  2KFF A;  2I94 A;  3RM1 A;  1KK7 Z;  1CTR A;  3GK1 A;  1M45 A;  1SYM A;  1TNW A;  1YTZ C;  1N0Y A;  4FQO A;  5ER5 A;  1BG1 A;  2JT8 A;  5TNC A;  3DVJ A;  1JFK A;  1TCO B;  1CM4 A;  1ZFS A;  3WXA A;  4I5K A;  4AQI A;  1BR1 B;  3TS5 C;  2NZ0 A;  1KK8 B;  3PFV A;  5AFP A;  2SAS A;  2LV7 A;  1WLZ A;  3VRP A;  1B7T Z;  1KQM C;  1CFC A;  2O5G A;  1VRK A;  4ZCU A;  2OTG B;  1KWO B;  4I5N B;  3KPX A;  3VGO A;  2I7A A;  1DMO A;  1A4P A;  2LVJ A;  2B1U A;  3EK8 A;  1XO5 A;  1CDP A;  3TZ1 A;  1SRA A;  4M2P A;  2BE6 A;  4UPG A;  4MRY A;  2KYF A;  1YRT B;  2NCP A;  1NX0 A;  3I5I C;  4IL1 A;  2JC2 A;  1NP8 A;  3TUY B;  1B1G A;  2CBL A;  1XYD A;  2BBM A;  4GPL B;  4WRI A;  1YVH A;  5CSI A;  4N1G A;  4PE7 A;  1OMD A;  2GGM A;  3BUO B;  1WRL A;  2H2K A;  1J7R A;  1NIW A;  1DTL A;  5KSZ A;  1K90 D;  5AER A;  2KYC A;  1LIN A;  1WDC C;  3DVK A;  4GGF C;  4CID A;  5HLV A;  2D8N A;  1AK8 A;  3SG3 A;  1NYA A;  3GK4 X;  2F3Z A;  4MZK A;  1OOJ A;  1DGU A;  1FI6 A;  2LP3 A;  2MJW B;  1NX3 A;  1RFJ A;  2JWW A;  3PSR A;  1REC A;  2SCP A;  3O78 A;  1G8I A;  4OV2 A;  3WHU B;  5JJG A;  2KAV A;  4A4B A;  1K93 D;  1F8H A;  1YUU A;  2LE9 B;  3A8R A;  5AEQ A;  1KCY A;  1W7I B;  3SG7 A;  2L51 A;  4XYN A;  4PHN A;  2MHH A;  4ICB A;  1DJZ A;  1K8U A;  2O60 A;  3K21 A;  1A29 A;  3NSI A;  3OP0 A;  4WQ3 A;  4XJK B;  2PAS A;  4A4C A;  1UUR A;  1CB1 A;  3CLN A;  1GGW A;  1MHO A;  5CSN A;  2LVV A;  1PVA A;  1F71 A;  1G4Y R;  4M2O A;  3PN7 B;  1YUS A;  1B8C A;  2LHI A;  1SW8 A;  1EG3 A;  1MUX A;  2CXJ A;  2Y4Q A;  2OPO A;  4YGA A;  4JQ0 D;  2BBN A;  3EVR A;  1NCZ A;  1HT9 A;  1KSM A;  2AAO A;  3O2P A;  1L2O C;  1ZMZ A;  2HPS A;  3I5G C;  4M2Q A;  2LAP A;  5D69 A;  2M97 A;  1SR6 C;  1SK6 D;  2F33 A;  3JTD C;  1QLS A;  3D0Y A;  4YI8 A;  3FIA A;  3CTN A;  3EKJ A;  4I5L B;  4CPV A;  1A2X A;  4ORC B;  1J7Q A;  3WNX B;  3CS1 A;  1DGV A;  2LLS A;  1N65 A;  3LLE A;  1OMR A;  1QV1 A;  1TRF A;  5I2Q A;  2KQY A;  1AVS A;  1EL4 A;  1ODB A;  1WRZ A;  2JQ6 A;  1UUS A;  1KQV A;  2PMY A;  4Q04 A;  1XFX O;  2JNX A;  1F70 A;  1DJW A;  3SIB A;  2L2E A;  2I2R E;  1F4O A;  2K7O A;  2JTT A;  4GBA A;  3PM8 A;  1CDN A;  2M29 A;  4CLN A;  1OZO A;  2F2O A;  2M1K B;  2VRG A;  1PVB A;  2BKH B;  1YUT A;  2K7C A;  4OR9 B;  1S26 D;  2ZKM X;  1SL7 A;  4MRX A;  5ER4 X;  1RWY A;  2JOJ A;  2KI6 D;  1S5G Y;  1F54 A;  1IG5 A;  1B47 A;  2BKI B;  3JVT B;  4YI9 A;  2M0R A;  2ZFD A;  1Y1U A;  3KEV A;  2WOR A;  5G08 A;  1XFY O;  1S6J A;  2KI4 C;  4YGD B;  1KFX S;  1DJH A;  1UHH A;  4GUK A;  1QAT A; 
