1NYAA

Nmr solution structure of calerythrin, an ef-hand calcium-binding protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
176
Chain Sequence
TTAIASDRLKKRFDRWDFDGNGALERADFEKEAQHIAEAFGKDAGAAEVQTLKNAFGGLFDYLAKEAGVGSDGSLTEEQFIRVTENLIFEQGEASFNRVLGPVVKGIVGMCDKNADGQINADEFAAWLTALGMSKAEAAEAFNQVDTNGNGELSLDELLTAVRDFHFGRLDVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of calerythrin, an EF-hand calcium-binding protein from Saccharopolyspora erythraea
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Metal binding protein
molecule keywords Calerythrin
total genus 46
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nyaA00
4NQGA 4HRGA 1DJHA 1XFZO 2LM5A 1QASA 1S5GY 1QVIY 1XFXO 1F4OA 2HPSA 2EC6C 4IL1A 2LCPA 2LV7A 2EGDA 1NIWA 3PALA 3TS5B 4N5XA 1MHOA 3VRPA 1J1EA 1IG5A 2LVJA 1ZOTB 3O4YA 2JWWA 3AAJA 1S6CA 1F4QA 4OKHA 4PHMA 5F6TA 1YR5A 5HKWA 1KWOB 1EL4A 1BU3A 2MJWB 4PHKA 1SPYA 1MXLC 2Q4UA 1DJYA 1A75B 3KF9A 2COLB 3I5IC 2KOTA 1OZOA 4DS7A 1S5GZ 2F33A 1LVCD 5FYXA 4WRIA 1KFUS 2BCAA 1KQMC 1NCXA 2KFFA 3CR4X 4M2PA 1TCFA 1EXRA 1QLKA 1LINA 3KO0A 4N1FA 1OMRA 1PK0D 1KCYA 2K0JA 1R2UA 1XK4C 2AMIA 1OQPA 4YGAA 1NCZA 1NCYA 4C0LA 1RFJA 2Y4QA 1QIVA 4FTGA 2JXCA 1YRTB 5ER5A 1CLBA 1MF8B 1K9KA 4E68A 4PDZA 1CDLA 1SCMB 4GPLB 2D8NA 2QACA 4AQJA 2KAXA 4OVNF 3BYAA 2CXJA 3I5FB 4OCIA 4I5NB 1CFCA 1HT9A 2JT8A 3A4UB 2LLSA 1F71A 3PLFB 3RLZA 3OB1B 2ZFDA 4U8DA 1BF5A 1H8BA 3LL8B 5KSZA 1CMFA 1XK4A 1JF0A 1FPWA 2JNXA 1S3PA 2ISDA 3TUYC 2WCBA 3OX6A 4NDDA 1UP5A 2K7DA 2KGBC 2Q91A 3BUNB 1GQMA 1YUSA 2MHHA 4N1GA 5KTYA 1CDNA 1K90D 5HKZA 3DVEA 1BMOA 1YX7A 1D1OA 1K8UA 1KSMA 1K94A 1WRLA 1SCMC 3PM8A 2BCBA 4TNCA 1LXFC 4OV2A 1RROA 5D7FA 5TNCA 3DVKA 1RJVA 5IBWA 1CLMA 4XJKB 2LVKA 2BL0C 2JQ6A 1S6IA 3TS5C 1CB1A 3PN7B 3DF0B 2EHBA 4GUKA 2KQYA 1B1GA 2BL0B 1B4CA 2OTGC 1B7TZ 4MZLA 2CTNA 1OMVA 1MWNA 5AFPA 4HRHA 2KDHA 4MZJA 4PHNA 1U5IA 2M0RA 4PE0A 4YRUA 2MLEC 1SBJA 3EVRA 1OE9B 1J1DA 4ORBB 3O78A 1CDPA 4ORCB 3TDUA 1QVIZ 3VRQA 5KU1A 1WRZA 1ALWA 3EK8A 1TTXA 3BOWA 2MAZA 3DF0A 1KK7Y 1QJTA 3EVVA 4F0ZB 2K7CA 4CPVA 4MRYA 1MQ1A 4ZCUA 4QJ3B 4C0JA 4BY4A 1EG3A 4MLWA 1EH2A 1NP8A 1F8HA 5HYDA 1DVIA 1QIWA 1BR1B 1UUSA 1GGZA 3SG4A 2I7AA 2BBMA 2M7LA 1AHRA 2BCXA 1Q80A 3VROA 1CNPA 1K9PA 2BKHB 5PALA 4GBAA 1CKKA 2RGIA 3KEVA 2PRUA 5AXIA 2IS9A 1G4YR 2WORA 3SJSA 1KFUL 2CT9A 3HCMA 3WHUB 1AK8A 1BLQA 2ZN8A 3VRNA 2KFHA 1PSRA 2KAYA 2O5GA 2FOTA 1QTXA 3DD4A 1M46A 3I5GC 1XFYO 1VRKA 4YI8A 2BBNA 1AJ4A 1F54A 1J7OA 1DJGA 1QX2A 2AAOA 1YX8A 2F8PA 1ODBA 2BE4A 1HQVA 1M31A 2CBLA 3SIBA 1ZUZA 2JZIA 2LE9B 1K9UA 3SG6A 3AKAA 2FJUB 1L2OB 1Y1XA 1SNLA 2M97A 2F2OA 4A4BA 2JRFA 1FI6A 1TNWA 1AVSA 1KK8B 5ER4X 1Y1UA 1C07A 5JJGA 5GQQC 1UHHA 3IF7A 1SK6D 1K96A 3I5FC 3KPXA 2L2EA 3O6BA 1Y1AA 3LK0A 4PALA 2LVIA 1DJZA 1YRUB 2L4HA 3EKHA 1UWOA 2JT3A 4GGFA 1CM4A 1QLSA 4NDCA 4PHJA 1BG1A 3MSEB 2K7OA 1SL8A 3QRXA 4CIDA 1DJXA 3CGAA 4MZKA 3PN7C 3M0WA 1AJ5A 2GGMA 3E3RA 2LC5A 3TDZA 1RECA 3BOWB 1FW4A 1QV1A 4DRWA 2LUXA 1K2HA 1IH0A 3BUWB 3CWGA 3JVTC 2LLUA 1CTRA 1LA3A 4ICBA 1QX7A 1NX2A 3SG3A 4UPGA 1B8CA 5CSJA 3EK4A 1DJIA 1QX5B 1QXPA 5BPJA 3WHTB 4MEWA 4GAOA 1JWDA 4GGNA 3DVMA 4GFTA 2LNKA 3LCPC 3PFVA 1JUOA 3TUYB 4MN0A 2PSRA 5I8NA 2L50A 2NCOA 1JBAA 1ALVA 2I18A 4YI9A 3JTDB 3PSRA 1AUIB 4ORAB 1WLZA 2M7NA 3BXKA 4WQ2A 2KYCA 1PVAA 2L5XB 2ZNEA 3CLNA 1TN4A 1SKTA 1WRKA 1PALA 3SIAA 5HKYA 2PVBA 2PASA 3BQ3A 3VGOA 2LAPA 2LUCA 1S6JA 2MLFC 2WOSA 2JT0A 1OOJA 1IRJA 1SRAA 1TOPA 2GGZA 1J7PA 1IJ6A 1FF1A 1A03A 2R2IA 1G8IA 1KWOC 1M45A 1SR6C 1YUUA 2SCPA 2Y1NA 3NSLA 4AOMA 1AP4A 4MSPA 4L9MA 1KFXS 3IQOA 2DOQA 2O60A 4YGBB 2PALA 2JC2A 2P6BB 1CFDA 2ZRTA 3WXAA 5K89A 1S36A 2GV5A 4ZCVA 3CZTX 2I94A 1IQ3A 2FCDA 3SG2A 3NSIA 2BKIB 2F3YA 1SYMA 4JWQA 1UHJA 5DKNA 1JFJA 1G33A 1MUXA 2K2FA 1ZFSA 2LP2A 1PVBA 3CR2A 1KSOA 4CLNA 3FWBA 2KSPA 1XVJA 4HSZA 2JU0A 1WDCB 5CSNA 4PE4A 4QJ4B 2HETA 1YURA 1W7IB 1XFWO 5CSFA 3I5GB 3CR5X 3GK4X 4PE7A 1NYAA 2A4JA 5I2QA 3AKBA 2KI6D 1K93D 1U5IB 1JF2A 2WNDA 2B1UA 2H61A 2MA2A 1Y6WA 1YTZC 2Y1MA 3H4SE 1IWQA 2LVVA 2L51A 2LMVA 3OX5A 4YGDB 2BE6A 2G2BA 4P5OE 4DCKA 1H4BA 1J55A 3BUOB 2AUCA 1L7ZA 3ICBA 3EVUA 1J7RA 3NSKA 4JQ0D 1RK9A 1WY9A 1TCOB 2KI4B 2H61C 2M3WA 1WLMA 2NZ0A 3I5HC 2KHNA 1ZMZA 4HREE 1DGUA 4GGFC 4YGCB 1MR8A 2SASA 3D0YA 4CFRA 3F45A 1TNQA 1WDCC 1A4PA 1B7TY 2NXQA 1F55A 1NPQA 1RTP1 1R6PA 1BR4B 4USLA 5J3XA 2NCPA 1F70A 1SMGA 2VRGA 1NX0A 1SY9A 1NX3A 1FI5A 2HF5A 2KNEA 1PULA 1SCVA 2HQ8A 1IKUA 3VRRA 2M8UA 1UHIA 2G9BA 1OZSA 1IQ5A 1MXEA 2L98A 3WNXB 3BUMB 1TRFA 2KBMA 1ZACA 2M49B 1YUTA 2L4IA 2OS8C 4PCWA 4DUQA 4PE1A 1JC2A 1SL9A 1LKJA 3CTNA 4AQIA 2MRDA 5DKRA 1BOCA 4MVFA 2KI6C 1XO5A 2KBIA 2LANA 1DT7B 1NUBA 2I2RE 2JNFA 1N0YA 2JULA 1LA0A 1S1EA 3SG7A 2JTZA 2JOJA 2K61A 3EK7A 4M2QA 1YVHA 1EJ3A 2V53A 1DF0B 3DVJA 1B8LA 3GK1A 2LP3A 1DMOA 1XFUO 2F3ZA 1EG4A 4GNKB 4A4CA 3OHMB 2F2PA 2PMYA 2Y5IA 1KFXL 1B47A 5D69A 4NDBA 4Q04A 3I5IB 3GK2A 2L0PA 1NWDA 1C7WA 3HX4A 4DIRA 4CFQA 2ZRSA 1NX1A 3FIAA 4P2YB 4YBHB 1RWYA 1DTLA 5CPVA 2MBXA 4I5JA 3NSOA 2H2KA 4XJKA 1JSAA 1B8RA 1XYDA 1KK7Z 1L2OC 1TNXA 2TN4A 1GGWA 1KK8C 1M63B 1N65A 2LMTA 5I2LA 1TNPA 4YGEB 1CFPA 1DF0A 2KQ6A 1UHNA 1JFKA 1IGVA 2WC8A 3EKJA 2HQWA 4ETOA 1A2XA 3A8RA 3RM1A 3ZWHA 1A29A 1GJYA 1X02A 5AANA 3TDIA 3ZNIA 1OSAA 2KGRA 2LHLA 1A75A 2OPOA 2LMUA 3LK1A 2E30A 3LLEA 2K7BA 1SL7A 1DGVA 1QATA 2JTTA 2NLNA 2ZKMX 3TZ1A 3AAKA 4OR9B 3I5HB 4I5KA 4XYNA 5HLOA 2M9GA 3OP0A 2FCEA 3GOFA 2ZNDA 2QPTA 2LLTA 4D1EA 4C0KA 2BECA 2OTGB 1W7JB 3FWCA 1FBVA 1XFVO 1C7VA 1CFFA 2KAVA 3JVTB 4FQOA 5B8IB 2LHIA 1BT6A 1QV0A 2EC6B 1CMGA 1CM1A 1M39A 2WCEA 1DJWA 1K95A 3JTDC 1KQVA 2M1UA 2JXLA 3PATA 1V1GA 3OB2B 1YVLA 5HLVA 1E8AA 3C1VA 2WCFA 2M29A 2OS8B 3O2PA 1OMDA 2CNPA 2ZN9A 5JOLA 3CS1A 1PRWA 1S26D 3D0YB 3FS7A 4BY5A 4MRXA 2E6WA 1SR6B 1UURA 4MBEA 1TIZA 1PSBA 4WQ3A 2K2AA 3KHEA 1NSHA 3NXAA 4JPZB 5CSIA 5G08A 5AEQA 1BJFA 1Y0VH 1CLLA 1N2DA 3K21A 1V1FA 2JPTA 2M1KB 4R1EA 1IJ5A 1XA5A 3IQQA 5DKQA 2CCMA 1SW8A 3D10A 2KYFA 1J7QA 4M2OA 1BODA 1KQMB 4QJ5B 3SG5A 1B9AA 1UHKA 5AERA 1CDMA 1QS7A 4I5LB 3BUXB 2K8MB 2KI4C 5I2OA 2KFGA
