1NYAA

Nmr solution structure of calerythrin, an ef-hand calcium-binding protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
176
Chain Sequence
TTAIASDRLKKRFDRWDFDGNGALERADFEKEAQHIAEAFGKDAGAAEVQTLKNAFGGLFDYLAKEAGVGSDGSLTEEQFIRVTENLIFEQGEASFNRVLGPVVKGIVGMCDKNADGQINADEFAAWLTALGMSKAEAAEAFNQVDTNGNGELSLDELLTAVRDFHFGRLDVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calerythrin
publication title NMR solution structure of calerythrin, an EF-hand calcium-binding protein from Saccharopolyspora erythraea
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Metal binding protein
total genus 46
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nyaA00
2MHHA 3A8RA 3CR2A 1IKUA 4MVFA 3TZ1A 1G33A 1D1OA 2KGBC 3JVTC 1KSOA 1UURA 1AVSA 1AUIB 1OE9B 4BY4A 2JULA 1B7TY 3CGAA 1EG3A 2ZN9A 4FTGA 1DJXA 3H4SE 3SG3A 4Q04A 2K7CA 1CDLA 1JWDA 2NCPA 1F4OA 1MHOA 3BUOB 4PE0A 1A03A 2COLB 3JVTB 4ORCB 1SR6B 3D0YA 5DKNA 2PVBA 3TDZA 2WOSA 4CIDA 3BXKA 1IWQA 1KFUS 1YUTA 3CZTX 4MZKA 2K0JA 1OZSA 4M2PA 1A29A 2LLSA 1ZUZA 1WDCB 4PHNA 4ICBA 1IQ3A 1S1EA 4P2YB 5JOLA 2LLTA 2DOQA 2JXLA 2AAOA 1KK7Y 1M45A 4NDBA 4OKHA 2ZN8A 1YX8A 1TNXA 2HPSA 3RLZA 2RGIA 1S5GY 2KI6C 2Y4QA 3CWGA 4AOMA 5CPVA 2K8MB 2KI6D 1MQ1A 1K9PA 1KFXL 2BBMA 2CNPA 2LLUA 1QJTA 4R1EA 1FI5A 5K89A 1JUOA 2BE6A 2I94A 3ZWHA 2LVVA 1G8IA 2BCAA 1TIZA 1S6JA 2L0PA 4CLNA 1QLSA 4N1GA 4JQ0D 1SPYA 3TUYC 1SBJA 1DJZA 2AMIA 4L9MA 1CDNA 1XFZO 2FCDA 4GGFA 2JNXA 1YVLA 1QX2A 2HQWA 2ZNEA 1VRKA 2WORA 1PALA 2M0RA 1KK8C 5GQQC 1CLBA 4ZCUA 1GJYA 2K7BA 1B8CA 1XK4C 3EK4A 3FS7A 1Q80A 2M97A 5CSIA 5DKQA 5I8NA 2L4IA 4QJ4B 1XO5A 2H61C 2HETA 1CLMA 5I2LA 1LVCD 4CFRA 2M1UA 1SMGA 3I5GC 4OV2A 4GBAA 1CDMA 3O4YA 2ZRSA 1DTLA 4M2QA 3SG2A 2QACA 4ETOA 3SG5A 1WLMA 2FJUB 4GFTA 1OMRA 4PHMA 3BQ3A 2KYCA 1SW8A 4YGAA 2WNDA 5KU1A 1BT6A 3O78A 5I2OA 2KDHA 1NPQA 1JBAA 2ZKMX 2KQ6A 1OZOA 2BECA 4F0ZB 1PVAA 5AXIA 1CB1A 1YUUA 3BYAA 2L2EA 4DIRA 5F6TA 1DF0B 1NCXA 3PN7B 1ZACA 3KHEA 5CSFA 2EC6C 2WCEA 3EVUA 3BUMB 2F2OA 4HRGA 2JOJA 3SG4A 3I5HB 1B4CA 2JNFA 1QS7A 3VRQA 2PASA 2EGDA 4PE4A 1J7OA 4HREE 5DKRA 2LM5A 2LCPA 1YUSA 1OOJA 1UHJA 3LCPC 2M9GA 1QIWA 1MF8B 1SYMA 1MR8A 1Y1XA 1AK8A 3I5IC 1M63B 3O6BA 3VROA 2NLNA 1PK0D 1YX7A 2JXCA 1LA0A 3CLNA 5TNCA 2ZRTA 2KAXA 1ALWA 1MXEA 2ZNDA 2BKHB 4IL1A 2KOTA 2IS9A 1XFVO 1LA3A 3M0WA 2Y5IA 3SIBA 1EXRA 4C0LA 1KSMA 4NDDA 1CM4A 1UUSA 4UPGA 1DGVA 1LKJA 5IBWA 3E3RA 1H4BA 5FYXA 3VRPA 4GGFC 3VRRA 1YURA 4WRIA 1S3PA 1J7RA 1WRKA 2KQYA 2LVIA 1DJWA 5B8IB 1ODBA 2F8PA 2KBMA 3KF9A 1CNPA 2MJWB 3AKAA 2NZ0A 1K8UA 1MUXA 1RECA 2CTNA 2V53A 3NSOA 4WQ2A 1GQMA 3OB1B 1K93D 1K95A 1X02A 1XA5A 2CCMA 4HRHA 2OS8C 2KNEA 1ZFSA 5D7FA 1SL9A 1ALVA 1XVJA 2LUCA 1KQMC 4PDZA 2HF5A 4BY5A 2LHIA 2KYFA 1M39A 2MLFC 2WCFA 1DJYA 2NCOA 1U5IA 4AQIA 2OS8B 1BF5A 1CFFA 1S26D 1ZMZA 4TNCA 1CMGA 2JT0A 4ORAB 4A4BA 1IJ5A 1WY9A 2PSRA 4PALA 2CT9A 2G2BA 3BOWA 1C7WA 4PCWA 4MN0A 1FF1A 1B8LA 1PSRA 3WHTB 4QJ3B 5D69A 2SASA 2L50A 1NCYA 1SY9A 2TN4A 1EL4A 3GK2A 2KFFA 3EVVA 1XFWO 3F45A 4CFQA 1AP4A 1W7IB 3D10A 1JC2A 3GOFA 1L7ZA 1EJ3A 1NCZA 4C0KA 3PALA 2Y1NA 3TUYB 2JTZA 3TDIA 2MLEC 1Y1AA 2M8UA 2L5XB 1K96A 2ZFDA 1CFPA 3VGOA 1GGZA 1K9UA 1H8BA 4DRWA 5HLVA 1KK8B 1B7TZ 1F71A 3CS1A 4DS7A 5AANA 4PE1A 3I5FC 1QASA 1WRLA 1A2XA 1TRFA 3EK7A 4YI8A 1YR5A 2KHNA 3GK1A 1NX2A 1Y1UA 2BCBA 4U8DA 1N2DA 1UHKA 2OTGC 3TDUA 5BPJA 1TNWA 1SKTA 2LAPA 2M3WA 3I5GB 2PRUA 2K61A 2E6WA 1MXLC 4PHJA 4ZCVA 4AQJA 1KFXS 4OR9B 2OTGB 3DVMA 1BG1A 1RJVA 1S36A 2M29A 1QVIZ 2NXQA 1F54A 4MLWA 1HT9A 1RK9A 1KK7Z 2MRDA 2JU0A 1CDPA 1A4PA 1FBVA 1S5GZ 1V1GA 2LNKA 1DJHA 3DVEA 4FQOA 3FIAA 4YGBB 1BU3A 1B8RA 2MAZA 1MWNA 3CR5X 1N65A 1XFUO 2QPTA 2P6BB 3EK8A 4XJKA 1DT7B 1IG5A 4ORBB 5HLOA 2K2FA 2BBNA 1UHNA 2EC6B 2L98A 4I5KA 5HKWA 1A75A 1SCMC 3C1VA 2F33A 4NDCA 2I2RE 2Q4UA 1TCFA 4I5NB 1NX0A 1E8AA 2K2AA 3OHMB 2KAYA 3WHUB 2GGMA 2LUXA 2L4HA 2K7OA 2PMYA 3AKBA 1YRUB 2LMUA 2EHBA 1JF2A 3DD4A 1YTZC 1YVHA 1U5IB 1G4YR 1TOPA 3CR4X 1KCYA 3I5IB 1J7PA 1DGUA 1Y6WA 3BOWB 1UHHA 3DVKA 1IRJA 2ISDA 1PSBA 2GGZA 2WCBA 1KFUL 2GV5A 5CSNA 1K2HA 2L51A 1M46A 1IGVA 2VRGA 3KPXA 4I5LB 1QLKA 2JC2A 1B9AA 1DVIA 1CFDA 1UWOA 1HQVA 1EH2A 2LMVA 2LP3A 3BUXB 4WQ3A 1SK6D 5HKZA 4N1FA 1CFCA 2Q91A 1CKKA 3CTNA 2LE9B 4DCKA 4MRXA 1TNPA 2LV7A 3ZNIA 4OVNF 2JWWA 1TCOB 1K94A 2O60A 2JT8A 1NUBA 1QX7A 4YI9A 3LLEA 1JFJA 1OSAA 3PLFB 1J7QA 1OMDA 3EKJA 3NSIA 4OCIA 2I7AA 1GGWA 1JF0A 1J55A 4E68A 1UHIA 2JT3A 5AEQA 4YGCB 1AJ4A 1SR6C 5I2QA 1BR1B 3PM8A 2JTTA 5G08A 4MZJA 3IQQA 1SCVA 1NYAA 1AHRA 3WNXB 5CSJA 1KQMB 1BR4B 1NSHA 4NQGA 3IF7A 2JRFA 2M1KB 2LHLA 1XFXO 4HSZA 1IH0A 2LVKA 5KSZA 1J1DA 1WDCC 3KO0A 1L2OC 2BE4A 1JFKA 2LP2A 2KI4C 1AJ5A 1S6IA 3HCMA 1DJGA 3LK0A 4YGEB 3SG6A 2F2PA 2WC8A 1NWDA 5AERA 3FWBA 1F55A 1OQPA 1YRTB 4CPVA 1K9KA 1S6CA 1L2OB 3DF0A 1QVIY 4C0JA 4MBEA 2KI4B 2KGRA 1TTXA 1XFYO 2AUCA 3BUWB 1IJ6A 3NSLA 1CM1A 1KWOC 4I5JA 3FWCA 1QIVA 1RROA 2BCXA 2OPOA 5JJGA 2MBXA 2I18A 2LVJA 1DMOA 2PALA 2KFHA 1KWOB 1JSAA 1QXPA 2BKIB 3OP0A 4XJKB 4JWQA 2D8NA 3TS5C 1KQVA 1QX5B 2MA2A 4GNKB 1NP8A 1A75B 1SL7A 5J3XA 2LANA 1QATA 4A4CA 2Y1MA 2F3YA 1CLLA 1FPWA 3TS5B 1OMVA 3EKHA 1J1EA 2KFGA 1F8HA 4D1EA 3I5FB 1C07A 5PALA 3MSEB 1TNQA 3KEVA 3O2PA 1PULA 4JPZB 2G9BA 2LMTA 3LL8B 1B47A 3AAJA 1N0YA 3K21A 3OX5A 1BODA 5AFPA 2O5GA 4GGNA 3WXAA 4P5OE 2JZIA 1LINA 2M49B 3IQOA 3NSKA 2A4JA 4MZLA 4GUKA 1WRZA 3HX4A 4N5XA 2R2IA 1Y0VH 1PVBA 3SIAA 4YBHB 3NXAA 2FCEA 2KAVA 3PSRA 4MEWA 5HKYA 3VRNA 3GK4X 3QRXA 1RWYA 1WLZA 1R2UA 1RFJA 1SL8A 2KBIA 3A4UB 3PN7C 1F4QA 2JPTA 3OB2B 4PHKA 3AAKA 4QJ5B 1ZOTB 1EG4A 3I5HC 3ICBA 3BUNB 3LK1A 2B1UA 3DVJA 5HYDA 1CMFA 2SCPA 1SCMB 1SNLA 5ER5A 4USLA 1DJIA 1NX3A 4PE7A 1QV0A 2K7DA 3EVRA 1PRWA 1B1GA 1TN4A 1M31A 2E30A 1W7JB 2F3ZA 2CXJA 1BOCA 2LC5A 1RTP1 4MSPA 2BL0C 1NIWA 3RM1A 1UP5A 1XK4A 1BLQA 1FI6A 4YGDB 2KSPA 3JTDC 1CTRA 2JQ6A 3D0YB 4MRYA 2H61A 4GPLB 3SG7A 1SRAA 1BJFA 2BL0B 1NX1A 1XYDA 1FW4A 2HQ8A 1V1FA 1K90D 3JTDB 4YRUA 3OX6A 5KTYA 3DF0B 1R6PA 2FOTA 4DUQA 5ER4X 4XYNA 1C7VA 4GAOA 1QTXA 3PATA 1QV1A 1F70A 1LXFC 2H2KA 2CBLA 1IQ5A 4M2OA 1BMOA 2M7NA 3SJSA 3PFVA 2M7LA 1DF0A
