2NLNA

Solution structure of calcium-free rat beta-parvalbumin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oncomodulin
publication title Solution structure of Ca2+-free rat beta-parvalbumin (oncomodulin).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2nlnA00
5F6TA 1M45A 2LP3A 3CLNA 1KK8B 1QV1A 2CXJA 1NPQA 2PALA 2KOTA 2LAPA 2BCXA 3PSRA 1QIWA 3SIAA 2MBXA 1BU3A 2G9BA 3ICBA 2ZN8A 4TNCA 4BY5A 1DGUA 3SG2A 4YRUA 1SNLA 1CDMA 1BJFA 1F54A 1XO5A 1KFXS 1W7IB 1E8AA 2LLSA 2M1UA 4HREE 2JULA 3HCMA 3OX6A 4CPVA 2LVJA 2M3WA 3PN7B 2KYCA 4JPZB 2I18A 2Y1MA 2AAOA 1PULA 1Y0VH 3MSEB 4PALA 3VRNA 2HQ8A 1N65A 3PLFB 3GK1A 4MN0A 2L51A 1J1DA 3BYAA 5CSJA 1J7OA 2HETA 4E68A 3EK4A 3D10A 1BLQA 2Q91A 1F4QA 1CMGA 3I5HC 1SRAA 3AAJA 1EH2A 1C7WA 1XFUO 1K94A 1NSHA 2JXLA 4P5OE 1B7TY 3PALA 3GK4X 3A8RA 1WY9A 1DJHA 2BBMA 1DVIA 1QIVA 2Q4UA 1B9AA 2KGRA 1JF2A 4ORBB 1Y1XA 3I5FC 1LKJA 2K7DA 1PVAA 5G08A 1ZUZA 5I8NA 2M8UA 1PALA 4GAOA 5I2OA 4I5JA 1NX1A 1KSOA 2ZN9A 1SYMA 2ZRSA 1A75A 1OZOA 1YX7A 1PVBA 2LMUA 2WC8A 3OB1B 4PE4A 1MXLC 1SCVA 2MRDA 4Q04A 5CSNA 2R2IA 2CTNA 1KQMC 3IF7A 3PM8A 2NCOA 1KK8C 1WRZA 1IQ3A 1XK4C 1SBJA 2BCBA 2MJWB 1SW8A 2F2OA 1DJIA 1F4OA 1U5IB 3DF0B 3BUMB 1KK7Y 1S5GY 3D0YB 3IQQA 1QATA 2MLFC 2NLNA 2M1KB 3WHUB 1CFDA 4USLA 4PHNA 3CWGA 2JTZA 1NX2A 1X02A 2MA2A 5JOLA 5I2QA 3PN7C 2LP2A 1A2XA 5AEQA 1BR1B 4GPLB 1YVHA 3TDIA 3VGOA 4GGFA 4FQOA 1CNPA 1MWNA 1AVSA 3VRRA 1AP4A 1PRWA 1S6CA 3JTDB 3SG3A 1RFJA 2HF5A 5KTYA 5AXIA 4YGBB 2M0RA 2TN4A 1MR8A 4YGAA 1CFFA 2M49B 4MBEA 4M2OA 1OZSA 2LMVA 3DVMA 3GK2A 4OVNF 1H8BA 3O6BA 1SL8A 3F45A 4GUKA 2AUCA 1BG1A 1MUXA 2BL0B 1QVIY 3CGAA 4PDZA 2F3YA 1JWDA 3E3RA 5AFPA 1S26D 4I5NB 5HKYA 1CFCA 1AHRA 1XVJA 1EG3A 1N0YA 4A4BA 1B8RA 2KSPA 4MEWA 1OMDA 2I2RE 1UWOA 1NCZA 3M0WA 2FCEA 1NX0A 5B8IB 1SMGA 1YRTB 4PE1A 3NSIA 5CSIA 1XFXO 2DOQA 2ZNEA 4GGNA 1DF0B 5ER4X 2H2KA 3FWCA 2FOTA 3NXAA 1LVCD 2K61A 4PCWA 1KCYA 2KYFA 2ZKMX 1CMFA 1NP8A 2LHLA 3RLZA 1SL7A 2G2BA 5TNCA 1AJ4A 2WCFA 2JNFA 2AMIA 4DUQA 3I5IC 2LUCA 4OV2A 2LC5A 1CKKA 3TUYB 4NDDA 4JQ0D 5GQQC 3JTDC 1KQMB 2GGZA 4HSZA 3VRPA 2L0PA 3CZTX 3BOWA 2JZIA 2KNEA 2LCPA 1ODBA 2QPTA 4AQIA 1VRKA 1K8UA 1IJ6A 5I2LA 3PATA 1XFWO 1XYDA 2GV5A 3OX5A 1S6JA 1XK4A 4C0JA 1LA0A 2I94A 2QACA 2L50A 4YGEB 5HYDA 5K89A 1FI5A 1RROA 4R1EA 1BMOA 4M2PA 1V1GA 5DKNA 2KBMA 2KAVA 1DMOA 2P6BB 2K2AA 1NCXA 1QASA 2L5XB 1XFVO 2OPOA 2BL0C 3CR4X 1F70A 3SIBA 2NCPA 1J1EA 1KSMA 2I7AA 2KQYA 2E30A 3OB2B 1PSBA 1AK8A 1K90D 2JC2A 2KFHA 1G4YR 2D8NA 1M63B 1DGVA 2O5GA 3EK8A 1J7RA 1QXPA 5DKRA 2SASA 5ER5A 4NDCA 2JOJA 2CBLA 3EKHA 2FCDA 1K9UA 4OR9B 3BXKA 1IRJA 1QX5B 1DTLA 1DJGA 1XFZO 1K9KA 2HPSA 2JQ6A 2MHHA 2RGIA 3LCPC 4L9MA 1RTP1 1XA5A 3JVTB 1S6IA 1M46A 1K95A 1N2DA 2V53A 2K8MB 5HKWA 4MRYA 1MXEA 4PE7A 4AQJA 1TNWA 1C7VA 2WCBA 3I5GB 2LLTA 5CSFA 2LVKA 4OCIA 4GNKB 3KEVA 3EKJA 4IL1A 2LV7A 1UHKA 2PASA 3TUYC 1B7TZ 1KFUS 2FJUB 2PSRA 4MRXA 3HX4A 4HRGA 2KHNA 1OMVA 4ZCUA 2BE4A 1PK0D 1G8IA 3BQ3A 1IQ5A 4MZKA 3AKBA 3VRQA 4UPGA 1JSAA 1LA3A 3CR5X 4MLWA 1JFKA 5D69A 3CTNA 3SG6A 3DD4A 1G33A 1UUSA 1Y1AA 2LHIA 4OKHA 1YUSA 1GGZA 2OTGB 4F0ZB 3D0YA 4N1GA 2H61C 2F3ZA 3TS5B 1MQ1A 2PMYA 3EVUA 3K21A 1K9PA 3I5IB 4DS7A 2Y5IA 1JF0A 1YR5A 1FW4A 1B1GA 1SY9A 2JT3A 2NZ0A 3TDUA 1NCYA 4D1EA 1NYAA 2LE9B 1YUTA 2IS9A 2WORA 1XFYO 2OS8C 2HQWA 1L2OC 1KK7Z 1S5GZ 4C0KA 1W7JB 3JVTC 1FF1A 1BODA 3ZNIA 1YX8A 1EXRA 1TN4A 2KI6D 1TNXA 2E6WA 1QX2A 2LVIA 1B8CA 1SK6D 1CLMA 2KI6C 2JT8A 3I5GC 1YVLA 3O78A 4MZJA 4YBHB 2M7LA 1FPWA 2ISDA 1H4BA 3WHTB 1IGVA 1KFXL 3DVKA 1M31A 1A29A 2EHBA 1B47A 5KSZA 1IJ5A 1Q80A 4I5KA 4GFTA 1QV0A 2K7BA 3BUWB 1K2HA 3GOFA 4N5XA 1WRKA 4CFRA 3KHEA 3O4YA 3NSOA 1NX3A 1TCOB 3NSLA 1HQVA 3KO0A 4GBAA 2BBNA 2BCAA 4PHJA 4QJ4B 1SL9A 1QS7A 3EVVA 4CFQA 1FI6A 1DF0A 1QVIZ 2OTGC 1UHJA 1CDPA 2JPTA 3TS5C 1LINA 2BKIB 4PE0A 5FYXA 1SKTA 2KAYA 1DJZA 2ZFDA 4XJKB 1ZACA 1UHNA 1AJ5A 3SG5A 1JBAA 1QX7A 2EGDA 2F8PA 1SR6B 1S1EA 1FBVA 1SPYA 4I5LB 1JFJA 2BE6A 4WRIA 2O60A 3BUOB 1V1FA 2M9GA 2B1UA 1QLSA 1Y1UA 3KF9A 3BOWB 4NDBA 1WDCB 3BUNB 3O2PA 2KFFA 1YURA 3LK0A 3WXAA 1RWYA 1ALWA 2L4HA 2H61A 3PFVA 4XYNA 4WQ2A 1C07A 1IH0A 4DCKA 5PALA 5D7FA 1OMRA 2OS8B 1WLZA 2VRGA 1TOPA 1EG4A 5CPVA 3H4SE 2PVBA 2LNKA 4BY4A 1L2OB 1SCMB 1BR4B 1BT6A 1PSRA 1CDLA 1QJTA 1KWOB 3LK1A 2JT0A 3SJSA 2CNPA 2EC6C 1RJVA 1J55A 1L7ZA 1J7QA 4HRHA 2KI4B 4MSPA 2K2FA 2L2EA 1GGWA 4WQ3A 3NSKA 4QJ3B 3SG4A 4ICBA 2PRUA 2CCMA 1BOCA 4DRWA 4DIRA 2JXCA 2KFGA 4ZCVA 1IG5A 3EVRA 3OP0A 2ZNDA 1F55A 5IBWA 2LUXA 1SR6C 1F8HA 3CR2A 3CS1A 5AERA 2JNXA 1LXFC 1A4PA 3KPXA 3C1VA 1OSAA 4CIDA 1A75B 5KU1A 1YRUB 3AAKA 5HLOA 1U5IA 2ZRTA 1UP5A 3DF0A 4MZLA 1IWQA 1HT9A 1OE9B 4NQGA 2LLUA 1QLKA 2WCEA 3OHMB 1WDCC 1CM1A 1F71A 4FTGA 2K7CA 5BPJA 4U8DA 3IQOA 2JWWA 1K96A 1JUOA 1ZOTB 2MLEC 4A4CA 4ORAB 5JJGA 3EK7A 4ORCB 5HLVA 2L98A 2LMTA 1M39A 1GQMA 1J7PA 4MVFA 3LLEA 1TNQA 3FIAA 2A4JA 1SCMC 1IKUA 1KWOC 1MHOA 1UHIA 2WOSA 1TNPA 3A4UB 5AANA 1RECA 2KDHA 1EJ3A 1QTXA 4N1FA 2LANA 2M97A 1AUIB 5HKZA 4C0LA 2KI4C 2Y4QA 2SCPA 1K93D 2NXQA 1YTZC 2KQ6A 3FS7A 1DJWA 2L4IA 1OQPA 1CDNA 1EL4A 3DVJA 1NUBA 2JRFA 2GGMA 1OOJA 1DJXA 1UHHA 4P2YB 1UURA 1TRFA 1CTRA 2F2PA 1CLLA 1WLMA 2M29A 3ZWHA 4PHMA 2K0JA 4M2QA 1NIWA 3AKAA 3VROA 3TZ1A 4ETOA 5J3XA 1D1OA 2BECA 2JTTA 2EC6B 3WNXB 1BF5A 1R6PA 1S36A 2Y1NA 1ZMZA 3SG7A 1DJYA 1R2UA 1DT7B 4YI9A 1KQVA 1TTXA 2CT9A 1TCFA 1NWDA 1CB1A 1CM4A 4YGDB 3BUXB 3I5HB 2K7OA 4QJ5B 2KGBC 2MAZA 5DKQA 4JWQA 1GJYA 3TDZA 1JC2A 2LM5A 1B4CA 1WRLA 1ZFSA 2JU0A 2BKHB 2KAXA 3RM1A 2LVVA 2F33A 4CLNA 2KBIA 1YUUA 1A03A 3FWBA 1MF8B 4XJKA 4AOMA 3I5FB 4YI8A 2COLB 3DVEA 4GGFC 1KFUL 3QRXA 1S3PA 1TIZA 3LL8B 1CFPA 4PHKA 4YGCB 2M7NA 1RK9A 1ALVA 1B8LA 2WNDA 1CLBA 1Y6WA