chains in the Genus database with same CATH superfamily
4NQGA 4HRGA 1DJHA 1XFZO 2LM5A 1QASA 1S5GY 1QVIY 1XFXO 1F4OA 2HPSA 2EC6C 4IL1A 2LCPA 2LV7A 2EGDA 1NIWA 2BNXA 3PALA 4N5XA 1MHOA 3VRPA 1J1EA 1IG5A 2LVJA 1ZOTB 3O4YA 2JWWA 3AAJA 1S6CA 1F4QA 4OKHA 1TUZA 4PHMA 5F6TA 1YR5A 5HKWA 1KWOB 1EL4A 1BU3A 2MJWB 4PHKA 1SPYA 1MXLC 3N7HA 2Q4UA 1DJYA 1A75B 3KF9A 2COLB 3I5IC 2KOTA 1OZOA 4DS7A 1S5GZ 2F33A 1LVCD 5FYXA 4WRIA 1KFUS 2BCAA 1KQMC 1NCXA 2KFFA 3CR4X 2QDIA 3D77A 1TCFA 1EXRA 4M2PA 1QLKA 1LINA 3KO0A 4N1FA 1OMRA 2K60A 2WCHA 3S0EA 1PK0D 1KCYA 2K0JA 1R2UA 1XK4C 2AMIA 1TWOA 1OQPA 4YGAA 1NCZA 1NCYA 4C0LA 1RFJA 2Y4QA 1QIVA 4FTGA 2JXCA 1YRTB 5ER5A 1CLBA 1DELA 1MF8B 1K9KA 3FE6A 4E68A 4PDZA 1CDLA 3B6XA 1SCMB 4GPLB 2D8NA 2QACA 4AQJA 2KAXA 4OVNF 3BYAA 2CXJA 3I5FB 4OCIA 4I5NB 1CFCA 1HT9A 2JT8A 3A4UB 2LLSA 3SS5A 1F71A 3PLFB 3RLZA 3OB1B 2ZFDA 4U8DA 1BF5A 3CDNA 1H8BA 3LL8B 5KSZA 2WCKA 1XK4A 3S0AA 1JF0A 1CMFA 1FPWA 2JNXA 1S3PA 2ISDA 3TUYC 2WCBA 3OX6A 4NDDA 1UP5A 2K7DA 2KGBC 2Q91A 3BUNB 1GQMA 1YUSA 2MHHA 4N1GA 5KTYA 1CDNA 1K90D 5HKZA 3DVEA 3CZ0A 1BMOA 1YX7A 1D1OA 1K8UA 1KSMA 1K94A 1WRLA 1SCMC 3PM8A 2BCBA 4TNCA 1LXFC 4OV2A 1RROA 2QEBA 5D7FA 5TNCA 3DVKA 1T14A 1RJVA 5IBWA 1CLMA 4XJKB 2LVKA 2BL0C 2JQ6A 1S6IA 3DZTA 3TS5C 1CB1A 3PN7B 3DF0B 2EHBA 4GUKA 2KQYA 1B1GA 2BL0B 1B4CA 2OTGC 1B7TZ 4MZLA 2CTNA 1OMVA 1MWNA 3DYEA 5AFPA 4HRHA 2BAPA 2KDHA 4MZJA 4PHNA 1U5IA 3CZ2A 2M0RA 4PE0A 4YRUA 3BFBA 2MLEC 1SBJA 3EVRA 1SSEB 1OE9B 3VB1A 1J1DA 4ORBB 3O78A 1CDPA 4ORCB 3TDUA 1QVIZ 3VRQA 2YGUA 5KU1A 1WRZA 1ALWA 3EK8A 1TTXA 3BOWA 2MAZA 3DF0A 1KK7Y 1QJTA 2P70A 3EVVA 4F0ZB 2K7CA 4CPVA 4MRYA 1MQ1A 4ZCUA 4QJ3B 4C0JA 2PYQA 4BY4A 1EG3A 4MLWA 1EH2A 1NP8A 1F8HA 5HYDA 1DVIA 1QIWA 1BR1B 1UUSA 1GGZA 3SG4A 2I7AA 2BBMA 2M7LA 1AHRA 2BCXA 1Q80A 3VROA 1CNPA 1K9PA 2BKHB 5PALA 4GBAA 1CKKA 2RGIA 3KEVA 2PRUA 5AXIA 2IS9A 1G4YR 2WORA 3SJSA 1KFUL 2CT9A 3HCMA 3WHUB 4PT1A 1AK8A 1BLQA 2ZN8A 3VRNA 2KFHA 1PSRA 2KAYA 2O5GA 2FOTA 1QTXA 3DD4A 1M46A 3NHIA 1OOIX 3I5GC 1XFYO 1VRKA 3SS3A 4YI8A 2BBNA 1AJ4A 1F54A 1J7OA 1DJGA 1QX2A 2AAOA 1YX8A 2F8PA 1ODBA 5FI2A 2BE4A 1HQVA 1M31A 2CBLA 3SIBA 1ZUZA 2JZIA 3UNWA 2LE9B 4FQTA 1K9UA 3SG6A 3R1VA 3AKAA 2FJUB 1L2OB 1Y1XA 1SNLA 2M97A 3UO9A 2F2OA 4A4BA 2JRFA 1FI6A 1TNWA 1AVSA 1KK8B 5ER4X 1Y1UA 1C07A 5JJGA 5GQQC 1UHHA 3IF7A 2H8VA 2WCMA 1SK6D 1K96A 3I5FC 3KPXA 2L2EA 3O6BA 1Y1AA 3LK0A 2GTEA 4PALA 2LVIA 1DJZA 1YRUB 2L4HA 3CABA 1UWOA 2JT3A 3EKHA 4GGFA 1CM4A 1QLSA 2L5YA 4NDCA 4PHJA 1BG1A 3MSEB 2K7OA 1SL8A 3QRXA 4CIDA 1DJXA 3FE8A 3CGAA 4MZKA 2L2CA 3PN7C 3M0WA 1AJ5A 2GGMA 3E3RA 2LC5A 3TDZA 1RECA 3BOWB 1FW4A 1LS8A 1QV1A 4DRWA 2LUXA 3B87A 1IH0A 1K2HA 3BUWB 3CWGA 3JVTC 2LLUA 1CTRA 4IJ7A 1LA3A 3D75A 4ICBA 1QX7A 1NX2A 3SG3A 3RZSA 3B88A 4UPGA 1B8CA 5CSJA 3V2LA 3EK4A 1DJIA 1QX5B 5D3OA 3S0DA 3NGVA 1QXPA 5BPJA 3BJHA 3WHTB 2PQLA 4MEWA 1OW4A 4GAOA 1JWDA 4GGNA 3DVMA 2WCLA 4GFTA 2LNKA 3LCPC 3PFVA 1JUOA 3TUYB 4MN0A 2PSRA 5I8NA 2L50A 2NCOA 1JBAA 1ALVA 2ERBA 2I18A 3JTDB 4YI9A 3PSRA 1AUIB 4ORAB 1WLZA 2M7NA 3BXKA 4WQ2A 2KYCA 1PVAA 2WC5A 2L5XB 3BFHA 2ZNEA 3CLNA 5FI6A 1TN4A 1SKTA 1WRKA 1PALA 3L4AA 3SIAA 2PVBA 5HKYA 2PASA 3BQ3A 3VGOA 2LAPA 2LUCA 1S6JA 2MLFC 2WOSA 2JT0A 1OOJA 1IRJA 1SRAA 1TOPA 2GGZA 4INXA 1J7PA 1IJ6A 1FF1A 1A03A 2R2IA 1G8IA 1KWOC 1M45A 1SR6C 1YUUA 2SCPA 2Y1NA 3NSLA 4AOMA 1AP4A 4MSPA 4L9MA 1KFXS 3IQOA 2DOQA 2O60A 3IVTA 4YGBB 3SS4A 2PALA 1C3YA 2JC2A 2P6BB 3EG5B 1CFDA 2KLDA 2ZRTA 3B86A 3WXAA 1S36A 2GV5A 5K89A 4ZCVA 3CZTX 2I94A 1IQ3A 2FCDA 3SG2A 3NSIA 2BKIB 2F3YA 1SYMA 4JWQA 1UHJA 3OBVA 5DKNA 1JFJA 1G33A 1MUXA 2K2FA 1ZFSA 2LP2A 1PVBA 3CR2A 3TS5B 1KSOA 4CLNA 3QMEA 3FWBA 2KSPA 1XVJA 5DICA 4HSZA 2JU0A 3O4XA 1WDCB 5CSNA 4PE4A 4QJ4B 2HETA 1DC1A 1YURA 1W7IB 1QWVA 1XFWO 2KPHA 3R72A 5CSFA 2QEOA 3I5GB 3CR5X 1OOFA 3GK4X 4JKTA 4PE7A 3PJIA 1NYAA 2A4JA 5I2QA 3AKBA 1DQEA 2KI6D 1K93D 1U5IB 1JF2A 2WCJA 2WNDA 2B1UA 2H61A 2MA2A 1Y6WA 1YTZC 2Y1MA 3H4SE 1IWQA 2LVVA 3S0BA 2L51A 2LMVA 3L47A 3OX5A 4YGDB 2BE6A 2G2BA 4P5OE 4DCKA 1H4BA 1J55A 3BUOB 2AUCA 1L7ZA 3ICBA 3EVUA 1J7RA 3NSKA 4JQ0D 1RK9A 1WY9A 1TCOB 2KI4B 2H61C 1IIOA 2M3WA 1WLMA 1C3ZA 2NZ0A 3I5HC 2KHNA 3DXLA 1ZMZA 4KYNA 4HREE 1DGUA 4GGFC 3BFAA 4YGCB 4F7FA 1MR8A 2SASA 3D0YA 4CFRA 3F45A 1TNQA 1WDCC 1A4PA 1B7TY 2NXQA 2WC6A 1F55A 1NPQA 1RTP1 1R6PA 1BR4B 4USLA 5J3XA 2NCPA 1F70A 1SMGA 2VRGA 3D78A 3OGNA 1NX0A 1GM0A 1SY9A 1NX3A 1FI5A 2HF5A 2KNEA 3D73A 1PULA 1SCVA 2HQ8A 1IKUA 3VRRA 2M8UA 1UHIA 2G9BA 1OZSA 1IQ5A 1MXEA 2L98A 3WNXB 3BUMB 1TRFA 2KBMA 1ZACA 2M49B 3R1PA 1YUTA 2L4IA 2OS8C 4PCWA 4DUQA 4PE1A 1JC2A 1SL9A 1LKJA 3D74A 3CTNA 4AQIA 2MRDA 5DKRA 1BOCA 4MVFA 2KI6C 1XO5A 2KBIA 2LANA 1DT7B 1NUBA 2I2RE 2JNFA 1N0YA 2JULA 1LA0A 1S1EA 3SG7A 2JTZA 2JOJA 2K61A 3EK7A 4M2QA 1YVHA 1EJ3A 2V53A 1DF0B 4JD9A 3DVJA 1B8LA 3GK1A 2LP3A 1DMOA 1XFUO 