chains in the Genus database with same CATH superfamily
3R1PA 2MHHA 3A8RA 3CR2A 1IKUA 4MVFA 3CYZA 3TZ1A 1G33A 1D1OA 2KGBC 3JVTC 1KSOA 3FE9A 1UURA 1AVSA 1AUIB 1OE9B 4BY4A 2JULA 1B7TY 3CGAA 3S0EA 1EG3A 2ZN9A 4FTGA 1DJXA 3H4SE 3SG3A 4Q04A 2K7CA 1CDLA 1JWDA 2NCPA 1F4OA 1MHOA 3BUOB 3D78A 4PE0A 1A03A 2COLB 3JVTB 4ORCB 1SR6B 3D0YA 5DKNA 2BAPA 2PVBA 3TDZA 2WOSA 4CIDA 3BXKA 1IWQA 2L5YA 1KFUS 1YUTA 3CZTX 3S0GA 4MZKA 2K0JA 1OZSA 4M2PA 2JPOA 1A29A 2LLSA 1ZUZA 1WDCB 4IJ7A 4ICBA 4PHNA 1IQ3A 1S1EA 4P2YB 5JOLA 2LLTA 2DOQA 2JXLA 2AAOA 3CZ1A 1KK7Y 1M45A 4NDBA 4OKHA 2ZN8A 1YX8A 1TNXA 2HPSA 3RLZA 2RGIA 1S5GY 2KI6C 2Y4QA 3CWGA 4AOMA 5CPVA 2K8MB 2KI6D 1MQ1A 1K9PA 1KFXL 2BBMA 2CNPA 2LLUA 1QJTA 4R1EA 1FI5A 5K89A 1JUOA 2BE6A 2I94A 1OOHA 2LVVA 3ZWHA 1G8IA 2BCAA 1TIZA 1S6JA 2L0PA 4CLNA 1QLSA 4N1GA 4JQ0D 1SPYA 3TUYC 3B88A 1SBJA 1DJZA 2WC6A 2AMIA 4L9MA 1CDNA 1XFZO 2FCDA 4GGFA 2JNXA 1YVLA 1QX2A 2HQWA 2ZNEA 1VRKA 2WORA 1PALA 2M0RA 1KK8C 3OBVA 5GQQC 4ZCUA 1GJYA 2K7BA 5DICA 1CLBA 1B8CA 1XK4C 3EK4A 3FS7A 1Q80A 2M97A 5CSIA 5DKQA 3D77A 5I8NA 2L4IA 4QJ4B 1XO5A 2H61C 2HETA 1CLMA 5I2LA 1LVCD 4CFRA 2M1UA 1SMGA 3I5GC 3NHIA 4GBAA 4OV2A 1CDMA 3O4YA 2ZRSA 1DTLA 4M2QA 3SG2A 2QACA 3DY9A 4ETOA 1OOIX 3BFBA 3QMEA 3SG5A 3D73A 1WLMA 2FJUB 4GFTA 1OMRA 4PHMA 5FI7A 3BQ3A 3B7AA 2KYCA 1SW8A 4YGAA 2WNDA 5KU1A 1BT6A 3O78A 5I2OA 2KDHA 1NPQA 1JBAA 2ZKMX 2KQ6A 1OZOA 2BECA 4F0ZB 3FE6A 1PVAA 3VB1A 5AXIA 1CB1A 3CABA 4OZDA 1YUUA 3BYAA 2L2EA 4DIRA 1DEKA 5F6TA 1DF0B 1NCXA 3PN7B 1ZACA 3KHEA 5CSFA 3IVTA 2EC6C 2WCEA 3EVUA 3BUMB 2F2OA 4HRGA 2JOJA 3SG4A 3I5HB 1B4CA 2JNFA 1QS7A 3VRQA 2PASA 1SSEB 2EGDA 4PE4A 1J7OA 4HREE 3O4XA 1C3ZA 2LM5A 4FQTA 2LCPA 3PJIA 5DKRA 1YUSA 1OOJA 1UHJA 2QEOA 3LCPC 2M9GA 1QIWA 3DYEA 1MF8B 1DELA 1SYMA 3L47A 1MR8A 1Y1XA 1AK8A 3I5IC 1M63B 3O6BA 3SS5A 3V2LA 3VROA 2NLNA 1PK0D 1YX7A 2JXCA 1LA0A 3CLNA 5TNCA 1QWVA 2ZRTA 2KAXA 1ALWA 1MXEA 2ZNDA 5HL1A 2BKHB 4IL1A 2KOTA 2IS9A 1XFVO 1LA3A 3M0WA 2Y5IA 3SIBA 1EXRA 3L4AA 4C0LA 1KSMA 4NDDA 1CM4A 1UUSA 4UPGA 1DGVA 1LKJA 5IBWA 3E3RA 1H4BA 5FYXA 3VRPA 4GGFC 3VRRA 1YURA 4WRIA 1S3PA 1J7RA 1WRKA 2H8VA 2KQYA 2LVIA 1DJWA 2WCHA 1ODBA 5B8IB 2F8PA 2KBMA 3BFAA 3DZTA 3KF9A 1CNPA 2MJWB 3AKAA 2NZ0A 1K8UA 1MUXA 1RECA 2CTNA 2V53A 3NSOA 4WQ2A 5FI6A 1GQMA 3OB1B 1K93D 1K95A 1X02A 1XA5A 2CCMA 4HRHA 2L2CA 2OS8C 2WCLA 2KNEA 1ORGA 1ZFSA 5D7FA 1SL9A 1ALVA 1XVJA 2LUCA 3B6XA 1KQMC 2QEBA 2HF5A 4PDZA 4BY5A 2LHIA 2KYFA 1M39A 2MLFC 2WCFA 1DJYA 2KLDA 2NCOA 1U5IA 4AQIA 2PYQA 2OS8B 1BF5A 1CFFA 1S26D 1ZMZA 4TNCA 1CMGA 2JT0A 4ORAB 4A4BA 1IJ5A 1WY9A 2PSRA 4PALA 2CT9A 2G2BA 3BOWA 1C7WA 3N7HA 4PCWA 4MN0A 1FF1A 1B8LA 1PSRA 3WHTB 4QJ3B 1OW4A 2SASA 5D69A 1LS8A 2GTEA 2L50A 1NCYA 1SY9A 2TN4A 1EL4A 3GK2A 2KFFA 3EVVA 1XFWO 3F45A 4CFQA 1AP4A 3S0AA 3S0FA 1W7IB 3D10A 1JC2A 3GOFA 3UNWA 1L7ZA 1EJ3A 1NCZA 1TUJA 3BJHA 4C0KA 3PALA 2Y1NA 3TUYB 4F7FA 2JTZA 3TDIA 2MLEC 1Y1AA 2M8UA 2WCKA 2L5XB 3CZ0A 1K96A 2ZFDA 2K60A 1CFPA 3VGOA 1GGZA 1K9UA 1H8BA 3NGVA 1OOFA 4DRWA 5HLVA 1KK8B 1B7TZ 1F71A 3CS1A 4DS7A 5AANA 4PE1A 3I5FC 1QASA 1WRLA 1A2XA 1TRFA 3EK7A 4YI8A 1YR5A 2KHNA 3GK1A 1NX2A 3R1VA 1Y1UA 2BCBA 4U8DA 1N2DA 1UHKA 2OTGC 3TDUA 5BPJA 1TNWA 1SKTA 2LAPA 2M3WA 3I5GB 2PRUA 2K61A 3FE8A 2E6WA 2P70A 3DXLA 1MXLC 4PHJA 4ZCVA 4AQJA 1KFXS 3S0BA 4OR9B 2OTGB 3DVMA 4INXA 1BG1A 1RJVA 1S36A 1XFRA 2M29A 1QVIZ 2NXQA 1F54A 4MLWA 3S0DA 1HT9A 1RK9A 1KK7Z 2MRDA 2JU0A 1CDPA 1A4PA 1FBVA 1S5GZ 1V1GA 2LNKA 1DJHA 3DVEA 4FQOA 3FIAA 3D74A 4YGBB 1BU3A 1B8RA 1TUZA 2MAZA 4JD9A 1MWNA 3CR5X 1N65A 1XFUO 2QPTA 2P6BB 3EK8A 4XJKA 1DT7B 1IG5A 2KLEA 4ORBB 2K2FA 5HLOA 2BBNA 1UHNA 2EC6B 2L98A 4I5KA 5HKWA 2ERBA 1GM0A 1A75A 1SCMC 5EL2A 3C1VA 2F33A 4NDCA 2I2RE 2Q4UA 1TCFA 3CDNA 4I5NB 1NX0A 1E8AA 2K2AA 3K1EA 1W9ZA 3OHMB 1C3YA 2KAYA 2WCJA 3WHUB 2GGMA 2LUXA 2L4HA 2K7OA 2PMYA 2QEVA 3AKBA 1YRUB 2LMUA 2EHBA 1JF2A 3R72A 3DD4A 1YTZC 1YVHA 1U5IB 4INWA 1G4YR 1TOPA 3CR4X 1KCYA 3I5IB 3D75A 1J7PA 1DGUA 1Y6WA 3BOWB 1UHHA 2P71A 3DVKA 1IRJA 2ISDA 1PSBA 2GGZA 2WCBA 1KFUL 2GV5A 5CSNA 1K2HA 2L51A 1M46A 1IGVA 2VRGA 3KPXA 2YGUA 4I5LB 1QLKA 2JC2A 1B9AA 1DVIA 4KYNA 1CFDA 1UWOA 1HQVA 1EH2A 2LMVA 2LP3A 3BUXB 4WQ3A 1T14A 1SK6D 5HKZA 4N1FA 1CFCA 2Q91A 1CKKA 3CTNA 2LE9B 4DCKA 4MRXA 1TNPA 2LV7A 3ZNIA 4OVNF 2JWWA 1TCOB 1K94A 1Z4HA 2JT8A 2O60A 1NUBA 1QX7A 3B87A 4YI9A 3LLEA 1JFJA 1OSAA 3PLFB 1J7QA 1OMDA 3EKJA 3NSIA 4OCIA 2I7AA 1GGWA 1JF0A 1J55A 4E68A 1UHIA 2JT3A 2QDIA 5AEQA 4YGCB 1AJ4A 1SR6C 5I2QA 1BR1B 2WC5A 3PM8A 2JTTA 5G08A 4MZJA 3IQQA 1SCVA 1NYAA 1AHRA 3WNXB 5CSJA 1KQMB 1BR4B 1NSHA 4NQGA 3IF7A 2JRFA 2M1KB 2LHLA 1XFXO 4HSZA 1TWOA 1IH0A 2QEHA 2LVKA 5KSZA 1J1DA 1WDCC 3KO0A 1L2OC 2BE4A 1JFKA 2LP2A 2KI4C 1AJ5A 1S6IA 3HCMA 1DJGA 3LK0A 4YGEB 3SG6A 2F2PA 2WC8A 1NWDA 5AERA 3FWBA 1F55A 1OQPA 1YRTB 4CPVA 1K9KA 1S6CA 1L2OB 3DF0A 