chains in the Genus database with same CATH superfamily
5F6TA 1M45A 1JSAA 2LP3A 3CLNA 3FE8A 1KK8B 1QV1A 2CXJA 1NPQA 2PALA 2KOTA 2LAPA 2BCXA 3OGNA 3PSRA 1QIWA 3SIAA 2MBXA 1BU3A 2G9BA 3ICBA 2ZN8A 1OOIX 4TNCA 5FI6A 1DGUA 3SG2A 4YRUA 1SNLA 1CDMA 1BJFA 1F54A 1XO5A 1KFXS 1W7IB 1E8AA 2LLSA 2M1UA 4HREE 2JULA 3HCMA 3OX6A 4CPVA 2LVJA 2M3WA 3PN7B 2KYCA 4JPZB 2I18A 2Y1MA 2AAOA 1PULA 1Y0VH 3MSEB 3EG5B 4PALA 2HQ8A 3VRNA 1N65A 3PLFB 3GK1A 4MN0A 2L51A 1J1DA 2WCHA 3BYAA 5CSJA 1J7OA 2HETA 4E68A 3EK4A 3D10A 1BLQA 2Q91A 1F4QA 1CMGA 3I5HC 1SRAA 3AAJA 1EH2A 1C7WA 1XFUO 1K94A 1NSHA 2JXLA 2QEHA 4P5OE 1B7TY 3D78A 3PALA 3GK4X 3A8RA 1WY9A 1DJHA 2BBMA 1DVIA 1QIVA 5D3OA 3CZ1A 2Q4UA 1DELA 1B9AA 2KGRA 1JF2A 4ORBB 1Y1XA 2QEVA 1LKJA 3I5FC 3S0GA 2K7DA 1PVAA 5G08A 1ZUZA 1Z2CB 2M8UA 5I8NA 1PALA 4GAOA 5I2OA 4I5JA 1NX1A 1KSOA 2ZN9A 1SYMA 2ZRSA 1A75A 1OZOA 1DQEA 1PVBA 1YX7A 2BAPA 2LMUA 2WC8A 1MXLC 1SCVA 2MRDA 4Q04A 5CSNA 3DY9A 2R2IA 2CTNA 2QDIA 1KQMC 3UNWA 3IF7A 3PM8A 2NCOA 1KK8C 1WRZA 1IQ3A 1XK4C 1SBJA 2BCBA 3FE6A 2MJWB 1SW8A 2FJYA 2F2OA 1DJIA 1F4OA 1U5IB 3DF0B 3BUMB 1KK7Y 1S5GY 3D0YB 3IQQA 1QATA 2MLFC 2NLNA 2M1KB 3WHUB 1CFDA 4USLA 4PHNA 3CWGA 2JTZA 1NX2A 1X02A 2MA2A 5JOLA 5I2QA 3PN7C 2LP2A 1A2XA 5AEQA 1BR1B 4GPLB 1YVHA 4FQTA 3TDIA 4GGFA 3VGOA 4FQOA 1CNPA 1MWNA 3Q8IA 1AVSA 3CABA 3DZTA 3VRRA 1AP4A 1PRWA 1S6CA 3JTDB 3SG3A 1RFJA 2HF5A 3NHTA 5KTYA 1GM0A 5AXIA 4YGBB 2M0RA 2TN4A 1MR8A 3B86A 4YGAA 1CFFA 2M49B 4MBEA 4M2OA 1OZSA 2LMVA 3DVMA 3GK2A 2JPOA 4OVNF 1H8BA 3O6BA 1SL8A 3F45A 1XFRA 4GUKA 1F70A 2AUCA 1BG1A 1MUXA 2BL0B 1QVIY 3CGAA 2WCKA 2F3YA 4PDZA 1JWDA 3N7HA 3E3RA 5AFPA 1S26D 4I5NB 5HKYA 1DC1A 1CFCA 1AHRA 1XVJA 1EG3A 1N0YA 4A4BA 3BFHA 1B8RA 2KSPA 4MEWA 2WC6A 1OMDA 2I2RE 1UWOA 1IIOA 1NCZA 3M0WA 2FCEA 1NX0A 5B8IB 1SMGA 2KLDA 1YRTB 4PE1A 3NSIA 5CSIA 1XFXO 2DOQA 2ZNEA 4GGNA 1DF0B 5ER4X 2H2KA 3FWCA 2FOTA 5FI7A 3NXAA 1LVCD 2K61A 4PCWA 1KCYA 2KYFA 2ZKMX 1CMFA 3S0BA 1NP8A 2LHLA 3RLZA 1SL7A 2G2BA 5TNCA 1AJ4A 2WCFA 2JNFA 2AMIA 4DUQA 3I5IC 2LUCA 3O4XA 4OV2A 3SS4A 2LC5A 1CKKA 5I94A 4IJ7A 3TUYB 4NDDA 4JQ0D 5GQQC 2QEBA 1KQMB 3JTDC 2GGZA 4HSZA 3VRPA 2L0PA 3CZTX 3BOWA 3NGVA 2JZIA 2KNEA 2LCPA 1ODBA 2QPTA 4AQIA 1VRKA 1K8UA 1IJ6A 5I2LA 3PATA 1OOGA 1XFWO 1XYDA 2GV5A 3OX5A 1S6JA 1XK4A 3B6XA 4C0JA 1C3YA 1LA0A 2I94A 2QACA 2L50A 2WC5A 4YGEB 5HYDA 5K89A 1FI5A 1RROA 4R1EA 1BMOA 4M2PA 1V1GA 5DKNA 2KBMA 2KAVA 1DMOA 2P6BB 2K2AA 1NCXA 1QASA 2L5XB 1XFVO 2H8VA 2BL0C 2OPOA 3CR4X 3SIBA 2NCPA 3IVTA 1J1EA 1KSMA 2I7AA 2KQYA 2E30A 3OB2B 1PSBA 2PQLA 1AK8A 1K90D 2JC2A 2KFHA 1G4YR 2D8NA 4JD9A 1M63B 1DGVA 2O5GA 3EK8A 1J7RA 1QXPA 5DKRA 2SASA 5ER5A 4NDCA 2JOJA 2CBLA 3EKHA 2FCDA 1K9UA 4OR9B 1OOHA 3BXKA 1IRJA 4OZDA 4PT1A 1QX5B 1DTLA 1DJGA 1XFZO 1K9KA 2HPSA 2JQ6A 2MHHA 2RGIA 3LCPC 4L9MA 1RTP1 3S0AA 1XA5A 3JVTB 1S6IA 1M46A 1K95A 1N2DA 2V53A 2K8MB 3PM2A 5HKWA 4MRYA 1MXEA 4PE7A 4AQJA 1TNWA 1C7VA 2WCBA 3I5GB 2LLTA 5CSFA 2LVKA 4OCIA 4GNKB 3D74A 3KEVA 3EKJA 4IL1A 2LV7A 1UHKA 2PASA 3TUYC 2L2CA 1DEKA 1B7TZ 1KFUS 2FJUB 2PSRA 4MRXA 3HX4A 4HRGA 2KHNA 1LS8A 1OMVA 4ZCUA 2BE4A 1PK0D 1G8IA 3BQ3A 1IQ5A 3B88A 3AKBA 4MZKA 3VRQA 4UPGA 1LA3A 3CR5X 4MLWA 1JFKA 5D69A 3CTNA 3SG6A 3SS3A 3DD4A 1G33A 1UUSA 1Y1AA 2LHIA 4OKHA 1YUSA 1GGZA 2OTGB 3B7AA 3D0YA 4N1GA 3S0EA 2H61C 2F3ZA 3TS5B 4F0ZB 1MQ1A 1W9ZA 2PMYA 3EVUA 3K21A 1K9PA 3I5IB 4DS7A 2Y5IA 3R1VA 1JF0A 1YR5A 1FW4A 1B1GA 1SY9A 2JT3A 2NZ0A 3TDUA 1NCYA 4D1EA 1NYAA 2LE9B 5HL1A 1YUTA 2IS9A 2WCMA 2WORA 1XFYO 2OS8C 2ERBA 2HQWA 1OW4A 1L2OC 1KK7Z 1S5GZ 4C0KA 1W7JB 3JVTC 1FF1A 1BODA 3ZNIA 1YX8A 1EXRA 1TN4A 2KI6D 1TNXA 2E6WA 1QX2A 2LVIA 1B8CA 1SK6D 1CLMA 2KI6C 2JT8A 3B87A 1YVLA 3I5GC 3O78A 4MZJA 4YBHB 2M7LA 2ISDA 1FPWA 1H4BA 3WHTB 1IGVA 1KFXL 4BY5A 3DVKA 1M31A 1A29A 2EHBA 1B47A 5KSZA 1IJ5A 3D73A 1Q80A 4I5KA 4GFTA 1QV0A 2K7BA 3BUWB 1K2HA 3GOFA 4N5XA 1WRKA 4CFRA 3KHEA 3O4YA 3NSOA 1NX3A 1TCOB 3NSLA 1HQVA 3KO0A 4GBAA 2BBNA 2BCAA 4PHJA 4QJ4B 1SL9A 1QS7A 3EVVA 4CFQA 1FI6A 1DF0A 1P28A 1QVIZ 2OTGC 1UHJA 1CDPA 2JPTA 3TS5C 1LINA 2BKIB 4PE0A 5FYXA 1SKTA 3CZ0A 4INWA 2KAYA 1DJZA 2K60A 5DICA 1C3ZA 2ZFDA 4XJKB 1ZACA 1UHNA 1AJ5A 3SG5A 1JBAA 1QX7A 2EGDA 2F8PA 1SR6B 1S1EA 1FBVA 1SPYA 4I5LB 1JFJA 2BE6A 4WRIA 2O60A 3BUOB 1V1FA 2M9GA 2B1UA 1QLSA 1Y1UA 3KF9A 1TWOA 3VB1A 2KLEA 3BOWB 4NDBA 1WDCB 3BUNB 3BFBA 3O2PA 2KFFA 1YURA 3LK0A 3WXAA 1RWYA 1ALWA 2L4HA 2H61A 3PFVA 4XYNA 3CYZA 4WQ2A 1C07A 1IH0A 4DCKA 5PALA 5D7FA 1OMRA 2OS8B 1WLZA 2VRGA 1TOPA 1EG4A 3L4LA 3H4SE 2PVBA 2LNKA 5CPVA 2BNXA 1L2OB 1SCMB 1BR4B 1BT6A 1PSRA 1CDLA 1QJTA 1KWOB 3LK1A 1ORGA 2JT0A 3SJSA 5EL2A 2CNPA 2EC6C 2GTEA 1RJVA 1J55A 1L7ZA 2KPHA 2P70A 3DXLA 4HRHA 2KI4B 4MSPA 2K2FA 2L2EA 1J7QA 1GGWA 3BFAA 4WQ3A 1Z4HA 3NSKA 3R1OA 4QJ3B 4ICBA 3SG4A 2PRUA 2CCMA 3RZSA 1BOCA 4DRWA 4DIRA 3R72A 2JXCA 2KFGA 4ZCVA 1IG5A 2YGUA 2WCLA 3EVRA 3OP0A 2ZNDA 1F55A 2WCJA 5IBWA 2LUXA 1SR6C 1F8HA 3CR2A 3CS1A 5AERA 2JNXA 1LXFC 1A4PA 4JKTA 3KPXA 3C1VA 1OSAA 4CIDA 1A75B 5KU1A 1YRUB 3AAKA 5HLOA 1U5IA 2ZRTA 1UP5A 3DF0A 3DYEA 1IWQA 1HT9A 1OE9B 4MZLA 2LLUA 4NQGA 3SS5A 3K1EA 1QLKA 2WCEA 3OHMB 1WDCC 1CM1A 1F71A 4FTGA 2K7CA 