2F3ZA 1EG4A 2KLEA 4GNKB 4A4CA 3OHMB 2F2PA 2PMYA 2Y5IA 1KFXL 5HL1A 1B47A 5D69A 4INWA 4OZDA 4NDBA 4Q04A 3I5IB 3GK2A 5EL2A 2L0PA 1NWDA 1C7WA 3HX4A 4DIRA 3B7AA 2ZRSA 4CFQA 1NX1A 3NHTA 3S0GA 3FIAA 3K1EA 4P2YB 4YBHB 1OOGA 1RWYA 1DTLA 5CPVA 3S0FA 2MBXA 4I5JA 3NSOA 2H2KA 4XJKA 1JSAA 3D76A 1B8RA 1XYDA 1KK7Z 1L2OC 1TNXA 2TN4A 3FE9A 1KK8C 1M63B 1N65A 1GGWA 2LMTA 5I2LA 1TNPA 3CZ1A 4YGEB 1CFPA 1DF0A 2KQ6A 1UHNA 1JFKA 1IGVA 2WC8A 3EKJA 2HQWA 3R1OA 4ETOA 1A2XA 3A8RA 3RM1A 3ZWHA 1A29A 1GJYA 1X02A 5AANA 3TDIA 3ZNIA 1OSAA 2KGRA 2LHLA 1A75A 2OPOA 2LMUA 3LK1A 2E30A 3LLEA 1OOHA 2K7BA 1SL7A 3Q8IA 1DGVA 1QATA 2JTTA 2NLNA 2ZKMX 3CYZA 3TZ1A 3AAKA 1TUJA 4OR9B 3I5HB 4I5KA 4XYNA 3PM2A 5HLOA 2M9GA 3L4LA 3OP0A 2FCEA 3GOFA 2ZNDA 2QPTA 2LLTA 1Z4HA 4D1EA 4C0KA 2BECA 2OTGB 1W7JB 3FWCA 1FBVA 1XFVO 1C7VA 2JPOA 1CFFA 2KAVA 3JVTB 4FQOA 5B8IB 2LHIA 1P28A 1BT6A 1QV0A 2EC6B 2P71A 1CMGA 1CM1A 1M39A 2WCEA 1DJWA 1K95A 1Z2CB 3JTDC 1KQVA 2M1UA 2JXLA 3PATA 1V1GA 3OB2B 1YVLA 3DY9A 5HLVA 1E8AA 3C1VA 2WCFA 2M29A 2OS8B 3O2PA 1OMDA 2CNPA 1W9ZA 2ZN9A 3CS1A 5JOLA 1PRWA 5I94A 1S26D 3D0YB 3FS7A 4BY5A 4MRXA 2QEHA 2E6WA 1SR6B 1UURA 4MBEA 1TIZA 1PSBA 4WQ3A 1ORGA 2K2AA 3KHEA 1NSHA 3NXAA 4JPZB 5CSIA 5G08A 5AEQA 1BJFA 5FI7A 1Y0VH 1CLLA 1N2DA 3K21A 2FJYA 1V1FA 2JPTA 2M1KB 4R1EA 1IJ5A 1XA5A 3IQQA 5DKQA 2CCMA 1DEKA 1SW8A 2KYFA 3D10A 1J7QA 4M2OA 1BODA 1KQMB 4QJ5B 3SG5A 1B9AA 1UHKA 5AERA 1CDMA 1QS7A 1XFRA 4I5LB 2QEVA 3BUXB 2K8MB 2KI4C 5I2OA 2KFGA
chains in the Genus database with same CATH topology
4NQGA 4HRGA 1DJHA 1XFZO 2LM5A 1QASA 1S5GY 1QVIY 1XFXO 1F4OA 2HPSA 2EC6C 4IL1A 2LCPA 2LV7A 2EGDA 1NIWA 3PALA 3TS5B 4N5XA 1MHOA 3VRPA 1J1EA 1IG5A 2LVJA 1ZOTB 3O4YA 2JWWA 3AAJA 1S6CA 1F4QA 4OKHA 4PHMA 5F6TA 1YR5A 5HKWA 1KWOB 1EL4A 1BU3A 2MJWB 4PHKA 1SPYA 1MXLC 2Q4UA 1DJYA 1A75B 3KF9A 2COLB 3I5IC 2KOTA 1OZOA 4DS7A 1S5GZ 2F33A 1LVCD 5FYXA 4WRIA 1KFUS 2BCAA 1KQMC 1NCXA 2KFFA 3CR4X 4M2PA 1TCFA 1EXRA 1QLKA 1LINA 3KO0A 4N1FA 1OMRA 1PK0D 1KCYA 2K0JA 1R2UA 1XK4C 2AMIA 1OQPA 4YGAA 1NCZA 1NCYA 4C0LA 1RFJA 2Y4QA 1QIVA 4FTGA 2JXCA 1YRTB 5ER5A 1CLBA 1MF8B 1K9KA 4E68A 4PDZA 1CDLA 1SCMB 4GPLB 2D8NA 2QACA 4AQJA 2KAXA 4OVNF 3BYAA 2CXJA 3I5FB 4OCIA 4I5NB 1CFCA 1HT9A 2JT8A 3A4UB 2LLSA 1F71A 3PLFB 3RLZA 3OB1B 2ZFDA 4U8DA 1BF5A 1H8BA 3LL8B 5KSZA 1CMFA 1XK4A 1JF0A 1FPWA 2JNXA 1S3PA 2ISDA 3TUYC 2WCBA 3OX6A 4NDDA 1UP5A 2K7DA 2KGBC 2Q91A 3BUNB 1GQMA 1YUSA 2MHHA 4N1GA 5KTYA 1CDNA 1K90D 5HKZA 3DVEA 1BMOA 1YX7A 1D1OA 1K8UA 1KSMA 1K94A 1WRLA 1SCMC 3PM8A 2BCBA 4TNCA 1LXFC 4OV2A 1RROA 5D7FA 5TNCA 3DVKA 1RJVA 5IBWA 1CLMA 4XJKB 2LVKA 2BL0C 2JQ6A 1S6IA 3TS5C 1CB1A 3PN7B 3DF0B 2EHBA 4GUKA 2KQYA 1B1GA 2BL0B 1B4CA 2OTGC 1B7TZ 4MZLA 2CTNA 1OMVA 1MWNA 5AFPA 4HRHA 2KDHA 4MZJA 4PHNA 1U5IA 2M0RA 4PE0A 4YRUA 2MLEC 1SBJA 3EVRA 1OE9B 1J1DA 4ORBB 3O78A 1CDPA 4ORCB 3TDUA 1QVIZ 3VRQA 5KU1A 1WRZA 1ALWA 3EK8A 1TTXA 3BOWA 2MAZA 3DF0A 1KK7Y 1QJTA 3EVVA 4F0ZB 2K7CA 4CPVA 4MRYA 1MQ1A 4ZCUA 4QJ3B 4C0JA 4BY4A 1EG3A 4MLWA 1EH2A 1NP8A 1F8HA 5HYDA 1DVIA 1QIWA 1BR1B 1UUSA 1GGZA 3SG4A 2I7AA 2BBMA 2M7LA 1AHRA 2BCXA 1Q80A 3VROA 1CNPA 1K9PA 2BKHB 5PALA 4GBAA 1CKKA 2RGIA 3KEVA 2PRUA 5AXIA 2IS9A 1G4YR 2WORA 3SJSA 1KFUL 2CT9A 3HCMA 3WHUB 1AK8A 1BLQA 2ZN8A 3VRNA 2KFHA 1PSRA 2KAYA 2O5GA 2FOTA 1QTXA 3DD4A 1M46A 3I5GC 1XFYO 1VRKA 4YI8A 2BBNA 1AJ4A 1F54A 1J7OA 1DJGA 1QX2A 2AAOA 1YX8A 2F8PA 1ODBA 2BE4A 1HQVA 1M31A 2CBLA 3SIBA 1ZUZA 2JZIA 2LE9B 1K9UA 3SG6A 3AKAA 2FJUB 1L2OB 1Y1XA 1SNLA 2M97A 2F2OA 4A4BA 2JRFA 1FI6A 1TNWA 1AVSA 1KK8B 5ER4X 1Y1UA 1C07A 5JJGA 5GQQC 1UHHA 3IF7A 1SK6D 1K96A 3I5FC 3KPXA 2L2EA 3O6BA 1Y1AA 3LK0A 4PALA 2LVIA 1DJZA 1YRUB 2L4HA 3EKHA 1UWOA 2JT3A 4GGFA 1CM4A 1QLSA 4NDCA 4PHJA 1BG1A 3MSEB 2K7OA 1SL8A 3QRXA 4CIDA 1DJXA 3CGAA 4MZKA 3PN7C 3M0WA 1AJ5A 2GGMA 3E3RA 2LC5A 3TDZA 1RECA 3BOWB 1FW4A 1QV1A 4DRWA 2LUXA 1K2HA 1IH0A 3BUWB 3CWGA 3JVTC 2LLUA 1CTRA 1LA3A 4ICBA 1QX7A 1NX2A 3SG3A 4UPGA 1B8CA 5CSJA 3EK4A 1DJIA 1QX5B 1QXPA 5BPJA 3WHTB 4MEWA 4GAOA 1JWDA 4GGNA 3DVMA 4GFTA 2LNKA 3LCPC 3PFVA 1JUOA 3TUYB 4MN0A 2PSRA 5I8NA 2L50A 2NCOA 1JBAA 1ALVA 2I18A 4YI9A 3JTDB 3PSRA 1AUIB 4ORAB 1WLZA 2M7NA 3BXKA 4WQ2A 2KYCA 1PVAA 2L5XB 2ZNEA 3CLNA 1TN4A 1SKTA 1WRKA 1PALA 3SIAA 5HKYA 2PVBA 2PASA 3BQ3A 3VGOA 2LAPA 2LUCA 1S6JA 2MLFC 2WOSA 2JT0A 1OOJA 1IRJA 1SRAA 1TOPA 2GGZA 1J7PA 1IJ6A 1FF1A 1A03A 2R2IA 1G8IA 1KWOC 1M45A 1SR6C 1YUUA 2SCPA 2Y1NA 3NSLA 4AOMA 1AP4A 4MSPA 4L9MA 1KFXS 3IQOA 2DOQA 2O60A 4YGBB 2PALA 2JC2A 2P6BB 1CFDA 2ZRTA 3WXAA 5K89A 1S36A 2GV5A 4ZCVA 3CZTX 2I94A 1IQ3A 2FCDA 3SG2A 3NSIA 2BKIB 2F3YA 1SYMA 4JWQA 1UHJA 5DKNA 1JFJA 1G33A 1MUXA 2K2FA 1ZFSA 2LP2A 1PVBA 3CR2A 1KSOA 4CLNA 3FWBA 2KSPA 1XVJA 4HSZA 2JU0A 1WDCB 5CSNA 4PE4A 4QJ4B 2HETA 1YURA 1W7IB 1XFWO 5CSFA 3I5GB 3CR5X 3GK4X 4PE7A 1NYAA 2A4JA 5I2QA 3AKBA 2KI6D 1K93D 1U5IB 1JF2A 2WNDA 2B1UA 2H61A 2MA2A 1Y6WA 1YTZC 2Y1MA 3H4SE 1IWQA 2LVVA 2L51A 2LMVA 3OX5A 4YGDB 2BE6A 2G2BA 4P5OE 4DCKA 1H4BA 1J55A 3BUOB 2AUCA 1L7ZA 3ICBA 3EVUA 1J7RA 3NSKA 4JQ0D 1RK9A 1WY9A 1TCOB 2KI4B 2H61C 2M3WA 1WLMA 2NZ0A 3I5HC 2KHNA 1ZMZA 4HREE 1DGUA 4GGFC 4YGCB 1MR8A 2SASA 3D0YA 4CFRA 3F45A 1TNQA 1WDCC 1A4PA 1B7TY 2NXQA 1F55A 1NPQA 1RTP1 1R6PA 1BR4B 4USLA 5J3XA 2NCPA 1F70A 1SMGA 2VRGA 1NX0A 1SY9A 1NX3A 1FI5A 2HF5A 2KNEA 1PULA 1SCVA 2HQ8A 1IKUA 3VRRA 2M8UA 1UHIA 2G9BA 1OZSA 1IQ5A 1MXEA 2L98A 3WNXB 3BUMB 1TRFA 2KBMA 1ZACA 2M49B 1YUTA 2L4IA 2OS8C 4PCWA 4DUQA 4PE1A 1JC2A 1SL9A 