1QVIY 4C0JA 4MBEA 2KI4B 2KGRA 1TTXA 1XFYO 2AUCA 3BUWB 4PT1A 1IJ6A 3NSLA 1CM1A 1KWOC 4I5JA 3FWCA 1QIVA 1RROA 2BCXA 2OPOA 5JJGA 2PQLA 2MBXA 3EG5B 3BFHA 1DC1A 2I18A 2LVJA 1DMOA 2PALA 2KFHA 1KWOB 1JSAA 1QXPA 2BKIB 3OP0A 4XJKB 4JWQA 2D8NA 3TS5C 1KQVA 1QX5B 2MA2A 4GNKB 1NP8A 1A75B 1SL7A 5J3XA 2LANA 1QATA 4A4CA 3R1OA 2Y1MA 2F3YA 1CLLA 1FPWA 3TS5B 1OMVA 3EKHA 1J1EA 2KFGA 1F8HA 4D1EA 3I5FB 1C07A 5PALA 3SS3A 3MSEB 5FI2A 1TNQA 3KEVA 3O2PA 1PULA 4JPZB 2G9BA 2LMTA 3LL8B 3Q8IA 1B47A 2KPHA 3AAJA 3L4LA 1N0YA 5D3OA 1IIOA 3K21A 3OX5A 1BODA 5AFPA 2O5GA 4JKTA 4GGNA 3WXAA 4P5OE 2JZIA 1LINA 2M49B 3IQOA 3NSKA 2A4JA 4MZLA 4GUKA 1WRZA 3HX4A 4N5XA 5I94A 2R2IA 1Y0VH 1PVBA 3SIAA 4YBHB 3NXAA 2FCEA 2KAVA 3PSRA 4MEWA 5HKYA 3VRNA 3GK4X 3QRXA 1RWYA 1Z2CB 1WLZA 1R2UA 1RFJA 1SL8A 1DQEA 2WCMA 3PM2A 2KBIA 3A4UB 3PN7C 1F4QA 2JPTA 3OB2B 4PHKA 3AAKA 3UO9A 4QJ5B 1ZOTB 1EG4A 3I5HC 3ICBA 3BUNB 3LK1A 2B1UA 3DVJA 5HYDA 1CMFA 2SCPA 1SCMB 1SNLA 5ER5A 4USLA 1DJIA 1NX3A 4PE7A 1QV0A 2K7DA 3EVRA 1PRWA 1B1GA 1TN4A 1M31A 2E30A 1W7JB 2F3ZA 2CXJA 1BOCA 2LC5A 1RTP1 2FJYA 4MSPA 2BL0C 1NIWA 3RM1A 1UP5A 1XK4A 3CZ2A 1BLQA 3NHTA 1FI6A 4YGDB 2KSPA 3SS4A 3JTDC 1CTRA 2JQ6A 3B86A 3D0YB 4MRYA 1OOGA 2H61A 4GPLB 3SG7A 1SRAA 1BJFA 3D76A 2BL0B 1NX1A 1XYDA 1FW4A 2HQ8A 1V1FA 1K90D 3JTDB 4YRUA 3OX6A 5KTYA 3DF0B 2BNXA 1R6PA 2FOTA 4DUQA 5ER4X 4XYNA 1C7VA 4GAOA 1QTXA 3PATA 1QV1A 1F70A 1LXFC 2H2KA 2CBLA 1IQ5A 4M2OA 1BMOA 2M7NA 3OGNA 3SJSA 3PFVA 3RZSA 2M7LA 1P28A 1DF0A
chains in the Genus database with same CATH topology
2MHHA 3A8RA 3CR2A 1IKUA 4MVFA 3TZ1A 1G33A 1D1OA 2KGBC 3JVTC 1KSOA 1UURA 1AVSA 1AUIB 1OE9B 4BY4A 2JULA 1B7TY 3CGAA 1EG3A 2ZN9A 4FTGA 1DJXA 3H4SE 3SG3A 4Q04A 2K7CA 1CDLA 1JWDA 2NCPA 1F4OA 1MHOA 3BUOB 4PE0A 1A03A 2COLB 3JVTB 4ORCB 1SR6B 3D0YA 5DKNA 2PVBA 3TDZA 2WOSA 4CIDA 3BXKA 1IWQA 1KFUS 1YUTA 3CZTX 4MZKA 2K0JA 1OZSA 4M2PA 1A29A 2LLSA 1ZUZA 1WDCB 4PHNA 4ICBA 1IQ3A 1S1EA 4P2YB 5JOLA 2LLTA 2DOQA 2JXLA 2AAOA 1KK7Y 1M45A 4NDBA 4OKHA 2ZN8A 1YX8A 1TNXA 2HPSA 3RLZA 2RGIA 1S5GY 2KI6C 2Y4QA 3CWGA 4AOMA 5CPVA 2K8MB 2KI6D 1MQ1A 1K9PA 1KFXL 2BBMA 2CNPA 2LLUA 1QJTA 4R1EA 1FI5A 5K89A 1JUOA 2BE6A 2I94A 3ZWHA 2LVVA 1G8IA 2BCAA 1TIZA 1S6JA 2L0PA 4CLNA 1QLSA 4N1GA 4JQ0D 1SPYA 3TUYC 1SBJA 1DJZA 2AMIA 4L9MA 1CDNA 1XFZO 2FCDA 4GGFA 2JNXA 1YVLA 1QX2A 2HQWA 2ZNEA 1VRKA 2WORA 1PALA 2M0RA 1KK8C 5GQQC 1CLBA 4ZCUA 1GJYA 2K7BA 1B8CA 1XK4C 3EK4A 3FS7A 1Q80A 2M97A 5CSIA 5DKQA 5I8NA 2L4IA 4QJ4B 1XO5A 2H61C 2HETA 1CLMA 5I2LA 1LVCD 4CFRA 2M1UA 1SMGA 3I5GC 4OV2A 4GBAA 1CDMA 3O4YA 2ZRSA 1DTLA 4M2QA 3SG2A 2QACA 4ETOA 3SG5A 1WLMA 2FJUB 4GFTA 1OMRA 4PHMA 3BQ3A 2KYCA 1SW8A 4YGAA 2WNDA 5KU1A 1BT6A 3O78A 5I2OA 2KDHA 1NPQA 1JBAA 2ZKMX 2KQ6A 1OZOA 2BECA 4F0ZB 1PVAA 5AXIA 1CB1A 1YUUA 3BYAA 2L2EA 4DIRA 5F6TA 1DF0B 1NCXA 3PN7B 1ZACA 3KHEA 5CSFA 2EC6C 2WCEA 3EVUA 3BUMB 2F2OA 4HRGA 2JOJA 3SG4A 3I5HB 1B4CA 2JNFA 1QS7A 3VRQA 2PASA 2EGDA 4PE4A 1J7OA 4HREE 5DKRA 2LM5A 2LCPA 1YUSA 1OOJA 1UHJA 3LCPC 2M9GA 1QIWA 1MF8B 1SYMA 1MR8A 1Y1XA 1AK8A 3I5IC 1M63B 3O6BA 3VROA 2NLNA 1PK0D 1YX7A 2JXCA 1LA0A 3CLNA 5TNCA 2ZRTA 2KAXA 1ALWA 1MXEA 2ZNDA 2BKHB 4IL1A 2KOTA 2IS9A 1XFVO 1LA3A 3M0WA 2Y5IA 3SIBA 1EXRA 4C0LA 1KSMA 4NDDA 1CM4A 1UUSA 4UPGA 1DGVA 1LKJA 5IBWA 3E3RA 1H4BA 5FYXA 3VRPA 4GGFC 3VRRA 1YURA 4WRIA 1S3PA 1J7RA 1WRKA 2KQYA 2LVIA 1DJWA 5B8IB 1ODBA 2F8PA 2KBMA 3KF9A 1CNPA 2MJWB 3AKAA 2NZ0A 1K8UA 1MUXA 1RECA 2CTNA 2V53A 3NSOA 4WQ2A 1GQMA 3OB1B 1K93D 1K95A 1X02A 1XA5A 2CCMA 4HRHA 2OS8C 2KNEA 1ZFSA 5D7FA 1SL9A 1ALVA 1XVJA 2LUCA 1KQMC 4PDZA 2HF5A 4BY5A 2LHIA 2KYFA 1M39A 2MLFC 2WCFA 1DJYA 2NCOA 1U5IA 4AQIA 2OS8B 1BF5A 1CFFA 1S26D 1ZMZA 4TNCA 1CMGA 2JT0A 4ORAB 4A4BA 1IJ5A 1WY9A 2PSRA 4PALA 2CT9A 2G2BA 3BOWA 1C7WA 4PCWA 4MN0A 1FF1A 1B8LA 1PSRA 3WHTB 4QJ3B 5D69A 2SASA 2L50A 1NCYA 1SY9A 2TN4A 1EL4A 3GK2A 2KFFA 3EVVA 1XFWO 3F45A 4CFQA 1AP4A 1W7IB 3D10A 1JC2A 3GOFA 1L7ZA 1EJ3A 1NCZA 4C0KA 3PALA 2Y1NA 3TUYB 2JTZA 3TDIA 2MLEC 1Y1AA 2M8UA 2L5XB 1K96A 2ZFDA 1CFPA 3VGOA 1GGZA 1K9UA 1H8BA 4DRWA 5HLVA 1KK8B 1B7TZ 1F71A 3CS1A 4DS7A 5AANA 4PE1A 3I5FC 1QASA 1WRLA 1A2XA 1TRFA 3EK7A 4YI8A 1YR5A 2KHNA 3GK1A 1NX2A 1Y1UA 2BCBA 4U8DA 1N2DA 1UHKA 2OTGC 3TDUA 5BPJA 1TNWA 1SKTA 2LAPA 2M3WA 3I5GB 2PRUA 2K61A 2E6WA 1MXLC 4PHJA 4ZCVA 4AQJA 1KFXS 4OR9B 2OTGB 3DVMA 1BG1A 1RJVA 1S36A 2M29A 1QVIZ 2NXQA 1F54A 4MLWA 1HT9A 1RK9A 1KK7Z 2MRDA 2JU0A 1CDPA 1A4PA 1FBVA 1S5GZ 1V1GA 2LNKA 1DJHA 3DVEA 4FQOA 3FIAA 4YGBB 1BU3A 1B8RA 2MAZA 1MWNA 3CR5X 1N65A 1XFUO 2QPTA 2P6BB 3EK8A 4XJKA 1DT7B 1IG5A 4ORBB 5HLOA 2K2FA 2BBNA 1UHNA 2EC6B 2L98A 4I5KA 5HKWA 1A75A 1SCMC 3C1VA 2F33A 4NDCA 2I2RE 2Q4UA 1TCFA 4I5NB 1NX0A 1E8AA 2K2AA 3OHMB 2KAYA 3WHUB 2GGMA 2LUXA 2L4HA 2K7OA 2PMYA 3AKBA 1YRUB 2LMUA 2EHBA 1JF2A 3DD4A 1YTZC 1YVHA 1U5IB 1G4YR 1TOPA 3CR4X 1KCYA 3I5IB 1J7PA 1DGUA 1Y6WA 3BOWB 1UHHA 3DVKA 1IRJA 2ISDA 1PSBA 2GGZA 2WCBA 1KFUL 2GV5A 5CSNA 1K2HA 2L51A 1M46A 1IGVA 2VRGA 3KPXA 4I5LB 1QLKA 2JC2A 1B9AA 1DVIA 1CFDA 1UWOA 1HQVA 1EH2A 2LMVA 2LP3A 3BUXB 4WQ3A 1SK6D 5HKZA 4N1FA 1CFCA 2Q91A 1CKKA 3CTNA 2LE9B 4DCKA 4MRXA 1TNPA 2LV7A 3ZNIA 4OVNF 2JWWA 1TCOB 1K94A 2O60A 2JT8A 1NUBA 1QX7A 4YI9A 3LLEA 1JFJA 1OSAA 3PLFB 1J7QA 1OMDA 3EKJA 3NSIA 4OCIA 2I7AA 1GGWA 1JF0A 1J55A 4E68A 1UHIA 2JT3A 5AEQA 4YGCB 1AJ4A 1SR6C 5I2QA 1BR1B 3PM8A 2JTTA 5G08A 4MZJA 3IQQA 1SCVA 1NYAA 1AHRA 3WNXB 5CSJA 1KQMB 1BR4B 1NSHA 4NQGA 3IF7A 2JRFA 2M1KB 2LHLA 1XFXO 4HSZA 1IH0A 