2NLNA

Solution structure of calcium-free rat beta-parvalbumin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Oncomodulin
publication title Solution structure of Ca2+-free rat beta-parvalbumin (oncomodulin).
pubmed doi rcsb
source organism Rattus norvegicus
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2nlnA00
1B47A 1F4QA 2M49B 1EJ3A 3SG5A 2CT9A 5IBWA 3HX4A 4PDZA 3VRPA 4M2OA 1WRLA 3RLZA 2LVIA 1TNQA 4BY5A 1S5GY 2L51A 2LM5A 2WNDA 1NYAA 1K2HA 1SYMA 4XYNA 2WORA 5HLVA 1IH0A 3TUYC 1BLQA 3M0WA 3CZTX 2I2RE 1KWOB 3I5FB 1LINA 1JUOA 2H61C 2JRFA 1QX5B 3I5IC 1K94A 3JTDB 1OQPA 2EC6B 4YRUA 3SG3A 1IJ6A 1CDPA 1S36A 2LMUA 4YGAA 1GQMA 1ZOTB 2L4HA 2L2EA 5CSIA 1JF2A 1YURA 2LCPA 4CFRA 2SCPA 2E6WA 5D7FA 1BU3A 4PE0A 1E8AA 2LVKA 3BYAA 4GUKA 5ER5A 1A29A 2EHBA 3EVRA 2WCEA 1C7VA 1DGVA 2LVJA 1DGUA 1M39A 1FBVA 4JPZB 2GGZA 1ZFSA 3CWGA 3JVTB 1AJ4A 1DMOA 2M0RA 2ISDA 4MBEA 5KTYA 1SNLA 2K7DA 4YGBB 1XYDA 5J3XA 1YX7A 4YGEB 4ICBA 3K21A 1SL9A 3SG2A 1L7ZA 4D1EA 1L2OB 2L50A 1N2DA 5CSJA 3SIBA 5HLOA 4MLWA 4DCKA 1B8RA 3PFVA 1NCZA 3F45A 4OVNF 1F55A 2BECA 1RFJA 3PM8A 3VROA 3I5FC 1EXRA 4PHKA 4PCWA 4HSZA 2CCMA 3JTDC 2EC6C 3SJSA 5BPJA 4GGNA 3EKHA 4NDBA 1BF5A 3PALA 2KGBC 3PATA 2RGIA 3FS7A 2L98A 1MUXA 1PVBA 3FIAA 1UHNA 1OMVA 1Y1UA 1N0YA 3WXAA 5KSZA 1XK4A 2L5XB 2MAZA 1CFDA 3PLFB 3VRNA 1DF0A 3JVTC 2KI6D 1NCYA 2E30A 2QPTA 2BKIB 4OCIA 4AQJA 4UPGA 5AERA 1BMOA 3O78A 1BR1B 4OKHA 2BE6A 1QATA 1L2OC 2WC8A 2MRDA 3AKBA 1TNXA 5DKQA 3I5HB 1RK9A 2OS8B 3LK1A 1CM4A 4A4BA 1DT7B 1QLSA 1NUBA 2F33A 3OP0A 3CTNA 3KO0A 1KFXL 2K2AA 3EK8A 1Y6WA 5GQQC 3IF7A 1CLMA 5TNCA 2ZNDA 3OB2B 1K9UA 2JT0A 1KSMA 3BUOB 4MVFA 1G8IA 1WRKA 3NSOA 2H2KA 2PSRA 1MR8A 4ZCUA 3NSIA 2COLB 2JTZA 5CSNA 5HKWA 1YVHA 2M8UA 2M7LA 2MJWB 1FI5A 1J7PA 1ODBA 1MHOA 1BR4B 2K7CA 4GFTA 4N1GA 4FTGA 1W7JB 1YTZC 1QVIZ 1S26D 5I2QA 1BOCA 4MSPA 1BG1A 1EH2A 4GPLB 2GV5A 1AUIB 2JXLA 1DJWA 3SG7A 2FOTA 1MXEA 2BCBA 1NSHA 1NWDA 2JWWA 4C0LA 1TNPA 1TN4A 1SRAA 2KBMA 3CR2A 1DF0B 2KFFA 2LMTA 2LC5A 2HQ8A 3GK2A 1VRKA 2JC2A 3EVVA 3TDIA 4DIRA 3ZWHA 3A4UB 3DF0A 2OS8C 1KFXS 3I5HC 1QS7A 3OB1B 4PALA 2O60A 2HPSA 2LNKA 3I5GB 4IL1A 4GNKB 2KI4B 1S5GZ 4FQOA 4XJKA 4ORAB 2JNFA 1CKKA 4PE4A 1BT6A 1MF8B 1NCXA 2OTGB 1NIWA 1HQVA 3OX5A 1R6PA 1JFJA 1TCOB 5G08A 1M63B 4F0ZB 1G4YR 1KFUS 1PALA 2Q4UA 1QIWA 1SCMB 1WLZA 2JT8A 2LP3A 1B4CA 1CB1A 1YUUA 2NZ0A 5HKYA 1S6IA 3AAJA 3BUWB 3OX6A 1NPQA 1IJ5A 2BBMA 1Y0VH 2F8PA 2KSPA 3DVMA 4JWQA 5JOLA 1D1OA 1FI6A 1PSBA 2CTNA 2MLEC 2LV7A 1CTRA 1WRZA 1H8BA 1A03A 1IQ3A 5AXIA 1JF0A 1CDLA 4AQIA 1Q80A 1XK4C 1Y1XA 3PN7B 4WQ2A 2LMVA 4OR9B 1WDCB 5HKZA 2G2BA 5AEQA 1OZSA 1PVAA 4R1EA 1SY9A 1IWQA 2BE4A 1QX7A 2NCPA 3CLNA 2WOSA 2PASA 1MXLC 5CPVA 1TTXA 1LVCD 4I5JA 3I5GC 3DVEA 3PSRA 2KI4C 5HYDA 1NX3A 5KU1A 1H4BA 3DF0B 2LHIA 2MHHA 2O5GA 2OTGC 2Q91A 4CIDA 5K89A 1CMGA 1JC2A 2LANA 1V1GA 1KK7Y 1KCYA 4XJKB 3BUNB 2FCDA 2ZN8A 2KYCA 2F3ZA 2FJUB 1SCMC 2KI6C 2M29A 2KOTA 1QLKA 1IGVA 2JQ6A 1CNPA 3C1VA 2K7BA 4U8DA 2LAPA 1JSAA 1N65A 1TIZA 1B8LA 3QRXA 1SPYA 1JBAA 2JT3A 3BXKA 1G33A 1EG3A 3NSKA 1CFFA 2ZRSA 3BOWA 1J1EA 2LE9B 1CFPA 4QJ4B 4CLNA 1ZUZA 2JNXA 1DJZA 2M9GA 1F4OA 2LVVA 2JU0A 3PN7C 4PE1A 1TNWA 4YGCB 5PALA 1WDCC 3O2PA 2BCAA 1GGWA 1OOJA 4YGDB 1OMDA 1SW8A 1K96A 2PVBA 1RECA 4YI8A 1ALVA 2NCOA 3RM1A 4MRYA 1QV0A 4ETOA 2KQ6A 3VGOA 2FCEA 3NXAA 2LLUA 3EVUA 1C7WA 2JTTA 3DD4A 4PHJA 5I2OA 4GBAA 3BUMB 3SG6A 2CBLA 2LP2A 5AFPA 4N1FA 1WY9A 1RWYA 4BY4A 3D0YA 2LHLA 3AAKA 1SL7A 1LKJA 3OHMB 1S1EA 3WHTB 1RTP1 1SL8A 2K2FA 2I94A 4MZKA 2IS9A 2ZRTA 3KEVA 1JWDA 2AMIA 2KFGA 2LUXA 1F70A 1CFCA 1IRJA 1J7OA 3IQOA 1PK0D 1IQ5A 1DJHA 1B8CA 1PSRA 2LUCA 2I18A 3MSEB 2GGMA 4GAOA 2F3YA 3GK4X 2NXQA 4NQGA 1AVSA 3BOWB 2JULA 4YBHB 4PE7A 5D69A 3IQQA 2M7NA 1RJVA 2ZKMX 3D10A 1B7TY 3WNXB 2B1UA 2ZNEA 1OSAA 1DJGA 1K93D 3KF9A 5DKRA 2CXJA 5AANA 3SIAA 3EK4A 4CPVA 1FW4A 5I8NA 4GGFA 1M31A 2M97A 4HRGA 1UP5A 4QJ3B 2JZIA 2KHNA 1F71A 2EGDA 4Q04A 1UHJA 2QACA 1NX2A 1TOPA 3NSLA 4MZJA 4ORBB 4C0KA 1CDNA 1SR6B 4M2PA 4E68A 2AAOA 4N5XA 2BCXA 2JOJA 2BKHB 3KHEA 1NX1A 3A8RA 4HRHA 2K8MB 1W7IB 1RROA 1UURA 1GGZA 1UHHA 5DKNA 3AKAA 1S6JA 3HCMA 3D0YB 1B1GA 3TDUA 1OZOA 1X02A 2PALA 4AOMA 3GOFA 2KGRA 1R2UA 3CS1A 3TZ1A 1SCVA 2Y1MA 5JJGA 1LA3A 1YX8A 4C0JA 1QV1A 4USLA 1MWNA 1A75A 1F54A 1GJYA 1K8UA 1IKUA 1XFXO 4PHNA 2KQYA 3WHUB 2M3WA 1AK8A 3ICBA 2LLSA 1UUSA 2KAVA 3FWCA 4TNCA 1FPWA 1CLLA 4I5NB 1J7RA 1JFKA 1UWOA 3VRRA 2BL0B 1K95A 2AUCA 2K0JA 2WCBA 3CGAA 2PRUA 1NP8A 2R2IA 5FYXA 4MRXA 2L4IA 4JQ0D 1AP4A 1DJXA 1DJYA 1QJTA 2KAXA 4PHMA 3LCPC 4HREE 2DOQA 2TN4A 3TDZA 1KQMB 1XVJA 1V1FA 1QXPA 2CNPA 4YI9A 1QASA 3LL8B 1SR6C 1U5IA 2OPOA 1EL4A 5ER4X 2VRGA 1KQVA 1B9AA 1YRUB 5F6TA 1CMFA 1DVIA 4P2YB 5I2LA 1YVLA 1SBJA 1XA5A 2JXCA 3FWBA 1KK7Z 2BBNA 2KDHA 1EG4A 1CDMA 1IG5A 3KPXA 2L0PA 3BQ3A 1OMRA 2KYFA 2V53A 1Y1AA 2SASA 1SK6D 1MQ1A 1C07A 1XFYO 3TS5B 1QIVA 1XFVO 2H61A 2K7OA 3GK1A 1NX0A 2KBIA 3DVJA 1KWOC 3CR4X 1LXFC 2MLFC 4MEWA 4ORCB 4DUQA 4CFQA 1A2XA 1A75B 2KNEA 2HETA 4QJ5B 1J1DA 1ZACA 4L9MA 2BL0C 3LK0A 1S6CA 1K9KA 2WCFA 1AJ5A 1KK8B 4A4CA 2I7AA 4M2QA 2Y5IA 2LLTA 2F2OA 2K61A 2G9BA 2M1KB 2PMYA 4GGFC 1KQMC 2HF5A 1YRTB 4I5KA 2ZN9A 3CR5X 3BUXB 1XFZO 1UHIA 4WRIA 2MBXA 1YUTA 2HQWA 4I5LB 1BODA 1U5IB 1K90D 1M46A 1S3PA 1TRFA 2JPTA 2Y1NA 1TCFA 1SKTA 1ALWA 1BJFA 1OE9B 1PRWA 1PULA 1CM1A 1UHKA 5CSFA 2F2PA 1J7QA 3SG4A 3TS5C 2KAYA 2ZFDA 3O6BA 3LLEA 1XFUO 1SMGA 3ZNIA 3TUYB 1J55A 1WLMA 3EKJA 4OV2A 1YR5A 1A4PA 1YUSA 1FF1A 5B8IB 2P6BB 3O4YA 1HT9A 2KFHA 2A4JA 3DVKA 3H4SE 1M45A 3I5IB 1AHRA 3EK7A 1F8HA 2NLNA 4DS7A 1KFUL 2D8NA 1LA0A 1QTXA 1QX2A 1QVIY 1KK8C 1KSOA 1B7TZ 2Y4QA 4ZCVA 4MN0A 4MZLA 3VRQA 4P5OE 3E3RA 1DTLA 4NDDA 4WQ3A 1DJIA 4DRWA 2M1UA 1XO5A 2MA2A 1XFWO 1ZMZA 1CLBA 1K9PA 4NDCA