1LKJA 3CTNA 4AQIA 2MRDA 5DKRA 1BOCA 4MVFA 2KI6C 1XO5A 2KBIA 2LANA 1DT7B 1NUBA 2I2RE 2JNFA 1N0YA 2JULA 1LA0A 1S1EA 3SG7A 2JTZA 2JOJA 2K61A 3EK7A 4M2QA 1YVHA 1EJ3A 2V53A 1DF0B 3DVJA 1B8LA 3GK1A 2LP3A 1DMOA 1XFUO 2F3ZA 1EG4A 4GNKB 4A4CA 3OHMB 2F2PA 2PMYA 2Y5IA 1KFXL 1B47A 5D69A 4NDBA 4Q04A 3I5IB 3GK2A 2L0PA 1NWDA 1C7WA 3HX4A 4DIRA 4CFQA 2ZRSA 1NX1A 3FIAA 4P2YB 4YBHB 1RWYA 1DTLA 5CPVA 2MBXA 4I5JA 3NSOA 2H2KA 4XJKA 1JSAA 1B8RA 1XYDA 1KK7Z 1L2OC 1TNXA 2TN4A 1GGWA 1KK8C 1M63B 1N65A 2LMTA 5I2LA 1TNPA 4YGEB 1CFPA 1DF0A 2KQ6A 1UHNA 1JFKA 1IGVA 2WC8A 3EKJA 2HQWA 4ETOA 1A2XA 3A8RA 3RM1A 3ZWHA 1A29A 1GJYA 1X02A 5AANA 3TDIA 3ZNIA 1OSAA 2KGRA 2LHLA 1A75A 2OPOA 2LMUA 3LK1A 2E30A 3LLEA 2K7BA 1SL7A 1DGVA 1QATA 2JTTA 2NLNA 2ZKMX 3TZ1A 3AAKA 4OR9B 3I5HB 4I5KA 4XYNA 5HLOA 2M9GA 3OP0A 2FCEA 3GOFA 2ZNDA 2QPTA 2LLTA 4D1EA 4C0KA 2BECA 2OTGB 1W7JB 3FWCA 1FBVA 1XFVO 1C7VA 1CFFA 2KAVA 3JVTB 4FQOA 5B8IB 2LHIA 1BT6A 1QV0A 2EC6B 1CMGA 1CM1A 1M39A 2WCEA 1DJWA 1K95A 3JTDC 1KQVA 2M1UA 2JXLA 3PATA 1V1GA 3OB2B 1YVLA 5HLVA 1E8AA 3C1VA 2WCFA 2M29A 2OS8B 3O2PA 1OMDA 2CNPA 2ZN9A 5JOLA 3CS1A 1PRWA 1S26D 3D0YB 3FS7A 4BY5A 4MRXA 2E6WA 1SR6B 1UURA 4MBEA 1TIZA 1PSBA 4WQ3A 2K2AA 3KHEA 1NSHA 3NXAA 4JPZB 5CSIA 5G08A 5AEQA 1BJFA 1Y0VH 1CLLA 1N2DA 3K21A 1V1FA 2JPTA 2M1KB 4R1EA 1IJ5A 1XA5A 3IQQA 5DKQA 2CCMA 1SW8A 3D10A 2KYFA 1J7QA 4M2OA 1BODA 1KQMB 4QJ5B 3SG5A 1B9AA 1UHKA 5AERA 1CDMA 1QS7A 4I5LB 3BUXB 2K8MB 2KI4C 5I2OA 2KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQG A;  4HRG A;  1DJH A;  1XFZ O;  2LM5 A;  1QAS A;  1S5G Y;  1QVI Y;  1XFX O;  1F4O A;  2HPS A;  2EC6 C;  4IL1 A;  2LCP A;  2LV7 A;  2EGD A;  1NIW A;  3PAL A;  3TS5 B;  4N5X A;  1MHO A;  3VRP A;  1J1E A;  1IG5 A;  2LVJ A;  1ZOT B;  3O4Y A;  2JWW A;  3AAJ A;  1S6C A;  1F4Q A;  4OKH A;  4PHM A;  5F6T A;  1YR5 A;  5HKW A;  1KWO B;  1EL4 A;  1BU3 A;  2MJW B;  4PHK A;  1SPY A;  1MXL C;  2Q4U A;  1DJY A;  1A75 B;  3KF9 A;  2COL B;  3I5I C;  2KOT A;  1OZO A;  4DS7 A;  1S5G Z;  2F33 A;  1LVC D;  5FYX A;  4WRI A;  1KFU S;  2BCA A;  1KQM C;  1NCX A;  2KFF A;  3CR4 X;  4M2P A;  1TCF A;  1EXR A;  1QLK A;  1LIN A;  3KO0 A;  4N1F A;  1OMR A;  1PK0 D;  1KCY A;  2K0J A;  1R2U A;  1XK4 C;  2AMI A;  1OQP A;  4YGA A;  1NCZ A;  1NCY A;  4C0L A;  1RFJ A;  2Y4Q A;  1QIV A;  4FTG A;  2JXC A;  1YRT B;  5ER5 A;  1CLB A;  1MF8 B;  1K9K A;  4E68 A;  4PDZ A;  1CDL A;  1SCM B;  4GPL B;  2D8N A;  2QAC A;  4AQJ A;  2KAX A;  4OVN F;  3BYA A;  2CXJ A;  3I5F B;  4OCI A;  4I5N B;  1CFC A;  1HT9 A;  2JT8 A;  3A4U B;  2LLS A;  1F71 A;  3PLF B;  3RLZ A;  3OB1 B;  2ZFD A;  4U8D A;  1BF5 A;  1H8B A;  3LL8 B;  5KSZ A;  1CMF A;  1XK4 A;  1JF0 A;  1FPW A;  2JNX A;  1S3P A;  2ISD A;  3TUY C;  2WCB A;  3OX6 A;  4NDD A;  1UP5 A;  2K7D A;  2KGB C;  2Q91 A;  3BUN B;  1GQM A;  1YUS A;  2MHH A;  4N1G A;  5KTY A;  1CDN A;  1K90 D;  5HKZ A;  3DVE A;  1BMO A;  1YX7 A;  1D1O A;  1K8U A;  1KSM A;  1K94 A;  1WRL A;  1SCM C;  3PM8 A;  2BCB A;  4TNC A;  1LXF C;  4OV2 A;  1RRO A;  5D7F A;  5TNC A;  3DVK A;  1RJV A;  5IBW A;  1CLM A;  4XJK B;  2LVK A;  2BL0 C;  2JQ6 A;  1S6I A;  3TS5 C;  1CB1 A;  3PN7 B;  3DF0 B;  2EHB A;  4GUK A;  2KQY A;  1B1G A;  2BL0 B;  1B4C A;  2OTG C;  1B7T Z;  4MZL A;  2CTN A;  1OMV A;  1MWN A;  5AFP A;  4HRH A;  2KDH A;  4MZJ A;  4PHN A;  1U5I A;  2M0R A;  4PE0 A;  4YRU A;  2MLE C;  1SBJ A;  3EVR A;  1OE9 B;  1J1D A;  4ORB B;  3O78 A;  1CDP A;  4ORC B;  3TDU A;  1QVI Z;  3VRQ A;  5KU1 A;  1WRZ A;  1ALW A;  3EK8 A;  1TTX A;  3BOW A;  2MAZ A;  3DF0 A;  1KK7 Y;  1QJT A;  3EVV A;  4F0Z B;  2K7C A;  4CPV A;  4MRY A;  1MQ1 A;  4ZCU A;  4QJ3 B;  4C0J A;  4BY4 A;  1EG3 A;  4MLW A;  1EH2 A;  1NP8 A;  1F8H A;  5HYD A;  1DVI A;  1QIW A;  1BR1 B;  1UUS A;  1GGZ A;  3SG4 A;  2I7A A;  2BBM A;  2M7L A;  1AHR A;  2BCX A;  1Q80 A;  3VRO A;  1CNP A;  1K9P A;  2BKH B;  5PAL A;  4GBA A;  1CKK A;  2RGI A;  3KEV A;  2PRU A;  5AXI A;  2IS9 A;  1G4Y R;  2WOR A;  3SJS A;  1KFU L;  2CT9 A;  3HCM A;  3WHU B;  1AK8 A;  1BLQ A;  2ZN8 A;  3VRN A;  2KFH A;  1PSR A;  2KAY A;  2O5G A;  2FOT A;  1QTX A;  3DD4 A;  1M46 A;  3I5G C;  1XFY O;  1VRK A;  4YI8 A;  2BBN A;  1AJ4 A;  1F54 A;  1J7O A;  1DJG A;  1QX2 A;  2AAO A;  1YX8 A;  2F8P A;  1ODB A;  2BE4 A;  1HQV A;  1M31 A;  2CBL A;  3SIB A;  1ZUZ A;  2JZI A;  2LE9 B;  1K9U A;  3SG6 A;  3AKA A;  2FJU B;  1L2O B;  1Y1X A;  1SNL A;  2M97 A;  2F2O A;  4A4B A;  2JRF A;  1FI6 A;  1TNW A;  1AVS A;  1KK8 B;  5ER4 X;  1Y1U A;  1C07 A;  5JJG A;  5GQQ C;  1UHH A;  3IF7 A;  1SK6 D;  1K96 A;  3I5F C;  3KPX A;  2L2E A;  3O6B A;  1Y1A A;  3LK0 A;  4PAL A;  2LVI A;  1DJZ A;  1YRU B;  2L4H A;  3EKH A;  1UWO A;  2JT3 A;  4GGF A;  1CM4 A;  1QLS A;  4NDC A;  4PHJ A;  1BG1 A;  3MSE B;  2K7O A;  1SL8 A;  3QRX A;  4CID A;  1DJX A;  3CGA A;  4MZK A;  3PN7 C;  3M0W A;  1AJ5 A;  2GGM A;  3E3R A;  2LC5 A;  3TDZ A;  1REC A;  3BOW B;  1FW4 A;  1QV1 A;  4DRW A;  2LUX A;  1K2H A;  1IH0 A;  3BUW B;  3CWG A;  3JVT C;  2LLU A;  1CTR A;  1LA3 A;  4ICB A;  1QX7 A;  1NX2 A;  3SG3 A;  4UPG A;  1B8C A;  5CSJ A;  3EK4 A;  1DJI A;  1QX5 B;  1QXP A;  5BPJ A;  3WHT B;  4MEW A;  4GAO A;  1JWD A;  4GGN A;  3DVM A;  4GFT A;  2LNK A;  3LCP C;  3PFV A;  1JUO A;  3TUY B;  4MN0 A;  2PSR A;  5I8N A;  2L50 A;  2NCO A;  1JBA A;  1ALV A;  2I18 A;  4YI9 A;  3JTD B;  3PSR A;  1AUI B;  4ORA B;  1WLZ A;  2M7N A;  