5BPJA 4U8DA 3S0FA 3IQOA 2JWWA 1K96A 1JUOA 1ZOTB 2MLEC 4A4CA 3NHIA 4ORAB 5JJGA 3EK7A 4ORCB 5HLVA 2L98A 2LMTA 3FE9A 1TUJA 1M39A 1GQMA 1J7PA 2PYQA 4MVFA 3LLEA 4PE4A 1TNQA 3FIAA 2A4JA 3CDNA 1SCMC 1IKUA 4INXA 3R1PA 1KWOC 1MHOA 1UHIA 2P71A 2WOSA 1TNPA 3A4UB 5AANA 1RECA 2KDHA 4KYNA 1EJ3A 3UO9A 1QTXA 4N1FA 2LANA 2M97A 4F7FA 1AUIB 5HKZA 4C0LA 2KI4C 2Y4QA 2SCPA 1K93D 2NXQA 1YTZC 2KQ6A 3FS7A 2QEOA 1DJWA 3D75A 2L4IA 1OQPA 1CDNA 1EL4A 3DVJA 1NUBA 2JRFA 2GGMA 1OOJA 1DJXA 1UHHA 4P2YB 1UURA 1OOFA 1TRFA 1CTRA 2F2PA 1SSEB 1CLLA 1WLMA 2M29A 3ZWHA 3QMEA 3L4AA 4PHMA 2K0JA 4M2QA 1NIWA 3AKAA 3VROA 4BY4A 3TZ1A 4ETOA 5J3XA 3D76A 1D1OA 3S0DA 2BECA 3OB1B 2JTTA 2EC6B 1QWVA 3WNXB 1BF5A 1R6PA 1S36A 2Y1NA 1ZMZA 3SG7A 1DJYA 1R2UA 1DT7B 4YI9A 1KQVA 1TTXA 2CT9A 1TCFA 1NWDA 1CB1A 1CM4A 4YGDB 3BUXB 3I5HB 1TUZA 2K7OA 4QJ5B 2KGBC 2MAZA 5DKQA 4JWQA 1GJYA 3TDZA 1JC2A 2LM5A 3D77A 1B4CA 3L47A 1WRLA 1ZFSA 2JU0A 2BKHB 2KAXA 5FI2A 3RM1A 2LVVA 3V2LA 2F33A 2L5YA 4CLNA 2KBIA 1YUUA 1A03A 3FWBA 1MF8B 4XJKA 4AOMA 3I5FB 4YI8A 2COLB 3CZ2A 3OBVA 3DVEA 4GGFC 1KFUL 3QRXA 1S3PA 1TIZA 3LL8B 1CFPA 4PHKA 4YGCB 2M7NA 3BJHA 1RK9A 1ALVA 3PJIA 1B8LA 2WNDA 1CLBA 1T14A 1Y6WA
chains in the Genus database with same CATH topology
5F6TA 1M45A 2LP3A 3CLNA 1KK8B 1QV1A 2CXJA 1NPQA 2PALA 2KOTA 2LAPA 2BCXA 3PSRA 1QIWA 3SIAA 2MBXA 1BU3A 2G9BA 3ICBA 2ZN8A 4TNCA 4BY5A 1DGUA 3SG2A 4YRUA 1SNLA 1CDMA 1BJFA 1F54A 1XO5A 1KFXS 1W7IB 1E8AA 2LLSA 2M1UA 4HREE 2JULA 3HCMA 3OX6A 4CPVA 2LVJA 2M3WA 3PN7B 2KYCA 4JPZB 2I18A 2Y1MA 2AAOA 1PULA 1Y0VH 3MSEB 4PALA 3VRNA 2HQ8A 1N65A 3PLFB 3GK1A 4MN0A 2L51A 1J1DA 3BYAA 5CSJA 1J7OA 2HETA 4E68A 3EK4A 3D10A 1BLQA 2Q91A 1F4QA 1CMGA 3I5HC 1SRAA 3AAJA 1EH2A 1C7WA 1XFUO 1K94A 1NSHA 2JXLA 4P5OE 1B7TY 3PALA 3GK4X 3A8RA 1WY9A 1DJHA 2BBMA 1DVIA 1QIVA 2Q4UA 1B9AA 2KGRA 1JF2A 4ORBB 1Y1XA 3I5FC 1LKJA 2K7DA 1PVAA 5G08A 1ZUZA 5I8NA 2M8UA 1PALA 4GAOA 5I2OA 4I5JA 1NX1A 1KSOA 2ZN9A 1SYMA 2ZRSA 1A75A 1OZOA 1YX7A 1PVBA 2LMUA 2WC8A 3OB1B 4PE4A 1MXLC 1SCVA 2MRDA 4Q04A 5CSNA 2R2IA 2CTNA 1KQMC 3IF7A 3PM8A 2NCOA 1KK8C 1WRZA 1IQ3A 1XK4C 1SBJA 2BCBA 2MJWB 1SW8A 2F2OA 1DJIA 1F4OA 1U5IB 3DF0B 3BUMB 1KK7Y 1S5GY 3D0YB 3IQQA 1QATA 2MLFC 2NLNA 2M1KB 3WHUB 1CFDA 4USLA 4PHNA 3CWGA 2JTZA 1NX2A 1X02A 2MA2A 5JOLA 5I2QA 3PN7C 2LP2A 1A2XA 5AEQA 1BR1B 4GPLB 1YVHA 3TDIA 3VGOA 4GGFA 4FQOA 1CNPA 1MWNA 1AVSA 3VRRA 1AP4A 1PRWA 1S6CA 3JTDB 3SG3A 1RFJA 2HF5A 5KTYA 5AXIA 4YGBB 2M0RA 2TN4A 1MR8A 4YGAA 1CFFA 2M49B 4MBEA 4M2OA 1OZSA 2LMVA 3DVMA 3GK2A 4OVNF 1H8BA 3O6BA 1SL8A 3F45A 4GUKA 2AUCA 1BG1A 1MUXA 2BL0B 1QVIY 3CGAA 4PDZA 2F3YA 1JWDA 3E3RA 5AFPA 1S26D 4I5NB 5HKYA 1CFCA 1AHRA 1XVJA 1EG3A 1N0YA 4A4BA 1B8RA 2KSPA 4MEWA 1OMDA 2I2RE 1UWOA 1NCZA 3M0WA 2FCEA 1NX0A 5B8IB 1SMGA 1YRTB 4PE1A 3NSIA 5CSIA 1XFXO 2DOQA 2ZNEA 4GGNA 1DF0B 5ER4X 2H2KA 3FWCA 2FOTA 3NXAA 1LVCD 2K61A 4PCWA 1KCYA 2KYFA 2ZKMX 1CMFA 1NP8A 2LHLA 3RLZA 1SL7A 2G2BA 5TNCA 1AJ4A 2WCFA 2JNFA 2AMIA 4DUQA 3I5IC 2LUCA 4OV2A 2LC5A 1CKKA 3TUYB 4NDDA 4JQ0D 5GQQC 3JTDC 1KQMB 2GGZA 4HSZA 3VRPA 2L0PA 3CZTX 3BOWA 2JZIA 2KNEA 2LCPA 1ODBA 2QPTA 4AQIA 1VRKA 1K8UA 1IJ6A 5I2LA 3PATA 1XFWO 1XYDA 2GV5A 3OX5A 1S6JA 1XK4A 4C0JA 1LA0A 2I94A 2QACA 2L50A 4YGEB 5HYDA 5K89A 1FI5A 1RROA 4R1EA 1BMOA 4M2PA 1V1GA 5DKNA 2KBMA 2KAVA 1DMOA 2P6BB 2K2AA 1NCXA 1QASA 2L5XB 1XFVO 2OPOA 2BL0C 3CR4X 1F70A 3SIBA 2NCPA 1J1EA 1KSMA 2I7AA 2KQYA 2E30A 3OB2B 1PSBA 1AK8A 1K90D 2JC2A 2KFHA 1G4YR 2D8NA 1M63B 1DGVA 2O5GA 3EK8A 1J7RA 1QXPA 5DKRA 2SASA 5ER5A 4NDCA 2JOJA 2CBLA 3EKHA 2FCDA 1K9UA 4OR9B 3BXKA 1IRJA 1QX5B 1DTLA 1DJGA 1XFZO 1K9KA 2HPSA 2JQ6A 2MHHA 2RGIA 3LCPC 4L9MA 1RTP1 1XA5A 3JVTB 1S6IA 1M46A 1K95A 1N2DA 2V53A 2K8MB 5HKWA 4MRYA 1MXEA 4PE7A 4AQJA 1TNWA 1C7VA 2WCBA 3I5GB 2LLTA 5CSFA 2LVKA 4OCIA 4GNKB 3KEVA 3EKJA 4IL1A 2LV7A 1UHKA 2PASA 3TUYC 1B7TZ 1KFUS 2FJUB 2PSRA 4MRXA 3HX4A 4HRGA 2KHNA 1OMVA 4ZCUA 2BE4A 1PK0D 1G8IA 3BQ3A 1IQ5A 4MZKA 3AKBA 3VRQA 4UPGA 1JSAA 1LA3A 3CR5X 4MLWA 1JFKA 5D69A 3CTNA 3SG6A 3DD4A 1G33A 1UUSA 1Y1AA 2LHIA 4OKHA 1YUSA 1GGZA 2OTGB 4F0ZB 3D0YA 4N1GA 2H61C 2F3ZA 3TS5B 1MQ1A 2PMYA 3EVUA 3K21A 1K9PA 3I5IB 4DS7A 2Y5IA 1JF0A 1YR5A 1FW4A 1B1GA 1SY9A 2JT3A 2NZ0A 3TDUA 1NCYA 4D1EA 1NYAA 2LE9B 1YUTA 2IS9A 2WORA 1XFYO 2OS8C 2HQWA 1L2OC 1KK7Z 1S5GZ 4C0KA 1W7JB 3JVTC 1FF1A 1BODA 3ZNIA 1YX8A 1EXRA 1TN4A 2KI6D 1TNXA 2E6WA 1QX2A 2LVIA 1B8CA 1SK6D 1CLMA 2KI6C 2JT8A 3I5GC 1YVLA 3O78A 4MZJA 4YBHB 2M7LA 1FPWA 2ISDA 1H4BA 3WHTB 1IGVA 1KFXL 3DVKA 1M31A 1A29A 2EHBA 1B47A 5KSZA 1IJ5A 1Q80A 4I5KA 4GFTA 1QV0A 2K7BA 3BUWB 1K2HA 3GOFA 4N5XA 1WRKA 4CFRA 3KHEA 3O4YA 3NSOA 1NX3A 1TCOB 3NSLA 1HQVA 3KO0A 4GBAA 2BBNA 2BCAA 4PHJA 4QJ4B 1SL9A 1QS7A 3EVVA 4CFQA 1FI6A 1DF0A 1QVIZ 2OTGC 1UHJA 1CDPA 2JPTA 3TS5C 1LINA 2BKIB 4PE0A 5FYXA 1SKTA 2KAYA 1DJZA 2ZFDA 4XJKB 1ZACA 1UHNA 1AJ5A 3SG5A 1JBAA 1QX7A 2EGDA 2F8PA 1SR6B 1S1EA 1FBVA 1SPYA 4I5LB 1JFJA 2BE6A 4WRIA 2O60A 3BUOB 1V1FA 2M9GA 2B1UA 1QLSA 1Y1UA 3KF9A 3BOWB 4NDBA 1WDCB 3BUNB 3O2PA 2KFFA 1YURA 3LK0A 3WXAA 1RWYA 1ALWA 2L4HA 2H61A 3PFVA 4XYNA 4WQ2A 1C07A 1IH0A 4DCKA 5PALA 5D7FA 1OMRA 2OS8B 1WLZA 2VRGA 1TOPA 1EG4A 5CPVA 3H4SE 2PVBA 2LNKA 4BY4A 1L2OB 1SCMB 1BR4B 1BT6A 1PSRA 1CDLA 1QJTA 1KWOB 3LK1A 2JT0A 3SJSA 2CNPA 2EC6C 1RJVA 1J55A 1L7ZA 1J7QA 4HRHA 2KI4B 4MSPA 2K2FA 2L2EA 1GGWA 4WQ3A 3NSKA 4QJ3B 3SG4A 4ICBA 2PRUA 2CCMA 1BOCA 4DRWA 4DIRA 2JXCA 2KFGA 4ZCVA 