chains in the Genus database with same CATH superfamily
1B47A 1F4QA 2M49B 1EJ3A 3SG5A 2CT9A 5IBWA 3HX4A 1DQEA 4PDZA 3VRPA 4M2OA 1WRLA 3RLZA 2LVIA 1TNQA 2FJYA 4BY5A 1S5GY 2L51A 3CZ1A 2LM5A 2WNDA 1DT7B 3DYEA 1NYAA 1K2HA 1SYMA 4XYNA 2WORA 5HLVA 1IH0A 3TUYC 1BLQA 3M0WA 3CZTX 5HL1A 2I2RE 1KWOB 3I5FB 1LINA 1JUOA 2H61C 2JRFA 1QX5B 3I5IC 1K94A 3JTDB 1OQPA 2EC6B 4YRUA 3SG3A 1IJ6A 1CDPA 1S36A 2LMUA 2WCJA 1GQMA 3Q8IA 1ZOTB 2ERBA 4YGAA 2L4HA 3FE8A 2L2EA 5CSIA 1JF2A 1YURA 2LCPA 4CFRA 2SCPA 2E6WA 5D7FA 1BU3A 4PE0A 1E8AA 2P70A 2LVKA 3BYAA 4GUKA 2WCLA 5ER5A 1A29A 2EHBA 2WCKA 3EVRA 3EG5B 2WCEA 1C7VA 1DGVA 2LVJA 1DGUA 1M39A 1FBVA 4JPZB 2GGZA 1ZFSA 3SS5A 3S0FA 3CWGA 3OGNA 3JVTB 1AJ4A 1DMOA 2M0RA 2ISDA 4MBEA 5KTYA 1SNLA 2K7DA 4YGBB 2QEBA 1XYDA 5J3XA 1YX7A 4YGEB 3B7AA 1GM0A 4ICBA 3K21A 1SL9A 4IJ7A 3SG2A 1L7ZA 4D1EA 1L2OB 2L50A 3BFAA 1N2DA 5CSJA 3SIBA 2KPHA 1C3ZA 5HLOA 4MLWA 4DCKA 1B8RA 3PFVA 1NCZA 3F45A 4OVNF 1F55A 2BECA 1RFJA 2BAPA 3OBVA 3PM8A 3VROA 3I5FC 1EXRA 3R1VA 4PCWA 4HSZA 4PHKA 2CCMA 3JTDC 2EC6C 5DICA 3S0GA 3SJSA 5BPJA 4GGNA 2WCHA 3EKHA 4NDBA 1BF5A 3PALA 2KGBC 1OOFA 3PATA 2RGIA 3FS7A 2L98A 1MUXA 3D74A 1PVBA 3B87A 3FIAA 1UHNA 1OMVA 1Y1UA 1N0YA 3WXAA 5KSZA 1XK4A 2L5XB 2MAZA 1CFDA 3PLFB 3VRNA 1DF0A 3JVTC 2KI6D 1NCYA 2E30A 2QPTA 2BKIB 4OCIA 4AQJA 4UPGA 5AERA 1BMOA 3O78A 1BR1B 4OKHA 2BE6A 1QATA 1L2OC 2WC8A 2MRDA 3AKBA 1TNXA 5DKQA 3I5HB 1RK9A 2OS8B 3LK1A 1CM4A 5FI6A 4A4BA 3R1PA 1QLSA 1NUBA 2F33A 3OP0A 3CTNA 4JD9A 3KO0A 1KFXL 2K2AA 3EK8A 2QEHA 1Y6WA 5GQQC 3IF7A 1CLMA 5TNCA 2ZNDA 3OB2B 1K9UA 2JT0A 1KSMA 3BUOB 4MVFA 3B6XA 1G8IA 1WRKA 3NSOA 2H2KA 2PSRA 1MR8A 3BFHA 3NSIA 2COLB 4ZCUA 2JTZA 3L4AA 5CSNA 5HKWA 1YVHA 2M8UA 2M7LA 2MJWB 1FI5A 1J7PA 1ODBA 1MHOA 1BR4B 2K7CA 4GFTA 4N1GA 4FTGA 1W7JB 1YTZC 1QVIZ 1S26D 5I2QA 1BOCA 4MSPA 1BG1A 1EH2A 4GPLB 2GV5A 1AUIB 4F7FA 2JXLA 1DJWA 3SG7A 2FOTA 3FE6A 1MXEA 2BCBA 1NSHA 1NWDA 2JWWA 4C0LA 1TNPA 1TN4A 1SRAA 2KBMA 3CR2A 1DF0B 3R72A 2KFFA 2LMTA 2LC5A 2HQ8A 3GK2A 1VRKA 2JC2A 3EVVA 3TDIA 4DIRA 3ZWHA 3A4UB 3DF0A 2OS8C 1KFXS 3I5HC 1QS7A 3OB1B 4PALA 2O60A 3SS3A 2HPSA 2LNKA 3I5GB 4IL1A 1Z4HA 4GNKB 2H8VA 2KI4B 1ORGA 1S5GZ 4FQOA 4ORAB 4XJKA 3RZSA 2JNFA 1CKKA 4PE4A 1BT6A 1MF8B 1NCXA 2OTGB 1NIWA 1HQVA 3OX5A 1R6PA 3B88A 1TCOB 3UO9A 1JFJA 5G08A 1M63B 4F0ZB 1G4YR 1DEKA 1KFUS 1PALA 2Q4UA 1QIWA 1SCMB 1WLZA 2JT8A 2LP3A 1B4CA 1CB1A 1IIOA 1YUUA 2NZ0A 5HKYA 1S6IA 3AAJA 3BUWB 3OX6A 1NPQA 1IJ5A 1XFRA 1Y0VH 2BBMA 2F8PA 2KSPA 3DVMA 4JWQA 5JOLA 1D1OA 1FI6A 1PSBA 2CTNA 2MLEC 2LV7A 1CTRA 1WRZA 1H8BA 1A03A 1IQ3A 5AXIA 1JF0A 2QEVA 1CDLA 4AQIA 1Q80A 1XK4C 1Y1XA 3PN7B 4WQ2A 2LMVA 4OR9B 1WDCB 5HKZA 2G2BA 5AEQA 1OZSA 1PVAA 2KLDA 4R1EA 1SY9A 1IWQA 2BE4A 1QX7A 2NCPA 3CLNA 2WOSA 2PASA 1MXLC 5CPVA 1TTXA 1LVCD 4I5JA 3I5GC 3DVEA 3PSRA 2KI4C 5HYDA 1NX3A 5KU1A 1H4BA 3DF0B 2LHIA 2MHHA 2O5GA 2OTGC 2Q91A 4CIDA 5K89A 1CMGA 1JC2A 2LANA 1V1GA 1KK7Y 1KCYA 4XJKB 3BUNB 2FCDA 2ZN8A 2KYCA 2F3ZA 2FJUB 1SCMC 2KI6C 2M29A 4INWA 2KOTA 1QLKA 1P28A 1IGVA 2JPOA 2JQ6A 1CNPA 1W9ZA 3C1VA 2K7BA 4U8DA 2LAPA 3QMEA 1JSAA 1N65A 1TIZA 1B8LA 3QRXA 1SPYA 4OZDA 2JT3A 1JBAA 3BXKA 1G33A 3O4XA 3IVTA 1EG3A 3NSKA 5I94A 1CFFA 1Z2CB 2ZRSA 3BOWA 1J1EA 2LE9B 1CFPA 3CABA 3V2LA 4QJ4B 4CLNA 1ZUZA 2JNXA 1DJZA 2M9GA 1F4OA 2LVVA 3NHTA 3PM2A 2JU0A 3PN7C 3S0AA 4PE1A 1TNWA 4YGCB 5PALA 1WDCC 3O2PA 2BCAA 1GGWA 1OOJA 4YGDB 1OMDA 1SW8A 1K96A 2PVBA 1RECA 4YI8A 1ALVA 2NCOA 3RM1A 4MRYA 1QV0A 4ETOA 2KQ6A 3VGOA 2FCEA 3CZ0A 3NXAA 2LLUA 3EVUA 1C7WA 3D76A 2JTTA 3DD4A 4PHJA 5I2OA 4FQTA 4GBAA 2L2CA 3BUMB 3SG6A 2CBLA 2LP2A 5D3OA 3S0DA 5AFPA 4N1FA 1WY9A 5FI7A 1C3YA 1RWYA 4BY4A 3D0YA 4INXA 1OOGA 2LHLA 3PJIA 3AAKA 1SL7A 1LKJA 3OHMB 1S1EA 3WHTB 1RTP1 1SL8A 2K2FA 2I94A 4MZKA 2IS9A 2ZRTA 3KEVA 1JWDA 2AMIA 2KFGA 2LUXA 1F70A 1CFCA 1IRJA 1J7OA 3IQOA 5FI2A 1PK0D 3D73A 1IQ5A 1DJHA 1B8CA 1DC1A 1PSRA 2LUCA 3BFBA 2I18A 3MSEB 2GGMA 4GAOA 2F3YA 3CDNA 3CZ2A 3GK4X 2NXQA 4NQGA 1AVSA 3BOWB 2JULA 4YBHB 4PE7A 5D69A 3IQQA 2M7NA 1RJVA 2ZKMX 3D10A 1B7TY 3WNXB 2B1UA 2ZNEA 1OSAA 1DJGA 1K93D 3KF9A 5DKRA 2CXJA 2L5YA 5AANA 3SIAA 3EK4A 4CPVA 1FW4A 5I8NA 4GGFA 1M31A 1QWVA 2M97A 3L47A 4HRGA 1UP5A 4QJ3B 2JZIA 2KHNA 1F71A 2EGDA 3R1OA 4Q04A 1UHJA 2QACA 1NX2A 1TOPA 3NSLA 4MZJA 4ORBB 4C0KA 1CDNA 1DELA 1SR6B 4M2PA 4E68A 2AAOA 4N5XA 2BCXA 2JOJA 2BKHB 3KHEA 1TUZA 1NX1A 3A8RA 4HRHA 2K8MB 2K60A 1W7IB 1RROA 1UURA 1GGZA 1UHHA 5DKNA 3AKAA 1S6JA 3DY9A 3HCMA 3D0YB 1B1GA 3TDUA 1OZOA 1X02A 2PALA 4KYNA 3CYZA 4AOMA 3GOFA 2KGRA 1R2UA 2BNXA 3CS1A 3TZ1A 1SCVA 2Y1MA 5JJGA 1LA3A 4PT1A 2QDIA 1YX8A 2PYQA 3D78A 4C0JA 1QV1A 4USLA 1MWNA 1A75A 1F54A 1GJYA 1K8UA 1IKUA 1XFXO 4PHNA 2KQYA 3WHUB 2YGUA 2M3WA 1AK8A 3ICBA 2LLSA 1UUSA 2KAVA 3NHIA 3FWCA 4TNCA 1FPWA 1CLLA 4I5NB 1J7RA 1JFKA 1UWOA 3VRRA 2WC5A 2BL0B 1K95A 2AUCA 2K0JA 2WCBA 3CGAA 2PRUA 1NP8A 2R2IA 5FYXA 4MRXA 2L4IA 3D77A 4JQ0D 1AP4A 1DJXA 1DJYA 1QJTA 2KAXA 4PHMA 3LCPC 4HREE 2DOQA 2TN4A 3TDZA 1KQMB 1XVJA 1V1FA 1QXPA 2CNPA 4YI9A 1QASA 3LL8B 1SR6C 1U5IA 2OPOA 1EL4A 5ER4X 2VRGA 1KQVA 1B9AA 1YRUB 2KLEA 5F6TA 1CMFA 1DVIA 3L4LA 