3BXK A;  4WQ2 A;  2KYC A;  1PVA A;  2L5X B;  2ZNE A;  3CLN A;  1TN4 A;  1SKT A;  1WRK A;  1PAL A;  3SIA A;  5HKY A;  2PVB A;  2PAS A;  3BQ3 A;  3VGO A;  2LAP A;  2LUC A;  1S6J A;  2MLF C;  2WOS A;  2JT0 A;  1OOJ A;  1IRJ A;  1SRA A;  1TOP A;  2GGZ A;  1J7P A;  1IJ6 A;  1FF1 A;  1A03 A;  2R2I A;  1G8I A;  1KWO C;  1M45 A;  1SR6 C;  1YUU A;  2SCP A;  2Y1N A;  3NSL A;  4AOM A;  1AP4 A;  4MSP A;  4L9M A;  1KFX S;  3IQO A;  2DOQ A;  2O60 A;  4YGB B;  2PAL A;  2JC2 A;  2P6B B;  1CFD A;  2ZRT A;  3WXA A;  5K89 A;  1S36 A;  2GV5 A;  4ZCV A;  3CZT X;  2I94 A;  1IQ3 A;  2FCD A;  3SG2 A;  3NSI A;  2BKI B;  2F3Y A;  1SYM A;  4JWQ A;  1UHJ A;  5DKN A;  1JFJ A;  1G33 A;  1MUX A;  2K2F A;  1ZFS A;  2LP2 A;  1PVB A;  3CR2 A;  1KSO A;  4CLN A;  3FWB A;  2KSP A;  1XVJ A;  4HSZ A;  2JU0 A;  1WDC B;  5CSN A;  4PE4 A;  4QJ4 B;  2HET A;  1YUR A;  1W7I B;  1XFW O;  5CSF A;  3I5G B;  3CR5 X;  3GK4 X;  4PE7 A;  1NYA A;  2A4J A;  5I2Q A;  3AKB A;  2KI6 D;  1K93 D;  1U5I B;  1JF2 A;  2WND A;  2B1U A;  2H61 A;  2MA2 A;  1Y6W A;  1YTZ C;  2Y1M A;  3H4S E;  1IWQ A;  2LVV A;  2L51 A;  2LMV A;  3OX5 A;  4YGD B;  2BE6 A;  2G2B A;  4P5O E;  4DCK A;  1H4B A;  1J55 A;  3BUO B;  2AUC A;  1L7Z A;  3ICB A;  3EVU A;  1J7R A;  3NSK A;  4JQ0 D;  1RK9 A;  1WY9 A;  1TCO B;  2KI4 B;  2H61 C;  2M3W A;  1WLM A;  2NZ0 A;  3I5H C;  2KHN A;  1ZMZ A;  4HRE E;  1DGU A;  4GGF C;  4YGC B;  1MR8 A;  2SAS A;  3D0Y A;  4CFR A;  3F45 A;  1TNQ A;  1WDC C;  1A4P A;  1B7T Y;  2NXQ A;  1F55 A;  1NPQ A;  1RTP 1;  1R6P A;  1BR4 B;  4USL A;  5J3X A;  2NCP A;  1F70 A;  1SMG A;  2VRG A;  1NX0 A;  1SY9 A;  1NX3 A;  1FI5 A;  2HF5 A;  2KNE A;  1PUL A;  1SCV A;  2HQ8 A;  1IKU A;  3VRR A;  2M8U A;  1UHI A;  2G9B A;  1OZS A;  1IQ5 A;  1MXE A;  2L98 A;  3WNX B;  3BUM B;  1TRF A;  2KBM A;  1ZAC A;  2M49 B;  1YUT A;  2L4I A;  2OS8 C;  4PCW A;  4DUQ A;  4PE1 A;  1JC2 A;  1SL9 A;  1LKJ A;  3CTN A;  4AQI A;  2MRD A;  5DKR A;  1BOC A;  4MVF A;  2KI6 C;  1XO5 A;  2KBI A;  2LAN A;  1DT7 B;  1NUB A;  2I2R E;  2JNF A;  1N0Y A;  2JUL A;  1LA0 A;  1S1E A;  3SG7 A;  2JTZ A;  2JOJ A;  2K61 A;  3EK7 A;  4M2Q A;  1YVH A;  1EJ3 A;  2V53 A;  1DF0 B;  3DVJ A;  1B8L A;  3GK1 A;  2LP3 A;  1DMO A;  1XFU O;  2F3Z A;  1EG4 A;  4GNK B;  4A4C A;  3OHM B;  2F2P A;  2PMY A;  2Y5I A;  1KFX L;  1B47 A;  5D69 A;  4NDB A;  4Q04 A;  3I5I B;  3GK2 A;  2L0P A;  1NWD A;  1C7W A;  3HX4 A;  4DIR A;  4CFQ A;  2ZRS A;  1NX1 A;  3FIA A;  4P2Y B;  4YBH B;  1RWY A;  1DTL A;  5CPV A;  2MBX A;  4I5J A;  3NSO A;  2H2K A;  4XJK A;  1JSA A;  1B8R A;  1XYD A;  1KK7 Z;  1L2O C;  1TNX A;  2TN4 A;  1GGW A;  1KK8 C;  1M63 B;  1N65 A;  2LMT A;  5I2L A;  1TNP A;  4YGE B;  1CFP A;  1DF0 A;  2KQ6 A;  1UHN A;  1JFK A;  1IGV A;  2WC8 A;  3EKJ A;  2HQW A;  4ETO A;  1A2X A;  3A8R A;  3RM1 A;  3ZWH A;  1A29 A;  1GJY A;  1X02 A;  5AAN A;  3TDI A;  3ZNI A;  1OSA A;  2KGR A;  2LHL A;  1A75 A;  2OPO A;  2LMU A;  3LK1 A;  2E30 A;  3LLE A;  2K7B A;  1SL7 A;  1DGV A;  1QAT A;  2JTT A;  2NLN A;  2ZKM X;  3TZ1 A;  3AAK A;  4OR9 B;  3I5H B;  4I5K A;  4XYN A;  5HLO A;  2M9G A;  3OP0 A;  2FCE A;  3GOF A;  2ZND A;  2QPT A;  2LLT A;  4D1E A;  4C0K A;  2BEC A;  2OTG B;  1W7J B;  3FWC A;  1FBV A;  1XFV O;  1C7V A;  1CFF A;  2KAV A;  3JVT B;  4FQO A;  5B8I B;  2LHI A;  1BT6 A;  1QV0 A;  2EC6 B;  1CMG A;  1CM1 A;  1M39 A;  2WCE A;  1DJW A;  1K95 A;  3JTD C;  1KQV A;  2M1U A;  2JXL A;  3PAT A;  1V1G A;  3OB2 B;  1YVL A;  5HLV A;  1E8A A;  3C1V A;  2WCF A;  2M29 A;  2OS8 B;  3O2P A;  1OMD A;  2CNP A;  2ZN9 A;  5JOL A;  3CS1 A;  1PRW A;  1S26 D;  3D0Y B;  3FS7 A;  4BY5 A;  4MRX A;  2E6W A;  1SR6 B;  1UUR A;  4MBE A;  1TIZ A;  1PSB A;  4WQ3 A;  2K2A A;  3KHE A;  1NSH A;  3NXA A;  4JPZ B;  5CSI A;  5G08 A;  5AEQ A;  1BJF A;  1Y0V H;  1CLL A;  1N2D A;  3K21 A;  1V1F A;  2JPT A;  2M1K B;  4R1E A;  1IJ5 A;  1XA5 A;  3IQQ A;  5DKQ A;  2CCM A;  1SW8 A;  3D10 A;  2KYF A;  1J7Q A;  4M2O A;  1BOD A;  1KQM B;  4QJ5 B;  3SG5 A;  1B9A A;  1UHK A;  5AER A;  1CDM A;  1QS7 A;  4I5L B;  3BUX B;  2K8M B;  2KI4 C;  5I2O A;  2KFG A; 
#chains in the Genus database with same CATH topology
 4NQG A;  4HRG A;  1DJH A;  1XFZ O;  2LM5 A;  1QAS A;  1S5G Y;  1QVI Y;  1XFX O;  1F4O A;  2HPS A;  2EC6 C;  4IL1 A;  2LCP A;  2LV7 A;  2EGD A;  1NIW A;  2BNX A;  3PAL A;  4N5X A;  1MHO A;  3VRP A;  1J1E A;  1IG5 A;  2LVJ A;  1ZOT B;  3O4Y A;  2JWW A;  3AAJ A;  1S6C A;  1F4Q A;  4OKH A;  1TUZ A;  4PHM A;  5F6T A;  1YR5 A;  5HKW A;  1KWO B;  1EL4 A;  1BU3 A;  2MJW B;  4PHK A;  1SPY A;  1MXL C;  3N7H A;  2Q4U A;  1DJY A;  1A75 B;  3KF9 A;  2COL B;  3I5I C;  2KOT A;  1OZO A;  4DS7 A;  1S5G Z;  2F33 A;  1LVC D;  5FYX A;  4WRI A;  1KFU S;  2BCA A;  1KQM C;  1NCX A;  2KFF A;  3CR4 X;  2QDI A;  3D77 A;  1TCF A;  1EXR A;  4M2P A;  1QLK A;  1LIN A;  3KO0 A;  4N1F A;  1OMR A;  2K60 A;  2WCH A;  3S0E A;  1PK0 D;  1KCY A;  2K0J A;  1R2U A;  1XK4 C;  2AMI A;  1TWO A;  1OQP A;  4YGA A;  1NCZ A;  1NCY A;  4C0L A;  1RFJ A;  2Y4Q A;  1QIV A;  4FTG A;  2JXC A;  1YRT B;  5ER5 A;  1CLB A;  1DEL A;  1MF8 B;  1K9K A;  3FE6 A;  4E68 A;  4PDZ A;  1CDL A;  3B6X A;  1SCM B;  4GPL B;  2D8N A;  2QAC A;  4AQJ A;  2KAX A;  4OVN F;  3BYA A;  2CXJ A;  3I5F B;  4OCI A;  4I5N B;  1CFC A;  1HT9 A;  2JT8 A;  3A4U B;  2LLS A;  3SS5 A;  1F71 A;  3PLF B;  3RLZ A;  3OB1 B;  2ZFD A;  4U8D