#chains in the Genus database with same CATH topology
 3DVM A;  4GGF A;  1QVI Z;  1RTP 1;  4MLW A;  2F3Y A;  1TN4 A;  5I8N A;  1F4Q A;  2K2A A;  1NCX A;  3BFA A;  1ZOT B;  2M8U A;  3B86 A;  3N7H A;  3IQQ A;  4DIR A;  1KQM B;  2JU0 A;  3ZWH A;  1K9K A;  2BCX A;  1A75 A;  2BCA A;  1CFF A;  2ZND A;  3CZ1 A;  1DJI A;  1KWO C;  4MSP A;  1A03 A;  1LA0 A;  1NUB A;  3DD4 A;  1SL8 A;  2KLD A;  4C0L A;  3VRO A;  2BL0 B;  1TOP A;  1IJ5 A;  3S0A A;  2K7B A;  4HRH A;  4CFR A;  1PRW A;  1M39 A;  5CSJ A;  3S0G A;  1SCV A;  1IRJ A;  2GV5 A;  5CPV A;  3PAL A;  2NCO A;  2K61 A;  1TNP A;  2KGR A;  2TN4 A;  2KBI A;  2QPT A;  3SG6 A;  4BY4 A;  4WQ2 A;  1B7T Y;  3TDZ A;  1SSE B;  1FF1 A;  1YUR A;  1IIO A;  3LCP C;  3PM2 A;  2IS9 A;  3TDU A;  1FPW A;  2H61 A;  3MSE B;  1XK4 A;  1BF5 A;  1S6I A;  2QEB A;  2JUL A;  2NXQ A;  2OTG C;  1DT7 B;  2FOT A;  1JF0 A;  2WCJ A;  2BEC A;  1SNL A;  2WCM A;  4DCK A;  1QWV A;  1IWQ A;  2M49 B;  1R2U A;  1SR6 B;  2H8V A;  3ZNI A;  2V53 A;  1AUI B;  3D10 A;  5HKY A;  2E30 A;  5CSF A;  4TNC A;  2YGU A;  1X02 A;  3BUX B;  1DF0 B;  1YX8 A;  3FS7 A;  4U8D A;  5PAL A;  1UHJ A;  3VRR A;  1BMO A;  3NSO A;  5IBW A;  1AP4 A;  2WC8 A;  2KOT A;  1CDL A;  1PAL A;  3EK4 A;  3AKA A;  4AOM A;  1TTX A;  1EXR A;  2PAL A;  3RLZ A;  1CKK A;  2LLU A;  5I2L A;  2JXL A;  1MWN A;  3D76 A;  1ALV A;  4N1F A;  1LVC D;  2LHL A;  4PE1 A;  2KLE A;  2L5Y A;  2JPT A;  1DF0 A;  2FCD A;  4ORB B;  2NLN A;  2JNF A;  3FWB A;  4MVF A;  4C0J A;  2EC6 B;  2LVK A;  2I18 A;  2MA2 A;  2ISD A;  5HYD A;  1QAS A;  1KK8 C;  2LUC A;  1C7V A;  3S0D A;  1RJV A;  3I5H B;  3I5F C;  4NQG A;  1S6C A;  3D78 A;  3CAB A;  1F55 A;  4ZCV A;  2G9B A;  2MLF C;  1E8A A;  4OVN F;  1DEL A;  4PE4 A;  2L0P A;  2QEH A;  1MXE A;  1JF2 A;  2KAX A;  1FBV A;  5GQQ C;  2G2B A;  3CWG A;  4F0Z B;  1CLB A;  3OHM B;  2K7D A;  1GM0 A;  2P6B B;  2WOS A;  5EL2 A;  2MAZ A;  3KF9 A;  4L9M A;  1B8R A;  1WLM A;  2LMT A;  1WRK A;  2M7N A;  2OS8 C;  5B8I B;  1K96 A;  3PN7 C;  4FTG A;  4P5O E;  1SL9 A;  4C0K A;  5DKQ A;  3E3R A;  2JT0 A;  4OCI A;  3I5H C;  2KSP A;  3L47 A;  1UHK A;  2PYQ A;  3EVV A;  3I5I B;  1OMV A;  1JSA A;  2PQL A;  3IF7 A;  2L50 A;  3O6B A;  4MN0 A;  2WCE A;  2A4J A;  2BCB A;  2MBX A;  2K8M B;  3R72 A;  3VRQ A;  3SG5 A;  4I5J A;  3SIA A;  1L2O B;  1YRU B;  1SBJ A;  3I5G B;  1Z4H A;  2ERB A;  2RGI A;  3S0F A;  1XA5 A;  3HCM A;  2MLE C;  