4P2YB 5I2LA 3S0BA 1YVLA 1SBJA 1XA5A 2JXCA 3FWBA 1KK7Z 2BBNA 2KDHA 2P71A 1EG4A 1CDMA 1OOIX 1IG5A 3KPXA 2L0PA 3BQ3A 1OMRA 1TWOA 1SSEB 1Y1AA 2KYFA 2PQLA 2SASA 2V53A 1SK6D 1MQ1A 1C07A 1XFYO 3TS5B 1QIVA 1XFVO 2H61A 1T14A 2K7OA 3GK1A 1NX0A 2KBIA 3DVJA 1KWOC 3CR4X 1LXFC 2MLFC 4MEWA 3VB1A 4ORCB 3S0EA 4DUQA 4CFQA 1A2XA 1A75B 2KNEA 2HETA 4QJ5B 1J1DA 1ZACA 4L9MA 2BL0C 3LK0A 1S6CA 1K9KA 2WCFA 1AJ5A 3B86A 1KK8B 4A4CA 2I7AA 3N7HA 4M2QA 2Y5IA 2LLTA 2F2OA 2K61A 2G9BA 1LS8A 2M1KB 2PMYA 4GGFC 1KQMC 2HF5A 1YRTB 4I5KA 2WCMA 2ZN9A 3CR5X 4JKTA 3BUXB 3FE9A 1XFZO 1UHIA 2GTEA 4WRIA 2MBXA 1YUTA 1OW4A 2HQWA 4I5LB 1BODA 1U5IB 1K90D 1M46A 1S3PA 1TRFA 2JPTA 2Y1NA 1TCFA 1SKTA 3BJHA 3D75A 1ALWA 1BJFA 1OE9B 1PRWA 1PULA 1CM1A 1UHKA 2WC6A 5CSFA 2F2PA 1J7QA 3SG4A 3TS5C 2KAYA 2ZFDA 3O6BA 3LLEA 2QEOA 1XFUO 1SMGA 3ZNIA 3TUYB 1J55A 1WLMA 3EKJA 4OV2A 1YR5A 1A4PA 1YUSA 1FF1A 5B8IB 2P6BB 3O4YA 1HT9A 2KFHA 2A4JA 3DVKA 3H4SE 1M45A 3I5IB 3DZTA 1AHRA 3EK7A 1F8HA 2NLNA 4DS7A 1KFUL 2D8NA 1LA0A 1QTXA 1QX2A 3UNWA 1QVIY 1KK8C 3NGVA 3SS4A 1KSOA 1B7TZ 1OOHA 2Y4QA 4ZCVA 4MN0A 4MZLA 3VRQA 4P5OE 3E3RA 1DTLA 4NDDA 4WQ3A 1DJIA 1TUJA 3DXLA 4DRWA 2M1UA 5EL2A 1XO5A 2MA2A 1XFWO 1ZMZA 1CLBA 3K1EA 1K9PA 4NDCA
chains in the Genus database with same CATH topology
1B47A 1F4QA 2M49B 1EJ3A 3SG5A 2CT9A 5IBWA 3HX4A 4PDZA 3VRPA 4M2OA 1WRLA 3RLZA 2LVIA 1TNQA 4BY5A 1S5GY 2L51A 2LM5A 2WNDA 1NYAA 1K2HA 1SYMA 4XYNA 2WORA 5HLVA 1IH0A 3TUYC 1BLQA 3M0WA 3CZTX 2I2RE 1KWOB 3I5FB 1LINA 1JUOA 2H61C 2JRFA 1QX5B 3I5IC 1K94A 3JTDB 1OQPA 2EC6B 4YRUA 3SG3A 1IJ6A 1CDPA 1S36A 2LMUA 4YGAA 1GQMA 1ZOTB 2L4HA 2L2EA 5CSIA 1JF2A 1YURA 2LCPA 4CFRA 2SCPA 2E6WA 5D7FA 1BU3A 4PE0A 1E8AA 2LVKA 3BYAA 4GUKA 5ER5A 1A29A 2EHBA 3EVRA 2WCEA 1C7VA 1DGVA 2LVJA 1DGUA 1M39A 1FBVA 4JPZB 2GGZA 1ZFSA 3CWGA 3JVTB 1AJ4A 1DMOA 2M0RA 2ISDA 4MBEA 5KTYA 1SNLA 2K7DA 4YGBB 1XYDA 5J3XA 1YX7A 4YGEB 4ICBA 3K21A 1SL9A 3SG2A 1L7ZA 4D1EA 1L2OB 2L50A 1N2DA 5CSJA 3SIBA 5HLOA 4MLWA 4DCKA 1B8RA 3PFVA 1NCZA 3F45A 4OVNF 1F55A 2BECA 1RFJA 3PM8A 3VROA 3I5FC 1EXRA 4PHKA 4PCWA 4HSZA 2CCMA 3JTDC 2EC6C 3SJSA 5BPJA 4GGNA 3EKHA 4NDBA 1BF5A 3PALA 2KGBC 3PATA 2RGIA 3FS7A 2L98A 1MUXA 1PVBA 3FIAA 1UHNA 1OMVA 1Y1UA 1N0YA 3WXAA 5KSZA 1XK4A 2L5XB 2MAZA 1CFDA 3PLFB 3VRNA 1DF0A 3JVTC 2KI6D 1NCYA 2E30A 2QPTA 2BKIB 4OCIA 4AQJA 4UPGA 5AERA 1BMOA 3O78A 1BR1B 4OKHA 2BE6A 1QATA 1L2OC 2WC8A 2MRDA 3AKBA 1TNXA 5DKQA 3I5HB 1RK9A 2OS8B 3LK1A 1CM4A 4A4BA 1DT7B 1QLSA 1NUBA 2F33A 3OP0A 3CTNA 3KO0A 1KFXL 2K2AA 3EK8A 1Y6WA 5GQQC 3IF7A 1CLMA 5TNCA 2ZNDA 3OB2B 1K9UA 2JT0A 1KSMA 3BUOB 4MVFA 1G8IA 1WRKA 3NSOA 2H2KA 2PSRA 1MR8A 4ZCUA 3NSIA 2COLB 2JTZA 5CSNA 5HKWA 1YVHA 2M8UA 2M7LA 2MJWB 1FI5A 1J7PA 1ODBA 1MHOA 1BR4B 2K7CA 4GFTA 4N1GA 4FTGA 1W7JB 1YTZC 1QVIZ 1S26D 5I2QA 1BOCA 4MSPA 1BG1A 1EH2A 4GPLB 2GV5A 1AUIB 2JXLA 1DJWA 3SG7A 2FOTA 1MXEA 2BCBA 1NSHA 1NWDA 2JWWA 4C0LA 1TNPA 1TN4A 1SRAA 2KBMA 3CR2A 1DF0B 2KFFA 2LMTA 2LC5A 2HQ8A 3GK2A 1VRKA 2JC2A 3EVVA 3TDIA 4DIRA 3ZWHA 3A4UB 3DF0A 2OS8C 1KFXS 3I5HC 1QS7A 3OB1B 4PALA 2O60A 2HPSA 2LNKA 3I5GB 4IL1A 4GNKB 2KI4B 1S5GZ 4FQOA 4XJKA 4ORAB 2JNFA 1CKKA 4PE4A 1BT6A 1MF8B 1NCXA 2OTGB 1NIWA 1HQVA 3OX5A 1R6PA 1JFJA 1TCOB 5G08A 1M63B 4F0ZB 1G4YR 1KFUS 1PALA 2Q4UA 1QIWA 1SCMB 1WLZA 2JT8A 2LP3A 1B4CA 1CB1A 1YUUA 2NZ0A 5HKYA 1S6IA 3AAJA 3BUWB 3OX6A 1NPQA 1IJ5A 2BBMA 1Y0VH 2F8PA 2KSPA 3DVMA 4JWQA 5JOLA 1D1OA 1FI6A 1PSBA 2CTNA 2MLEC 2LV7A 1CTRA 1WRZA 1H8BA 1A03A 1IQ3A 5AXIA 1JF0A 1CDLA 4AQIA 1Q80A 1XK4C 1Y1XA 3PN7B 4WQ2A 2LMVA 4OR9B 1WDCB 5HKZA 2G2BA 5AEQA 1OZSA 1PVAA 4R1EA 1SY9A 1IWQA 2BE4A 1QX7A 2NCPA 3CLNA 2WOSA 2PASA 1MXLC 5CPVA 1TTXA 1LVCD 4I5JA 3I5GC 3DVEA 3PSRA 2KI4C 5HYDA 1NX3A 5KU1A 1H4BA 3DF0B 2LHIA 2MHHA 2O5GA 2OTGC 2Q91A 4CIDA 5K89A 1CMGA 1JC2A 2LANA 1V1GA 1KK7Y 1KCYA 4XJKB 3BUNB 2FCDA 2ZN8A 2KYCA 2F3ZA 2FJUB 1SCMC 2KI6C 2M29A 2KOTA 1QLKA 1IGVA 2JQ6A 1CNPA 3C1VA 2K7BA 4U8DA 2LAPA 1JSAA 1N65A 1TIZA 1B8LA 3QRXA 1SPYA 1JBAA 2JT3A 3BXKA 1G33A 1EG3A 3NSKA 1CFFA 2ZRSA 3BOWA 1J1EA 2LE9B 1CFPA 4QJ4B 4CLNA 1ZUZA 2JNXA 1DJZA 2M9GA 1F4OA 2LVVA 2JU0A 3PN7C 4PE1A 1TNWA 4YGCB 5PALA 1WDCC 3O2PA 2BCAA 1GGWA 1OOJA 4YGDB 1OMDA 1SW8A 1K96A 2PVBA 1RECA 4YI8A 1ALVA 2NCOA 3RM1A 4MRYA 1QV0A 4ETOA 2KQ6A 3VGOA 2FCEA 3NXAA 2LLUA 3EVUA 1C7WA 2JTTA 3DD4A 4PHJA 5I2OA 4GBAA 3BUMB 3SG6A 2CBLA 2LP2A 5AFPA 4N1FA 1WY9A 1RWYA 4BY4A 3D0YA 2LHLA 3AAKA 1SL7A 1LKJA 3OHMB 1S1EA 3WHTB 1RTP1 1SL8A 2K2FA 2I94A 4MZKA 2IS9A 2ZRTA 3KEVA 1JWDA 2AMIA 2KFGA 2LUXA 1F70A 1CFCA 1IRJA 1J7OA 3IQOA 1PK0D 1IQ5A 1DJHA 1B8CA 1PSRA 2LUCA 2I18A 3MSEB 2GGMA 4GAOA 2F3YA 3GK4X 2NXQA 4NQGA 1AVSA 3BOWB 2JULA 4YBHB 4PE7A 5D69A 3IQQA 2M7NA 1RJVA 2ZKMX 3D10A 1B7TY 3WNXB 2B1UA 2ZNEA 1OSAA 1DJGA 1K93D 3KF9A 5DKRA 2CXJA 5AANA 3SIAA 3EK4A 4CPVA 1FW4A 5I8NA 4GGFA 1M31A 2M97A 4HRGA 1UP5A 4QJ3B 2JZIA 2KHNA 1F71A 2EGDA 4Q04A 1UHJA 2QACA 1NX2A 1TOPA 3NSLA 4MZJA 4ORBB 4C0KA 1CDNA 1SR6B 4M2PA 4E68A 2AAOA 4N5XA 2BCXA 2JOJA 2BKHB 3KHEA 1NX1A 3A8RA 4HRHA 2K8MB 1W7IB 1RROA 1UURA 1GGZA 1UHHA 5DKNA 3AKAA 1S6JA 3HCMA 3D0YB 1B1GA 3TDUA 1OZOA 1X02A 2PALA 4AOMA 3GOFA 2KGRA 1R2UA 3CS1A 3TZ1A 1SCVA 2Y1MA 5JJGA 1LA3A 1YX8A 4C0JA 1QV1A 4USLA 1MWNA 1A75A 1F54A 1GJYA 1K8UA 1IKUA 1XFXO 4PHNA 2KQYA 3WHUB 2M3WA 1AK8A 3ICBA 2LLSA 1UUSA 2KAVA 3FWCA 4TNCA 1FPWA 1CLLA 4I5NB 1J7RA 1JFKA 1UWOA 3VRRA 2BL0B 1K95A 2AUCA 2K0JA 2WCBA 3CGAA 2PRUA 1NP8A 