A;  1BF5 A;  3CDN A;  1H8B A;  3LL8 B;  5KSZ A;  2WCK A;  1XK4 A;  3S0A A;  1JF0 A;  1CMF A;  1FPW A;  2JNX A;  1S3P A;  2ISD A;  3TUY C;  2WCB A;  3OX6 A;  4NDD A;  1UP5 A;  2K7D A;  2KGB C;  2Q91 A;  3BUN B;  1GQM A;  1YUS A;  2MHH A;  4N1G A;  5KTY A;  1CDN A;  1K90 D;  5HKZ A;  3DVE A;  3CZ0 A;  1BMO A;  1YX7 A;  1D1O A;  1K8U A;  1KSM A;  1K94 A;  1WRL A;  1SCM C;  3PM8 A;  2BCB A;  4TNC A;  1LXF C;  4OV2 A;  1RRO A;  2QEB A;  5D7F A;  5TNC A;  3DVK A;  1T14 A;  1RJV A;  5IBW A;  1CLM A;  4XJK B;  2LVK A;  2BL0 C;  2JQ6 A;  1S6I A;  3DZT A;  3TS5 C;  1CB1 A;  3PN7 B;  3DF0 B;  2EHB A;  4GUK A;  2KQY A;  1B1G A;  2BL0 B;  1B4C A;  2OTG C;  1B7T Z;  4MZL A;  2CTN A;  1OMV A;  1MWN A;  3DYE A;  5AFP A;  4HRH A;  2BAP A;  2KDH A;  4MZJ A;  4PHN A;  1U5I A;  3CZ2 A;  2M0R A;  4PE0 A;  4YRU A;  3BFB A;  2MLE C;  1SBJ A;  3EVR A;  1SSE B;  1OE9 B;  3VB1 A;  1J1D A;  4ORB B;  3O78 A;  1CDP A;  4ORC B;  3TDU A;  1QVI Z;  3VRQ A;  2YGU A;  5KU1 A;  1WRZ A;  1ALW A;  3EK8 A;  1TTX A;  3BOW A;  2MAZ A;  3DF0 A;  1KK7 Y;  1QJT A;  2P70 A;  3EVV A;  4F0Z B;  2K7C A;  4CPV A;  4MRY A;  1MQ1 A;  4ZCU A;  4QJ3 B;  4C0J A;  2PYQ A;  4BY4 A;  1EG3 A;  4MLW A;  1EH2 A;  1NP8 A;  1F8H A;  5HYD A;  1DVI A;  1QIW A;  1BR1 B;  1UUS A;  1GGZ A;  3SG4 A;  2I7A A;  2BBM A;  2M7L A;  1AHR A;  2BCX A;  1Q80 A;  3VRO A;  1CNP A;  1K9P A;  2BKH B;  5PAL A;  4GBA A;  1CKK A;  2RGI A;  3KEV A;  2PRU A;  5AXI A;  2IS9 A;  1G4Y R;  2WOR A;  3SJS A;  1KFU L;  2CT9 A;  3HCM A;  3WHU B;  4PT1 A;  1AK8 A;  1BLQ A;  2ZN8 A;  3VRN A;  2KFH A;  1PSR A;  2KAY A;  2O5G A;  2FOT A;  1QTX A;  3DD4 A;  1M46 A;  3NHI A;  1OOI X;  3I5G C;  1XFY O;  1VRK A;  3SS3 A;  4YI8 A;  2BBN A;  1AJ4 A;  1F54 A;  1J7O A;  1DJG A;  1QX2 A;  2AAO A;  1YX8 A;  2F8P A;  1ODB A;  5FI2 A;  2BE4 A;  1HQV A;  1M31 A;  2CBL A;  3SIB A;  1ZUZ A;  2JZI A;  3UNW A;  2LE9 B;  4FQT A;  1K9U A;  3SG6 A;  3R1V A;  3AKA A;  2FJU B;  1L2O B;  1Y1X A;  1SNL A;  2M97 A;  3UO9 A;  2F2O A;  4A4B A;  2JRF A;  1FI6 A;  1TNW A;  1AVS A;  1KK8 B;  5ER4 X;  1Y1U A;  1C07 A;  5JJG A;  5GQQ C;  1UHH A;  3IF7 A;  2H8V A;  2WCM A;  1SK6 D;  1K96 A;  3I5F C;  3KPX A;  2L2E A;  3O6B A;  1Y1A A;  3LK0 A;  2GTE A;  4PAL A;  2LVI A;  1DJZ A;  1YRU B;  2L4H A;  3CAB A;  1UWO A;  2JT3 A;  3EKH A;  4GGF A;  1CM4 A;  1QLS A;  2L5Y A;  4NDC A;  4PHJ A;  1BG1 A;  3MSE B;  2K7O A;  1SL8 A;  3QRX A;  4CID A;  1DJX A;  3FE8 A;  3CGA A;  4MZK A;  2L2C A;  3PN7 C;  3M0W A;  1AJ5 A;  2GGM A;  3E3R A;  2LC5 A;  3TDZ A;  1REC A;  3BOW B;  1FW4 A;  1LS8 A;  1QV1 A;  4DRW A;  2LUX A;  3B87 A;  1IH0 A;  1K2H A;  3BUW B;  3CWG A;  3JVT C;  2LLU A;  1CTR A;  4IJ7 A;  1LA3 A;  3D75 A;  4ICB A;  1QX7 A;  1NX2 A;  3SG3 A;  3RZS A;  3B88 A;  4UPG A;  1B8C A;  5CSJ A;  3V2L A;  3EK4 A;  1DJI A;  1QX5 B;  5D3O A;  3S0D A;  3NGV A;  1QXP A;  5BPJ A;  3BJH A;  3WHT B;  2PQL A;  4MEW A;  1OW4 A;  4GAO A;  1JWD A;  4GGN A;  3DVM A;  2WCL A;  4GFT A;  2LNK A;  3LCP C;  3PFV A;  1JUO A;  3TUY B;  4MN0 A;  2PSR A;  5I8N A;  2L50 A;  2NCO A;  1JBA A;  1ALV A;  2ERB A;  2I18 A;  3JTD B;  4YI9 A;  3PSR A;  1AUI B;  4ORA B;  1WLZ A;  2M7N A;  3BXK A;  4WQ2 A;  2KYC A;  1PVA A;  2WC5 A;  2L5X B;  3BFH A;  2ZNE A;  3CLN A;  5FI6 A;  1TN4 A;  1SKT A;  1WRK A;  1PAL A;  3L4A A;  3SIA A;  2PVB A;  5HKY A;  2PAS A;  3BQ3 A;  3VGO A;  2LAP A;  2LUC A;  1S6J A;  2MLF C;  2WOS A;  2JT0 A;  1OOJ A;  1IRJ A;  1SRA A;  1TOP A;  2GGZ A;  4INX A;  1J7P A;  1IJ6 A;  1FF1 A;  1A03 A;  2R2I A;  1G8I A;  1KWO C;  1M45 A;  1SR6 C;  1YUU A;  2SCP A;  2Y1N A;  3NSL A;  4AOM A;  1AP4 A;  4MSP A;  4L9M A;  1KFX S;  3IQO A;  2DOQ A;  2O60 A;  3IVT A;  4YGB B;  3SS4 A;  2PAL A;  1C3Y A;  2JC2 A;  2P6B B;  3EG5 B;  1CFD A;  2KLD A;  2ZRT A;  3B86 A;  3WXA A;  1S36 A;  2GV5 A;  5K89 A;  4ZCV A;  3CZT X;  2I94 A;  1IQ3 A;  2FCD A;  3SG2 A;  3NSI A;  2BKI B;  2F3Y A;  1SYM A;  4JWQ A;  1UHJ A;  3OBV A;  5DKN A;  1JFJ A;  1G33 A;  1MUX A;  2K2F A;  1ZFS A;  2LP2 A;  1PVB A;  3CR2 A;  3TS5 B;  1KSO A;  4CLN A;  3QME A;  3FWB A;  2KSP A;  1XVJ A;  5DIC A;  4HSZ A;  2JU0 A;  3O4X A;  1WDC B;  5CSN A;  4PE4 A;  4QJ4 B;  2HET A;  1DC1 A;  1YUR A;  1W7I B;  1QWV A;  1XFW O;  2KPH A;  3R72 A;  5CSF A;  2QEO A;  3I5G B;  3CR5 X;  1OOF A;  3GK4 X;  4JKT A;  4PE7 A;  3PJI A;  1NYA A;  2A4J A;  5I2Q A;  3AKB A;  1DQE A;  2KI6 D;  1K93 D;  1U5I B;  1JF2 A;  2WCJ A;  2WND A;  2B1U A;  2H61 A;  2MA2 A;  1Y6W A;  1YTZ C;  2Y1M A;  3H4S E;  1IWQ A;  2LVV A;  3S0B A;  2L51 A;  2LMV A;  3L47 A;  3OX5 A;  4YGD B;  2BE6 A;  2G2B A;  4P5O E;  4DCK A;  1H4B A;  1J55 A;  3BUO B;  2AUC A;  1L7Z A;  3ICB A;  3EVU A;  1J7R A;  3NSK A;  4JQ0 D;  1RK9 A;  1WY9 A;  1TCO B;  2KI4 B;  2H61 C;  1IIO A;  2M3W A;  1WLM A;  1C3Z A;  2NZ0 A;  3I5H C;  2KHN A;  3DXL A;  1ZMZ A;  4KYN A;  4HRE E;  1DGU A;  4GGF C;  3BFA A;  4YGC B;  4F7F A;  1MR8 A;  2SAS A;  3D0Y A;  4CFR A;  3F45 A;  1TNQ A;  1WDC C;  1A4P A;  1B7T Y;  2NXQ A;  2WC6 A;  1F55 A;  1NPQ A;  1RTP 1;  1R6P A;  1BR4 B;  4USL A;  5J3X A;  2NCP A;  1F70 A;  1SMG A;  2VRG A;  3D78 A;  3OGN A;  1NX0 A;  1GM0 A;  1SY9 A;  1NX3 A;  1FI5 A;  2HF5 A;  2KNE A;  3D73 A;  1PUL A;  1SCV A;  2HQ8 A;  1IKU A;  3VRR A;  2M8U A;  1UHI A;  2G9B A;  1OZS A;  1IQ5 A;  1MXE A;  2L98 A;  3WNX B;  3BUM