1NYAA

Nmr solution structure of calerythrin, an ef-hand calcium-binding protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
176
Chain Sequence
TTAIASDRLKKRFDRWDFDGNGALERADFEKEAQHIAEAFGKDAGAAEVQTLKNAFGGLFDYLAKEAGVGSDGSLTEEQFIRVTENLIFEQGEASFNRVLGPVVKGIVGMCDKNADGQINADEFAAWLTALGMSKAEAAEAFNQVDTNGNGELSLDELLTAVRDFHFGRLDVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calerythrin
publication title NMR solution structure of calerythrin, an EF-hand calcium-binding protein from Saccharopolyspora erythraea
pubmed doi rcsb
source organism Saccharopolyspora erythraea
total genus 46
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nyaA00
1LINA 4HRGA 4QJ4B 2TN4A 5HLVA 2AAOA 1N65A 2K7BA 2WCEA 4PALA 4YGBB 4ETOA 1B1GA 4YGCB 1IJ5A 1DJZA 2I2RE 3EVRA 2KQYA 1YUTA 1NX0A 1QX7A 5ER4X 2LMUA 2K61A 2ZN9A 2LANA 1L2OB 2EC6C 1SL8A 3CS1A 1B8RA 1C7VA 1YRTB 2KAXA 1WRKA 4A4BA 1DJIA 1QIWA 4I5KA 1GQMA 3CR4X 1SK6D 2LUCA 4GAOA 1KK8C 1OSAA 3VRPA 1NWDA 1L7ZA 2E6WA 2F2OA 3SG5A 2LP2A 3SG7A 3DVKA 4C0JA 2LVIA 3BXKA 2FCEA 1UHNA 4CFQA 1NSHA 2BKIB 3WXAA 5IBWA 2LV7A 1AP4A 4MSPA 1B4CA 3EK4A 3DF0A 3PM8A 4HSZA 4N1GA 2B1UA 1WRZA 2FOTA 2LM5A 3K21A 1KCYA 3SG2A 1SCMB 1CDPA 1SMGA 4USLA 2HPSA 2KI4B 1S36A 1LA3A 3IF7A 4WRIA 1MUXA 2KQ6A 1K90D 1TNQA 3EK8A 1PALA 1K9KA 2NZ0A 3OB1B 4WQ2A 1V1FA 1XFZO 3BYAA 4GGFC 1XFYO 2BKHB 4TNCA 1J7QA 4ORCB 2JULA 5HKZA 3KO0A 3I5HC 3EVVA 2JU0A 3CGAA 1Y0VH 5HLOA 2COLB 4P5OE 1B8LA 1UP5A 1YUUA 1U5IB 1F4OA 2K7OA 1BMOA 1XK4C 4DUQA 2MA2A 5TNCA 4F0ZB 4HRHA 1W7IB 2KYCA 1S5GZ 3BUNB 4CIDA 2LAPA 1KSOA 5FYXA 2BL0C 1DJYA 2F3YA 2ZNDA 1YVLA 1K2HA 3KHEA 3JVTB 2NLNA 1OOJA 2M9GA 2PVBA 1SRAA 1SPYA 4XJKA 1G4YR 5HKWA 3IQQA 2OS8B 3GK1A 3PSRA 1S26D 4AOMA 1KFUL 4Q04A 2M7LA 4D1EA 1N2DA 1IQ5A 1ZFSA 3ICBA 3D0YA 4MBEA 2KFGA 2BECA 2I18A 1FBVA 1KWOB 4N1FA 4QJ5B 2ZKMX 1RJVA 3I5FB 5KTYA 1DMOA 3JTDB 2WORA 1SL9A 1NX3A 1BOCA 1SNLA 