2R2IA 5FYXA 4MRXA 2L4IA 4JQ0D 1AP4A 1DJXA 1DJYA 1QJTA 2KAXA 4PHMA 3LCPC 4HREE 2DOQA 2TN4A 3TDZA 1KQMB 1XVJA 1V1FA 1QXPA 2CNPA 4YI9A 1QASA 3LL8B 1SR6C 1U5IA 2OPOA 1EL4A 5ER4X 2VRGA 1KQVA 1B9AA 1YRUB 5F6TA 1CMFA 1DVIA 4P2YB 5I2LA 1YVLA 1SBJA 1XA5A 2JXCA 3FWBA 1KK7Z 2BBNA 2KDHA 1EG4A 1CDMA 1IG5A 3KPXA 2L0PA 3BQ3A 1OMRA 2KYFA 2V53A 1Y1AA 2SASA 1SK6D 1MQ1A 1C07A 1XFYO 3TS5B 1QIVA 1XFVO 2H61A 2K7OA 3GK1A 1NX0A 2KBIA 3DVJA 1KWOC 3CR4X 1LXFC 2MLFC 4MEWA 4ORCB 4DUQA 4CFQA 1A2XA 1A75B 2KNEA 2HETA 4QJ5B 1J1DA 1ZACA 4L9MA 2BL0C 3LK0A 1S6CA 1K9KA 2WCFA 1AJ5A 1KK8B 4A4CA 2I7AA 4M2QA 2Y5IA 2LLTA 2F2OA 2K61A 2G9BA 2M1KB 2PMYA 4GGFC 1KQMC 2HF5A 1YRTB 4I5KA 2ZN9A 3CR5X 3BUXB 1XFZO 1UHIA 4WRIA 2MBXA 1YUTA 2HQWA 4I5LB 1BODA 1U5IB 1K90D 1M46A 1S3PA 1TRFA 2JPTA 2Y1NA 1TCFA 1SKTA 1ALWA 1BJFA 1OE9B 1PRWA 1PULA 1CM1A 1UHKA 5CSFA 2F2PA 1J7QA 3SG4A 3TS5C 2KAYA 2ZFDA 3O6BA 3LLEA 1XFUO 1SMGA 3ZNIA 3TUYB 1J55A 1WLMA 3EKJA 4OV2A 1YR5A 1A4PA 1YUSA 1FF1A 5B8IB 2P6BB 3O4YA 1HT9A 2KFHA 2A4JA 3DVKA 3H4SE 1M45A 3I5IB 1AHRA 3EK7A 1F8HA 2NLNA 4DS7A 1KFUL 2D8NA 1LA0A 1QTXA 1QX2A 1QVIY 1KK8C 1KSOA 1B7TZ 2Y4QA 4ZCVA 4MN0A 4MZLA 3VRQA 4P5OE 3E3RA 1DTLA 4NDDA 4WQ3A 1DJIA 4DRWA 2M1UA 1XO5A 2MA2A 1XFWO 1ZMZA 1CLBA 1K9PA 4NDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  1F4Q A;  2M49 B;  1EJ3 A;  3SG5 A;  2CT9 A;  5IBW A;  3HX4 A;  4PDZ A;  3VRP A;  4M2O A;  1WRL A;  3RLZ A;  2LVI A;  1TNQ A;  4BY5 A;  1S5G Y;  2L51 A;  2LM5 A;  2WND A;  1NYA A;  1K2H A;  1SYM A;  4XYN A;  2WOR A;  5HLV A;  1IH0 A;  3TUY C;  1BLQ A;  3M0W A;  3CZT X;  2I2R E;  1KWO B;  3I5F B;  1LIN A;  1JUO A;  2H61 C;  2JRF A;  1QX5 B;  3I5I C;  1K94 A;  3JTD B;  1OQP A;  2EC6 B;  4YRU A;  3SG3 A;  1IJ6 A;  1CDP A;  1S36 A;  2LMU A;  4YGA A;  1GQM A;  1ZOT B;  2L4H A;  2L2E A;  5CSI A;  1JF2 A;  1YUR A;  2LCP A;  4CFR A;  2SCP A;  2E6W A;  5D7F A;  1BU3 A;  4PE0 A;  1E8A A;  2LVK A;  3BYA A;  4GUK A;  5ER5 A;  1A29 A;  2EHB A;  3EVR A;  2WCE A;  1C7V A;  1DGV A;  2LVJ A;  1DGU A;  1M39 A;  1FBV A;  4JPZ B;  2GGZ A;  1ZFS A;  3CWG A;  3JVT B;  1AJ4 A;  1DMO A;  2M0R A;  2ISD A;  4MBE A;  5KTY A;  1SNL A;  2K7D A;  4YGB B;  1XYD A;  5J3X A;  1YX7 A;  4YGE B;  4ICB A;  3K21 A;  1SL9 A;  3SG2 A;  1L7Z A;  4D1E A;  1L2O B;  2L50 A;  1N2D A;  5CSJ A;  3SIB A;  5HLO A;  4MLW A;  4DCK A;  1B8R A;  3PFV A;  1NCZ A;  3F45 A;  4OVN F;  1F55 A;  2BEC A;  1RFJ A;  3PM8 A;  3VRO A;  3I5F C;  1EXR A;  4PHK A;  4PCW A;  4HSZ A;  2CCM A;  3JTD C;  2EC6 C;  3SJS A;  5BPJ A;  4GGN A;  3EKH A;  4NDB A;  1BF5 A;  3PAL A;  2KGB C;  3PAT A;  2RGI A;  3FS7 A;  2L98 A;  1MUX A;  1PVB A;  3FIA A;  1UHN A;  1OMV A;  1Y1U A;  1N0Y A;  3WXA A;  5KSZ A;  1XK4 A;  2L5X B;  2MAZ A;  1CFD A;  3PLF B;  3VRN A;  1DF0 A;  3JVT C;  2KI6 D;  1NCY A;  2E30 A;  2QPT A;  2BKI B;  4OCI A;  4AQJ A;  4UPG A;  5AER A;  1BMO A;  3O78 A;  1BR1 B;  4OKH A;  2BE6 A;  1QAT A;  1L2O C;  2WC8 A;  2MRD A;  3AKB A;  1TNX A;  5DKQ A;  3I5H B;  1RK9 A;  2OS8 B;  3LK1 A;  1CM4 A;  4A4B A;  1DT7 B;  1QLS A;  1NUB A;  2F33 A;  3OP0 A;  3CTN A;  3KO0 A;  1KFX L;  2K2A A;  3EK8 A;  1Y6W A;  5GQQ C;  3IF7 A;  1CLM A;  5TNC A;  2ZND A;  3OB2 B;  1K9U A;  2JT0 A;  1KSM A;  3BUO B;  4MVF A;  1G8I A;  1WRK A;  3NSO A;  2H2K A;  2PSR A;  1MR8 A;  4ZCU A;  3NSI A;  2COL B;  2JTZ A;  5CSN A;  5HKW A;  1YVH A;  2M8U A;  2M7L A;  2MJW B;  1FI5 A;  1J7P A;  1ODB A;  1MHO A;  1BR4 B;  2K7C A;  4GFT A;  4N1G A;  4FTG A;  1W7J B;  1YTZ C;  1QVI Z;  1S26 D;  5I2Q A;  1BOC A;  4MSP A;  1BG1 A;  1EH2 A;  4GPL B;  2GV5 A;  1AUI B;  2JXL A;  1DJW A;  3SG7 A;  2FOT A;  1MXE A;  2BCB A;  1NSH A;  1NWD A;  2JWW A;  4C0L A;  1TNP A;  1TN4 A;  1SRA A;  2KBM A;  3CR2 A;  1DF0 B;  2KFF A;  2LMT A;  2LC5 A;  2HQ8 A;  3GK2 A;  1VRK A;  2JC2 A;  3EVV A;  3TDI A;  4DIR A;  3ZWH A;  3A4U B;  3DF0 A;  2OS8 C;  1KFX S;  3I5H C;  1QS7 A;  3OB1 B;  4PAL A;  2O60 A;  2HPS A;  2LNK A;  3I5G B;  4IL1 A;  4GNK B;  2KI4 B;  1S5G Z;  4FQO A;  4XJK A;  4ORA B;  2JNF A;  1CKK A;  4PE4 A;  1BT6 A;  1MF8 B;  1NCX A;  2OTG B;  1NIW A;  1HQV A;  3OX5 A;  1R6P A;  1JFJ A;  1TCO B;  5G08 A;  1M63 B;  4F0Z B;  1G4Y R;  1KFU S;  1PAL A;  2Q4U A;  1QIW A;  1SCM B;  1WLZ A;  2JT8 A;  2LP3 A;  1B4C A;  1CB1 A;  1YUU A;  2NZ0 A;  5HKY A;  1S6I A;  3AAJ A;  3BUW B;  3OX6 A;  1NPQ A;  1IJ5 A;  2BBM A;  1Y0V H;  2F8P A;  2KSP A;  3DVM A;  4JWQ A;  5JOL A;  1D1O A;  1FI6 A;  1PSB A;  2CTN A;  2MLE C;  2LV7 A;  1CTR A;  1WRZ A;  1H8B A;  1A03 A;  1IQ3 A;  5AXI A;  1JF0 A;  1CDL A;  4AQI A;  1Q80 A;  1XK4 C;  1Y1X A;  3PN7 B;  4WQ2 A;  2LMV A;  4OR9 B;  1WDC B;  5HKZ A;  2G2B A;  5AEQ A;  1OZS A;  1PVA A;  4R1E A;  1SY9 A;  1IWQ A;  2BE4 A;  1QX7 A;  2NCP A;  3CLN A;  2WOS A;  2PAS A;  1MXL C;  5CPV A;  1TTX A;  1LVC D;  4I5J A;  3I5G C;  3DVE A;  3PSR A;  2KI4 C;  5HYD A;  1NX3 A;  5KU1 A;  1H4B A;  3DF0 B;  2LHI A;  2MHH A;  2O5G A;  2OTG C;  2Q91 A;  4CID A;  5K89 A;  1CMG A;  1JC2 A;  2LAN A;  1V1G A;  1KK7 Y;  1KCY A;  4XJK B;  3BUN B;  2FCD A;  2ZN8 A;  2KYC A;  2F3Z A;  2FJU B;  1SCM C;  2KI6 C;  2M29 A;  2KOT A;  1QLK A;  1IGV A;  2JQ6 A;  1CNP A;  3C1V A;  2K7B A;  4U8D A;  2LAP A;  1JSA A;  1N65 A;  1TIZ A;  1B8L A;  3QRX A;  1SPY A;  1JBA A;  2JT3 A;  3BXK A;  1G33 A;  1EG3 A;  3NSK A;  1CFF