1IG5A 3EVRA 3OP0A 2ZNDA 1F55A 5IBWA 2LUXA 1SR6C 1F8HA 3CR2A 3CS1A 5AERA 2JNXA 1LXFC 1A4PA 3KPXA 3C1VA 1OSAA 4CIDA 1A75B 5KU1A 1YRUB 3AAKA 5HLOA 1U5IA 2ZRTA 1UP5A 3DF0A 4MZLA 1IWQA 1HT9A 1OE9B 4NQGA 2LLUA 1QLKA 2WCEA 3OHMB 1WDCC 1CM1A 1F71A 4FTGA 2K7CA 5BPJA 4U8DA 3IQOA 2JWWA 1K96A 1JUOA 1ZOTB 2MLEC 4A4CA 4ORAB 5JJGA 3EK7A 4ORCB 5HLVA 2L98A 2LMTA 1M39A 1GQMA 1J7PA 4MVFA 3LLEA 1TNQA 3FIAA 2A4JA 1SCMC 1IKUA 1KWOC 1MHOA 1UHIA 2WOSA 1TNPA 3A4UB 5AANA 1RECA 2KDHA 1EJ3A 1QTXA 4N1FA 2LANA 2M97A 1AUIB 5HKZA 4C0LA 2KI4C 2Y4QA 2SCPA 1K93D 2NXQA 1YTZC 2KQ6A 3FS7A 1DJWA 2L4IA 1OQPA 1CDNA 1EL4A 3DVJA 1NUBA 2JRFA 2GGMA 1OOJA 1DJXA 1UHHA 4P2YB 1UURA 1TRFA 1CTRA 2F2PA 1CLLA 1WLMA 2M29A 3ZWHA 4PHMA 2K0JA 4M2QA 1NIWA 3AKAA 3VROA 3TZ1A 4ETOA 5J3XA 1D1OA 2BECA 2JTTA 2EC6B 3WNXB 1BF5A 1R6PA 1S36A 2Y1NA 1ZMZA 3SG7A 1DJYA 1R2UA 1DT7B 4YI9A 1KQVA 1TTXA 2CT9A 1TCFA 1NWDA 1CB1A 1CM4A 4YGDB 3BUXB 3I5HB 2K7OA 4QJ5B 2KGBC 2MAZA 5DKQA 4JWQA 1GJYA 3TDZA 1JC2A 2LM5A 1B4CA 1WRLA 1ZFSA 2JU0A 2BKHB 2KAXA 3RM1A 2LVVA 2F33A 4CLNA 2KBIA 1YUUA 1A03A 3FWBA 1MF8B 4XJKA 4AOMA 3I5FB 4YI8A 2COLB 3DVEA 4GGFC 1KFUL 3QRXA 1S3PA 1TIZA 3LL8B 1CFPA 4PHKA 4YGCB 2M7NA 1RK9A 1ALVA 1B8LA 2WNDA 1CLBA 1Y6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  1M45 A;  2LP3 A;  3CLN A;  1KK8 B;  1QV1 A;  2CXJ A;  1NPQ A;  2PAL A;  2KOT A;  2LAP A;  2BCX A;  3PSR A;  1QIW A;  3SIA A;  2MBX A;  1BU3 A;  2G9B A;  3ICB A;  2ZN8 A;  4TNC A;  4BY5 A;  1DGU A;  3SG2 A;  4YRU A;  1SNL A;  1CDM A;  1BJF A;  1F54 A;  1XO5 A;  1KFX S;  1W7I B;  1E8A A;  2LLS A;  2M1U A;  4HRE E;  2JUL A;  3HCM A;  3OX6 A;  4CPV A;  2LVJ A;  2M3W A;  3PN7 B;  2KYC A;  4JPZ B;  2I18 A;  2Y1M A;  2AAO A;  1PUL A;  1Y0V H;  3MSE B;  4PAL A;  3VRN A;  2HQ8 A;  1N65 A;  3PLF B;  3GK1 A;  4MN0 A;  2L51 A;  1J1D A;  3BYA A;  5CSJ A;  1J7O A;  2HET A;  4E68 A;  3EK4 A;  3D10 A;  1BLQ A;  2Q91 A;  1F4Q A;  1CMG A;  3I5H C;  1SRA A;  3AAJ A;  1EH2 A;  1C7W A;  1XFU O;  1K94 A;  1NSH A;  2JXL A;  4P5O E;  1B7T Y;  3PAL A;  3GK4 X;  3A8R A;  1WY9 A;  1DJH A;  2BBM A;  1DVI A;  1QIV A;  2Q4U A;  1B9A A;  2KGR A;  1JF2 A;  4ORB B;  1Y1X A;  3I5F C;  1LKJ A;  2K7D A;  1PVA A;  5G08 A;  1ZUZ A;  5I8N A;  2M8U A;  1PAL A;  4GAO A;  5I2O A;  4I5J A;  1NX1 A;  1KSO A;  2ZN9 A;  1SYM A;  2ZRS A;  1A75 A;  1OZO A;  1YX7 A;  1PVB A;  2LMU A;  2WC8 A;  3OB1 B;  4PE4 A;  1MXL C;  1SCV A;  2MRD A;  4Q04 A;  5CSN A;  2R2I A;  2CTN A;  1KQM C;  3IF7 A;  3PM8 A;  2NCO A;  1KK8 C;  1WRZ A;  1IQ3 A;  1XK4 C;  1SBJ A;  2BCB A;  2MJW B;  1SW8 A;  2F2O A;  1DJI A;  1F4O A;  1U5I B;  3DF0 B;  3BUM B;  1KK7 Y;  1S5G Y;  3D0Y B;  3IQQ A;  1QAT A;  2MLF C;  2NLN A;  2M1K B;  3WHU B;  1CFD A;  4USL A;  4PHN A;  3CWG A;  2JTZ A;  1NX2 A;  1X02 A;  2MA2 A;  5JOL A;  5I2Q A;  3PN7 C;  2LP2 A;  1A2X A;  5AEQ A;  1BR1 B;  4GPL B;  1YVH A;  3TDI A;  3VGO A;  4GGF A;  4FQO A;  1CNP A;  1MWN A;  1AVS A;  3VRR A;  1AP4 A;  1PRW A;  1S6C A;  3JTD B;  3SG3 A;  1RFJ A;  2HF5 A;  5KTY A;  5AXI A;  4YGB B;  2M0R A;  2TN4 A;  1MR8 A;  4YGA A;  1CFF A;  2M49 B;  4MBE A;  4M2O A;  1OZS A;  2LMV A;  3DVM A;  3GK2 A;  4OVN F;  1H8B A;  3O6B A;  1SL8 A;  3F45 A;  4GUK A;  2AUC A;  1BG1 A;  1MUX A;  2BL0 B;  1QVI Y;  3CGA A;  4PDZ A;  2F3Y A;  1JWD A;  3E3R A;  5AFP A;  1S26 D;  4I5N B;  5HKY A;  1CFC A;  1AHR A;  1XVJ A;  1EG3 A;  1N0Y A;  4A4B A;  1B8R A;  2KSP A;  4MEW A;  1OMD A;  2I2R E;  1UWO A;  1NCZ A;  3M0W A;  2FCE A;  1NX0 A;  5B8I B;  1SMG A;  1YRT B;  4PE1 A;  3NSI A;  5CSI A;  1XFX O;  2DOQ A;  2ZNE A;  4GGN A;  1DF0 B;  5ER4 X;  2H2K A;  3FWC A;  2FOT A;  3NXA A;  1LVC D;  2K61 A;  4PCW A;  1KCY A;  2KYF A;  2ZKM X;  1CMF A;  1NP8 A;  2LHL A;  3RLZ A;  1SL7 A;  2G2B A;  5TNC A;  1AJ4 A;  2WCF A;  2JNF A;  2AMI A;  4DUQ A;  3I5I C;  2LUC A;  4OV2 A;  2LC5 A;  1CKK A;  3TUY B;  4NDD A;  4JQ0 D;  5GQQ C;  3JTD C;  1KQM B;  2GGZ A;  4HSZ A;  3VRP A;  2L0P A;  3CZT X;  3BOW A;  2JZI A;  2KNE A;  2LCP A;  1ODB A;  2QPT A;  4AQI A;  1VRK A;  1K8U A;  1IJ6 A;  5I2L A;  3PAT A;  1XFW O;  1XYD A;  2GV5 A;  3OX5 A;  1S6J A;  1XK4 A;  4C0J A;  1LA0 A;  2I94 A;  2QAC A;  2L50 A;  4YGE B;  5HYD A;  5K89 A;  1FI5 A;  1RRO A;  4R1E A;  1BMO A;  4M2P A;  1V1G A;  5DKN A;  2KBM A;  2KAV A;  1DMO A;  2P6B B;  2K2A A;  1NCX A;  1QAS A;  2L5X B;  1XFV O;  2OPO A;  2BL0 C;  3CR4 X;  1F70 A;  3SIB A;  2NCP A;  1J1E A;  1KSM A;  2I7A A;  2KQY A;  2E30 A;  3OB2 B;  1PSB A;  1AK8 A;  1K90 D;  2JC2 A;  2KFH A;  1G4Y R;  2D8N A;  1M63 B;  1DGV A;  2O5G A;  3EK8 A;  1J7R A;  1QXP A;  5DKR A;  2SAS A;  5ER5 A;  4NDC A;  2JOJ A;  2CBL A;  3EKH A;  2FCD A;  1K9U A;  4OR9 B;  3BXK A;  1IRJ A;  1QX5 B;  1DTL A;  1DJG A;  1XFZ O;  1K9K A;  2HPS A;  2JQ6 A;  2MHH A;  2RGI A;  3LCP C;  4L9M A;  1RTP 1;  1XA5 A;  3JVT B;  1S6I A;  1M46 A;  1K95 A;  1N2D A;  2V53 A;  2K8M B;  5HKW A;  4MRY A;  1MXE A;  4PE7 A;  4AQJ A;  1TNW A;  1C7V A;  2WCB A;  3I5G B;  2LLT A;  5CSF A;  2LVK A;  4OCI A;  4GNK B;  3KEV A;  3EKJ A;  4IL1 A;  2LV7 A;  1UHK A;  2PAS A;  3TUY C;  1B7T Z;  1KFU S;  2FJU B;  2PSR A;  4MRX A;  3HX4 A;  4HRG A;  2KHN A;  1OMV A;  4ZCU A;  2BE4 A;  1PK0 D;  1G8I A;  3BQ3 A;  1IQ5 A;  4MZK A;  3AKB A;  3VRQ A;  4UPG A;  1JSA A;  1LA3 A;  3CR5 X;  4MLW A;  1JFK A;  5D69 