2LVKA 5KSZA 1J1DA 1WDCC 3KO0A 1L2OC 2BE4A 1JFKA 2LP2A 2KI4C 1AJ5A 1S6IA 3HCMA 1DJGA 3LK0A 4YGEB 3SG6A 2F2PA 2WC8A 1NWDA 5AERA 3FWBA 1F55A 1OQPA 1YRTB 4CPVA 1K9KA 1S6CA 1L2OB 3DF0A 1QVIY 4C0JA 4MBEA 2KI4B 2KGRA 1TTXA 1XFYO 2AUCA 3BUWB 1IJ6A 3NSLA 1CM1A 1KWOC 4I5JA 3FWCA 1QIVA 1RROA 2BCXA 2OPOA 5JJGA 2MBXA 2I18A 2LVJA 1DMOA 2PALA 2KFHA 1KWOB 1JSAA 1QXPA 2BKIB 3OP0A 4XJKB 4JWQA 2D8NA 3TS5C 1KQVA 1QX5B 2MA2A 4GNKB 1NP8A 1A75B 1SL7A 5J3XA 2LANA 1QATA 4A4CA 2Y1MA 2F3YA 1CLLA 1FPWA 3TS5B 1OMVA 3EKHA 1J1EA 2KFGA 1F8HA 4D1EA 3I5FB 1C07A 5PALA 3MSEB 1TNQA 3KEVA 3O2PA 1PULA 4JPZB 2G9BA 2LMTA 3LL8B 1B47A 3AAJA 1N0YA 3K21A 3OX5A 1BODA 5AFPA 2O5GA 4GGNA 3WXAA 4P5OE 2JZIA 1LINA 2M49B 3IQOA 3NSKA 2A4JA 4MZLA 4GUKA 1WRZA 3HX4A 4N5XA 2R2IA 1Y0VH 1PVBA 3SIAA 4YBHB 3NXAA 2FCEA 2KAVA 3PSRA 4MEWA 5HKYA 3VRNA 3GK4X 3QRXA 1RWYA 1WLZA 1R2UA 1RFJA 1SL8A 2KBIA 3A4UB 3PN7C 1F4QA 2JPTA 3OB2B 4PHKA 3AAKA 4QJ5B 1ZOTB 1EG4A 3I5HC 3ICBA 3BUNB 3LK1A 2B1UA 3DVJA 5HYDA 1CMFA 2SCPA 1SCMB 1SNLA 5ER5A 4USLA 1DJIA 1NX3A 4PE7A 1QV0A 2K7DA 3EVRA 1PRWA 1B1GA 1TN4A 1M31A 2E30A 1W7JB 2F3ZA 2CXJA 1BOCA 2LC5A 1RTP1 4MSPA 2BL0C 1NIWA 3RM1A 1UP5A 1XK4A 1BLQA 1FI6A 4YGDB 2KSPA 3JTDC 1CTRA 2JQ6A 3D0YB 4MRYA 2H61A 4GPLB 3SG7A 1SRAA 1BJFA 2BL0B 1NX1A 1XYDA 1FW4A 2HQ8A 1V1FA 1K90D 3JTDB 4YRUA 3OX6A 5KTYA 3DF0B 1R6PA 2FOTA 4DUQA 5ER4X 4XYNA 1C7VA 4GAOA 1QTXA 3PATA 1QV1A 1F70A 1LXFC 2H2KA 2CBLA 1IQ5A 4M2OA 1BMOA 2M7NA 3SJSA 3PFVA 2M7LA 1DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHH A;  3A8R A;  3CR2 A;  1IKU A;  4MVF A;  3TZ1 A;  1G33 A;  1D1O A;  2KGB C;  3JVT C;  1KSO A;  1UUR A;  1AVS A;  1AUI B;  1OE9 B;  4BY4 A;  2JUL A;  1B7T Y;  3CGA A;  1EG3 A;  2ZN9 A;  4FTG A;  1DJX A;  3H4S E;  3SG3 A;  4Q04 A;  2K7C A;  1CDL A;  1JWD A;  2NCP A;  1F4O A;  1MHO A;  3BUO B;  4PE0 A;  1A03 A;  2COL B;  3JVT B;  4ORC B;  1SR6 B;  3D0Y A;  5DKN A;  2PVB A;  3TDZ A;  2WOS A;  4CID A;  3BXK A;  1IWQ A;  1KFU S;  1YUT A;  3CZT X;  4MZK A;  2K0J A;  1OZS A;  4M2P A;  1A29 A;  2LLS A;  1ZUZ A;  1WDC B;  4PHN A;  4ICB A;  1IQ3 A;  1S1E A;  4P2Y B;  5JOL A;  2LLT A;  2DOQ A;  2JXL A;  2AAO A;  1KK7 Y;  1M45 A;  4NDB A;  4OKH A;  2ZN8 A;  1YX8 A;  1TNX A;  2HPS A;  3RLZ A;  2RGI A;  1S5G Y;  2KI6 C;  2Y4Q A;  3CWG A;  4AOM A;  5CPV A;  2K8M B;  2KI6 D;  1MQ1 A;  1K9P A;  1KFX L;  2BBM A;  2CNP A;  2LLU A;  1QJT A;  4R1E A;  1FI5 A;  5K89 A;  1JUO A;  2BE6 A;  2I94 A;  3ZWH A;  2LVV A;  1G8I A;  2BCA A;  1TIZ A;  1S6J A;  2L0P A;  4CLN A;  1QLS A;  4N1G A;  4JQ0 D;  1SPY A;  3TUY C;  1SBJ A;  1DJZ A;  2AMI A;  4L9M A;  1CDN A;  1XFZ O;  2FCD A;  4GGF A;  2JNX A;  1YVL A;  1QX2 A;  2HQW A;  2ZNE A;  1VRK A;  2WOR A;  1PAL A;  2M0R A;  1KK8 C;  5GQQ C;  1CLB A;  4ZCU A;  1GJY A;  2K7B A;  1B8C A;  1XK4 C;  3EK4 A;  3FS7 A;  1Q80 A;  2M97 A;  5CSI A;  5DKQ A;  5I8N A;  2L4I A;  4QJ4 B;  1XO5 A;  2H61 C;  2HET A;  1CLM A;  5I2L A;  1LVC D;  4CFR A;  2M1U A;  1SMG A;  3I5G C;  4OV2 A;  4GBA A;  1CDM A;  3O4Y A;  2ZRS A;  1DTL A;  4M2Q A;  3SG2 A;  2QAC A;  4ETO A;  3SG5 A;  1WLM A;  2FJU B;  4GFT A;  1OMR A;  4PHM A;  3BQ3 A;  2KYC A;  1SW8 A;  4YGA A;  2WND A;  5KU1 A;  1BT6 A;  3O78 A;  5I2O A;  2KDH A;  1NPQ A;  1JBA A;  2ZKM X;  2KQ6 A;  1OZO A;  2BEC A;  4F0Z B;  1PVA A;  5AXI A;  1CB1 A;  1YUU A;  3BYA A;  2L2E A;  4DIR A;  5F6T A;  1DF0 B;  1NCX A;  3PN7 B;  1ZAC A;  3KHE A;  5CSF A;  2EC6 C;  2WCE A;  3EVU A;  3BUM B;  2F2O A;  4HRG A;  2JOJ A;  3SG4 A;  3I5H B;  1B4C A;  2JNF A;  1QS7 A;  3VRQ A;  2PAS A;  2EGD A;  4PE4 A;  1J7O A;  4HRE E;  5DKR A;  2LM5 A;  2LCP A;  1YUS A;  1OOJ A;  1UHJ A;  3LCP C;  2M9G A;  1QIW A;  1MF8 B;  1SYM A;  1MR8 A;  1Y1X A;  1AK8 A;  3I5I C;  1M63 B;  3O6B A;  3VRO A;  2NLN A;  1PK0 D;  1YX7 A;  2JXC A;  1LA0 A;  3CLN A;  5TNC A;  2ZRT A;  2KAX A;  1ALW A;  1MXE A;  2ZND A;  2BKH B;  4IL1 A;  2KOT A;  2IS9 A;  1XFV O;  1LA3 A;  3M0W A;  2Y5I A;  3SIB A;  1EXR A;  4C0L A;  1KSM A;  4NDD A;  1CM4 A;  1UUS A;  4UPG A;  1DGV A;  1LKJ A;  5IBW A;  3E3R A;  1H4B A;  5FYX A;  3VRP A;  4GGF C;  3VRR A;  1YUR A;  4WRI A;  1S3P A;  1J7R A;  1WRK A;  2KQY A;  2LVI A;  1DJW A;  5B8I B;  1ODB A;  2F8P A;  2KBM A;  3KF9 A;  1CNP A;  2MJW B;  3AKA A;  2NZ0 A;  1K8U A;  1MUX A;  1REC A;  2CTN A;  2V53 A;  3NSO A;  4WQ2 A;  1GQM A;  3OB1 B;  1K93 D;  1K95 A;  1X02 A;  1XA5 A;  2CCM A;  4HRH A;  2OS8 C;  2KNE A;  1ZFS A;  5D7F A;  1SL9 A;  1ALV A;  1XVJ A;  2LUC A;  1KQM C;  4PDZ A;  2HF5 A;  4BY5 A;  2LHI A;  2KYF A;  1M39 A;  2MLF C;  2WCF A;  1DJY A;  2NCO A;  1U5I A;  4AQI A;  2OS8 B;  1BF5 A;  1CFF A;  1S26 D;  1ZMZ A;  4TNC A;  1CMG A;  2JT0 A;  4ORA B;  4A4B A;  1IJ5 A;  1WY9 A;  2PSR A;  4PAL A;  2CT9 A;  2G2B A;  3BOW A;  1C7W A;  4PCW A;  4MN0 A;  1FF1 A;  1B8L A;  1PSR A;  3WHT B;  4QJ3 B;  5D69 A;  2SAS A;  2L50 A;  1NCY A;  1SY9 A;  2TN4 A;  1EL4 A;  3GK2 A;  2KFF A;  3EVV A;  1XFW O;  3F45 A;  4CFQ A;  1AP4 A;  1W7I B;  3D10 A;  1JC2 A;  3GOF A;  1L7Z A;  1EJ3 A;  1NCZ A;  4C0K A;  3PAL A;  2Y1N A;  3TUY B;  2JTZ A;  3TDI A;  2MLE C;  1Y1A A;  2M8U A;  2L5X B;  1K96 A;  2ZFD A;  1CFP A;  3VGO A;  1GGZ A;  1K9U A;  1H8B A;  4DRW A;  5HLV A;  1KK8 B;  1B7T Z;  1F71 A;  3CS1 A;  4DS7 A;  5AAN A;  4PE1 A;  3I5F C;  1QAS A;  1WRL A;  1A2X A;  1TRF A;  3EK7 A;  4YI8 A;  1YR5 A;  2KHN A;  3GK1 