B;  1TRF A;  2KBM A;  1ZAC A;  2M49 B;  3R1P A;  1YUT A;  2L4I A;  2OS8 C;  4PCW A;  4DUQ A;  4PE1 A;  1JC2 A;  1SL9 A;  1LKJ A;  3D74 A;  3CTN A;  4AQI A;  2MRD A;  5DKR A;  1BOC A;  4MVF A;  2KI6 C;  1XO5 A;  2KBI A;  2LAN A;  1DT7 B;  1NUB A;  2I2R E;  2JNF A;  1N0Y A;  2JUL A;  1LA0 A;  1S1E A;  3SG7 A;  2JTZ A;  2JOJ A;  2K61 A;  3EK7 A;  4M2Q A;  1YVH A;  1EJ3 A;  2V53 A;  1DF0 B;  4JD9 A;  3DVJ A;  1B8L A;  3GK1 A;  2LP3 A;  1DMO A;  1XFU O;  2F3Z A;  1EG4 A;  2KLE A;  4GNK B;  4A4C A;  3OHM B;  2F2P A;  2PMY A;  2Y5I A;  1KFX L;  5HL1 A;  1B47 A;  5D69 A;  4INW A;  4OZD A;  4NDB A;  4Q04 A;  3I5I B;  3GK2 A;  5EL2 A;  2L0P A;  1NWD A;  1C7W A;  3HX4 A;  4DIR A;  3B7A A;  2ZRS A;  4CFQ A;  1NX1 A;  3NHT A;  3S0G A;  3FIA A;  3K1E A;  4P2Y B;  4YBH B;  1OOG A;  1RWY A;  1DTL A;  5CPV A;  3S0F A;  2MBX A;  4I5J A;  3NSO A;  2H2K A;  4XJK A;  1JSA A;  3D76 A;  1B8R A;  1XYD A;  1KK7 Z;  1L2O C;  1TNX A;  2TN4 A;  3FE9 A;  1KK8 C;  1M63 B;  1N65 A;  1GGW A;  2LMT A;  5I2L A;  1TNP A;  3CZ1 A;  4YGE B;  1CFP A;  1DF0 A;  2KQ6 A;  1UHN A;  1JFK A;  1IGV A;  2WC8 A;  3EKJ A;  2HQW A;  3R1O A;  4ETO A;  1A2X A;  3A8R A;  3RM1 A;  3ZWH A;  1A29 A;  1GJY A;  1X02 A;  5AAN A;  3TDI A;  3ZNI A;  1OSA A;  2KGR A;  2LHL A;  1A75 A;  2OPO A;  2LMU A;  3LK1 A;  2E30 A;  3LLE A;  1OOH A;  2K7B A;  1SL7 A;  3Q8I A;  1DGV A;  1QAT A;  2JTT A;  2NLN A;  2ZKM X;  3CYZ A;  3TZ1 A;  3AAK A;  1TUJ A;  4OR9 B;  3I5H B;  4I5K A;  4XYN A;  3PM2 A;  5HLO A;  2M9G A;  3L4L A;  3OP0 A;  2FCE A;  3GOF A;  2ZND A;  2QPT A;  2LLT A;  1Z4H A;  4D1E A;  4C0K A;  2BEC A;  2OTG B;  1W7J B;  3FWC A;  1FBV A;  1XFV O;  1C7V A;  2JPO A;  1CFF A;  2KAV A;  3JVT B;  4FQO A;  5B8I B;  2LHI A;  1P28 A;  1BT6 A;  1QV0 A;  2EC6 B;  2P71 A;  1CMG A;  1CM1 A;  1M39 A;  2WCE A;  1DJW A;  1K95 A;  1Z2C B;  3JTD C;  1KQV A;  2M1U A;  2JXL A;  3PAT A;  1V1G A;  3OB2 B;  1YVL A;  3DY9 A;  5HLV A;  1E8A A;  3C1V A;  2WCF A;  2M29 A;  2OS8 B;  3O2P A;  1OMD A;  2CNP A;  1W9Z A;  2ZN9 A;  3CS1 A;  5JOL A;  1PRW A;  5I94 A;  1S26 D;  3D0Y B;  3FS7 A;  4BY5 A;  4MRX A;  2QEH A;  2E6W A;  1SR6 B;  1UUR A;  4MBE A;  1TIZ A;  1PSB A;  4WQ3 A;  1ORG A;  2K2A A;  3KHE A;  1NSH A;  3NXA A;  4JPZ B;  5CSI A;  5G08 A;  5AEQ A;  1BJF A;  5FI7 A;  1Y0V H;  1CLL A;  1N2D A;  3K21 A;  2FJY A;  1V1F A;  2JPT A;  2M1K B;  4R1E A;  1IJ5 A;  1XA5 A;  3IQQ A;  5DKQ A;  2CCM A;  1DEK A;  1SW8 A;  2KYF A;  3D10 A;  1J7Q A;  4M2O A;  1BOD A;  1KQM B;  4QJ5 B;  3SG5 A;  1B9A A;  1UHK A;  5AER A;  1CDM A;  1QS7 A;  1XFR A;  4I5L B;  2QEV A;  3BUX B;  2K8M B;  2KI4 C;  5I2O A;  2KFG A; 
#chains in the Genus database with same CATH homology
 4NQG A;  4HRG A;  1DJH A;  1XFZ O;  2LM5 A;  1QAS A;  1S5G Y;  1QVI Y;  1XFX O;  1F4O A;  2HPS A;  2EC6 C;  4IL1 A;  2LCP A;  2LV7 A;  2EGD A;  1NIW A;  3PAL A;  3TS5 B;  4N5X A;  1MHO A;  3VRP A;  1J1E A;  1IG5 A;  2LVJ A;  1ZOT B;  3O4Y A;  2JWW A;  3AAJ A;  1S6C A;  1F4Q A;  4OKH A;  4PHM A;  5F6T A;  1YR5 A;  5HKW A;  1KWO B;  1EL4 A;  1BU3 A;  2MJW B;  4PHK A;  1SPY A;  1MXL C;  2Q4U A;  1DJY A;  1A75 B;  3KF9 A;  2COL B;  3I5I C;  2KOT A;  1OZO A;  4DS7 A;  1S5G Z;  2F33 A;  1LVC D;  5FYX A;  4WRI A;  1KFU S;  2BCA A;  1KQM C;  1NCX A;  2KFF A;  3CR4 X;  4M2P A;  1TCF A;  1EXR A;  1QLK A;  1LIN A;  3KO0 A;  4N1F A;  1OMR A;  1PK0 D;  1KCY A;  2K0J A;  1R2U A;  1XK4 C;  2AMI A;  1OQP A;  4YGA A;  1NCZ A;  1NCY A;  4C0L A;  1RFJ A;  2Y4Q A;  1QIV A;  4FTG A;  2JXC A;  1YRT B;  5ER5 A;  1CLB A;  1MF8 B;  1K9K A;  4E68 A;  4PDZ A;  1CDL A;  1SCM B;  4GPL B;  2D8N A;  2QAC A;  4AQJ A;  2KAX A;  4OVN F;  3BYA A;  2CXJ A;  3I5F B;  4OCI A;  4I5N B;  1CFC A;  1HT9 A;  2JT8 A;  3A4U B;  2LLS A;  1F71 A;  3PLF B;  3RLZ A;  3OB1 B;  2ZFD A;  4U8D A;  1BF5 A;  1H8B A;  3LL8 B;  5KSZ A;  1CMF A;  1XK4 A;  1JF0 A;  1FPW A;  2JNX A;  1S3P A;  2ISD A;  3TUY C;  2WCB A;  3OX6 A;  4NDD A;  1UP5 A;  2K7D A;  2KGB C;  2Q91 A;  3BUN B;  1GQM A;  1YUS A;  2MHH A;  4N1G A;  5KTY A;  1CDN A;  1K90 D;  5HKZ A;  3DVE A;  1BMO A;  1YX7 A;  1D1O A;  1K8U A;  1KSM A;  1K94 A;  1WRL A;  1SCM C;  3PM8 A;  2BCB A;  4TNC A;  1LXF C;  4OV2 A;  1RRO A;  5D7F A;  5TNC A;  3DVK A;  1RJV A;  5IBW A;  1CLM A;  4XJK B;  2LVK A;  2BL0 C;  2JQ6 A;  1S6I A;  3TS5 C;  1CB1 A;  3PN7 B;  3DF0 B;  2EHB A;  4GUK A;  2KQY A;  1B1G A;  2BL0 B;  1B4C A;  2OTG C;  1B7T Z;  4MZL A;  2CTN A;  1OMV A;  1MWN A;  5AFP A;  4HRH A;  2KDH A;  4MZJ A;  4PHN A;  1U5I A;  2M0R A;  4PE0 A;  4YRU A;  2MLE C;  1SBJ A;  3EVR A;  1OE9 B;  1J1D A;  4ORB B;  3O78 A;  1CDP A;  4ORC B;  3TDU A;  1QVI Z;  3VRQ A;  5KU1 A;  1WRZ A;  1ALW A;  3EK8 A;  1TTX A;  3BOW A;  2MAZ A;  3DF0 A;  1KK7 Y;  1QJT A;  3EVV A;  4F0Z B;  2K7C A;  4CPV A;  4MRY A;  1MQ1 A;  4ZCU A;  4QJ3 B;  4C0J A;  4BY4 A;  1EG3 A;  4MLW A;  1EH2 A;  1NP8 A;  1F8H A;  5HYD A;  1DVI A;  1QIW A;  1BR1 B;  1UUS A;  1GGZ A;  3SG4 A;  2I7A A;  2BBM A;  2M7L A;  1AHR A;  2BCX A;  1Q80 A;  3VRO A;  1CNP A;  1K9P A;  2BKH B;  5PAL A;  4GBA A;  1CKK A;  2RGI A;  3KEV A;  2PRU A;  5AXI A;  2IS9 A;  1G4Y R;  2WOR A;  3SJS A;  1KFU L;  2CT9 A;  3HCM A;  3WHU B;  1AK8 A;  1BLQ A;  2ZN8 A;  3VRN A;  2KFH A;  1PSR A;  2KAY A;  2O5G A;  2FOT A;  1QTX A;  3DD4 A;  1M46 A;  3I5G C;  1XFY O;  1VRK A;  4YI8 A;  