A;  2ZRS A;  3BOW A;  1J1E A;  2LE9 B;  1CFP A;  4QJ4 B;  4CLN A;  1ZUZ A;  2JNX A;  1DJZ A;  2M9G A;  1F4O A;  2LVV A;  2JU0 A;  3PN7 C;  4PE1 A;  1TNW A;  4YGC B;  5PAL A;  1WDC C;  3O2P A;  2BCA A;  1GGW A;  1OOJ A;  4YGD B;  1OMD A;  1SW8 A;  1K96 A;  2PVB A;  1REC A;  4YI8 A;  1ALV A;  2NCO A;  3RM1 A;  4MRY A;  1QV0 A;  4ETO A;  2KQ6 A;  3VGO A;  2FCE A;  3NXA A;  2LLU A;  3EVU A;  1C7W A;  2JTT A;  3DD4 A;  4PHJ A;  5I2O A;  4GBA A;  3BUM B;  3SG6 A;  2CBL A;  2LP2 A;  5AFP A;  4N1F A;  1WY9 A;  1RWY A;  4BY4 A;  3D0Y A;  2LHL A;  3AAK A;  1SL7 A;  1LKJ A;  3OHM B;  1S1E A;  3WHT B;  1RTP 1;  1SL8 A;  2K2F A;  2I94 A;  4MZK A;  2IS9 A;  2ZRT A;  3KEV A;  1JWD A;  2AMI A;  2KFG A;  2LUX A;  1F70 A;  1CFC A;  1IRJ A;  1J7O A;  3IQO A;  1PK0 D;  1IQ5 A;  1DJH A;  1B8C A;  1PSR A;  2LUC A;  2I18 A;  3MSE B;  2GGM A;  4GAO A;  2F3Y A;  3GK4 X;  2NXQ A;  4NQG A;  1AVS A;  3BOW B;  2JUL A;  4YBH B;  4PE7 A;  5D69 A;  3IQQ A;  2M7N A;  1RJV A;  2ZKM X;  3D10 A;  1B7T Y;  3WNX B;  2B1U A;  2ZNE A;  1OSA A;  1DJG A;  1K93 D;  3KF9 A;  5DKR A;  2CXJ A;  5AAN A;  3SIA A;  3EK4 A;  4CPV A;  1FW4 A;  5I8N A;  4GGF A;  1M31 A;  2M97 A;  4HRG A;  1UP5 A;  4QJ3 B;  2JZI A;  2KHN A;  1F71 A;  2EGD A;  4Q04 A;  1UHJ A;  2QAC A;  1NX2 A;  1TOP A;  3NSL A;  4MZJ A;  4ORB B;  4C0K A;  1CDN A;  1SR6 B;  4M2P A;  4E68 A;  2AAO A;  4N5X A;  2BCX A;  2JOJ A;  2BKH B;  3KHE A;  1NX1 A;  3A8R A;  4HRH A;  2K8M B;  1W7I B;  1RRO A;  1UUR A;  1GGZ A;  1UHH A;  5DKN A;  3AKA A;  1S6J A;  3HCM A;  3D0Y B;  1B1G A;  3TDU A;  1OZO A;  1X02 A;  2PAL A;  4AOM A;  3GOF A;  2KGR A;  1R2U A;  3CS1 A;  3TZ1 A;  1SCV A;  2Y1M A;  5JJG A;  1LA3 A;  1YX8 A;  4C0J A;  1QV1 A;  4USL A;  1MWN A;  1A75 A;  1F54 A;  1GJY A;  1K8U A;  1IKU A;  1XFX O;  4PHN A;  2KQY A;  3WHU B;  2M3W A;  1AK8 A;  3ICB A;  2LLS A;  1UUS A;  2KAV A;  3FWC A;  4TNC A;  1FPW A;  1CLL A;  4I5N B;  1J7R A;  1JFK A;  1UWO A;  3VRR A;  2BL0 B;  1K95 A;  2AUC A;  2K0J A;  2WCB A;  3CGA A;  2PRU A;  1NP8 A;  2R2I A;  5FYX A;  4MRX A;  2L4I A;  4JQ0 D;  1AP4 A;  1DJX A;  1DJY A;  1QJT A;  2KAX A;  4PHM A;  3LCP C;  4HRE E;  2DOQ A;  2TN4 A;  3TDZ A;  1KQM B;  1XVJ A;  1V1F A;  1QXP A;  2CNP A;  4YI9 A;  1QAS A;  3LL8 B;  1SR6 C;  1U5I A;  2OPO A;  1EL4 A;  5ER4 X;  2VRG A;  1KQV A;  1B9A A;  1YRU B;  5F6T A;  1CMF A;  1DVI A;  4P2Y B;  5I2L A;  1YVL A;  1SBJ A;  1XA5 A;  2JXC A;  3FWB A;  1KK7 Z;  2BBN A;  2KDH A;  1EG4 A;  1CDM A;  1IG5 A;  3KPX A;  2L0P A;  3BQ3 A;  1OMR A;  2KYF A;  2V53 A;  1Y1A A;  2SAS A;  1SK6 D;  1MQ1 A;  1C07 A;  1XFY O;  3TS5 B;  1QIV A;  1XFV O;  2H61 A;  2K7O A;  3GK1 A;  1NX0 A;  2KBI A;  3DVJ A;  1KWO C;  3CR4 X;  1LXF C;  2MLF C;  4MEW A;  4ORC B;  4DUQ A;  4CFQ A;  1A2X A;  1A75 B;  2KNE A;  2HET A;  4QJ5 B;  1J1D A;  1ZAC A;  4L9M A;  2BL0 C;  3LK0 A;  1S6C A;  1K9K A;  2WCF A;  1AJ5 A;  1KK8 B;  4A4C A;  2I7A A;  4M2Q A;  2Y5I A;  2LLT A;  2F2O A;  2K61 A;  2G9B A;  2M1K B;  2PMY A;  4GGF C;  1KQM C;  2HF5 A;  1YRT B;  4I5K A;  2ZN9 A;  3CR5 X;  3BUX B;  1XFZ O;  1UHI A;  4WRI A;  2MBX A;  1YUT A;  2HQW A;  4I5L B;  1BOD A;  1U5I B;  1K90 D;  1M46 A;  1S3P A;  1TRF A;  2JPT A;  2Y1N A;  1TCF A;  1SKT A;  1ALW A;  1BJF A;  1OE9 B;  1PRW A;  1PUL A;  1CM1 A;  1UHK A;  5CSF A;  2F2P A;  1J7Q A;  3SG4 A;  3TS5 C;  2KAY A;  2ZFD A;  3O6B A;  3LLE A;  1XFU O;  1SMG A;  3ZNI A;  3TUY B;  1J55 A;  1WLM A;  3EKJ A;  4OV2 A;  1YR5 A;  1A4P A;  1YUS A;  1FF1 A;  5B8I B;  2P6B B;  3O4Y A;  1HT9 A;  2KFH A;  2A4J A;  3DVK A;  3H4S E;  1M45 A;  3I5I B;  1AHR A;  3EK7 A;  1F8H A;  2NLN A;  4DS7 A;  1KFU L;  2D8N A;  1LA0 A;  1QTX A;  1QX2 A;  1QVI Y;  1KK8 C;  1KSO A;  1B7T Z;  2Y4Q A;  4ZCV A;  4MN0 A;  4MZL A;  3VRQ A;  4P5O E;  3E3R A;  1DTL A;  4NDD A;  4WQ3 A;  1DJI A;  4DRW A;  2M1U A;  1XO5 A;  2MA2 A;  1XFW O;  1ZMZ A;  1CLB A;  1K9P A;  4NDC A; 
#chains in the Genus database with same CATH topology
 1B47 A;  1F4Q A;  2M49 B;  1EJ3 A;  3SG5 A;  2CT9 A;  5IBW A;  3HX4 A;  1DQE A;  4PDZ A;  3VRP A;  4M2O A;  1WRL A;  3RLZ A;  2LVI A;  1TNQ A;  2FJY A;  4BY5 A;  1S5G Y;  2L51 A;  3CZ1 A;  2LM5 A;  2WND A;  1DT7 B;  3DYE A;  1NYA A;  1K2H A;  1SYM A;  4XYN A;  2WOR A;  5HLV A;  1IH0 A;  3TUY C;  1BLQ A;  3M0W A;  3CZT X;  5HL1 A;  2I2R E;  1KWO B;  3I5F B;  1LIN A;  1JUO A;  2H61 C;  2JRF A;  1QX5 B;  3I5I C;  1K94 A;  3JTD B;  1OQP A;  2EC6 B;  4YRU A;  3SG3 A;  1IJ6 A;  1CDP A;  1S36 A;  2LMU A;  2WCJ A;  1GQM A;  3Q8I A;  1ZOT B;  2ERB A;  4YGA A;  2L4H A;  3FE8 A;  2L2E A;  5CSI A;  1JF2 A;  1YUR A;  2LCP A;  4CFR A;  2SCP A;  2E6W A;  5D7F A;  1BU3 A;  4PE0 A;  1E8A A;  2P70 A;  2LVK A;  3BYA A;  4GUK A;  2WCL A;  5ER5 A;  1A29 A;  2EHB A;  2WCK A;  3EVR A;  3EG5 B;  2WCE A;  1C7V A;  1DGV A;  2LVJ A;  1DGU A;  1M39 A;  1FBV A;  4JPZ B;  2GGZ A;  1ZFS A;  3SS5 A;  3S0F A;  3CWG A;  3OGN A;  3JVT B;  1AJ4 A;  1DMO A;  2M0R A;  2ISD A;  4MBE A;  5KTY A;  1SNL A;  2K7D A;  4YGB B;  2QEB A;  1XYD A;  5J3X A;  1YX7 A;  4YGE B;  3B7A A;  1GM0 A;  4ICB A;  3K21 A;  1SL9 A;  4IJ7 A;  3SG2 A;  1L7Z A;  4D1E A;  1L2O B;  2L50 A;  3BFA A;  1N2D A;  5CSJ A;  3SIB A;  2KPH A;  1C3Z A;  5HLO A;  4MLW A;  4DCK A;  1B8R A;  3PFV A;  1NCZ A;  3F45 A;  4OVN F;  1F55 A;  2BEC