A;  1NX2 A;  1Y1U A;  2BCB A;  4U8D A;  1N2D A;  1UHK A;  2OTG C;  3TDU A;  5BPJ A;  1TNW A;  1SKT A;  2LAP A;  2M3W A;  3I5G B;  2PRU A;  2K61 A;  2E6W A;  1MXL C;  4PHJ A;  4ZCV A;  4AQJ A;  1KFX S;  4OR9 B;  2OTG B;  3DVM A;  1BG1 A;  1RJV A;  1S36 A;  2M29 A;  1QVI Z;  2NXQ A;  1F54 A;  4MLW A;  1HT9 A;  1RK9 A;  1KK7 Z;  2MRD A;  2JU0 A;  1CDP A;  1A4P A;  1FBV A;  1S5G Z;  1V1G A;  2LNK A;  1DJH A;  3DVE A;  4FQO A;  3FIA A;  4YGB B;  1BU3 A;  1B8R A;  2MAZ A;  1MWN A;  3CR5 X;  1N65 A;  1XFU O;  2QPT A;  2P6B B;  3EK8 A;  4XJK A;  1DT7 B;  1IG5 A;  4ORB B;  5HLO A;  2K2F A;  2BBN A;  1UHN A;  2EC6 B;  2L98 A;  4I5K A;  5HKW A;  1A75 A;  1SCM C;  3C1V A;  2F33 A;  4NDC A;  2I2R E;  2Q4U A;  1TCF A;  4I5N B;  1NX0 A;  1E8A A;  2K2A A;  3OHM B;  2KAY A;  3WHU B;  2GGM A;  2LUX A;  2L4H A;  2K7O A;  2PMY A;  3AKB A;  1YRU B;  2LMU A;  2EHB A;  1JF2 A;  3DD4 A;  1YTZ C;  1YVH A;  1U5I B;  1G4Y R;  1TOP A;  3CR4 X;  1KCY A;  3I5I B;  1J7P A;  1DGU A;  1Y6W A;  3BOW B;  1UHH A;  3DVK A;  1IRJ A;  2ISD A;  1PSB A;  2GGZ A;  2WCB A;  1KFU L;  2GV5 A;  5CSN A;  1K2H A;  2L51 A;  1M46 A;  1IGV A;  2VRG A;  3KPX A;  4I5L B;  1QLK A;  2JC2 A;  1B9A A;  1DVI A;  1CFD A;  1UWO A;  1HQV A;  1EH2 A;  2LMV A;  2LP3 A;  3BUX B;  4WQ3 A;  1SK6 D;  5HKZ A;  4N1F A;  1CFC A;  2Q91 A;  1CKK A;  3CTN A;  2LE9 B;  4DCK A;  4MRX A;  1TNP A;  2LV7 A;  3ZNI A;  4OVN F;  2JWW A;  1TCO B;  1K94 A;  2O60 A;  2JT8 A;  1NUB A;  1QX7 A;  4YI9 A;  3LLE A;  1JFJ A;  1OSA A;  3PLF B;  1J7Q A;  1OMD A;  3EKJ A;  3NSI A;  4OCI A;  2I7A A;  1GGW A;  1JF0 A;  1J55 A;  4E68 A;  1UHI A;  2JT3 A;  5AEQ A;  4YGC B;  1AJ4 A;  1SR6 C;  5I2Q A;  1BR1 B;  3PM8 A;  2JTT A;  5G08 A;  4MZJ A;  3IQQ A;  1SCV A;  1NYA A;  1AHR A;  3WNX B;  5CSJ A;  1KQM B;  1BR4 B;  1NSH A;  4NQG A;  3IF7 A;  2JRF A;  2M1K B;  2LHL A;  1XFX O;  4HSZ A;  1IH0 A;  2LVK A;  5KSZ A;  1J1D A;  1WDC C;  3KO0 A;  1L2O C;  2BE4 A;  1JFK A;  2LP2 A;  2KI4 C;  1AJ5 A;  1S6I A;  3HCM A;  1DJG A;  3LK0 A;  4YGE B;  3SG6 A;  2F2P A;  2WC8 A;  1NWD A;  5AER A;  3FWB A;  1F55 A;  1OQP A;  1YRT B;  4CPV A;  1K9K A;  1S6C A;  1L2O B;  3DF0 A;  1QVI Y;  4C0J A;  4MBE A;  2KI4 B;  2KGR A;  1TTX A;  1XFY O;  2AUC A;  3BUW B;  1IJ6 A;  3NSL A;  1CM1 A;  1KWO C;  4I5J A;  3FWC A;  1QIV A;  1RRO A;  2BCX A;  2OPO A;  5JJG A;  2MBX A;  2I18 A;  2LVJ A;  1DMO A;  2PAL A;  2KFH A;  1KWO B;  1JSA A;  1QXP A;  2BKI B;  3OP0 A;  4XJK B;  4JWQ A;  2D8N A;  3TS5 C;  1KQV A;  1QX5 B;  2MA2 A;  4GNK B;  1NP8 A;  1A75 B;  1SL7 A;  5J3X A;  2LAN A;  1QAT A;  4A4C A;  2Y1M A;  2F3Y A;  1CLL A;  1FPW A;  3TS5 B;  1OMV A;  3EKH A;  1J1E A;  2KFG A;  1F8H A;  4D1E A;  3I5F B;  1C07 A;  5PAL A;  3MSE B;  1TNQ A;  3KEV A;  3O2P A;  1PUL A;  4JPZ B;  2G9B A;  2LMT A;  3LL8 B;  1B47 A;  3AAJ A;  1N0Y A;  3K21 A;  3OX5 A;  1BOD A;  5AFP A;  2O5G A;  4GGN A;  3WXA A;  4P5O E;  2JZI A;  1LIN A;  2M49 B;  3IQO A;  3NSK A;  2A4J A;  4MZL A;  4GUK A;  1WRZ A;  3HX4 A;  4N5X A;  2R2I A;  1Y0V H;  1PVB A;  3SIA A;  4YBH B;  3NXA A;  2FCE A;  2KAV A;  3PSR A;  4MEW A;  5HKY A;  3VRN A;  3GK4 X;  3QRX A;  1RWY A;  1WLZ A;  1R2U A;  1RFJ A;  1SL8 A;  2KBI A;  3A4U B;  3PN7 C;  1F4Q A;  2JPT A;  3OB2 B;  4PHK A;  3AAK A;  4QJ5 B;  1ZOT B;  1EG4 A;  3I5H C;  3ICB A;  3BUN B;  3LK1 A;  2B1U A;  3DVJ A;  5HYD A;  1CMF A;  2SCP A;  1SCM B;  1SNL A;  5ER5 A;  4USL A;  1DJI A;  1NX3 A;  4PE7 A;  1QV0 A;  2K7D A;  3EVR A;  1PRW A;  1B1G A;  1TN4 A;  1M31 A;  2E30 A;  1W7J B;  2F3Z A;  2CXJ A;  1BOC A;  2LC5 A;  1RTP 1;  4MSP A;  2BL0 C;  1NIW A;  3RM1 A;  1UP5 A;  1XK4 A;  1BLQ A;  1FI6 A;  4YGD B;  2KSP A;  3JTD C;  1CTR A;  2JQ6 A;  3D0Y B;  4MRY A;  2H61 A;  4GPL B;  3SG7 A;  1SRA A;  1BJF A;  2BL0 B;  1NX1 A;  1XYD A;  1FW4 A;  2HQ8 A;  1V1F A;  1K90 D;  3JTD B;  4YRU A;  3OX6 A;  5KTY A;  3DF0 B;  1R6P A;  2FOT A;  4DUQ A;  5ER4 X;  4XYN A;  1C7V A;  4GAO A;  1QTX A;  3PAT A;  1QV1 A;  1F70 A;  1LXF C;  2H2K A;  2CBL A;  1IQ5 A;  4M2O A;  1BMO A;  2M7N A;  3SJS A;  3PFV A;  2M7L A;  1DF0 A; 
#chains in the Genus database with same CATH topology
 3R1P A;  2MHH A;  3A8R A;  3CR2 A;  1IKU A;  4MVF A;  3CYZ A;  3TZ1 A;  1G33 A;  1D1O A;  2KGB C;  3JVT C;  1KSO A;  3FE9 A;  1UUR A;  1AVS A;  1AUI B;  1OE9 B;  4BY4 A;  2JUL A;  1B7T Y;  3CGA A;  3S0E A;  1EG3 A;  2ZN9 A;  4FTG A;  1DJX A;  3H4S E;  3SG3 A;  4Q04 A;  2K7C A;  1CDL A;  1JWD A;  2NCP A;  1F4O A;  1MHO A;  3BUO B;  3D78 A;  4PE0 A;  1A03 A;  2COL B;  3JVT B;  4ORC B;  1SR6 B;  3D0Y A;  5DKN A;  2BAP A;  2PVB A;  3TDZ A;  2WOS A;  4CID A;  3BXK A;  1IWQ A;  2L5Y A;  1KFU S;  1YUT A;  3CZT X;  3S0G A;  4MZK A;  2K0J A;  1OZS A;  4M2P A;  2JPO A;  1A29 A;  2LLS A;  1ZUZ A;  1WDC B;  4IJ7 A;  4ICB A;  4PHN A;  1IQ3 A;  1S1E A;  4P2Y B;  5JOL A;  2LLT A;  2DOQ A;  2JXL A;  2AAO A;  3CZ1 A;  1KK7 Y;  1M45 A;  4NDB A;  4OKH A;  2ZN8 A;  1YX8 A;  1TNX A;  2HPS A;  3RLZ A;  2RGI A;  1S5G Y;  2KI6 C;  2Y4Q A;  3CWG A;  4AOM A;  5CPV A;  2K8M B;  2KI6 D;  1MQ1 A;  1K9P A;  1KFX L;  2BBM A;  2CNP A;  2LLU A;  1QJT A;  4R1E A;  1FI5 A;  5K89 A;  1JUO A;  2BE6 A;  2I94 A;  1OOH A;  2LVV A;  3ZWH A;  1G8I A;  2BCA A;  1TIZ A;  1S6J A;  2L0P A;  4CLN A;  1QLS A;  4N1G A;  4JQ0 D;  1SPY A;  3TUY C;  3B88 A;  1SBJ A;  1DJZ A;  2WC6 A;  2AMI