1J55 A;  4F7F A;  3IVT A;  2CTN A;  1BR4 B;  2AUC A;  1MQ1 A;  2JZI A;  4PE0 A;  1N2D A;  2WCK A;  3FWC A;  2KHN A;  3LK0 A;  1AJ4 A;  1XFU O;  2LVI A;  1Y6W A;  2ZRT A;  3QRX A;  4YGC B;  4QJ4 B;  1BOC A;  2QEV A;  1CFD A;  1QLK A;  3DF0 A;  3D73 A;  4XJK A;  3BOW A;  1YX7 A;  1BLQ A;  1UHN A;  3BOW B;  3K1E A;  2LNK A;  2DOQ A;  1KK7 Y;  2KDH A;  1SY9 A;  2KBM A;  3PLF B;  2LAN A;  1S1E A;  3JTD B;  3RZS A;  2LUX A;  3OX6 A;  1C3Z A;  4NDD A;  1C3Y A;  1EH2 A;  5K89 A;  1KFX L;  1TIZ A;  1TUJ A;  1KSO A;  1BT6 A;  1KFU L;  1OOG A;  1Z2C B;  3D0Y B;  4GGN A;  3TS5 B;  2K2F A;  1FI5 A;  2FJU B;  3BUW B;  3SS3 A;  2LP2 A;  4USL A;  3B88 A;  3LK1 A;  2WCF A;  3BFH A;  1CFP A;  1XFZ O;  4CFQ A;  1DEK A;  1NX2 A;  4PHK A;  1C7W A;  1LKJ A;  1TUZ A;  2M3W A;  4MZJ A;  3EK7 A;  2LC5 A;  1IH0 A;  1S3P A;  1GGZ A;  2LM5 A;  1B9A A;  2JT3 A;  3NSL A;  2L2C A;  5D3O A;  2WCL A;  3VRN A;  2EHB A;  4YRU A;  1S36 A;  1K9U A;  1S5G Z;  1BOD A;  1DVI A;  4JD9 A;  3O4Y A;  2KPH A;  3I5F B;  2L98 A;  4D1E A;  1M46 A;  4JPZ B;  3DF0 B;  1DJX A;  1IKU A;  2MRD A;  2F2P A;  1AJ5 A;  4PHM A;  1R6P A;  3OB1 B;  1QX7 A;  1M31 A;  1CM1 A;  1OSA A;  3O4X A;  5HKW A;  1IJ6 A;  1NCY A;  1TCF A;  3BXK A;  2E6W A;  1J7P A;  2OS8 B;  2LCP A;  4DUQ A;  3SS4 A;  1EG4 A;  1WY9 A;  2F8P A;  2L5X B;  2ZNE A;  5AAN A;  3TDI A;  1K95 A;  1W9Z A;  1DJG A;  2ZN8 A;  1SPY A;  1J1E A;  1OOH A;  1DQE A;  2LLT A;  1B8L A;  4AQJ A;  2WND A;  1OQP A;  3R1O A;  2BL0 C;  5D7F A;  2WCB A;  2FCE A;  3OX5 A;  4MZL A;  5FI2 A;  2LMU A;  4YGE B;  1U5I B;  3NHT A;  2WC5 A;  1RRO A;  5AXI A;  4HSZ A;  3GK2 A;  2AMI A;  1CLL A;  4HRG A;  1QS7 A;  2QAC A;  3CDN A;  4DRW A;  1IQ5 A;  5HKZ A;  1D1O A;  1LA3 A;  2M1U A;  3TUY C;  4ORA B;  3ICB A;  2M9G A;  4PCW A;  1IGV A;  4FQT A;  1PUL A;  1FW4 A;  2KAY A;  2KQ6 A;  2FJY A;  1MR8 A;  4OKH A;  3NHI A;  1Y1A A;  3GOF A;  2LMV A;  3SJS A;  1ALW A;  4JWQ A;  5F6T A;  5BPJ A;  2KFG A;  2COL B;  3R1P A;  4PT1 A;  1OZS A;  1CMF A;  1CLM A;  1QV0 A;  1W7J B;  1K2H A;  1TNX A;  1UP5 A;  1CNP A;  3CR4 X;  3CR5 X;  2Y1N A;  3C1V A;  1M63 B;  1PSR A;  2JXC A;  5KU1 A;  1XK4 C;  1AHR A;  1NSH A;  1MF8 B;  1Q80 A;  1QIV A;  1A75 B;  1ZAC A;  3BUM B;  1TNQ A;  4HRE E;  4PAL A;  3WHT B;  4E68 A;  1XFW O;  3EVU A;  3SG2 A;  3SG4 A;  1KFU S;  1JBA A;  2KNE A;  2L4H A;  1HQV A;  2BE4 A;  3NXA A;  4PDZ A;  1BJF A;  3S0E A;  1PSB A;  2JRF A;  1RK9 A;  3FE6 A;  5J3X A;  2EC6 C;  