A;  3CTN A;  3SG6 A;  3DD4 A;  1G33 A;  1UUS A;  1Y1A A;  2LHI A;  4OKH A;  1YUS A;  1GGZ A;  2OTG B;  4F0Z B;  3D0Y A;  4N1G A;  2H61 C;  2F3Z A;  3TS5 B;  1MQ1 A;  2PMY A;  3EVU A;  3K21 A;  1K9P A;  3I5I B;  4DS7 A;  2Y5I A;  1JF0 A;  1YR5 A;  1FW4 A;  1B1G A;  1SY9 A;  2JT3 A;  2NZ0 A;  3TDU A;  1NCY A;  4D1E A;  1NYA A;  2LE9 B;  1YUT A;  2IS9 A;  2WOR A;  1XFY O;  2OS8 C;  2HQW A;  1L2O C;  1KK7 Z;  1S5G Z;  4C0K A;  1W7J B;  3JVT C;  1FF1 A;  1BOD A;  3ZNI A;  1YX8 A;  1EXR A;  1TN4 A;  2KI6 D;  1TNX A;  2E6W A;  1QX2 A;  2LVI A;  1B8C A;  1SK6 D;  1CLM A;  2KI6 C;  2JT8 A;  3I5G C;  1YVL A;  3O78 A;  4MZJ A;  4YBH B;  2M7L A;  1FPW A;  2ISD A;  1H4B A;  3WHT B;  1IGV A;  1KFX L;  3DVK A;  1M31 A;  1A29 A;  2EHB A;  1B47 A;  5KSZ A;  1IJ5 A;  1Q80 A;  4I5K A;  4GFT A;  1QV0 A;  2K7B A;  3BUW B;  1K2H A;  3GOF A;  4N5X A;  1WRK A;  4CFR A;  3KHE A;  3O4Y A;  3NSO A;  1NX3 A;  1TCO B;  3NSL A;  1HQV A;  3KO0 A;  4GBA A;  2BBN A;  2BCA A;  4PHJ A;  4QJ4 B;  1SL9 A;  1QS7 A;  3EVV A;  4CFQ A;  1FI6 A;  1DF0 A;  1QVI Z;  2OTG C;  1UHJ A;  1CDP A;  2JPT A;  3TS5 C;  1LIN A;  2BKI B;  4PE0 A;  5FYX A;  1SKT A;  2KAY A;  1DJZ A;  2ZFD A;  4XJK B;  1ZAC A;  1UHN A;  1AJ5 A;  3SG5 A;  1JBA A;  1QX7 A;  2EGD A;  2F8P A;  1SR6 B;  1S1E A;  1FBV A;  1SPY A;  4I5L B;  1JFJ A;  2BE6 A;  4WRI A;  2O60 A;  3BUO B;  1V1F A;  2M9G A;  2B1U A;  1QLS A;  1Y1U A;  3KF9 A;  3BOW B;  4NDB A;  1WDC B;  3BUN B;  3O2P A;  2KFF A;  1YUR A;  3LK0 A;  3WXA A;  1RWY A;  1ALW A;  2L4H A;  2H61 A;  3PFV A;  4XYN A;  4WQ2 A;  1C07 A;  1IH0 A;  4DCK A;  5PAL A;  5D7F A;  1OMR A;  2OS8 B;  1WLZ A;  2VRG A;  1TOP A;  1EG4 A;  5CPV A;  3H4S E;  2PVB A;  2LNK A;  4BY4 A;  1L2O B;  1SCM B;  1BR4 B;  1BT6 A;  1PSR A;  1CDL A;  1QJT A;  1KWO B;  3LK1 A;  2JT0 A;  3SJS A;  2CNP A;  2EC6 C;  1RJV A;  1J55 A;  1L7Z A;  1J7Q A;  4HRH A;  2KI4 B;  4MSP A;  2K2F A;  2L2E A;  1GGW A;  4WQ3 A;  3NSK A;  4QJ3 B;  3SG4 A;  4ICB A;  2PRU A;  2CCM A;  1BOC A;  4DRW A;  4DIR A;  2JXC A;  2KFG A;  4ZCV A;  1IG5 A;  3EVR A;  3OP0 A;  2ZND A;  1F55 A;  5IBW A;  2LUX A;  1SR6 C;  1F8H A;  3CR2 A;  3CS1 A;  5AER A;  2JNX A;  1LXF C;  1A4P A;  3KPX A;  3C1V A;  1OSA A;  4CID A;  1A75 B;  5KU1 A;  1YRU B;  3AAK A;  5HLO A;  1U5I A;  2ZRT A;  1UP5 A;  3DF0 A;  4MZL A;  1IWQ A;  1HT9 A;  1OE9 B;  4NQG A;  2LLU A;  1QLK A;  2WCE A;  3OHM B;  1WDC C;  1CM1 A;  1F71 A;  4FTG A;  2K7C A;  5BPJ A;  4U8D A;  3IQO A;  2JWW A;  1K96 A;  1JUO A;  1ZOT B;  2MLE C;  4A4C A;  4ORA B;  5JJG A;  3EK7 A;  4ORC B;  5HLV A;  2L98 A;  2LMT A;  1M39 A;  1GQM A;  1J7P A;  4MVF A;  3LLE A;  1TNQ A;  3FIA A;  2A4J A;  1SCM C;  1IKU A;  1KWO C;  1MHO A;  1UHI A;  2WOS A;  1TNP A;  3A4U B;  5AAN A;  1REC A;  2KDH A;  1EJ3 A;  1QTX A;  4N1F A;  2LAN A;  2M97 A;  1AUI B;  5HKZ A;  4C0L A;  2KI4 C;  2Y4Q A;  2SCP A;  1K93 D;  2NXQ A;  1YTZ C;  2KQ6 A;  3FS7 A;  1DJW A;  2L4I A;  1OQP A;  1CDN A;  1EL4 A;  3DVJ A;  1NUB A;  2JRF A;  2GGM A;  1OOJ A;  1DJX A;  1UHH A;  4P2Y B;  1UUR A;  1TRF A;  1CTR A;  2F2P A;  1CLL A;  1WLM A;  2M29 A;  3ZWH A;  4PHM A;  2K0J A;  4M2Q A;  1NIW A;  3AKA A;  3VRO A;  3TZ1 A;  4ETO A;  5J3X A;  1D1O A;  2BEC A;  2JTT A;  2EC6 B;  3WNX B;  1BF5 A;  1R6P A;  1S36 A;  2Y1N A;  1ZMZ A;  3SG7 A;  1DJY A;  1R2U A;  1DT7 B;  4YI9 A;  1KQV A;  1TTX A;  2CT9 A;  1TCF A;  1NWD A;  1CB1 A;  1CM4 A;  4YGD B;  3BUX B;  3I5H B;  2K7O A;  4QJ5 B;  2KGB C;  2MAZ A;  5DKQ A;  4JWQ A;  1GJY A;  3TDZ A;  1JC2 A;  2LM5 A;  1B4C A;  1WRL A;  1ZFS A;  2JU0 A;  2BKH B;  2KAX A;  3RM1 A;  2LVV A;  2F33 A;  4CLN A;  2KBI A;  1YUU A;  1A03 A;  3FWB A;  1MF8 B;  4XJK A;  4AOM A;  3I5F B;  4YI8 A;  2COL B;  3DVE A;  4GGF C;  1KFU L;  3QRX A;  1S3P A;  1TIZ A;  3LL8 B;  1CFP A;  4PHK A;  4YGC B;  2M7N A;  1RK9 A;  1ALV A;  1B8L A;  2WND A;  1CLB A;  1Y6W A; 
#chains in the Genus database with same CATH topology
 5F6T A;  1M45 A;  1JSA A;  2LP3 A;  3CLN A;  3FE8 A;  1KK8 B;  1QV1 A;  2CXJ A;  1NPQ A;  2PAL A;  2KOT A;  2LAP A;  2BCX A;  3OGN A;  3PSR A;  1QIW A;  3SIA A;  2MBX A;  1BU3 A;  2G9B A;  3ICB A;  2ZN8 A;  1OOI X;  4TNC A;  5FI6 A;  1DGU A;  3SG2 A;  4YRU A;  1SNL A;  1CDM A;  1BJF A;  1F54 A;  1XO5 A;  1KFX S;  1W7I B;  1E8A A;  2LLS A;  2M1U A;  4HRE E;  2JUL A;  3HCM A;  3OX6 A;  4CPV A;  2LVJ A;  2M3W A;  3PN7 B;  2KYC A;  4JPZ B;  2I18 A;  2Y1M A;  2AAO A;  1PUL A;  1Y0V H;  3MSE B;  3EG5 B;  4PAL A;  2HQ8 A;  3VRN A;  1N65 A;  3PLF B;  3GK1 A;  4MN0 A;  2L51 A;  1J1D A;  2WCH A;  3BYA A;  5CSJ A;  1J7O A;  2HET A;  4E68 A;  3EK4 A;  3D10 A;  1BLQ A;  2Q91 A;  1F4Q A;  1CMG A;  3I5H C;  1SRA A;  3AAJ A;  1EH2 A;  1C7W A;  1XFU O;  1K94 A;  1NSH A;  2JXL A;  2QEH A;  4P5O E;  1B7T Y;  3D78 A;  3PAL A;  3GK4 X;  3A8R A;  1WY9 A;  1DJH A;  2BBM A;  1DVI A;  1QIV A;  5D3O A;  3CZ1 A;  2Q4U A;  1DEL A;  1B9A A;  2KGR A;  1JF2 A;  4ORB B;  1Y1X A;  2QEV A;  1LKJ A;  3I5F C;  3S0G A;  2K7D A;  1PVA A;  5G08 A;  1ZUZ A;  1Z2C B;  2M8U A;  5I8N A;  1PAL A;  4GAO A;  5I2O A;  4I5J A;  1NX1 A;  1KSO A;  2ZN9 A;  1SYM A;  2ZRS A;  1A75 A;  1OZO A;  1DQE A;  1PVB A;  1YX7 A;  2BAP A;  2LMU A;  2WC8 A;  1MXL C;  1SCV A;  2MRD A;  4Q04 A;  5CSN A;  3DY9 A;  2R2I A;  2CTN A;  2QDI A;  1KQM C;  