A;  4L9M A;  1CDN A;  1XFZ O;  2FCD A;  4GGF A;  2JNX A;  1YVL A;  1QX2 A;  2HQW A;  2ZNE A;  1VRK A;  2WOR A;  1PAL A;  2M0R A;  1KK8 C;  3OBV A;  5GQQ C;  4ZCU A;  1GJY A;  2K7B A;  5DIC A;  1CLB A;  1B8C A;  1XK4 C;  3EK4 A;  3FS7 A;  1Q80 A;  2M97 A;  5CSI A;  5DKQ A;  3D77 A;  5I8N A;  2L4I A;  4QJ4 B;  1XO5 A;  2H61 C;  2HET A;  1CLM A;  5I2L A;  1LVC D;  4CFR A;  2M1U A;  1SMG A;  3I5G C;  3NHI A;  4GBA A;  4OV2 A;  1CDM A;  3O4Y A;  2ZRS A;  1DTL A;  4M2Q A;  3SG2 A;  2QAC A;  3DY9 A;  4ETO A;  1OOI X;  3BFB A;  3QME A;  3SG5 A;  3D73 A;  1WLM A;  2FJU B;  4GFT A;  1OMR A;  4PHM A;  5FI7 A;  3BQ3 A;  3B7A A;  2KYC A;  1SW8 A;  4YGA A;  2WND A;  5KU1 A;  1BT6 A;  3O78 A;  5I2O A;  2KDH A;  1NPQ A;  1JBA A;  2ZKM X;  2KQ6 A;  1OZO A;  2BEC A;  4F0Z B;  3FE6 A;  1PVA A;  3VB1 A;  5AXI A;  1CB1 A;  3CAB A;  4OZD A;  1YUU A;  3BYA A;  2L2E A;  4DIR A;  1DEK A;  5F6T A;  1DF0 B;  1NCX A;  3PN7 B;  1ZAC A;  3KHE A;  5CSF A;  3IVT A;  2EC6 C;  2WCE A;  3EVU A;  3BUM B;  2F2O A;  4HRG A;  2JOJ A;  3SG4 A;  3I5H B;  1B4C A;  2JNF A;  1QS7 A;  3VRQ A;  2PAS A;  1SSE B;  2EGD A;  4PE4 A;  1J7O A;  4HRE E;  3O4X A;  1C3Z A;  2LM5 A;  4FQT A;  2LCP A;  3PJI A;  5DKR A;  1YUS A;  1OOJ A;  1UHJ A;  2QEO A;  3LCP C;  2M9G A;  1QIW A;  3DYE A;  1MF8 B;  1DEL A;  1SYM A;  3L47 A;  1MR8 A;  1Y1X A;  1AK8 A;  3I5I C;  1M63 B;  3O6B A;  3SS5 A;  3V2L A;  3VRO A;  2NLN A;  1PK0 D;  1YX7 A;  2JXC A;  1LA0 A;  3CLN A;  5TNC A;  1QWV A;  2ZRT A;  2KAX A;  1ALW A;  1MXE A;  2ZND A;  5HL1 A;  2BKH B;  4IL1 A;  2KOT A;  2IS9 A;  1XFV O;  1LA3 A;  3M0W A;  2Y5I A;  3SIB A;  1EXR A;  3L4A A;  4C0L A;  1KSM A;  4NDD A;  1CM4 A;  1UUS A;  4UPG A;  1DGV A;  1LKJ A;  5IBW A;  3E3R A;  1H4B A;  5FYX A;  3VRP A;  4GGF C;  3VRR A;  1YUR A;  4WRI A;  1S3P A;  1J7R A;  1WRK A;  2H8V A;  2KQY A;  2LVI A;  1DJW A;  2WCH A;  1ODB A;  5B8I B;  2F8P A;  2KBM A;  3BFA A;  3DZT A;  3KF9 A;  1CNP A;  2MJW B;  3AKA A;  2NZ0 A;  1K8U A;  1MUX A;  1REC A;  2CTN A;  2V53 A;  3NSO A;  4WQ2 A;  5FI6 A;  1GQM A;  3OB1 B;  1K93 D;  1K95 A;  1X02 A;  1XA5 A;  2CCM A;  4HRH A;  2L2C A;  2OS8 C;  2WCL A;  2KNE A;  1ORG A;  1ZFS A;  5D7F A;  1SL9 A;  1ALV A;  1XVJ A;  2LUC A;  3B6X A;  1KQM C;  2QEB A;  2HF5 A;  4PDZ A;  4BY5 A;  2LHI A;  2KYF A;  1M39 A;  2MLF C;  2WCF A;  1DJY A;  2KLD A;  2NCO A;  1U5I A;  4AQI A;  2PYQ A;  2OS8 B;  1BF5 A;  1CFF A;  1S26 D;  1ZMZ A;  4TNC A;  1CMG A;  2JT0 A;  4ORA B;  4A4B A;  1IJ5 A;  1WY9 A;  2PSR A;  4PAL A;  2CT9 A;  2G2B A;  3BOW A;  1C7W A;  3N7H A;  4PCW A;  4MN0 A;  1FF1 A;  1B8L A;  1PSR A;  3WHT B;  4QJ3 B;  1OW4 A;  2SAS A;  5D69 A;  1LS8 A;  2GTE A;  2L50 A;  1NCY A;  1SY9 A;  2TN4 A;  1EL4 A;  3GK2 A;  2KFF A;  3EVV A;  1XFW O;  3F45 A;  4CFQ A;  1AP4 A;  3S0A A;  3S0F A;  1W7I B;  3D10 A;  1JC2 A;  3GOF A;  3UNW A;  1L7Z A;  1EJ3 A;  1NCZ A;  1TUJ A;  3BJH A;  4C0K A;  3PAL A;  2Y1N A;  3TUY B;  4F7F A;  2JTZ A;  3TDI A;  2MLE C;  1Y1A A;  2M8U A;  2WCK A;  2L5X B;  3CZ0 A;  1K96 A;  2ZFD A;  2K60 A;  1CFP A;  3VGO A;  1GGZ A;  1K9U A;  1H8B A;  3NGV A;  1OOF A;  4DRW A;  5HLV A;  1KK8 B;  1B7T Z;  1F71 A;  3CS1 A;  4DS7 A;  5AAN A;  4PE1 A;  3I5F C;  1QAS A;  1WRL A;  1A2X A;  1TRF A;  3EK7 A;  4YI8 A;  1YR5 A;  2KHN A;  3GK1 A;  1NX2 A;  3R1V A;  1Y1U A;  2BCB A;  4U8D A;  1N2D A;  1UHK A;  2OTG C;  3TDU A;  5BPJ A;  1TNW A;  1SKT A;  2LAP A;  2M3W A;  3I5G B;  2PRU A;  2K61 A;  3FE8 A;  2E6W A;  2P70 A;  3DXL A;  1MXL C;  4PHJ A;  4ZCV A;  4AQJ A;  1KFX S;  3S0B A;  4OR9 B;  2OTG B;  3DVM A;  4INX A;  1BG1 A;  1RJV A;  1S36 A;  1XFR A;  2M29 A;  1QVI Z;  2NXQ A;  1F54 A;  4MLW A;  3S0D A;  1HT9 A;  1RK9 A;  1KK7 Z;  2MRD A;  2JU0 A;  1CDP A;  1A4P A;  1FBV A;  1S5G Z;  1V1G A;  2LNK A;  1DJH A;  3DVE A;  4FQO A;  3FIA A;  3D74 A;  4YGB B;  1BU3 A;  1B8R A;  1TUZ A;  2MAZ A;  4JD9 A;  1MWN A;  3CR5 X;  1N65 A;  1XFU O;  2QPT A;  2P6B B;  3EK8 A;  4XJK A;  1DT7 B;  1IG5 A;  2KLE A;  4ORB B;  2K2F A;  5HLO A;  2BBN A;  1UHN A;  2EC6 B;  2L98 A;  4I5K A;  5HKW A;  2ERB A;  1GM0 A;  1A75 A;  1SCM C;  5EL2 A;  3C1V A;  2F33 A;  4NDC A;  2I2R E;  2Q4U A;  1TCF A;  3CDN A;  4I5N B;  1NX0 A;  1E8A A;  2K2A A;  3K1E A;  1W9Z A;  3OHM B;  1C3Y A;  2KAY A;  2WCJ A;  3WHU B;  2GGM A;  2LUX A;  2L4H A;  2K7O A;  2PMY A;  2QEV A;  3AKB A;  1YRU B;  2LMU A;  2EHB A;  1JF2 A;  3R72 A;  3DD4 A;  1YTZ C;  1YVH A;  1U5I B;  4INW A;  1G4Y R;  1TOP A;  3CR4 X;  1KCY A;  3I5I B;  3D75 A;  1J7P A;  1DGU A;  1Y6W A;  3BOW B;  1UHH A;  2P71 A;  3DVK A;  1IRJ A;  2ISD A;  1PSB A;  2GGZ A;  2WCB A;  1KFU L;  2GV5 A;  5CSN A;  1K2H A;  2L51 A;  1M46 A;  1IGV A;  2VRG A;  3KPX A;  2YGU A;  4I5L B;  1QLK A;  2JC2 A;  1B9A A;  1DVI A;  4KYN A;  1CFD A;  1UWO A;  1HQV A;  1EH2 A;  2LMV A;  2LP3 A;  3BUX B;  4WQ3 A;  1T14 A;  1SK6 D;  5HKZ A;  4N1F A;  1CFC A;  2Q91 A;  1CKK A;  3CTN A;  2LE9 B;  4DCK A;  4MRX A;  1TNP A;  2LV7 A;  3ZNI A;  4OVN F;  2JWW A;  1TCO B;  1K94 A;  1Z4H A;  2JT8 A;  2O60 A;  1NUB A;  1QX7 A;  3B87 A;  4YI9 A;  3LLE A;  1JFJ A;  1OSA A;  3PLF B;  1J7Q A;  1OMD A;  3EKJ A;  3NSI A;  4OCI A;  2I7A A;  1GGW A;  1JF0 A;  1J55 A;  4E68 A;  1UHI A;  2JT3 A;  2QDI A;  5AEQ A;  4YGC B;  1AJ4 A;  1SR6 C;  5I2Q A;  1BR1 B;  2WC5 A;  3PM8 A;  2JTT A;  5G08 A;  4MZJ A;  