1GJY A;  4MEW A;  4NDB A;  4DS7 A;  3BQ3 A;  1MXL C;  1Y0V H;  2Y1M A;  5KTY A;  1CMG A;  3JVT C;  1QIW A;  1DJY A;  2GGZ A;  2Q91 A;  3A4U B;  2KI6 C;  3AAJ A;  1K9P A;  2ZN9 A;  3F45 A;  3M0W A;  4PHJ A;  5DKN A;  4ETO A;  1PK0 D;  3KO0 A;  1U5I A;  2CNP A;  2BNX A;  1SKT A;  1P28 A;  2Q4U A;  4R1E A;  1UHI A;  3NSK A;  1LXF C;  3L4A A;  1B4C A;  2P71 A;  2KFH A;  3IQO A;  1JFJ A;  1SCM B;  3DVE A;  3EKH A;  1QVI Y;  3BYA A;  1SMG A;  1UWO A;  1JC2 A;  3PAT A;  4GNK B;  1J7O A;  1JUO A;  1QJT A;  1G33 A;  2HQW A;  3CGA A;  3CR2 A;  4QJ5 B;  4KYN A;  4N5X A;  1BU3 A;  2CT9 A;  1Y1X A;  1GQM A;  1QX2 A;  1H4B A;  1YR5 A;  5JOL A;  3CZT X;  3QME A;  3AKB A;  2HF5 A;  2R2I A;  2M7L A;  1QTX A;  2PVB A;  1XVJ A;  2Y5I A;  4BY5 A;  2HQ8 A;  3AAK A;  2L4I A;  4NDC A;  1J1D A;  2CCM A;  1ZUZ A;  4MBE A;  1K94 A;  1NPQ A;  3BUN B;  5HLO A;  3HX4 A;  5FI7 A;  1YVL A;  5DKR A;  1C07 A;  1WDC B;  2P70 A;  1IQ3 A;  2HET A;  3OB2 B;  1ORG A;  3DZT A;  5FYX A;  1XFV O;  1NWD A;  1OE9 B;  2KGB C;  2QDI A;  2EGD A;  4YGB B;  1V1F A;  2ZRS A;  2PRU A;  5I2O A;  2JPO A;  1NX1 A;  2H61 C;  1EJ3 A;  3H4S E;  3KHE A;  1QXP A;  2KI4 B;  2K0J A;  1JWD A;  4GAO A;  4P2Y B;  4GFT A;  1L7Z A;  1SCM C;  2PSR A;  4JKT A;  1H8B A;  4QJ3 B;  1V1G A;  1QX5 B;  2JTZ A;  4YBH B;  3LL8 B;  1CDM A;  2KFF A;  2I94 A;  3RM1 A;  1T14 A;  1KK7 Z;  5DIC A;  1CTR A;  3S0B A;  3EG5 B;  3GK1 A;  1M45 A;  1SYM A;  1TNW A;  1YTZ C;  1N0Y A;  4FQO A;  5ER5 A;  1BG1 A;  2JT8 A;  5TNC A;  3DVJ A;  3UNW A;  5HL1 A;  1JFK A;  1TCO B;  1CM4 A;  3L4L A;  1ZFS A;  2QEO A;  3WXA A;  4I5K A;  4INW A;  4AQI A;  1BR1 B;  3TS5 C;  2NZ0 A;  1KK8 B;  3CYZ A;  3PFV A;  5AFP A;  2SAS A;  2LV7 A;  1WLZ A;  3VRP A;  1B7T Z;  1KQM C;  1CFC A;  2O5G A;  3VB1 A;  1VRK A;  4ZCU A;  2OTG B;  1KWO B;  4I5N B;  3KPX A;  3DXL A;  3VGO A;  2I7A A;  1DMO A;  1A4P A;  2LVJ A;  2B1U A;  3D77 A;  3EK8 A;  1XFR A;  3UO9 A;  5I94 A;  1XO5 A;  1CDP A;  3TZ1 A;  3FE9 A;  1SRA A;  4M2P A;  3B6X A;  2BE6 A;  4UPG A;  4MRY A;  2KYF A;  1YRT B;  2NCP A;  1NX0 A;  3I5I C;  4IL1 A;  2JC2 A;  1NP8 A;  3PJI A;  3TUY B;  1B1G A;  2CBL A;  1XYD A;  2BBM A;  4GPL B;  4INX A;  4WRI A;  1YVH A;  2WC6 A;  5FI6 A;  5CSI A;  4N1G A;  4PE7 A;  1OMD A;  2GGM A;  3BUO B;  1WRL A;  3DYE A;  2H2K A;  1J7R A;  1NIW A;  1DTL A;  5KSZ A;  1K90 D;  5AER A;  2KYC A;  1LIN A;  1WDC C;  3DVK A;  4GGF C;  4CID A;  5HLV A;  2D8N A;  2GTE A;  1AK8 A;  3SG3 