A;  1RFJ A;  2BAP A;  3OBV A;  3PM8 A;  3VRO A;  3I5F C;  1EXR A;  3R1V A;  4PCW A;  4HSZ A;  4PHK A;  2CCM A;  3JTD C;  2EC6 C;  5DIC A;  3S0G A;  3SJS A;  5BPJ A;  4GGN A;  2WCH A;  3EKH A;  4NDB A;  1BF5 A;  3PAL A;  2KGB C;  1OOF A;  3PAT A;  2RGI A;  3FS7 A;  2L98 A;  1MUX A;  3D74 A;  1PVB A;  3B87 A;  3FIA A;  1UHN A;  1OMV A;  1Y1U A;  1N0Y A;  3WXA A;  5KSZ A;  1XK4 A;  2L5X B;  2MAZ A;  1CFD A;  3PLF B;  3VRN A;  1DF0 A;  3JVT C;  2KI6 D;  1NCY A;  2E30 A;  2QPT A;  2BKI B;  4OCI A;  4AQJ A;  4UPG A;  5AER A;  1BMO A;  3O78 A;  1BR1 B;  4OKH A;  2BE6 A;  1QAT A;  1L2O C;  2WC8 A;  2MRD A;  3AKB A;  1TNX A;  5DKQ A;  3I5H B;  1RK9 A;  2OS8 B;  3LK1 A;  1CM4 A;  5FI6 A;  4A4B A;  3R1P A;  1QLS A;  1NUB A;  2F33 A;  3OP0 A;  3CTN A;  4JD9 A;  3KO0 A;  1KFX L;  2K2A A;  3EK8 A;  2QEH A;  1Y6W A;  5GQQ C;  3IF7 A;  1CLM A;  5TNC A;  2ZND A;  3OB2 B;  1K9U A;  2JT0 A;  1KSM A;  3BUO B;  4MVF A;  3B6X A;  1G8I A;  1WRK A;  3NSO A;  2H2K A;  2PSR A;  1MR8 A;  3BFH A;  3NSI A;  2COL B;  4ZCU A;  2JTZ A;  3L4A A;  5CSN A;  5HKW A;  1YVH A;  2M8U A;  2M7L A;  2MJW B;  1FI5 A;  1J7P A;  1ODB A;  1MHO A;  1BR4 B;  2K7C A;  4GFT A;  4N1G A;  4FTG A;  1W7J B;  1YTZ C;  1QVI Z;  1S26 D;  5I2Q A;  1BOC A;  4MSP A;  1BG1 A;  1EH2 A;  4GPL B;  2GV5 A;  1AUI B;  4F7F A;  2JXL A;  1DJW A;  3SG7 A;  2FOT A;  3FE6 A;  1MXE A;  2BCB A;  1NSH A;  1NWD A;  2JWW A;  4C0L A;  1TNP A;  1TN4 A;  1SRA A;  2KBM A;  3CR2 A;  1DF0 B;  3R72 A;  2KFF A;  2LMT A;  2LC5 A;  2HQ8 A;  3GK2 A;  1VRK A;  2JC2 A;  3EVV A;  3TDI A;  4DIR A;  3ZWH A;  3A4U B;  3DF0 A;  2OS8 C;  1KFX S;  3I5H C;  1QS7 A;  3OB1 B;  4PAL A;  2O60 A;  3SS3 A;  2HPS A;  2LNK A;  3I5G B;  4IL1 A;  1Z4H A;  4GNK B;  2H8V A;  2KI4 B;  1ORG A;  1S5G Z;  4FQO A;  4ORA B;  4XJK A;  3RZS A;  2JNF A;  1CKK A;  4PE4 A;  1BT6 A;  1MF8 B;  1NCX A;  2OTG B;  1NIW A;  1HQV A;  3OX5 A;  1R6P A;  3B88 A;  1TCO B;  3UO9 A;  1JFJ A;  5G08 A;  1M63 B;  4F0Z B;  1G4Y R;  1DEK A;  1KFU S;  1PAL A;  2Q4U A;  1QIW A;  1SCM B;  1WLZ A;  2JT8 A;  2LP3 A;  1B4C A;  1CB1 A;  1IIO A;  1YUU A;  2NZ0 A;  5HKY A;  1S6I A;  3AAJ A;  3BUW B;  3OX6 A;  1NPQ A;  1IJ5 A;  1XFR A;  1Y0V H;  2BBM A;  2F8P A;  2KSP A;  3DVM A;  4JWQ A;  5JOL A;  1D1O A;  1FI6 A;  1PSB A;  2CTN A;  2MLE C;  2LV7 A;  1CTR A;  1WRZ A;  1H8B A;  1A03 A;  1IQ3 A;  5AXI A;  1JF0 A;  2QEV A;  1CDL A;  4AQI A;  1Q80 A;  1XK4 C;  1Y1X A;  3PN7 B;  4WQ2 A;  2LMV A;  4OR9 B;  1WDC B;  5HKZ A;  2G2B A;  5AEQ A;  1OZS A;  1PVA A;  2KLD A;  4R1E A;  1SY9 A;  1IWQ A;  2BE4 A;  1QX7 A;  2NCP A;  3CLN A;  2WOS A;  2PAS A;  1MXL C;  5CPV A;  1TTX A;  1LVC D;  4I5J A;  3I5G C;  3DVE A;  3PSR A;  2KI4 C;  5HYD A;  1NX3 A;  5KU1 A;  1H4B A;  3DF0 B;  2LHI A;  2MHH A;  2O5G A;  2OTG C;  2Q91 A;  4CID A;  5K89 A;  1CMG A;  1JC2 A;  2LAN A;  1V1G A;  1KK7 Y;  1KCY A;  4XJK B;  3BUN B;  2FCD A;  2ZN8 A;  2KYC A;  2F3Z A;  2FJU B;  1SCM C;  2KI6 C;  2M29 A;  4INW A;  2KOT A;  1QLK A;  1P28 A;  1IGV A;  2JPO A;  2JQ6 A;  1CNP A;  1W9Z A;  3C1V A;  2K7B A;  4U8D A;  2LAP A;  3QME A;  1JSA A;  1N65 A;  1TIZ A;  1B8L A;  3QRX A;  1SPY A;  4OZD A;  2JT3 A;  1JBA A;  3BXK A;  1G33 A;  3O4X A;  3IVT A;  1EG3 A;  3NSK A;  5I94 A;  1CFF A;  1Z2C B;  2ZRS A;  3BOW A;  1J1E A;  2LE9 B;  1CFP A;  3CAB A;  3V2L A;  4QJ4 B;  4CLN A;  1ZUZ A;  2JNX A;  1DJZ A;  2M9G A;  1F4O A;  2LVV A;  3NHT A;  3PM2 A;  2JU0 A;  3PN7 C;  3S0A A;  4PE1 A;  1TNW A;  4YGC B;  5PAL A;  1WDC C;  3O2P A;  2BCA A;  1GGW A;  1OOJ A;  4YGD B;  1OMD A;  1SW8 A;  1K96 A;  2PVB A;  1REC A;  4YI8 A;  1ALV A;  2NCO A;  3RM1 A;  4MRY A;  1QV0 A;  4ETO A;  2KQ6 A;  3VGO A;  2FCE A;  3CZ0 A;  3NXA A;  2LLU A;  3EVU A;  1C7W A;  3D76 A;  2JTT A;  3DD4 A;  4PHJ A;  5I2O A;  4FQT A;  4GBA A;  2L2C A;  3BUM B;  3SG6 A;  2CBL A;  2LP2 A;  5D3O A;  3S0D A;  5AFP A;  4N1F A;  1WY9 A;  5FI7 A;  1C3Y A;  1RWY A;  4BY4 A;  3D0Y A;  4INX A;  1OOG A;  2LHL A;  3PJI A;  3AAK A;  1SL7 A;  1LKJ A;  3OHM B;  1S1E A;  3WHT B;  1RTP 1;  1SL8 A;  2K2F A;  2I94 A;  4MZK A;  2IS9 A;  2ZRT A;  3KEV A;  1JWD A;  2AMI A;  2KFG A;  2LUX A;  1F70 A;  1CFC A;  1IRJ A;  1J7O A;  3IQO A;  5FI2 A;  1PK0 D;  3D73 A;  1IQ5 A;  1DJH A;  1B8C A;  1DC1 A;  1PSR A;  2LUC A;  3BFB A;  2I18 A;  3MSE B;  2GGM A;  4GAO A;  2F3Y A;  3CDN A;  3CZ2 A;  3GK4 X;  2NXQ A;  4NQG A;  1AVS A;  3BOW B;  2JUL A;  4YBH B;  4PE7 A;  5D69 A;  3IQQ A;  2M7N A;  1RJV A;  2ZKM X;  3D10 A;  1B7T Y;  3WNX B;  2B1U A;  2ZNE A;  1OSA A;  1DJG A;  1K93 D;  3KF9 A;  5DKR A;  2CXJ A;  2L5Y A;  5AAN A;  3SIA A;  3EK4 A;  4CPV A;  1FW4 A;  5I8N A;  4GGF A;  1M31 A;  1QWV A;  2M97 A;  3L47 A;  4HRG A;  1UP5 A;  4QJ3 B;  2JZI A;  2KHN A;  1F71 A;  2EGD A;  3R1O A;  4Q04 A;  1UHJ A;  2QAC A;  1NX2 A;  1TOP A;  3NSL A;  4MZJ A;  4ORB B;  4C0K A;  1CDN A;  1DEL A;  1SR6 B;  4M2P A;  4E68 A;  2AAO A;  4N5X A;  2BCX A;  2JOJ A;  2BKH B;  3KHE A;  1TUZ A;  1NX1 A;  3A8R A;  4HRH A;  2K8M B;  2K60 A;  1W7I B;  1RRO A;  1UUR A;  1GGZ A;  1UHH A;  5DKN A;  3AKA A;  1S6J A;  3DY9 A;  3HCM A;  3D0Y B;  1B1G A;  3TDU A;  1OZO A;  1X02 A;  2PAL A;  4KYN A;  3CYZ A;  4AOM A;  3GOF A;  2KGR A;  1R2U A;  2BNX A;  3CS1 A;  3TZ1 A;  1SCV A;  2Y1M A;  5JJG A;  1LA3 A;  4PT1 A;  2QDI