3IQQ A;  1SCV A;  1NYA A;  1AHR A;  3WNX B;  5CSJ A;  1KQM B;  1BR4 B;  1NSH A;  4NQG A;  3IF7 A;  2JRF A;  2M1K B;  2LHL A;  1XFX O;  4HSZ A;  1TWO A;  1IH0 A;  2QEH A;  2LVK A;  5KSZ A;  1J1D A;  1WDC C;  3KO0 A;  1L2O C;  2BE4 A;  1JFK A;  2LP2 A;  2KI4 C;  1AJ5 A;  1S6I A;  3HCM A;  1DJG A;  3LK0 A;  4YGE B;  3SG6 A;  2F2P A;  2WC8 A;  1NWD A;  5AER A;  3FWB A;  1F55 A;  1OQP A;  1YRT B;  4CPV A;  1K9K A;  1S6C A;  1L2O B;  3DF0 A;  1QVI Y;  4C0J A;  4MBE A;  2KI4 B;  2KGR A;  1TTX A;  1XFY O;  2AUC A;  3BUW B;  4PT1 A;  1IJ6 A;  3NSL A;  1CM1 A;  1KWO C;  4I5J A;  3FWC A;  1QIV A;  1RRO A;  2BCX A;  2OPO A;  5JJG A;  2PQL A;  2MBX A;  3EG5 B;  3BFH A;  1DC1 A;  2I18 A;  2LVJ A;  1DMO A;  2PAL A;  2KFH A;  1KWO B;  1JSA A;  1QXP A;  2BKI B;  3OP0 A;  4XJK B;  4JWQ A;  2D8N A;  3TS5 C;  1KQV A;  1QX5 B;  2MA2 A;  4GNK B;  1NP8 A;  1A75 B;  1SL7 A;  5J3X A;  2LAN A;  1QAT A;  4A4C A;  3R1O A;  2Y1M A;  2F3Y A;  1CLL A;  1FPW A;  3TS5 B;  1OMV A;  3EKH A;  1J1E A;  2KFG A;  1F8H A;  4D1E A;  3I5F B;  1C07 A;  5PAL A;  3SS3 A;  3MSE B;  5FI2 A;  1TNQ A;  3KEV A;  3O2P A;  1PUL A;  4JPZ B;  2G9B A;  2LMT A;  3LL8 B;  3Q8I A;  1B47 A;  2KPH A;  3AAJ A;  3L4L A;  1N0Y A;  5D3O A;  1IIO A;  3K21 A;  3OX5 A;  1BOD A;  5AFP A;  2O5G A;  4JKT A;  4GGN A;  3WXA A;  4P5O E;  2JZI A;  1LIN A;  2M49 B;  3IQO A;  3NSK A;  2A4J A;  4MZL A;  4GUK A;  1WRZ A;  3HX4 A;  4N5X A;  5I94 A;  2R2I A;  1Y0V H;  1PVB A;  3SIA A;  4YBH B;  3NXA A;  2FCE A;  2KAV A;  3PSR A;  4MEW A;  5HKY A;  3VRN A;  3GK4 X;  3QRX A;  1RWY A;  1Z2C B;  1WLZ A;  1R2U A;  1RFJ A;  1SL8 A;  1DQE A;  2WCM A;  3PM2 A;  2KBI A;  3A4U B;  3PN7 C;  1F4Q A;  2JPT A;  3OB2 B;  4PHK A;  3AAK A;  3UO9 A;  4QJ5 B;  1ZOT B;  1EG4 A;  3I5H C;  3ICB A;  3BUN B;  3LK1 A;  2B1U A;  3DVJ A;  5HYD A;  1CMF A;  2SCP A;  1SCM B;  1SNL A;  5ER5 A;  4USL A;  1DJI A;  1NX3 A;  4PE7 A;  1QV0 A;  2K7D A;  3EVR A;  1PRW A;  1B1G A;  1TN4 A;  1M31 A;  2E30 A;  1W7J B;  2F3Z A;  2CXJ A;  1BOC A;  2LC5 A;  1RTP 1;  2FJY A;  4MSP A;  2BL0 C;  1NIW A;  3RM1 A;  1UP5 A;  1XK4 A;  3CZ2 A;  1BLQ A;  3NHT A;  1FI6 A;  4YGD B;  2KSP A;  3SS4 A;  3JTD C;  1CTR A;  2JQ6 A;  3B86 A;  3D0Y B;  4MRY A;  1OOG A;  2H61 A;  4GPL B;  3SG7 A;  1SRA A;  1BJF A;  3D76 A;  2BL0 B;  1NX1 A;  1XYD A;  1FW4 A;  2HQ8 A;  1V1F A;  1K90 D;  3JTD B;  4YRU A;  3OX6 A;  5KTY A;  3DF0 B;  2BNX A;  1R6P A;  2FOT A;  4DUQ A;  5ER4 X;  4XYN A;  1C7V A;  4GAO A;  1QTX A;  3PAT A;  1QV1 A;  1F70 A;  1LXF C;  2H2K A;  2CBL A;  1IQ5 A;  4M2O A;  1BMO A;  2M7N A;  3OGN A;  3SJS A;  3PFV A;  3RZS A;  2M7L A;  1P28 A;  1DF0 A; 
#chains in the Genus database with same CATH homology
 2MHH A;  3A8R A;  3CR2 A;  1IKU A;  4MVF A;  3TZ1 A;  1G33 A;  1D1O A;  2KGB C;  3JVT C;  1KSO A;  1UUR A;  1AVS A;  1AUI B;  1OE9 B;  4BY4 A;  2JUL A;  1B7T Y;  3CGA A;  1EG3 A;  2ZN9 A;  4FTG A;  1DJX A;  3H4S E;  3SG3 A;  4Q04 A;  2K7C A;  1CDL A;  1JWD A;  2NCP A;  1F4O A;  1MHO A;  3BUO B;  4PE0 A;  1A03 A;  2COL B;  3JVT B;  4ORC B;  1SR6 B;  3D0Y A;  5DKN A;  2PVB A;  3TDZ A;  2WOS A;  4CID A;  3BXK A;  1IWQ A;  1KFU S;  1YUT A;  3CZT X;  4MZK A;  2K0J A;  1OZS A;  4M2P A;  1A29 A;  2LLS A;  1ZUZ A;  1WDC B;  4PHN A;  4ICB A;  1IQ3 A;  1S1E A;  4P2Y B;  5JOL A;  2LLT A;  2DOQ A;  2JXL A;  2AAO A;  1KK7 Y;  1M45 A;  4NDB A;  4OKH A;  2ZN8 A;  1YX8 A;  1TNX A;  2HPS A;  3RLZ A;  2RGI A;  1S5G Y;  2KI6 C;  2Y4Q A;  3CWG A;  4AOM A;  5CPV A;  2K8M B;  2KI6 D;  1MQ1 A;  1K9P A;  1KFX L;  2BBM A;  2CNP A;  2LLU A;  1QJT A;  4R1E A;  1FI5 A;  5K89 A;  1JUO A;  2BE6 A;  2I94 A;  3ZWH A;  2LVV A;  1G8I A;  2BCA A;  1TIZ A;  1S6J A;  2L0P A;  4CLN A;  1QLS A;  4N1G A;  4JQ0 D;  1SPY A;  3TUY C;  1SBJ A;  1DJZ A;  2AMI A;  4L9M A;  1CDN A;  1XFZ O;  2FCD A;  4GGF A;  2JNX A;  1YVL A;  1QX2 A;  2HQW A;  2ZNE A;  1VRK A;  2WOR A;  1PAL A;  2M0R A;  1KK8 C;  5GQQ C;  1CLB A;  4ZCU A;  1GJY A;  2K7B A;  1B8C A;  1XK4 C;  3EK4 A;  3FS7 A;  1Q80 A;  2M97 A;  5CSI A;  5DKQ A;  5I8N A;  2L4I A;  4QJ4 B;  1XO5 A;  2H61 C;  2HET A;  1CLM A;  5I2L A;  1LVC D;  4CFR A;  2M1U A;  1SMG A;  3I5G C;  4OV2 A;  4GBA A;  1CDM A;  3O4Y A;  2ZRS A;  1DTL A;  4M2Q A;  3SG2 A;  2QAC A;  4ETO A;  3SG5 A;  1WLM A;  2FJU B;  4GFT A;  1OMR A;  4PHM A;  3BQ3 A;  2KYC A;  1SW8 A;  4YGA A;  2WND A;  5KU1 A;  1BT6 A;  3O78 A;  5I2O A;  2KDH A;  1NPQ A;  1JBA A;  2ZKM X;  2KQ6 A;  1OZO A;  2BEC A;  4F0Z B;  1PVA A;  5AXI A;  1CB1 A;  1YUU A;  3BYA A;  2L2E A;  4DIR A;  5F6T A;  1DF0 B;  1NCX A;  3PN7 B;  1ZAC A;  3KHE A;  5CSF A;  2EC6 C;  2WCE A;  3EVU A;  3BUM B;  2F2O A;  4HRG A;  2JOJ A;  3SG4 A;  3I5H B;  1B4C A;  2JNF A;  1QS7 A;  3VRQ A;  2PAS A;  2EGD A;  4PE4 A;  1J7O A;  4HRE E;  5DKR A;  2LM5 A;  2LCP A;  1YUS A;  1OOJ A;  1UHJ A;  3LCP C;  2M9G A;  1QIW A;  1MF8 B;  1SYM A;  1MR8 A;  1Y1X A;  1AK8 A;  3I5I C;  1M63 B;  3O6B A;  3VRO A;  2NLN A;  1PK0 D;  1YX7 A;  2JXC A;  1LA0 A;  3CLN A;  5TNC A;  2ZRT A;  2KAX A;  1ALW A;  1MXE A;  2ZND A;  2BKH B;  4IL1 A;  2KOT A;  2IS9 A;  1XFV O;  1LA3 A;  3M0W A;  2Y5I A;  3SIB A;  1EXR A;  4C0L A;  1KSM A;  4NDD A;  1CM4 A;  1UUS A;  4UPG A;  1DGV A;  1LKJ A;  5IBW A;  3E3R A;  1H4B A;  5FYX A;  3VRP A;  4GGF C;  3VRR A;  1YUR A;  4WRI A;  1S3P A;  1J7R A;  1WRK A;  2KQY