A;  1NYA A;  2BAP A;  3GK4 X;  3OGN A;  2F3Z A;  4MZK A;  1OOJ A;  1DGU A;  3B7A A;  1FI6 A;  2LP3 A;  2MJW B;  1NX3 A;  1RFJ A;  2JWW A;  3PSR A;  1REC A;  2SCP A;  3O78 A;  1G8I A;  4OV2 A;  3WHU B;  5JJG A;  2KAV A;  4A4B A;  1K93 D;  2K60 A;  1F8H A;  1OOI X;  1YUU A;  2LE9 B;  3A8R A;  3OBV A;  5AEQ A;  1W7I B;  3SG7 A;  1KCY A;  3CZ0 A;  2L51 A;  4XYN A;  4PHN A;  2MHH A;  4ICB A;  1DJZ A;  1K8U A;  2O60 A;  3SS5 A;  3K21 A;  1A29 A;  3NSI A;  3OP0 A;  4WQ3 A;  4OZD A;  1OW4 A;  1OOF A;  3R1V A;  4XJK B;  2PAS A;  4A4C A;  1UUR A;  1CB1 A;  3CLN A;  1GGW A;  1MHO A;  5CSN A;  2LVV A;  3D75 A;  3BJH A;  1PVA A;  1F71 A;  1G4Y R;  4M2O A;  3V2L A;  3PN7 B;  3CZ2 A;  1YUS A;  1B8C A;  2LHI A;  1SW8 A;  1EG3 A;  1MUX A;  2CXJ A;  2Y4Q A;  2OPO A;  4YGA A;  4JQ0 D;  2WCH A;  2BBN A;  3EVR A;  3FE8 A;  1NCZ A;  3Q8I A;  1HT9 A;  1KSM A;  2AAO A;  3O2P A;  1L2O C;  1ZMZ A;  2HPS A;  3I5G C;  4IJ7 A;  2LAP A;  4M2Q A;  2M97 A;  1SR6 C;  1SK6 D;  2F33 A;  3JTD C;  1QLS A;  3D0Y A;  4YI8 A;  3FIA A;  3CTN A;  3EKJ A;  4I5L B;  4CPV A;  1A2X A;  4ORC B;  1J7Q A;  3WNX B;  3CS1 A;  1DGV A;  2LLS A;  1N65 A;  1DC1 A;  3LLE A;  1OMR A;  1QV1 A;  1TRF A;  5I2Q A;  2KQY A;  1AVS A;  1EL4 A;  1ODB A;  1WRZ A;  2JQ6 A;  1UUS A;  3BFB A;  1KQV A;  2PMY A;  4Q04 A;  1XFX O;  3DY9 A;  2JNX A;  1F70 A;  1DJW A;  3SIB A;  2L2E A;  2I2R E;  1F4O A;  1LS8 A;  2JTT A;  2K7O A;  4GBA A;  5D69 A;  3PM8 A;  3B87 A;  1CDN A;  2M29 A;  4CLN A;  1OZO A;  2F2O A;  2M1K B;  2VRG A;  1PVB A;  2BKH B;  1YUT A;  2K7C A;  4OR9 B;  1S26 D;  2ZKM X;  1SL7 A;  4MRX A;  5ER4 X;  1RWY A;  2JOJ A;  2KI6 D;  1S5G Y;  1F54 A;  1IG5 A;  1B47 A;  2BKI B;  3JVT B;  3NGV A;  4YI9 A;  1TWO A;  2M0R A;  2ZFD A;  1Y1U A;  3KEV A;  2WOR A;  5G08 A;  1XFY O;  1S6J A;  2KI4 C;  4YGD B;  1KFX S;  1DJH A;  3D74 A;  1UHH A;  4GUK A;  1QAT A; 
#chains in the Genus database with same CATH homology
 3DVM A;  4GGF A;  1QVI Z;  1RTP 1;  4MLW A;  2F3Y A;  1TN4 A;  5I8N A;  1F4Q A;  2K2A A;  1NCX A;  1ZOT B;  2M8U A;  3IQQ A;  4DIR A;  1KQM B;  2JU0 A;  3ZWH A;  1K9K A;  2BCX A;  1A75 A;  2BCA A;  1CFF A;  2ZND A;  1DJI A;  1KWO C;  4MSP A;  1A03 A;  1LA0 A;  1NUB A;  3DD4 A;  1SL8 A;  4C0L A;  3VRO A;  2BL0 B;  1TOP A;  1IJ5 A;  2K7B A;  4HRH A;  4CFR A;  1PRW A;  1M39 A;  5CSJ A;  1SCV A;  1IRJ A;  2GV5 A;  5CPV A;  3PAL A;  2NCO A;  2K61 A;  1TNP A;  2KGR A;  2TN4 A;  2KBI A;  2QPT A;  3SG6 A;  4BY4 A;  4WQ2 