2BBN A;  1AJ4 A;  1F54 A;  1J7O A;  1DJG A;  1QX2 A;  2AAO A;  1YX8 A;  2F8P A;  1ODB A;  2BE4 A;  1HQV A;  1M31 A;  2CBL A;  3SIB A;  1ZUZ A;  2JZI A;  2LE9 B;  1K9U A;  3SG6 A;  3AKA A;  2FJU B;  1L2O B;  1Y1X A;  1SNL A;  2M97 A;  2F2O A;  4A4B A;  2JRF A;  1FI6 A;  1TNW A;  1AVS A;  1KK8 B;  5ER4 X;  1Y1U A;  1C07 A;  5JJG A;  5GQQ C;  1UHH A;  3IF7 A;  1SK6 D;  1K96 A;  3I5F C;  3KPX A;  2L2E A;  3O6B A;  1Y1A A;  3LK0 A;  4PAL A;  2LVI A;  1DJZ A;  1YRU B;  2L4H A;  3EKH A;  1UWO A;  2JT3 A;  4GGF A;  1CM4 A;  1QLS A;  4NDC A;  4PHJ A;  1BG1 A;  3MSE B;  2K7O A;  1SL8 A;  3QRX A;  4CID A;  1DJX A;  3CGA A;  4MZK A;  3PN7 C;  3M0W A;  1AJ5 A;  2GGM A;  3E3R A;  2LC5 A;  3TDZ A;  1REC A;  3BOW B;  1FW4 A;  1QV1 A;  4DRW A;  2LUX A;  1K2H A;  1IH0 A;  3BUW B;  3CWG A;  3JVT C;  2LLU A;  1CTR A;  1LA3 A;  4ICB A;  1QX7 A;  1NX2 A;  3SG3 A;  4UPG A;  1B8C A;  5CSJ A;  3EK4 A;  1DJI A;  1QX5 B;  1QXP A;  5BPJ A;  3WHT B;  4MEW A;  4GAO A;  1JWD A;  4GGN A;  3DVM A;  4GFT A;  2LNK A;  3LCP C;  3PFV A;  1JUO A;  3TUY B;  4MN0 A;  2PSR A;  5I8N A;  2L50 A;  2NCO A;  1JBA A;  1ALV A;  2I18 A;  4YI9 A;  3JTD B;  3PSR A;  1AUI B;  4ORA B;  1WLZ A;  2M7N A;  3BXK A;  4WQ2 A;  2KYC A;  1PVA A;  2L5X B;  2ZNE A;  3CLN A;  1TN4 A;  1SKT A;  1WRK A;  1PAL A;  3SIA A;  5HKY A;  2PVB A;  2PAS A;  3BQ3 A;  3VGO A;  2LAP A;  2LUC A;  1S6J A;  2MLF C;  2WOS A;  2JT0 A;  1OOJ A;  1IRJ A;  1SRA A;  1TOP A;  2GGZ A;  1J7P A;  1IJ6 A;  1FF1 A;  1A03 A;  2R2I A;  1G8I A;  1KWO C;  1M45 A;  1SR6 C;  1YUU A;  2SCP A;  2Y1N A;  3NSL A;  4AOM A;  1AP4 A;  4MSP A;  4L9M A;  1KFX S;  3IQO A;  2DOQ A;  2O60 A;  4YGB B;  2PAL A;  2JC2 A;  2P6B B;  1CFD A;  2ZRT A;  3WXA A;  5K89 A;  1S36 A;  2GV5 A;  4ZCV A;  3CZT X;  2I94 A;  1IQ3 A;  2FCD A;  3SG2 A;  3NSI A;  2BKI B;  2F3Y A;  1SYM A;  4JWQ A;  1UHJ A;  5DKN A;  1JFJ A;  1G33 A;  1MUX A;  2K2F A;  1ZFS A;  2LP2 A;  1PVB A;  3CR2 A;  1KSO A;  4CLN A;  3FWB A;  2KSP A;  1XVJ A;  4HSZ A;  2JU0 A;  1WDC B;  5CSN A;  4PE4 A;  4QJ4 B;  2HET A;  1YUR A;  1W7I B;  1XFW O;  5CSF A;  3I5G B;  3CR5 X;  3GK4 X;  4PE7 A;  1NYA A;  2A4J A;  5I2Q A;  3AKB A;  2KI6 D;  1K93 D;  1U5I B;  1JF2 A;  2WND A;  2B1U A;  2H61 A;  2MA2 A;  1Y6W A;  1YTZ C;  2Y1M A;  3H4S E;  1IWQ A;  2LVV A;  2L51 A;  2LMV A;  3OX5 A;  4YGD B;  2BE6 A;  2G2B A;  4P5O E;  4DCK A;  1H4B A;  1J55 A;  3BUO B;  2AUC A;  1L7Z A;  3ICB A;  3EVU A;  1J7R A;  3NSK A;  4JQ0 D;  1RK9 A;  1WY9 A;  1TCO B;  2KI4 B;  2H61 C;  2M3W A;  1WLM A;  2NZ0 A;  3I5H C;  2KHN A;  1ZMZ A;  4HRE E;  1DGU A;  4GGF C;  4YGC B;  1MR8 A;  2SAS A;  3D0Y A;  4CFR A;  3F45 A;  1TNQ A;  1WDC C;  1A4P A;  1B7T Y;  2NXQ A;  1F55 A;  1NPQ A;  1RTP 1;  1R6P A;  1BR4 B;  4USL A;  5J3X A;  2NCP A;  1F70 A;  1SMG A;  2VRG A;  1NX0 A;  1SY9 A;  1NX3 A;  1FI5 A;  2HF5 A;  2KNE A;  1PUL A;  1SCV A;  2HQ8 A;  1IKU A;  3VRR A;  2M8U A;  1UHI A;  2G9B A;  1OZS A;  1IQ5 A;  1MXE A;  2L98 A;  3WNX B;  3BUM B;  1TRF A;  2KBM A;  1ZAC A;  2M49 B;  1YUT A;  2L4I A;  2OS8 C;  4PCW A;  4DUQ A;  4PE1 A;  1JC2 A;  1SL9 A;  1LKJ A;  3CTN A;  4AQI A;  2MRD A;  5DKR A;  1BOC A;  4MVF A;  2KI6 C;  1XO5 A;  2KBI A;  2LAN A;  1DT7 B;  1NUB A;  2I2R E;  2JNF A;  1N0Y A;  2JUL A;  1LA0 A;  1S1E A;  3SG7 A;  2JTZ A;  2JOJ A;  2K61 A;  3EK7 A;  4M2Q A;  1YVH A;  1EJ3 A;  2V53 A;  1DF0 B;  3DVJ A;  1B8L A;  3GK1 A;  2LP3 A;  1DMO A;  1XFU O;  2F3Z A;  1EG4 A;  4GNK B;  4A4C A;  3OHM B;  2F2P A;  2PMY A;  2Y5I A;  1KFX L;  1B47 A;  5D69 A;  4NDB A;  4Q04 A;  3I5I B;  3GK2 A;  2L0P A;  1NWD A;  1C7W A;  3HX4 A;  4DIR A;  4CFQ A;  2ZRS A;  1NX1 A;  3FIA A;  4P2Y B;  4YBH B;  1RWY A;  1DTL A;  5CPV A;  2MBX A;  4I5J A;  3NSO A;  2H2K A;  4XJK A;  1JSA A;  1B8R A;  1XYD A;  1KK7 Z;  1L2O C;  1TNX A;  2TN4 A;  1GGW A;  1KK8 C;  1M63 B;  1N65 A;  2LMT A;  5I2L A;  1TNP A;  4YGE B;  1CFP A;  1DF0 A;  2KQ6 A;  1UHN A;  1JFK A;  1IGV A;  2WC8 A;  3EKJ A;  2HQW A;  4ETO A;  1A2X A;  3A8R A;  3RM1 A;  3ZWH A;  1A29 A;  1GJY A;  1X02 A;  5AAN A;  3TDI A;  3ZNI A;  1OSA A;  2KGR A;  2LHL A;  1A75 A;  2OPO A;  2LMU A;  3LK1 A;  2E30 A;  3LLE A;  2K7B A;  1SL7 A;  1DGV A;  1QAT A;  2JTT A;  2NLN A;  2ZKM X;  3TZ1 A;  3AAK A;  4OR9 B;  3I5H B;  4I5K A;  4XYN A;  5HLO A;  2M9G A;  3OP0 A;  2FCE A;  3GOF A;  2ZND A;  2QPT A;  2LLT A;  4D1E A;  4C0K A;  2BEC A;  2OTG B;  1W7J B;  3FWC A;  1FBV A;  1XFV O;  1C7V A;  1CFF A;  2KAV A;  3JVT B;  4FQO A;  5B8I B;  2LHI A;  1BT6 A;  1QV0 A;  2EC6 B;  1CMG A;  1CM1 A;  1M39 A;  2WCE A;  1DJW A;  1K95 A;  3JTD C;  1KQV A;  2M1U A;  2JXL A;  3PAT A;  1V1G A;  3OB2 B;  1YVL A;  5HLV A;  1E8A A;  3C1V A;  2WCF A;  2M29 A;  2OS8 B;  3O2P A;  1OMD A;  2CNP A;  2ZN9 A;  5JOL A;  3CS1 A;  1PRW A;  1S26 D;  3D0Y B;  3FS7 A;  4BY5 A;  4MRX A;  2E6W A;  1SR6 B;  1UUR A;  4MBE A;  1TIZ A;  1PSB A;  4WQ3 A;  2K2A A;  3KHE A;  1NSH A;  3NXA A;  4JPZ B;  5CSI A;  5G08 A;  5AEQ A;  1BJF A;  1Y0V H;  1CLL A;  1N2D A;  3K21 A;  1V1F A;  2JPT A;  2M1K B;  4R1E A;  1IJ5 A;  1XA5 A;  3IQQ A;  5DKQ A;  2CCM A;  1SW8 A;  3D10 A;  2KYF A;  1J7Q A;  4M2O A;  1BOD A;  1KQM B;  4QJ5 B;  3SG5 A;  1B9A A;  1UHK A;  5AER A;  1CDM A;  1QS7 A;  4I5L B;  3BUX B;  2K8M B;  2KI4 C;  5I2O A;  2KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...