3UNW A;  3IF7 A;  3PM8 A;  2NCO A;  1KK8 C;  1WRZ A;  1IQ3 A;  1XK4 C;  1SBJ A;  2BCB A;  3FE6 A;  2MJW B;  1SW8 A;  2FJY A;  2F2O A;  1DJI A;  1F4O A;  1U5I B;  3DF0 B;  3BUM B;  1KK7 Y;  1S5G Y;  3D0Y B;  3IQQ A;  1QAT A;  2MLF C;  2NLN A;  2M1K B;  3WHU B;  1CFD A;  4USL A;  4PHN A;  3CWG A;  2JTZ A;  1NX2 A;  1X02 A;  2MA2 A;  5JOL A;  5I2Q A;  3PN7 C;  2LP2 A;  1A2X A;  5AEQ A;  1BR1 B;  4GPL B;  1YVH A;  4FQT A;  3TDI A;  4GGF A;  3VGO A;  4FQO A;  1CNP A;  1MWN A;  3Q8I A;  1AVS A;  3CAB A;  3DZT A;  3VRR A;  1AP4 A;  1PRW A;  1S6C A;  3JTD B;  3SG3 A;  1RFJ A;  2HF5 A;  3NHT A;  5KTY A;  1GM0 A;  5AXI A;  4YGB B;  2M0R A;  2TN4 A;  1MR8 A;  3B86 A;  4YGA A;  1CFF A;  2M49 B;  4MBE A;  4M2O A;  1OZS A;  2LMV A;  3DVM A;  3GK2 A;  2JPO A;  4OVN F;  1H8B A;  3O6B A;  1SL8 A;  3F45 A;  1XFR A;  4GUK A;  1F70 A;  2AUC A;  1BG1 A;  1MUX A;  2BL0 B;  1QVI Y;  3CGA A;  2WCK A;  2F3Y A;  4PDZ A;  1JWD A;  3N7H A;  3E3R A;  5AFP A;  1S26 D;  4I5N B;  5HKY A;  1DC1 A;  1CFC A;  1AHR A;  1XVJ A;  1EG3 A;  1N0Y A;  4A4B A;  3BFH A;  1B8R A;  2KSP A;  4MEW A;  2WC6 A;  1OMD A;  2I2R E;  1UWO A;  1IIO A;  1NCZ A;  3M0W A;  2FCE A;  1NX0 A;  5B8I B;  1SMG A;  2KLD A;  1YRT B;  4PE1 A;  3NSI A;  5CSI A;  1XFX O;  2DOQ A;  2ZNE A;  4GGN A;  1DF0 B;  5ER4 X;  2H2K A;  3FWC A;  2FOT A;  5FI7 A;  3NXA A;  1LVC D;  2K61 A;  4PCW A;  1KCY A;  2KYF A;  2ZKM X;  1CMF A;  3S0B A;  1NP8 A;  2LHL A;  3RLZ A;  1SL7 A;  2G2B A;  5TNC A;  1AJ4 A;  2WCF A;  2JNF A;  2AMI A;  4DUQ A;  3I5I C;  2LUC A;  3O4X A;  4OV2 A;  3SS4 A;  2LC5 A;  1CKK A;  5I94 A;  4IJ7 A;  3TUY B;  4NDD A;  4JQ0 D;  5GQQ C;  2QEB A;  1KQM B;  3JTD C;  2GGZ A;  4HSZ A;  3VRP A;  2L0P A;  3CZT X;  3BOW A;  3NGV A;  2JZI A;  2KNE A;  2LCP A;  1ODB A;  2QPT A;  4AQI A;  1VRK A;  1K8U A;  1IJ6 A;  5I2L A;  3PAT A;  1OOG A;  1XFW O;  1XYD A;  2GV5 A;  3OX5 A;  1S6J A;  1XK4 A;  3B6X A;  4C0J A;  1C3Y A;  1LA0 A;  2I94 A;  2QAC A;  2L50 A;  2WC5 A;  4YGE B;  5HYD A;  5K89 A;  1FI5 A;  1RRO A;  4R1E A;  1BMO A;  4M2P A;  1V1G A;  5DKN A;  2KBM A;  2KAV A;  1DMO A;  2P6B B;  2K2A A;  1NCX A;  1QAS A;  2L5X B;  1XFV O;  2H8V A;  2BL0 C;  2OPO A;  3CR4 X;  3SIB A;  2NCP A;  3IVT A;  1J1E A;  1KSM A;  2I7A A;  2KQY A;  2E30 A;  3OB2 B;  1PSB A;  2PQL A;  1AK8 A;  1K90 D;  2JC2 A;  2KFH A;  1G4Y R;  2D8N A;  4JD9 A;  1M63 B;  1DGV A;  2O5G A;  3EK8 A;  1J7R A;  1QXP A;  5DKR A;  2SAS A;  5ER5 A;  4NDC A;  2JOJ A;  2CBL A;  3EKH A;  2FCD A;  1K9U A;  4OR9 B;  1OOH A;  3BXK A;  1IRJ A;  4OZD A;  4PT1 A;  1QX5 B;  1DTL A;  1DJG A;  1XFZ O;  1K9K A;  2HPS A;  2JQ6 A;  2MHH A;  2RGI A;  3LCP C;  4L9M A;  1RTP 1;  3S0A A;  1XA5 A;  3JVT B;  1S6I A;  1M46 A;  1K95 A;  1N2D A;  2V53 A;  2K8M B;  3PM2 A;  5HKW A;  4MRY A;  1MXE A;  4PE7 A;  4AQJ A;  1TNW A;  1C7V A;  2WCB A;  3I5G B;  2LLT A;  5CSF A;  2LVK A;  4OCI A;  4GNK B;  3D74 A;  3KEV A;  3EKJ A;  4IL1 A;  2LV7 A;  1UHK A;  2PAS A;  3TUY C;  2L2C A;  1DEK A;  1B7T Z;  1KFU S;  2FJU B;  2PSR A;  4MRX A;  3HX4 A;  4HRG A;  2KHN A;  1LS8 A;  1OMV A;  4ZCU A;  2BE4 A;  1PK0 D;  1G8I A;  3BQ3 A;  1IQ5 A;  3B88 A;  3AKB A;  4MZK A;  3VRQ A;  4UPG A;  1LA3 A;  3CR5 X;  4MLW A;  1JFK A;  5D69 A;  3CTN A;  3SG6 A;  3SS3 A;  3DD4 A;  1G33 A;  1UUS A;  1Y1A A;  2LHI A;  4OKH A;  1YUS A;  1GGZ A;  2OTG B;  3B7A A;  3D0Y A;  4N1G A;  3S0E A;  2H61 C;  2F3Z A;  3TS5 B;  4F0Z B;  1MQ1 A;  1W9Z A;  2PMY A;  3EVU A;  3K21 A;  1K9P A;  3I5I B;  4DS7 A;  2Y5I A;  3R1V A;  1JF0 A;  1YR5 A;  1FW4 A;  1B1G A;  1SY9 A;  2JT3 A;  2NZ0 A;  3TDU A;  1NCY A;  4D1E A;  1NYA A;  2LE9 B;  5HL1 A;  1YUT A;  2IS9 A;  2WCM A;  2WOR A;  1XFY O;  2OS8 C;  2ERB A;  2HQW A;  1OW4 A;  1L2O C;  1KK7 Z;  1S5G Z;  4C0K A;  1W7J B;  3JVT C;  1FF1 A;  1BOD A;  3ZNI A;  1YX8 A;  1EXR A;  1TN4 A;  2KI6 D;  1TNX A;  2E6W A;  1QX2 A;  2LVI A;  1B8C A;  1SK6 D;  1CLM A;  2KI6 C;  2JT8 A;  3B87 A;  1YVL A;  3I5G C;  3O78 A;  4MZJ A;  4YBH B;  2M7L A;  2ISD A;  1FPW A;  1H4B A;  3WHT B;  1IGV A;  1KFX L;  4BY5 A;  3DVK A;  1M31 A;  1A29 A;  2EHB A;  1B47 A;  5KSZ A;  1IJ5 A;  3D73 A;  1Q80 A;  4I5K A;  4GFT A;  1QV0 A;  2K7B A;  3BUW B;  1K2H A;  3GOF A;  4N5X A;  1WRK A;  4CFR A;  3KHE A;  3O4Y A;  3NSO A;  1NX3 A;  1TCO B;  3NSL A;  1HQV A;  3KO0 A;  4GBA A;  2BBN A;  2BCA A;  4PHJ A;  4QJ4 B;  1SL9 A;  1QS7 A;  3EVV A;  4CFQ A;  1FI6 A;  1DF0 A;  1P28 A;  1QVI Z;  2OTG C;  1UHJ A;  1CDP A;  2JPT A;  3TS5 C;  1LIN A;  2BKI B;  4PE0 A;  5FYX A;  1SKT A;  3CZ0 A;  4INW A;  2KAY A;  1DJZ A;  2K60 A;  5DIC A;  1C3Z A;  2ZFD A;  4XJK B;  1ZAC A;  1UHN A;  1AJ5 A;  3SG5 A;  1JBA A;  1QX7 A;  2EGD A;  2F8P A;  1SR6 B;  1S1E A;  1FBV A;  1SPY A;  4I5L B;  1JFJ A;  2BE6 A;  4WRI A;  2O60 A;  3BUO B;  1V1F A;  2M9G A;  2B1U A;  1QLS A;  1Y1U A;  3KF9 A;  1TWO A;  3VB1 A;  2KLE A;  3BOW B;  4NDB A;  1WDC B;  3BUN B;  3BFB A;  3O2P A;  2KFF A;  1YUR A;  3LK0 A;  3WXA A;  1RWY A;  1ALW A;  2L4H A;  2H61 A;  3PFV A;  4XYN A;  3CYZ A;  4WQ2 A;  1C07 A;  1IH0 A;  4DCK A;  5PAL A;  5D7F A;  1OMR A;  2OS8 B;  1WLZ A;  2VRG A;  1TOP A;  1EG4 A;  3L4L A;  3H4S E;  2PVB A;  2LNK A;  5CPV A;  2BNX A;  1L2O B;  1SCM B;  1BR4 B;  1BT6 A;  1PSR A;  1CDL A;  1QJT A;  1KWO B;  3LK1 A;  1ORG A;  