A;  1B7T Y;  3TDZ A;  1FF1 A;  1YUR A;  3LCP C;  3TDU A;  2IS9 A;  1FPW A;  2H61 A;  3MSE B;  1XK4 A;  1BF5 A;  1S6I A;  2JUL A;  2NXQ A;  2OTG C;  1DT7 B;  2FOT A;  1JF0 A;  2BEC A;  1SNL A;  4DCK A;  1IWQ A;  2M49 B;  1R2U A;  1SR6 B;  3ZNI A;  2V53 A;  1AUI B;  3D10 A;  5HKY A;  2E30 A;  5CSF A;  4TNC A;  1X02 A;  3BUX B;  1DF0 B;  1YX8 A;  3FS7 A;  4U8D A;  5PAL A;  1UHJ A;  3VRR A;  1BMO A;  3NSO A;  5IBW A;  1AP4 A;  2WC8 A;  2KOT A;  1CDL A;  1PAL A;  3EK4 A;  3AKA A;  4AOM A;  1TTX A;  1EXR A;  2PAL A;  3RLZ A;  1CKK A;  2LLU A;  5I2L A;  2JXL A;  1MWN A;  1ALV A;  4N1F A;  1LVC D;  2LHL A;  4PE1 A;  2JPT A;  1DF0 A;  2FCD A;  4ORB B;  2NLN A;  2JNF A;  3FWB A;  4MVF A;  4C0J A;  2EC6 B;  2LVK A;  2I18 A;  2MA2 A;  2ISD A;  5HYD A;  1QAS A;  1KK8 C;  2LUC A;  1C7V A;  1RJV A;  3I5H B;  3I5F C;  4NQG A;  1S6C A;  1F55 A;  4ZCV A;  2G9B A;  2MLF C;  1E8A A;  4OVN F;  4PE4 A;  2L0P A;  5GQQ C;  1MXE A;  1JF2 A;  2KAX A;  1FBV A;  2G2B A;  3CWG A;  4F0Z B;  1CLB A;  3OHM B;  2K7D A;  2P6B B;  2WOS A;  2MAZ A;  3KF9 A;  4L9M A;  1B8R A;  1WLM A;  2LMT A;  1WRK A;  2M7N A;  2OS8 C;  5B8I B;  1K96 A;  3PN7 C;  4FTG A;  4P5O E;  1SL9 A;  4C0K A;  5DKQ A;  3E3R A;  2JT0 A;  4OCI A;  3I5H C;  2KSP A;  1UHK A;  3EVV A;  3I5I B;  1OMV A;  1JSA A;  3IF7 A;  2L50 A;  3O6B A;  4MN0 A;  2WCE A;  2A4J A;  2BCB A;  2MBX A;  2K8M B;  3VRQ A;  3SG5 A;  4I5J A;  3SIA A;  1L2O B;  1YRU B;  1SBJ A;  3I5G B;  2RGI A;  1XA5 A;  3HCM A;  2MLE C;  1J55 A;  2CTN A;  1BR4 B;  2AUC A;  1MQ1 A;  2JZI A;  4PE0 A;  1N2D A;  3FWC A;  2KHN A;  3LK0 A;  1AJ4 A;  1XFU O;  2LVI A;  1Y6W A;  2ZRT A;  3QRX A;  4YGC B;  4QJ4 B;  1BOC A;  1CFD A;  1QLK A;  3DF0 A;  4XJK A;  3BOW A;  1YX7 A;  1BLQ A;  1UHN A;  3BOW B;  2LNK A;  2DOQ A;  1KK7 Y;  2KDH A;  1SY9 A;  2KBM A;  3PLF B;  2LAN A;  1S1E A;  3JTD B;  2LUX A;  3OX6 A;  4NDD A;  1EH2 A;  5K89 A;  1KFX L;  1TIZ A;  3TS5 B;  1KSO A;  1BT6 A;  1KFU L;  3D0Y B;  4GGN A;  1FI5 A;  2K2F A;  2FJU B;  3BUW B;  2LP2 A;  4USL A;  3LK1 A;  2WCF A;  1CFP A;  1XFZ O;  4CFQ A;  1NX2 A;  4PHK A;  1C7W A;  1LKJ A;  2M3W A;  4MZJ A;  3EK7 A;  2LC5 A;  1IH0 A;  1S3P A;  1GGZ A;  2LM5 A;  1B9A A;  2JT3 A;  3NSL A;  4YRU A;  3VRN A;  2EHB A;  1S36 A;  1K9U A;  1S5G Z;  1BOD A;  1DVI A;  3O4Y A;  3I5F B;  2L98 A;  4D1E A;  1M46 A;  4JPZ B;  3DF0 B;  1DJX A;  1IKU A;  2MRD A;  2F2P A;  1AJ5 A;  4PHM A;  1R6P A;  3OB1 B;  1QX7 A;  1M31 A;  1CM1 A;  