A;  1YX8 A;  2PYQ A;  3D78 A;  4C0J A;  1QV1 A;  4USL A;  1MWN A;  1A75 A;  1F54 A;  1GJY A;  1K8U A;  1IKU A;  1XFX O;  4PHN A;  2KQY A;  3WHU B;  2YGU A;  2M3W A;  1AK8 A;  3ICB A;  2LLS A;  1UUS A;  2KAV A;  3NHI A;  3FWC A;  4TNC A;  1FPW A;  1CLL A;  4I5N B;  1J7R A;  1JFK A;  1UWO A;  3VRR A;  2WC5 A;  2BL0 B;  1K95 A;  2AUC A;  2K0J A;  2WCB A;  3CGA A;  2PRU A;  1NP8 A;  2R2I A;  5FYX A;  4MRX A;  2L4I A;  3D77 A;  4JQ0 D;  1AP4 A;  1DJX A;  1DJY A;  1QJT A;  2KAX A;  4PHM A;  3LCP C;  4HRE E;  2DOQ A;  2TN4 A;  3TDZ A;  1KQM B;  1XVJ A;  1V1F A;  1QXP A;  2CNP A;  4YI9 A;  1QAS A;  3LL8 B;  1SR6 C;  1U5I A;  2OPO A;  1EL4 A;  5ER4 X;  2VRG A;  1KQV A;  1B9A A;  1YRU B;  2KLE A;  5F6T A;  1CMF A;  1DVI A;  3L4L A;  4P2Y B;  5I2L A;  3S0B A;  1YVL A;  1SBJ A;  1XA5 A;  2JXC A;  3FWB A;  1KK7 Z;  2BBN A;  2KDH A;  2P71 A;  1EG4 A;  1CDM A;  1OOI X;  1IG5 A;  3KPX A;  2L0P A;  3BQ3 A;  1OMR A;  1TWO A;  1SSE B;  1Y1A A;  2KYF A;  2PQL A;  2SAS A;  2V53 A;  1SK6 D;  1MQ1 A;  1C07 A;  1XFY O;  3TS5 B;  1QIV A;  1XFV O;  2H61 A;  1T14 A;  2K7O A;  3GK1 A;  1NX0 A;  2KBI A;  3DVJ A;  1KWO C;  3CR4 X;  1LXF C;  2MLF C;  4MEW A;  3VB1 A;  4ORC B;  3S0E A;  4DUQ A;  4CFQ A;  1A2X A;  1A75 B;  2KNE A;  2HET A;  4QJ5 B;  1J1D A;  1ZAC A;  4L9M A;  2BL0 C;  3LK0 A;  1S6C A;  1K9K A;  2WCF A;  1AJ5 A;  3B86 A;  1KK8 B;  4A4C A;  2I7A A;  3N7H A;  4M2Q A;  2Y5I A;  2LLT A;  2F2O A;  2K61 A;  2G9B A;  1LS8 A;  2M1K B;  2PMY A;  4GGF C;  1KQM C;  2HF5 A;  1YRT B;  4I5K A;  2WCM A;  2ZN9 A;  3CR5 X;  4JKT A;  3BUX B;  3FE9 A;  1XFZ O;  1UHI A;  2GTE A;  4WRI A;  2MBX A;  1YUT A;  1OW4 A;  2HQW A;  4I5L B;  1BOD A;  1U5I B;  1K90 D;  1M46 A;  1S3P A;  1TRF A;  2JPT A;  2Y1N A;  1TCF A;  1SKT A;  3BJH A;  3D75 A;  1ALW A;  1BJF A;  1OE9 B;  1PRW A;  1PUL A;  1CM1 A;  1UHK A;  2WC6 A;  5CSF A;  2F2P A;  1J7Q A;  3SG4 A;  3TS5 C;  2KAY A;  2ZFD A;  3O6B A;  3LLE A;  2QEO A;  1XFU O;  1SMG A;  3ZNI A;  3TUY B;  1J55 A;  1WLM A;  3EKJ A;  4OV2 A;  1YR5 A;  1A4P A;  1YUS A;  1FF1 A;  5B8I B;  2P6B B;  3O4Y A;  1HT9 A;  2KFH A;  2A4J A;  3DVK A;  3H4S E;  1M45 A;  3I5I B;  3DZT A;  1AHR A;  3EK7 A;  1F8H A;  2NLN A;  4DS7 A;  1KFU L;  2D8N A;  1LA0 A;  1QTX A;  1QX2 A;  3UNW A;  1QVI Y;  1KK8 C;  3NGV A;  3SS4 A;  1KSO A;  1B7T Z;  1OOH A;  2Y4Q A;  4ZCV A;  4MN0 A;  4MZL A;  3VRQ A;  4P5O E;  3E3R A;  1DTL A;  4NDD A;  4WQ3 A;  1DJI A;  1TUJ A;  3DXL A;  4DRW A;  2M1U A;  5EL2 A;  1XO5 A;  2MA2 A;  1XFW O;  1ZMZ A;  1CLB A;  3K1E A;  1K9P A;  4NDC A; 
#chains in the Genus database with same CATH homology
 1B47 A;  1F4Q A;  2M49 B;  1EJ3 A;  3SG5 A;  2CT9 A;  5IBW A;  3HX4 A;  4PDZ A;  3VRP A;  4M2O A;  1WRL A;  3RLZ A;  2LVI A;  1TNQ A;  4BY5 A;  1S5G Y;  2L51 A;  2LM5 A;  2WND A;  1NYA A;  1K2H A;  1SYM A;  4XYN A;  2WOR A;  5HLV A;  1IH0 A;  3TUY C;  1BLQ A;  3M0W A;  3CZT X;  2I2R E;  1KWO B;  3I5F B;  1LIN A;  1JUO A;  2H61 C;  2JRF A;  1QX5 B;  3I5I C;  1K94 A;  3JTD B;  1OQP A;  2EC6 B;  4YRU A;  3SG3 A;  1IJ6 A;  1CDP A;  1S36 A;  2LMU A;  4YGA A;  1GQM A;  1ZOT B;  2L4H A;  2L2E A;  5CSI A;  1JF2 A;  1YUR A;  2LCP A;  4CFR A;  2SCP A;  2E6W A;  5D7F A;  1BU3 A;  4PE0 A;  1E8A A;  2LVK A;  3BYA A;  4GUK A;  5ER5 A;  1A29 A;  2EHB A;  3EVR A;  2WCE A;  1C7V A;  1DGV A;  2LVJ A;  1DGU A;  1M39 A;  1FBV A;  4JPZ B;  2GGZ A;  1ZFS A;  3CWG A;  3JVT B;  1AJ4 A;  1DMO A;  2M0R A;  2ISD A;  4MBE A;  5KTY A;  1SNL A;  2K7D A;  4YGB B;  1XYD A;  5J3X A;  1YX7 A;  4YGE B;  4ICB A;  3K21 A;  1SL9 A;  3SG2 A;  1L7Z A;  4D1E A;  1L2O B;  2L50 A;  1N2D A;  5CSJ A;  3SIB A;  5HLO A;  4MLW A;  4DCK A;  1B8R A;  3PFV A;  1NCZ A;  3F45 A;  4OVN F;  1F55 A;  2BEC A;  1RFJ A;  3PM8 A;  3VRO A;  3I5F C;  1EXR A;  4PHK A;  4PCW A;  4HSZ A;  2CCM A;  3JTD C;  2EC6 C;  3SJS A;  5BPJ A;  4GGN A;  3EKH A;  4NDB A;  1BF5 A;  3PAL A;  2KGB C;  3PAT A;  2RGI A;  3FS7 A;  2L98 A;  1MUX A;  1PVB A;  3FIA A;  1UHN A;  1OMV A;  1Y1U A;  1N0Y A;  3WXA A;  5KSZ A;  1XK4 A;  2L5X B;  2MAZ A;  1CFD A;  3PLF B;  3VRN A;  1DF0 A;  3JVT C;  2KI6 D;  1NCY A;  2E30 A;  2QPT A;  2BKI B;  4OCI A;  4AQJ A;  4UPG A;  5AER A;  1BMO A;  3O78 A;  1BR1 B;  4OKH A;  2BE6 A;  1QAT A;  1L2O C;  2WC8 A;  2MRD A;  3AKB A;  1TNX A;  5DKQ A;  3I5H B;  1RK9 A;  2OS8 B;  3LK1 A;  1CM4 A;  4A4B A;  1DT7 B;  1QLS A;  1NUB A;  2F33 A;  3OP0 A;  3CTN A;  3KO0 A;  1KFX L;  2K2A A;  3EK8 A;  1Y6W A;  5GQQ C;  3IF7 A;  1CLM A;  5TNC A;  2ZND A;  3OB2 B;  1K9U A;  2JT0 A;  1KSM A;  3BUO B;  4MVF A;  1G8I A;  1WRK A;  3NSO A;  2H2K A;  2PSR A;  1MR8 A;  4ZCU A;  3NSI A;  2COL B;  2JTZ A;  5CSN A;  5HKW A;  1YVH A;  2M8U A;  2M7L A;  2MJW B;  1FI5 A;  1J7P A;  1ODB A;  1MHO A;  1BR4 B;  2K7C A;  4GFT A;  4N1G A;  4FTG A;  1W7J B;  1YTZ C;  1QVI Z;  1S26 D;  5I2Q A;  1BOC A;  4MSP A;  1BG1 A;  1EH2 A;  4GPL B;  2GV5 A;  1AUI B;  2JXL A;  1DJW A;  3SG7 A;  2FOT A;  1MXE A;  2BCB A;  1NSH A;  1NWD A;  2JWW A;  4C0L A;  1TNP A;  1TN4 A;  1SRA A;  2KBM A;  3CR2 A;  1DF0 B;  2KFF A;  2LMT A;  2LC5 A;  2HQ8 A;  3GK2 A;  1VRK A;  2JC2 A;  3EVV A;  3TDI A;  4DIR A;  3ZWH A;  3A4U B;  3DF0 A;  2OS8 C;  1KFX S;  3I5H C;  1QS7 A;  3OB1 B;  4PAL A;  2O60 A;  2HPS A;  2LNK A;  3I5G B;  4IL1 A;  4GNK B;  2KI4 