1SR6B 3LLEA 4P2YB 3ZNIA 1DF0B 1WLMA 3VGOA 1MQ1A 3WNXB 1EJ3A 4UPGA 2DOQA 2K2FA 2MJWB 1QLKA 1QLSA 2LC5A 3TZ1A 1DJWA 1A75B 2HQWA 3KPXA 1KK7Y 4GFTA 4A4CA 3KEVA 5DKQA 3NSLA 1KQMC 1ALWA 1LXFC 2Q91A 1Y1AA 1WDCB 4ICBA 1A4PA 2K8MB 2M29A 1YX7A 2EGDA 3CWGA 3TS5C 1IG5A 2Y5IA 3LCPC 2LP3A 2M97A 1AHRA 3O78A 1SY9A 2M8UA 2KDHA 2NXQA 2QACA 2L5XB 4PE4A 2K7CA 2SCPA 2R2IA 1M31A 5HKYA 1IQ3A 1F55A 1IWQA 1RK9A 2Q4UA 3RM1A 2P6BB 1CKKA 5AFPA 1DJHA 4WQ3A 1RFJA 1TTXA 1DVIA 2M49B 4ORBB 2M7NA 1CM4A 5K89A 2LLUA 1CFFA 1JUOA 1F71A 4MRYA 4L9MA 3FWBA 4YBHB 1M46A 1JSAA 4FQOA 1RROA 3PN7C 1AK8A 1K95A 5F6TA 4ZCVA 3SIBA 2E30A 1TCFA 4FTGA 1HQVA 4M2OA 4OR9B 3FIAA 1LA0A 1Y6WA 1NCZA 3CR2A 3BOWB 1HT9A 2JPTA 1PULA 4GUKA 1ALVA 1ZACA 2FCDA 2OTGC 5J3XA 2M1KB 5I8NA 2I7AA 1CLLA 2ZN8A 3I5GB 1AVSA 2QPTA 2L50A 2HF5A 4CLNA 1KFUS 3VRRA 4ZCUA 1E8AA 5AEQA 1SKTA 1JC2A 5B8IB 1F70A 2JQ6A 1J55A 2Y1MA 2L98A 1CDLA 2HETA 5I2QA 1OQPA 1CDNA 2WC8A 4PHJA 2MHHA 2CCMA 1TN4A 2JTTA 1SL7A 2KAVA 1YVHA 4NDBA 1J7PA 1VRKA 3BUOB 2KI6D 1QATA 2NCPA 1S6IA 1YTZC 1QV0A 1NP8A 1FW4A 4GNKB 3SG3A 1OMVA 3SIAA 2HQ8A 3NSOA 3E3RA 5G08A 1IRJA 3VRNA 5DKRA 2KI6C 4CFRA 2BCBA 1JFJA 4OVNF 2SASA 2CBLA 1CB1A 1YR5A 2JOJA 2OPOA 2WCBA 2LCPA 1UHJA 2KOTA 2H61C 2EC6B 3FS7A 3DF0B 2F3ZA 2BBMA 1Y1UA 4R1EA 3HCMA 2ZRSA 1W7JB 1OE9B 1KK8B 1KFXL 1M45A 3I5IC 1NPQA 1F54A 1U5IA 3TUYC 1NX1A 1QV1A 2KNEA 1AJ4A 1CTRA 3GOFA 3NXAA 2MRDA 3NSKA 1RWYA 5KSZA 1A2XA 5CSIA 1YRUB 3IQOA 2H61A 1X02A 1A29A 1IH0A 1OMRA 4HREE 4QJ3B 4M2PA 4PHMA 1UWOA 1NUBA 2M1UA 1CNPA 3GK4X 2KGBC 1OZSA 1K9PA 2JXCA 3QRXA 4IL1A 3CTNA 2M3WA 1MHOA 1OMDA 3MSEB 2D8NA 2KBMA 2GGMA 2AMIA 4PCWA 1FF1A 2BBNA 1TIZA 2LNKA 1JF2A 3I5HB 2M0RA 2CTNA 4MLWA 4XJKB 4MZJA 1K96A 4DRWA 1V1GA 2JT0A 4DS7A 1RTP1 1CFDA 4DIRA 1M63B 1B9AA 1J7RA 1R6PA 1GJYA 3O2PA 3D0YB 3WHTB 2ZRTA 2AUCA 2KGRA 1QJTA 2BL0B 2KAYA 1XFVO 3D10A 4JPZB 1QXPA 2BCAA 2MBXA 1JWDA 2BE4A 