1OSA A;  5HKW A;  1IJ6 A;  1NCY A;  1TCF A;  3BXK A;  2E6W A;  1J7P A;  2OS8 B;  2LCP A;  4DUQ A;  1EG4 A;  1WY9 A;  2F8P A;  2L5X B;  2ZNE A;  5AAN A;  3TDI A;  1K95 A;  1DJG A;  2ZN8 A;  1SPY A;  1J1E A;  2LLT A;  1B8L A;  4AQJ A;  2WND A;  1OQP A;  2BL0 C;  5D7F A;  2WCB A;  2FCE A;  3OX5 A;  4MZL A;  2LMU A;  4YGE B;  1U5I B;  1RRO A;  5AXI A;  4HSZ A;  3GK2 A;  2AMI A;  1CLL A;  4HRG A;  1QS7 A;  2QAC A;  4DRW A;  1IQ5 A;  5HKZ A;  1D1O A;  1LA3 A;  2M1U A;  3TUY C;  4ORA B;  3ICB A;  2M9G A;  4PCW A;  1IGV A;  1PUL A;  1FW4 A;  2KAY A;  2KQ6 A;  1MR8 A;  4OKH A;  1Y1A A;  3GOF A;  2LMV A;  3SJS A;  1ALW A;  4JWQ A;  5F6T A;  5BPJ A;  2KFG A;  2COL B;  1CMF A;  1OZS A;  1CLM A;  1QV0 A;  1W7J B;  1K2H A;  1TNX A;  1UP5 A;  1CNP A;  3CR4 X;  3CR5 X;  2Y1N A;  3C1V A;  1M63 B;  1PSR A;  2JXC A;  5KU1 A;  1XK4 C;  1AHR A;  1NSH A;  1MF8 B;  1Q80 A;  1QIV A;  1A75 B;  1ZAC A;  3BUM B;  1TNQ A;  4HRE E;  4PAL A;  3WHT B;  4E68 A;  1XFW O;  3EVU A;  3SG2 A;  3SG4 A;  1KFU S;  1JBA A;  2KNE A;  2L4H A;  1HQV A;  2BE4 A;  3NXA A;  4PDZ A;  1BJF A;  1PSB A;  2JRF A;  1RK9 A;  5J3X A;  2EC6 C;  1GJY A;  4MEW A;  4NDB A;  4DS7 A;  3BQ3 A;  1MXL C;  1Y0V H;  2Y1M A;  5KTY A;  1CMG A;  3JVT C;  1QIW A;  1DJY A;  2GGZ A;  2Q91 A;  3A4U B;  2KI6 C;  3AAJ A;  1K9P A;  2ZN9 A;  3F45 A;  3M0W A;  4PHJ A;  5DKN A;  4ETO A;  1PK0 D;  3KO0 A;  1U5I A;  2CNP A;  1SKT A;  2Q4U A;  4R1E A;  1UHI A;  3NSK A;  1LXF C;  1B4C A;  2KFH A;  3IQO A;  1JFJ A;  1SCM B;  3DVE A;  3EKH A;  1QVI Y;  3BYA A;  1SMG A;  1UWO A;  1JC2 A;  3PAT A;  4GNK B;  1J7O A;  1JUO A;  1QJT A;  1G33 A;  2HQW A;  3CGA A;  3CR2 A;  4QJ5 B;  4N5X A;  1BU3 A;  2CT9 A;  1Y1X A;  1GQM A;  1QX2 A;  1H4B A;  1YR5 A;  5JOL A;  3CZT X;  3AKB A;  2HF5 A;  2R2I A;  2M7L A;  1QTX A;  2PVB A;  1XVJ A;  2Y5I A;  4BY5 A;  2HQ8 A;  3AAK A;  2L4I A;  4NDC A;  1J1D A;  2CCM A;  1ZUZ A;  4MBE A;  1K94 A;  1NPQ A;  3BUN B;  5HLO A;  3HX4 A;  1YVL A;  5DKR A;  1C07 A;  1WDC B;  1IQ3 A;  2HET A;  3OB2 B;  5FYX A;  1XFV O;  1NWD A;  1OE9 B;  2KGB C;  2EGD A;  4YGB B;  1V1F A;  2ZRS A;  2PRU A;  5I2O A;  1NX1 A;  2H61 C;  1EJ3 A;  3H4S E;  3KHE A;  1QXP A;  2KI4 B;  2K0J A;  1JWD A;  4GAO A;  4P2Y B;  4GFT A;  1L7Z A;  1SCM C;  2PSR A;  1H8B A;  4QJ3 B;  1V1G A;  1QX5 B;  2JTZ A;  4YBH B;  3LL8 B;  1CDM A;  2KFF A;  2I94 A;  3RM1 A;  1KK7 Z;  1CTR A;  3GK1 A;  1M45 A;  1SYM A;  1TNW A;  1YTZ C;  1N0Y A;  4FQO A;  5ER5 A;  