2JT0 A;  3SJS A;  5EL2 A;  2CNP A;  2EC6 C;  2GTE A;  1RJV A;  1J55 A;  1L7Z A;  2KPH A;  2P70 A;  3DXL A;  4HRH A;  2KI4 B;  4MSP A;  2K2F A;  2L2E A;  1J7Q A;  1GGW A;  3BFA A;  4WQ3 A;  1Z4H A;  3NSK A;  3R1O A;  4QJ3 B;  4ICB A;  3SG4 A;  2PRU A;  2CCM A;  3RZS A;  1BOC A;  4DRW A;  4DIR A;  3R72 A;  2JXC A;  2KFG A;  4ZCV A;  1IG5 A;  2YGU A;  2WCL A;  3EVR A;  3OP0 A;  2ZND A;  1F55 A;  2WCJ A;  5IBW A;  2LUX A;  1SR6 C;  1F8H A;  3CR2 A;  3CS1 A;  5AER A;  2JNX A;  1LXF C;  1A4P A;  4JKT A;  3KPX A;  3C1V A;  1OSA A;  4CID A;  1A75 B;  5KU1 A;  1YRU B;  3AAK A;  5HLO A;  1U5I A;  2ZRT A;  1UP5 A;  3DF0 A;  3DYE A;  1IWQ A;  1HT9 A;  1OE9 B;  4MZL A;  2LLU A;  4NQG A;  3SS5 A;  3K1E A;  1QLK A;  2WCE A;  3OHM B;  1WDC C;  1CM1 A;  1F71 A;  4FTG A;  2K7C A;  5BPJ A;  4U8D A;  3S0F A;  3IQO A;  2JWW A;  1K96 A;  1JUO A;  1ZOT B;  2MLE C;  4A4C A;  3NHI A;  4ORA B;  5JJG A;  3EK7 A;  4ORC B;  5HLV A;  2L98 A;  2LMT A;  3FE9 A;  1TUJ A;  1M39 A;  1GQM A;  1J7P A;  2PYQ A;  4MVF A;  3LLE A;  4PE4 A;  1TNQ A;  3FIA A;  2A4J A;  3CDN A;  1SCM C;  1IKU A;  4INX A;  3R1P A;  1KWO C;  1MHO A;  1UHI A;  2P71 A;  2WOS A;  1TNP A;  3A4U B;  5AAN A;  1REC A;  2KDH A;  4KYN A;  1EJ3 A;  3UO9 A;  1QTX A;  4N1F A;  2LAN A;  2M97 A;  4F7F A;  1AUI B;  5HKZ A;  4C0L A;  2KI4 C;  2Y4Q A;  2SCP A;  1K93 D;  2NXQ A;  1YTZ C;  2KQ6 A;  3FS7 A;  2QEO A;  1DJW A;  3D75 A;  2L4I A;  1OQP A;  1CDN A;  1EL4 A;  3DVJ A;  1NUB A;  2JRF A;  2GGM A;  1OOJ A;  1DJX A;  1UHH A;  4P2Y B;  1UUR A;  1OOF A;  1TRF A;  1CTR A;  2F2P A;  1SSE B;  1CLL A;  1WLM A;  2M29 A;  3ZWH A;  3QME A;  3L4A A;  4PHM A;  2K0J A;  4M2Q A;  1NIW A;  3AKA A;  3VRO A;  4BY4 A;  3TZ1 A;  4ETO A;  5J3X A;  3D76 A;  1D1O A;  3S0D A;  2BEC A;  3OB1 B;  2JTT A;  2EC6 B;  1QWV A;  3WNX B;  1BF5 A;  1R6P A;  1S36 A;  2Y1N A;  1ZMZ A;  3SG7 A;  1DJY A;  1R2U A;  1DT7 B;  4YI9 A;  1KQV A;  1TTX A;  2CT9 A;  1TCF A;  1NWD A;  1CB1 A;  1CM4 A;  4YGD B;  3BUX B;  3I5H B;  1TUZ A;  2K7O A;  4QJ5 B;  2KGB C;  2MAZ A;  5DKQ A;  4JWQ A;  1GJY A;  3TDZ A;  1JC2 A;  2LM5 A;  3D77 A;  1B4C A;  3L47 A;  1WRL A;  1ZFS A;  2JU0 A;  2BKH B;  2KAX A;  5FI2 A;  3RM1 A;  2LVV A;  3V2L A;  2F33 A;  2L5Y A;  4CLN A;  2KBI A;  1YUU A;  1A03 A;  3FWB A;  1MF8 B;  4XJK A;  4AOM A;  3I5F B;  4YI8 A;  2COL B;  3CZ2 A;  3OBV A;  3DVE A;  4GGF C;  1KFU L;  3QRX A;  1S3P A;  1TIZ A;  3LL8 B;  1CFP A;  4PHK A;  4YGC B;  2M7N A;  3BJH A;  1RK9 A;  1ALV A;  3PJI A;  1B8L A;  2WND A;  1CLB A;  1T14 A;  1Y6W A; 
#chains in the Genus database with same CATH homology
 5F6T A;  1M45 A;  2LP3 A;  3CLN A;  1KK8 B;  1QV1 A;  2CXJ A;  1NPQ A;  2PAL A;  2KOT A;  2LAP A;  2BCX A;  3PSR A;  1QIW A;  3SIA A;  2MBX A;  1BU3 A;  2G9B A;  3ICB A;  2ZN8 A;  4TNC A;  4BY5 A;  1DGU A;  3SG2 A;  4YRU A;  1SNL A;  1CDM A;  1BJF A;  1F54 A;  1XO5 A;  1KFX S;  1W7I B;  1E8A A;  2LLS A;  2M1U A;  4HRE E;  2JUL A;  3HCM A;  3OX6 A;  4CPV A;  2LVJ A;  2M3W A;  3PN7 B;  2KYC A;  4JPZ B;  2I18 A;  2Y1M A;  2AAO A;  1PUL A;  1Y0V H;  3MSE B;  4PAL A;  3VRN A;  2HQ8 A;  1N65 A;  3PLF B;  3GK1 A;  4MN0 A;  2L51 A;  1J1D A;  3BYA A;  5CSJ A;  1J7O A;  2HET A;  4E68 A;  3EK4 A;  3D10 A;  1BLQ A;  2Q91 A;  1F4Q A;  1CMG A;  3I5H C;  1SRA A;  3AAJ A;  1EH2 A;  1C7W A;  1XFU O;  1K94 A;  1NSH A;  2JXL A;  4P5O E;  1B7T Y;  3PAL A;  3GK4 X;  3A8R A;  1WY9 A;  1DJH A;  2BBM A;  1DVI A;  1QIV A;  2Q4U A;  1B9A A;  2KGR A;  1JF2 A;  4ORB B;  1Y1X A;  3I5F C;  1LKJ A;  2K7D A;  1PVA A;  5G08 A;  1ZUZ A;  5I8N A;  2M8U A;  1PAL A;  4GAO A;  5I2O A;  4I5J A;  1NX1 A;  1KSO A;  2ZN9 A;  1SYM A;  2ZRS A;  1A75 A;  1OZO A;  1YX7 A;  1PVB A;  2LMU A;  2WC8 A;  3OB1 B;  4PE4 A;  1MXL C;  1SCV A;  2MRD A;  4Q04 A;  5CSN A;  2R2I A;  2CTN A;  1KQM C;  3IF7 A;  3PM8 A;  2NCO A;  1KK8 C;  1WRZ A;  1IQ3 A;  1XK4 C;  1SBJ A;  2BCB A;  2MJW B;  1SW8 A;  2F2O A;  1DJI A;  1F4O A;  1U5I B;  3DF0 B;  3BUM B;  1KK7 Y;  1S5G Y;  3D0Y B;  3IQQ A;  1QAT A;  2MLF C;  2NLN A;  2M1K B;  3WHU B;  1CFD A;  4USL A;  4PHN A;  3CWG A;  2JTZ A;  1NX2 A;  1X02 A;  2MA2 A;  5JOL A;  5I2Q A;  3PN7 C;  2LP2 A;  1A2X A;  5AEQ A;  1BR1 B;  4GPL B;  1YVH A;  3TDI A;  3VGO A;  4GGF A;  4FQO A;  1CNP A;  1MWN A;  1AVS A;  3VRR A;  1AP4 A;  1PRW A;  1S6C A;  3JTD B;  3SG3 A;  1RFJ A;  2HF5 A;  5KTY A;  5AXI A;  4YGB B;  2M0R A;  2TN4 A;  1MR8 A;  4YGA A;  1CFF A;  2M49 B;  4MBE A;  4M2O A;  1OZS A;  2LMV A;  3DVM A;  3GK2 A;  4OVN F;  1H8B A;  3O6B A;  1SL8 A;  3F45 A;  4GUK A;  2AUC A;  1BG1 A;  1MUX A;  2BL0 B;  1QVI Y;  3CGA A;  4PDZ A;  2F3Y A;  1JWD A;  3E3R A;  5AFP A;  1S26 D;  4I5N B;  5HKY A;  1CFC A;  1AHR A;  1XVJ A;  1EG3 A;  1N0Y A;  4A4B A;  1B8R A;  2KSP A;  4MEW A;  1OMD A;  2I2R E;  1UWO A;  1NCZ A;  3M0W A;  2FCE A;  1NX0 A;  5B8I B;  1SMG A;  1YRT B;  4PE1 A;  3NSI A;  5CSI A;  1XFX O;  2DOQ A;  2ZNE A;  4GGN A;  1DF0 B;  5ER4 X;  2H2K A;  3FWC A;  2FOT A;  3NXA A;  1LVC D;  2K61 A;  4PCW A;  1KCY A;  2KYF A;  2ZKM X;  1CMF A;  1NP8 A;  2LHL A;  3RLZ A;  1SL7 A;  2G2B A;  5TNC A;  1AJ4 A;  2WCF A;  2JNF A;  2AMI A;  4DUQ A;  3I5I C;  2LUC A;  4OV2 A;  2LC5 A;  1CKK A;  3TUY B;  4NDD A;  4JQ0 D;  5GQQ C;  3JTD C;  1KQM B;  2GGZ A;  4HSZ A;  3VRP A;  2L0P A;  