1KK7Z 4MZLA 2LUXA 1WRLA 4MRXA 1XO5A 1BT6A 1XVJA 3ZWHA 1OZOA 3BQ3A 2LVJA 1BJFA 5CPVA 2MLFC 4OCIA 1TRFA 1BG1A 4YRUA 3TDUA 5AANA 1YX8A 3F45A 2PSRA 1BLQA 1K9UA 1MWNA 4YGEB 2PMYA 2CXJA 3A8RA 2LMTA 3AKBA 1ZUZA 1K94A 4XYNA 5ER5A 3O6BA 4PDZA 2G2BA 1S6CA 3BUWB 4OKHA 2FJUB 3CLNA 1MR8A 2JXLA 3LK1A 1MF8B 1Q80A 4JQ0D 4NDCA 4MZKA 2O60A 5HYDA 2WNDA 2WOSA 2KBIA 1L2OC 1KFXS 2WCFA 4PHNA 1LVCD 1EXRA 1RECA 1KQMB 1FI5A 2RGIA 1ZMZA 1DTLA 1QTXA 1G8IA 3A4UB 1WY9A 3TS5B 1PVBA 2L51A 4PE1A 1R2UA 4PE0A 2GV5A 1UUSA 1G33A 1B47A 3OX6A 1CMFA 1GGWA 3NSIA 1UHHA 1CLMA 1ODBA 2ISDA 1N0YA 5AERA 1JFKA 3BUXB 2H2KA 2JT8A 4PHKA 2IS9A 3C1VA 2F2PA 4MEWA 3LK0A 1AJ5A 4M2QA 3TDIA 1SCMC 3VRQA 2KI4C 2GGZA 1SW8A 1S1EA 5D7FA 1BODA 1CFPA 4YI8A 1D1OA 1F8HA 4OV2A 4U8DA 2PRUA 1PVAA 2BE6A 3PN7B 2K0JA 1EL4A 1DGUA 1XFXO 1J1DA 1DT7B 2K2AA 2LVKA 1JBAA 3AAKA 3WHUB 5CSNA 4YGAA 1PK0D 2G9BA 3GK2A 2CNPA 5DKNA 1UHIA 1TCOB 1IGVA 3EVUA 4GBAA 4DCKA 1XFUO 4GGNA 2L2EA 2OTGB 3M0WA 1M39A 1BR4B 3KF9A 4I5JA 4ORAB 3PATA 3OX5A 1J7OA 2LHIA 3DD4A 3JVTC 3SG4A 1SYMA 2Y1NA 2OS8C 1SBJA 3OB2B 2VRGA 1PRWA 1CFCA 2LMVA 1XYDA 1C07A 1PSRA 2KYFA 1B7TY 2L0PA 1QVIY 1KQVA 1B8CA 1K93D 1KWOC 1TNPA 3CZTX 2ZNEA 3EK7A 1EH2A 1CLBA 1XA5A 1UURA 3I5FC 3JTDC 1B7TZ 1QX5B 1BF5A 4BY4A 5JJGA 1CMGA 1QVIZ 3EKHA 1SR6C 1H4BA 1S5GY 3RLZA 1C7WA 3PLFB 3O4YA 1NX2A 1S3PA 4AQJA 1NYAA 1YUSA 1Y1XA 2KSPA 2KHNA 2MAZA 2Y4QA 2PALA 4MN0A 1FI6A 5AXIA 1TNWA 2LLTA 3DVMA 1EG3A 3TDZA 1IJ6A 2O5GA 4GGFA 1WDCC 4NDDA 1GGZA 2JNXA 1AUIB 1JF0A 3I5IB 3AKAA 1DJGA 1CDMA 1QASA 1YURA 3TUYB 4JWQA 1DF0A 4YI9A 1XK4A 1KSMA 1WLZA 4BY5A 4C0KA 4GPLB 1DGVA 4CPVA 2L4HA 1PSBA 1H8BA 1A75A 3SJSA 1MXEA 3PFVA 1K8UA 2NCOA 1FPWA 2BCXA 1NIWA 1DJXA 1QIVA 4AQIA 3BUMB 3FWCA 1CM1A 1F4QA 3H4SE 3PALA 4PE7A 5JOLA 5I2LA 3SG6A 1QS7A 3VROA 2EHBA 4MVFA 1TNXA 2JT3A 1NCXA 5D69A 1ZOTB 1LKJA 4N5XA 1TOPA 2JTZA 1SCVA 2K7DA 3OP0A 5BPJA 3DVEA 3EKJA 1J1EA 