1BG1 A;  2JT8 A;  5TNC A;  3DVJ A;  1JFK A;  1TCO B;  1CM4 A;  1ZFS A;  3WXA A;  4I5K A;  4AQI A;  1BR1 B;  3TS5 C;  2NZ0 A;  1KK8 B;  3PFV A;  5AFP A;  2SAS A;  2LV7 A;  1WLZ A;  3VRP A;  1B7T Z;  1KQM C;  1CFC A;  2O5G A;  1VRK A;  4ZCU A;  2OTG B;  1KWO B;  4I5N B;  3KPX A;  3VGO A;  2I7A A;  1DMO A;  1A4P A;  2LVJ A;  2B1U A;  3EK8 A;  1XO5 A;  1CDP A;  3TZ1 A;  1SRA A;  4M2P A;  2BE6 A;  4UPG A;  4MRY A;  2KYF A;  1YRT B;  2NCP A;  1NX0 A;  3I5I C;  4IL1 A;  2JC2 A;  1NP8 A;  3TUY B;  1B1G A;  2CBL A;  1XYD A;  2BBM A;  4GPL B;  4WRI A;  1YVH A;  5CSI A;  4N1G A;  4PE7 A;  1OMD A;  2GGM A;  3BUO B;  1WRL A;  2H2K A;  1J7R A;  1NIW A;  1DTL A;  5KSZ A;  1K90 D;  5AER A;  2KYC A;  1LIN A;  1WDC C;  3DVK A;  4GGF C;  4CID A;  5HLV A;  2D8N A;  1AK8 A;  3SG3 A;  1NYA A;  3GK4 X;  2F3Z A;  4MZK A;  1OOJ A;  1DGU A;  1FI6 A;  2LP3 A;  2MJW B;  1NX3 A;  1RFJ A;  2JWW A;  3PSR A;  1REC A;  2SCP A;  3O78 A;  1G8I A;  4OV2 A;  3WHU B;  5JJG A;  2KAV A;  4A4B A;  1K93 D;  1F8H A;  1YUU A;  2LE9 B;  3A8R A;  5AEQ A;  1KCY A;  1W7I B;  3SG7 A;  2L51 A;  4XYN A;  4PHN A;  2MHH A;  4ICB A;  1DJZ A;  1K8U A;  2O60 A;  3K21 A;  1A29 A;  3NSI A;  3OP0 A;  4WQ3 A;  4XJK B;  2PAS A;  4A4C A;  1UUR A;  1CB1 A;  3CLN A;  1GGW A;  1MHO A;  5CSN A;  2LVV A;  1PVA A;  1F71 A;  1G4Y R;  4M2O A;  3PN7 B;  1YUS A;  1B8C A;  2LHI A;  1SW8 A;  1EG3 A;  1MUX A;  2CXJ A;  2Y4Q A;  2OPO A;  4YGA A;  4JQ0 D;  2BBN A;  3EVR A;  1NCZ A;  1HT9 A;  1KSM A;  2AAO A;  3O2P A;  1L2O C;  1ZMZ A;  2HPS A;  3I5G C;  4M2Q A;  2LAP A;  5D69 A;  2M97 A;  1SR6 C;  1SK6 D;  2F33 A;  3JTD C;  1QLS A;  3D0Y A;  4YI8 A;  3FIA A;  3CTN A;  3EKJ A;  4I5L B;  4CPV A;  1A2X A;  4ORC B;  1J7Q A;  3WNX B;  3CS1 A;  1DGV A;  2LLS A;  1N65 A;  3LLE A;  1OMR A;  1QV1 A;  1TRF A;  5I2Q A;  2KQY A;  1AVS A;  1EL4 A;  1ODB A;  1WRZ A;  2JQ6 A;  1UUS A;  1KQV A;  2PMY A;  4Q04 A;  1XFX O;  2JNX A;  1F70 A;  1DJW A;  3SIB A;  2L2E A;  2I2R E;  1F4O A;  2K7O A;  2JTT A;  4GBA A;  3PM8 A;  1CDN A;  2M29 A;  4CLN A;  1OZO A;  2F2O A;  2M1K B;  2VRG A;  1PVB A;  2BKH B;  1YUT A;  2K7C A;  4OR9 B;  1S26 D;  2ZKM X;  1SL7 A;  4MRX A;  5ER4 X;  1RWY A;  2JOJ A;  2KI6 D;  1S5G Y;  1F54 A;  1IG5 A;  1B47 A;  2BKI B;  3JVT B;  4YI9 A;  2M0R A;  2ZFD A;  1Y1U A;  3KEV A;  2WOR A;  5G08 A;  1XFY O;  1S6J A;  2KI4 C;  4YGD B;  1KFX S;  1DJH A;  1UHH A;  4GUK A;  1QAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...