A;  2LVI A;  1DJW A;  5B8I B;  1ODB A;  2F8P A;  2KBM A;  3KF9 A;  1CNP A;  2MJW B;  3AKA A;  2NZ0 A;  1K8U A;  1MUX A;  1REC A;  2CTN A;  2V53 A;  3NSO A;  4WQ2 A;  1GQM A;  3OB1 B;  1K93 D;  1K95 A;  1X02 A;  1XA5 A;  2CCM A;  4HRH A;  2OS8 C;  2KNE A;  1ZFS A;  5D7F A;  1SL9 A;  1ALV A;  1XVJ A;  2LUC A;  1KQM C;  4PDZ A;  2HF5 A;  4BY5 A;  2LHI A;  2KYF A;  1M39 A;  2MLF C;  2WCF A;  1DJY A;  2NCO A;  1U5I A;  4AQI A;  2OS8 B;  1BF5 A;  1CFF A;  1S26 D;  1ZMZ A;  4TNC A;  1CMG A;  2JT0 A;  4ORA B;  4A4B A;  1IJ5 A;  1WY9 A;  2PSR A;  4PAL A;  2CT9 A;  2G2B A;  3BOW A;  1C7W A;  4PCW A;  4MN0 A;  1FF1 A;  1B8L A;  1PSR A;  3WHT B;  4QJ3 B;  5D69 A;  2SAS A;  2L50 A;  1NCY A;  1SY9 A;  2TN4 A;  1EL4 A;  3GK2 A;  2KFF A;  3EVV A;  1XFW O;  3F45 A;  4CFQ A;  1AP4 A;  1W7I B;  3D10 A;  1JC2 A;  3GOF A;  1L7Z A;  1EJ3 A;  1NCZ A;  4C0K A;  3PAL A;  2Y1N A;  3TUY B;  2JTZ A;  3TDI A;  2MLE C;  1Y1A A;  2M8U A;  2L5X B;  1K96 A;  2ZFD A;  1CFP A;  3VGO A;  1GGZ A;  1K9U A;  1H8B A;  4DRW A;  5HLV A;  1KK8 B;  1B7T Z;  1F71 A;  3CS1 A;  4DS7 A;  5AAN A;  4PE1 A;  3I5F C;  1QAS A;  1WRL A;  1A2X A;  1TRF A;  3EK7 A;  4YI8 A;  1YR5 A;  2KHN A;  3GK1 A;  1NX2 A;  1Y1U A;  2BCB A;  4U8D A;  1N2D A;  1UHK A;  2OTG C;  3TDU A;  5BPJ A;  1TNW A;  1SKT A;  2LAP A;  2M3W A;  3I5G B;  2PRU A;  2K61 A;  2E6W A;  1MXL C;  4PHJ A;  4ZCV A;  4AQJ A;  1KFX S;  4OR9 B;  2OTG B;  3DVM A;  1BG1 A;  1RJV A;  1S36 A;  2M29 A;  1QVI Z;  2NXQ A;  1F54 A;  4MLW A;  1HT9 A;  1RK9 A;  1KK7 Z;  2MRD A;  2JU0 A;  1CDP A;  1A4P A;  1FBV A;  1S5G Z;  1V1G A;  2LNK A;  1DJH A;  3DVE A;  4FQO A;  3FIA A;  4YGB B;  1BU3 A;  1B8R A;  2MAZ A;  1MWN A;  3CR5 X;  1N65 A;  1XFU O;  2QPT A;  2P6B B;  3EK8 A;  4XJK A;  1DT7 B;  1IG5 A;  4ORB B;  5HLO A;  2K2F A;  2BBN A;  1UHN A;  2EC6 B;  2L98 A;  4I5K A;  5HKW A;  1A75 A;  1SCM C;  3C1V A;  2F33 A;  4NDC A;  2I2R E;  2Q4U A;  1TCF A;  4I5N B;  1NX0 A;  1E8A A;  2K2A A;  3OHM B;  2KAY A;  3WHU B;  2GGM A;  2LUX A;  2L4H A;  2K7O A;  2PMY A;  3AKB A;  1YRU B;  2LMU A;  2EHB A;  1JF2 A;  3DD4 A;  1YTZ C;  1YVH A;  1U5I B;  1G4Y R;  1TOP A;  3CR4 X;  1KCY A;  3I5I B;  1J7P A;  1DGU A;  1Y6W A;  3BOW B;  1UHH A;  3DVK A;  1IRJ A;  2ISD A;  1PSB A;  2GGZ A;  2WCB A;  1KFU L;  2GV5 A;  5CSN A;  1K2H A;  2L51 A;  1M46 A;  1IGV A;  2VRG A;  3KPX A;  4I5L B;  1QLK A;  2JC2 A;  1B9A A;  1DVI A;  1CFD A;  1UWO A;  1HQV A;  1EH2 A;  2LMV A;  2LP3 A;  3BUX B;  4WQ3 A;  1SK6 D;  5HKZ A;  4N1F A;  1CFC A;  2Q91 A;  1CKK A;  3CTN A;  2LE9 B;  4DCK A;  4MRX A;  1TNP A;  2LV7 A;  3ZNI A;  4OVN F;  2JWW A;  1TCO B;  1K94 A;  2O60 A;  2JT8 A;  1NUB A;  1QX7 A;  4YI9 A;  3LLE A;  1JFJ A;  1OSA A;  3PLF B;  1J7Q A;  1OMD A;  3EKJ A;  3NSI A;  4OCI A;  2I7A A;  1GGW A;  1JF0 A;  1J55 A;  4E68 A;  1UHI A;  2JT3 A;  5AEQ A;  4YGC B;  1AJ4 A;  1SR6 C;  5I2Q A;  1BR1 B;  3PM8 A;  2JTT A;  5G08 A;  4MZJ A;  3IQQ A;  1SCV A;  1NYA A;  1AHR A;  3WNX B;  5CSJ A;  1KQM B;  1BR4 B;  1NSH A;  4NQG A;  3IF7 A;  2JRF A;  2M1K B;  2LHL A;  1XFX O;  4HSZ A;  1IH0 A;  2LVK A;  5KSZ A;  1J1D A;  1WDC C;  3KO0 A;  1L2O C;  2BE4 A;  1JFK A;  2LP2 A;  2KI4 C;  1AJ5 A;  1S6I A;  3HCM A;  1DJG A;  3LK0 A;  4YGE B;  3SG6 A;  2F2P A;  2WC8 A;  1NWD A;  5AER A;  3FWB A;  1F55 A;  1OQP A;  1YRT B;  4CPV A;  1K9K A;  1S6C A;  1L2O B;  3DF0 A;  1QVI Y;  4C0J A;  4MBE A;  2KI4 B;  2KGR A;  1TTX A;  1XFY O;  2AUC A;  3BUW B;  1IJ6 A;  3NSL A;  1CM1 A;  1KWO C;  4I5J A;  3FWC A;  1QIV A;  1RRO A;  2BCX A;  2OPO A;  5JJG A;  2MBX A;  2I18 A;  2LVJ A;  1DMO A;  2PAL A;  2KFH A;  1KWO B;  1JSA A;  1QXP A;  2BKI B;  3OP0 A;  4XJK B;  4JWQ A;  2D8N A;  3TS5 C;  1KQV A;  1QX5 B;  2MA2 A;  4GNK B;  1NP8 A;  1A75 B;  1SL7 A;  5J3X A;  2LAN A;  1QAT A;  4A4C A;  2Y1M A;  2F3Y A;  1CLL A;  1FPW A;  3TS5 B;  1OMV A;  3EKH A;  1J1E A;  2KFG A;  1F8H A;  4D1E A;  3I5F B;  1C07 A;  5PAL A;  3MSE B;  1TNQ A;  3KEV A;  3O2P A;  1PUL A;  4JPZ B;  2G9B A;  2LMT A;  3LL8 B;  1B47 A;  3AAJ A;  1N0Y A;  3K21 A;  3OX5 A;  1BOD A;  5AFP A;  2O5G A;  4GGN A;  3WXA A;  4P5O E;  2JZI A;  1LIN A;  2M49 B;  3IQO A;  3NSK A;  2A4J A;  4MZL A;  4GUK A;  1WRZ A;  3HX4 A;  4N5X A;  2R2I A;  1Y0V H;  1PVB A;  3SIA A;  4YBH B;  3NXA A;  2FCE A;  2KAV A;  3PSR A;  4MEW A;  5HKY A;  3VRN A;  3GK4 X;  3QRX A;  1RWY A;  1WLZ A;  1R2U A;  1RFJ A;  1SL8 A;  2KBI A;  3A4U B;  3PN7 C;  1F4Q A;  2JPT A;  3OB2 B;  4PHK A;  3AAK A;  4QJ5 B;  1ZOT B;  1EG4 A;  3I5H C;  3ICB A;  3BUN B;  3LK1 A;  2B1U A;  3DVJ A;  5HYD A;  1CMF A;  2SCP A;  1SCM B;  1SNL A;  5ER5 A;  4USL A;  1DJI A;  1NX3 A;  4PE7 A;  1QV0 A;  2K7D A;  3EVR A;  1PRW A;  1B1G A;  1TN4 A;  1M31 A;  2E30 A;  1W7J B;  2F3Z A;  2CXJ A;  1BOC A;  2LC5 A;  1RTP 1;  4MSP A;  2BL0 C;  1NIW A;  3RM1 A;  1UP5 A;  1XK4 A;  1BLQ A;  1FI6 A;  4YGD B;  2KSP A;  3JTD C;  1CTR A;  2JQ6 A;  3D0Y B;  4MRY A;  2H61 A;  4GPL B;  3SG7 A;  1SRA A;  1BJF A;  2BL0 B;  1NX1 A;  1XYD A;  1FW4 A;  2HQ8 A;  1V1F A;  1K90 D;  3JTD B;  4YRU A;  3OX6 A;  5KTY A;  3DF0 B;  1R6P A;  2FOT A;  4DUQ A;  5ER4 X;  4XYN A;  1C7V A;  4GAO A;  1QTX A;  3PAT A;  1QV1 A;  1F70 A;  1LXF C;  2H2K A;  2CBL A;  1IQ5 A;  4M2O A;  1BMO A;  2M7N A;  3SJS A;  3PFV A;  2M7L A;  1DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...