B;  1S5G Z;  4FQO A;  4XJK A;  4ORA B;  2JNF A;  1CKK A;  4PE4 A;  1BT6 A;  1MF8 B;  1NCX A;  2OTG B;  1NIW A;  1HQV A;  3OX5 A;  1R6P A;  1JFJ A;  1TCO B;  5G08 A;  1M63 B;  4F0Z B;  1G4Y R;  1KFU S;  1PAL A;  2Q4U A;  1QIW A;  1SCM B;  1WLZ A;  2JT8 A;  2LP3 A;  1B4C A;  1CB1 A;  1YUU A;  2NZ0 A;  5HKY A;  1S6I A;  3AAJ A;  3BUW B;  3OX6 A;  1NPQ A;  1IJ5 A;  2BBM A;  1Y0V H;  2F8P A;  2KSP A;  3DVM A;  4JWQ A;  5JOL A;  1D1O A;  1FI6 A;  1PSB A;  2CTN A;  2MLE C;  2LV7 A;  1CTR A;  1WRZ A;  1H8B A;  1A03 A;  1IQ3 A;  5AXI A;  1JF0 A;  1CDL A;  4AQI A;  1Q80 A;  1XK4 C;  1Y1X A;  3PN7 B;  4WQ2 A;  2LMV A;  4OR9 B;  1WDC B;  5HKZ A;  2G2B A;  5AEQ A;  1OZS A;  1PVA A;  4R1E A;  1SY9 A;  1IWQ A;  2BE4 A;  1QX7 A;  2NCP A;  3CLN A;  2WOS A;  2PAS A;  1MXL C;  5CPV A;  1TTX A;  1LVC D;  4I5J A;  3I5G C;  3DVE A;  3PSR A;  2KI4 C;  5HYD A;  1NX3 A;  5KU1 A;  1H4B A;  3DF0 B;  2LHI A;  2MHH A;  2O5G A;  2OTG C;  2Q91 A;  4CID A;  5K89 A;  1CMG A;  1JC2 A;  2LAN A;  1V1G A;  1KK7 Y;  1KCY A;  4XJK B;  3BUN B;  2FCD A;  2ZN8 A;  2KYC A;  2F3Z A;  2FJU B;  1SCM C;  2KI6 C;  2M29 A;  2KOT A;  1QLK A;  1IGV A;  2JQ6 A;  1CNP A;  3C1V A;  2K7B A;  4U8D A;  2LAP A;  1JSA A;  1N65 A;  1TIZ A;  1B8L A;  3QRX A;  1SPY A;  1JBA A;  2JT3 A;  3BXK A;  1G33 A;  1EG3 A;  3NSK A;  1CFF A;  2ZRS A;  3BOW A;  1J1E A;  2LE9 B;  1CFP A;  4QJ4 B;  4CLN A;  1ZUZ A;  2JNX A;  1DJZ A;  2M9G A;  1F4O A;  2LVV A;  2JU0 A;  3PN7 C;  4PE1 A;  1TNW A;  4YGC B;  5PAL A;  1WDC C;  3O2P A;  2BCA A;  1GGW A;  1OOJ A;  4YGD B;  1OMD A;  1SW8 A;  1K96 A;  2PVB A;  1REC A;  4YI8 A;  1ALV A;  2NCO A;  3RM1 A;  4MRY A;  1QV0 A;  4ETO A;  2KQ6 A;  3VGO A;  2FCE A;  3NXA A;  2LLU A;  3EVU A;  1C7W A;  2JTT A;  3DD4 A;  4PHJ A;  5I2O A;  4GBA A;  3BUM B;  3SG6 A;  2CBL A;  2LP2 A;  5AFP A;  4N1F A;  1WY9 A;  1RWY A;  4BY4 A;  3D0Y A;  2LHL A;  3AAK A;  1SL7 A;  1LKJ A;  3OHM B;  1S1E A;  3WHT B;  1RTP 1;  1SL8 A;  2K2F A;  2I94 A;  4MZK A;  2IS9 A;  2ZRT A;  3KEV A;  1JWD A;  2AMI A;  2KFG A;  2LUX A;  1F70 A;  1CFC A;  1IRJ A;  1J7O A;  3IQO A;  1PK0 D;  1IQ5 A;  1DJH A;  1B8C A;  1PSR A;  2LUC A;  2I18 A;  3MSE B;  2GGM A;  4GAO A;  2F3Y A;  3GK4 X;  2NXQ A;  4NQG A;  1AVS A;  3BOW B;  2JUL A;  4YBH B;  4PE7 A;  5D69 A;  3IQQ A;  2M7N A;  1RJV A;  2ZKM X;  3D10 A;  1B7T Y;  3WNX B;  2B1U A;  2ZNE A;  1OSA A;  1DJG A;  1K93 D;  3KF9 A;  5DKR A;  2CXJ A;  5AAN A;  3SIA A;  3EK4 A;  4CPV A;  1FW4 A;  5I8N A;  4GGF A;  1M31 A;  2M97 A;  4HRG A;  1UP5 A;  4QJ3 B;  2JZI A;  2KHN A;  1F71 A;  2EGD A;  4Q04 A;  1UHJ A;  2QAC A;  1NX2 A;  1TOP A;  3NSL A;  4MZJ A;  4ORB B;  4C0K A;  1CDN A;  1SR6 B;  4M2P A;  4E68 A;  2AAO A;  4N5X A;  2BCX A;  2JOJ A;  2BKH B;  3KHE A;  1NX1 A;  3A8R A;  4HRH A;  2K8M B;  1W7I B;  1RRO A;  1UUR A;  1GGZ A;  1UHH A;  5DKN A;  3AKA A;  1S6J A;  3HCM A;  3D0Y B;  1B1G A;  3TDU A;  1OZO A;  1X02 A;  2PAL A;  4AOM A;  3GOF A;  2KGR A;  1R2U A;  3CS1 A;  3TZ1 A;  1SCV A;  2Y1M A;  5JJG A;  1LA3 A;  1YX8 A;  4C0J A;  1QV1 A;  4USL A;  1MWN A;  1A75 A;  1F54 A;  1GJY A;  1K8U A;  1IKU A;  1XFX O;  4PHN A;  2KQY A;  3WHU B;  2M3W A;  1AK8 A;  3ICB A;  2LLS A;  1UUS A;  2KAV A;  3FWC A;  4TNC A;  1FPW A;  1CLL A;  4I5N B;  1J7R A;  1JFK A;  1UWO A;  3VRR A;  2BL0 B;  1K95 A;  2AUC A;  2K0J A;  2WCB A;  3CGA A;  2PRU A;  1NP8 A;  2R2I A;  5FYX A;  4MRX A;  2L4I A;  4JQ0 D;  1AP4 A;  1DJX A;  1DJY A;  1QJT A;  2KAX A;  4PHM A;  3LCP C;  4HRE E;  2DOQ A;  2TN4 A;  3TDZ A;  1KQM B;  1XVJ A;  1V1F A;  1QXP A;  2CNP A;  4YI9 A;  1QAS A;  3LL8 B;  1SR6 C;  1U5I A;  2OPO A;  1EL4 A;  5ER4 X;  2VRG A;  1KQV A;  1B9A A;  1YRU B;  5F6T A;  1CMF A;  1DVI A;  4P2Y B;  5I2L A;  1YVL A;  1SBJ A;  1XA5 A;  2JXC A;  3FWB A;  1KK7 Z;  2BBN A;  2KDH A;  1EG4 A;  1CDM A;  1IG5 A;  3KPX A;  2L0P A;  3BQ3 A;  1OMR A;  2KYF A;  2V53 A;  1Y1A A;  2SAS A;  1SK6 D;  1MQ1 A;  1C07 A;  1XFY O;  3TS5 B;  1QIV A;  1XFV O;  2H61 A;  2K7O A;  3GK1 A;  1NX0 A;  2KBI A;  3DVJ A;  1KWO C;  3CR4 X;  1LXF C;  2MLF C;  4MEW A;  4ORC B;  4DUQ A;  4CFQ A;  1A2X A;  1A75 B;  2KNE A;  2HET A;  4QJ5 B;  1J1D A;  1ZAC A;  4L9M A;  2BL0 C;  3LK0 A;  1S6C A;  1K9K A;  2WCF A;  1AJ5 A;  1KK8 B;  4A4C A;  2I7A A;  4M2Q A;  2Y5I A;  2LLT A;  2F2O A;  2K61 A;  2G9B A;  2M1K B;  2PMY A;  4GGF C;  1KQM C;  2HF5 A;  1YRT B;  4I5K A;  2ZN9 A;  3CR5 X;  3BUX B;  1XFZ O;  1UHI A;  4WRI A;  2MBX A;  1YUT A;  2HQW A;  4I5L B;  1BOD A;  1U5I B;  1K90 D;  1M46 A;  1S3P A;  1TRF A;  2JPT A;  2Y1N A;  1TCF A;  1SKT A;  1ALW A;  1BJF A;  1OE9 B;  1PRW A;  1PUL A;  1CM1 A;  1UHK A;  5CSF A;  2F2P A;  1J7Q A;  3SG4 A;  3TS5 C;  2KAY A;  2ZFD A;  3O6B A;  3LLE A;  1XFU O;  1SMG A;  3ZNI A;  3TUY B;  1J55 A;  1WLM A;  3EKJ A;  4OV2 A;  1YR5 A;  1A4P A;  1YUS A;  1FF1 A;  5B8I B;  2P6B B;  3O4Y A;  1HT9 A;  2KFH A;  2A4J A;  3DVK A;  3H4S E;  1M45 A;  3I5I B;  1AHR A;  3EK7 A;  1F8H A;  2NLN A;  4DS7 A;  1KFU L;  2D8N A;  1LA0 A;  1QTX A;  1QX2 A;  1QVI Y;  1KK8 C;  1KSO A;  1B7T Z;  2Y4Q A;  4ZCV A;  4MN0 A;  4MZL A;  3VRQ A;  4P5O E;  3E3R A;  1DTL A;  4NDD A;  4WQ3 A;  1DJI A;  4DRW A;  2M1U A;  1XO5 A;  2MA2 A;  1XFW O;  1ZMZ A;  1CLB A;  1K9P A;  4NDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...