3CZT X;  3BOW A;  2JZI A;  2KNE A;  2LCP A;  1ODB A;  2QPT A;  4AQI A;  1VRK A;  1K8U A;  1IJ6 A;  5I2L A;  3PAT A;  1XFW O;  1XYD A;  2GV5 A;  3OX5 A;  1S6J A;  1XK4 A;  4C0J A;  1LA0 A;  2I94 A;  2QAC A;  2L50 A;  4YGE B;  5HYD A;  5K89 A;  1FI5 A;  1RRO A;  4R1E A;  1BMO A;  4M2P A;  1V1G A;  5DKN A;  2KBM A;  2KAV A;  1DMO A;  2P6B B;  2K2A A;  1NCX A;  1QAS A;  2L5X B;  1XFV O;  2OPO A;  2BL0 C;  3CR4 X;  1F70 A;  3SIB A;  2NCP A;  1J1E A;  1KSM A;  2I7A A;  2KQY A;  2E30 A;  3OB2 B;  1PSB A;  1AK8 A;  1K90 D;  2JC2 A;  2KFH A;  1G4Y R;  2D8N A;  1M63 B;  1DGV A;  2O5G A;  3EK8 A;  1J7R A;  1QXP A;  5DKR A;  2SAS A;  5ER5 A;  4NDC A;  2JOJ A;  2CBL A;  3EKH A;  2FCD A;  1K9U A;  4OR9 B;  3BXK A;  1IRJ A;  1QX5 B;  1DTL A;  1DJG A;  1XFZ O;  1K9K A;  2HPS A;  2JQ6 A;  2MHH A;  2RGI A;  3LCP C;  4L9M A;  1RTP 1;  1XA5 A;  3JVT B;  1S6I A;  1M46 A;  1K95 A;  1N2D A;  2V53 A;  2K8M B;  5HKW A;  4MRY A;  1MXE A;  4PE7 A;  4AQJ A;  1TNW A;  1C7V A;  2WCB A;  3I5G B;  2LLT A;  5CSF A;  2LVK A;  4OCI A;  4GNK B;  3KEV A;  3EKJ A;  4IL1 A;  2LV7 A;  1UHK A;  2PAS A;  3TUY C;  1B7T Z;  1KFU S;  2FJU B;  2PSR A;  4MRX A;  3HX4 A;  4HRG A;  2KHN A;  1OMV A;  4ZCU A;  2BE4 A;  1PK0 D;  1G8I A;  3BQ3 A;  1IQ5 A;  4MZK A;  3AKB A;  3VRQ A;  4UPG A;  1JSA A;  1LA3 A;  3CR5 X;  4MLW A;  1JFK A;  5D69 A;  3CTN A;  3SG6 A;  3DD4 A;  1G33 A;  1UUS A;  1Y1A A;  2LHI A;  4OKH A;  1YUS A;  1GGZ A;  2OTG B;  4F0Z B;  3D0Y A;  4N1G A;  2H61 C;  2F3Z A;  3TS5 B;  1MQ1 A;  2PMY A;  3EVU A;  3K21 A;  1K9P A;  3I5I B;  4DS7 A;  2Y5I A;  1JF0 A;  1YR5 A;  1FW4 A;  1B1G A;  1SY9 A;  2JT3 A;  2NZ0 A;  3TDU A;  1NCY A;  4D1E A;  1NYA A;  2LE9 B;  1YUT A;  2IS9 A;  2WOR A;  1XFY O;  2OS8 C;  2HQW A;  1L2O C;  1KK7 Z;  1S5G Z;  4C0K A;  1W7J B;  3JVT C;  1FF1 A;  1BOD A;  3ZNI A;  1YX8 A;  1EXR A;  1TN4 A;  2KI6 D;  1TNX A;  2E6W A;  1QX2 A;  2LVI A;  1B8C A;  1SK6 D;  1CLM A;  2KI6 C;  2JT8 A;  3I5G C;  1YVL A;  3O78 A;  4MZJ A;  4YBH B;  2M7L A;  1FPW A;  2ISD A;  1H4B A;  3WHT B;  1IGV A;  1KFX L;  3DVK A;  1M31 A;  1A29 A;  2EHB A;  1B47 A;  5KSZ A;  1IJ5 A;  1Q80 A;  4I5K A;  4GFT A;  1QV0 A;  2K7B A;  3BUW B;  1K2H A;  3GOF A;  4N5X A;  1WRK A;  4CFR A;  3KHE A;  3O4Y A;  3NSO A;  1NX3 A;  1TCO B;  3NSL A;  1HQV A;  3KO0 A;  4GBA A;  2BBN A;  2BCA A;  4PHJ A;  4QJ4 B;  1SL9 A;  1QS7 A;  3EVV A;  4CFQ A;  1FI6 A;  1DF0 A;  1QVI Z;  2OTG C;  1UHJ A;  1CDP A;  2JPT A;  3TS5 C;  1LIN A;  2BKI B;  4PE0 A;  5FYX A;  1SKT A;  2KAY A;  1DJZ A;  2ZFD A;  4XJK B;  1ZAC A;  1UHN A;  1AJ5 A;  3SG5 A;  1JBA A;  1QX7 A;  2EGD A;  2F8P A;  1SR6 B;  1S1E A;  1FBV A;  1SPY A;  4I5L B;  1JFJ A;  2BE6 A;  4WRI A;  2O60 A;  3BUO B;  1V1F A;  2M9G A;  2B1U A;  1QLS A;  1Y1U A;  3KF9 A;  3BOW B;  4NDB A;  1WDC B;  3BUN B;  3O2P A;  2KFF A;  1YUR A;  3LK0 A;  3WXA A;  1RWY A;  1ALW A;  2L4H A;  2H61 A;  3PFV A;  4XYN A;  4WQ2 A;  1C07 A;  1IH0 A;  4DCK A;  5PAL A;  5D7F A;  1OMR A;  2OS8 B;  1WLZ A;  2VRG A;  1TOP A;  1EG4 A;  5CPV A;  3H4S E;  2PVB A;  2LNK A;  4BY4 A;  1L2O B;  1SCM B;  1BR4 B;  1BT6 A;  1PSR A;  1CDL A;  1QJT A;  1KWO B;  3LK1 A;  2JT0 A;  3SJS A;  2CNP A;  2EC6 C;  1RJV A;  1J55 A;  1L7Z A;  1J7Q A;  4HRH A;  2KI4 B;  4MSP A;  2K2F A;  2L2E A;  1GGW A;  4WQ3 A;  3NSK A;  4QJ3 B;  3SG4 A;  4ICB A;  2PRU A;  2CCM A;  1BOC A;  4DRW A;  4DIR A;  2JXC A;  2KFG A;  4ZCV A;  1IG5 A;  3EVR A;  3OP0 A;  2ZND A;  1F55 A;  5IBW A;  2LUX A;  1SR6 C;  1F8H A;  3CR2 A;  3CS1 A;  5AER A;  2JNX A;  1LXF C;  1A4P A;  3KPX A;  3C1V A;  1OSA A;  4CID A;  1A75 B;  5KU1 A;  1YRU B;  3AAK A;  5HLO A;  1U5I A;  2ZRT A;  1UP5 A;  3DF0 A;  4MZL A;  1IWQ A;  1HT9 A;  1OE9 B;  4NQG A;  2LLU A;  1QLK A;  2WCE A;  3OHM B;  1WDC C;  1CM1 A;  1F71 A;  4FTG A;  2K7C A;  5BPJ A;  4U8D A;  3IQO A;  2JWW A;  1K96 A;  1JUO A;  1ZOT B;  2MLE C;  4A4C A;  4ORA B;  5JJG A;  3EK7 A;  4ORC B;  5HLV A;  2L98 A;  2LMT A;  1M39 A;  1GQM A;  1J7P A;  4MVF A;  3LLE A;  1TNQ A;  3FIA A;  2A4J A;  1SCM C;  1IKU A;  1KWO C;  1MHO A;  1UHI A;  2WOS A;  1TNP A;  3A4U B;  5AAN A;  1REC A;  2KDH A;  1EJ3 A;  1QTX A;  4N1F A;  2LAN A;  2M97 A;  1AUI B;  5HKZ A;  4C0L A;  2KI4 C;  2Y4Q A;  2SCP A;  1K93 D;  2NXQ A;  1YTZ C;  2KQ6 A;  3FS7 A;  1DJW A;  2L4I A;  1OQP A;  1CDN A;  1EL4 A;  3DVJ A;  1NUB A;  2JRF A;  2GGM A;  1OOJ A;  1DJX A;  1UHH A;  4P2Y B;  1UUR A;  1TRF A;  1CTR A;  2F2P A;  1CLL A;  1WLM A;  2M29 A;  3ZWH A;  4PHM A;  2K0J A;  4M2Q A;  1NIW A;  3AKA A;  3VRO A;  3TZ1 A;  4ETO A;  5J3X A;  1D1O A;  2BEC A;  2JTT A;  2EC6 B;  3WNX B;  1BF5 A;  1R6P A;  1S36 A;  2Y1N A;  1ZMZ A;  3SG7 A;  1DJY A;  1R2U A;  1DT7 B;  4YI9 A;  1KQV A;  1TTX A;  2CT9 A;  1TCF A;  1NWD A;  1CB1 A;  1CM4 A;  4YGD B;  3BUX B;  3I5H B;  2K7O A;  4QJ5 B;  2KGB C;  2MAZ A;  5DKQ A;  4JWQ A;  1GJY A;  3TDZ A;  1JC2 A;  2LM5 A;  1B4C A;  1WRL A;  1ZFS A;  2JU0 A;  2BKH B;  2KAX A;  3RM1 A;  2LVV A;  2F33 A;  4CLN A;  2KBI A;  1YUU A;  1A03 A;  3FWB A;  1MF8 B;  4XJK A;  4AOM A;  3I5F B;  4YI8 A;  2COL B;  3DVE A;  4GGF C;  1KFU L;  3QRX A;  1S3P A;  1TIZ A;  3LL8 B;  1CFP A;  4PHK A;  4YGC B;  2M7N A;  1RK9 A;  1ALV A;  1B8L A;  2WND A;  1CLB A;  1Y6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...