1XFWO 1EG4A 1QX2A 1IKUA 2I94A 1A03A 2KFFA 2JZIA 2L4IA 1MXLC 4YGDB 2JNFA 2LVVA 2MLEC 5CSJA 2F33A 1NCYA 3OHMB 5KU1A 5GQQC 2LHLA 3LL8B 2F8PA 2PASA 3CR5X 3I5GC 4NQGA 4C0LA 3HX4A 2JC2A 3AAJA 1S6JA 4E68A 2V53A 2ZFDA 5PALA 2KFHA 5CSFA 1BR1B 1UHKA 3DVJA 1BU3A 4I5LB 2A4JA 2CT9A 2JWWA 2JRFA 2LE9B 5I2OA 2LLSA 4I5NB 3BOWA
chains in the Genus database with same CATH superfamily
3PM2A 1LINA 4HRGA 4QJ4B 2TN4A 5HLVA 2PQLA 2AAOA 1N65A 2K7BA 2WCEA 4PALA 4YGBB 4ETOA 1B1GA 4YGCB 1IJ5A 1DJZA 2I2RE 3EVRA 1Z2CB 2KQYA 1YUTA 1NX0A 1QX7A 5ER4X 2LMUA 2K61A 2ZN9A 2LANA 1L2OB 2EC6C 1SL8A 3CS1A 1B8RA 1C3YA 1YRTB 2KAXA 1WRKA 1C7VA 4A4BA 1DJIA 1QIWA 1OOGA 4I5KA 1GQMA 3CR4X 1SK6D 1DEKA 2LUCA 1KK8C 1OSAA 4GAOA 3VB1A 3VRPA 1NWDA 3S0FA 1L7ZA 2E6WA 4OZDA 2F2OA 3SG5A 2LP2A 3SG7A 3DVKA 4C0JA 2LVIA 3BXKA 2FCEA 1UHNA 4CFQA 1NSHA 2BKIB 3WXAA 5IBWA 2LV7A 1AP4A 2P70A 4MSPA 3EK4A 3DF0A 3V2LA 1B4CA 3PM8A 4HSZA 4N1GA 2B1UA 1DC1A 1WRZA 2FOTA 2LM5A 3K21A 3SS4A 3SG2A 1KCYA 3S0EA 1SCMB 3QMEA 1CDPA 1SMGA 4USLA 2HPSA 2KI4B 1S36A 1LA3A 3IF7A 4WRIA 1MUXA 2KQ6A 2WCLA 1K90D 1TNQA 3EK8A 4INXA 1PALA 1K9KA 2NZ0A 3OB1B 4WQ2A 1V1FA 1XFZO 3BYAA 4GGFC 1XFYO 2BKHB 4TNCA 1J7QA 4ORCB 2JULA 5HKZA 3KO0A 3I5HC 3EVVA 2JU0A 3CGAA 1Y0VH 5HLOA 2COLB 4JD9A 2P71A 4P5OE 1B8LA 1UP5A 1YUUA 1U5IB 1F4OA 2K7OA 1BMOA 1XK4C 4DUQA 2MA2A 4FQTA 2QEBA 3L47A 5TNCA 4F0ZB 4HRHA 1W7IB 2KYCA 1S5GZ 3BUNB 4CIDA 2LAPA 1KSOA 5FYXA 2BL0C 1DJYA 3DY9A 3OBVA 2F3YA 2ZNDA 3N7HA 1YVLA 1K2HA 3KHEA 3JVTB 2NLNA 1OOJA 2M9GA 2PVBA 1SRAA 1SPYA 4XJKA 1G4YR 5HKWA 3IQQA 2OS8B 1TWOA 3GK1A 1S26D 3PSRA 3Q8IA 1KFUL 4Q04A 2M7LA 4AOMA 4D1EA 1N2DA 1IQ5A 1ZFSA 3ICBA 3R1OA 3D0YA 3D77A 4MBEA 2KFGA 2BECA 2I18A 1FBVA 1KWOB 4N1FA 4QJ5B 2ZKMX 1RJVA 3I5FB 5KTYA 1DMOA 3JTDB 2WORA 1SL9A 1NX3A 5HL1A 1BOCA 1SNLA 1SR6B 3LLEA 4P2YB 3R72A 4F7FA 3ZNIA 1DF0B 1WLMA 3VGOA 1MQ1A 3WNXB 1EJ3A 4UPGA 2DOQA 2K2FA 2MJWB 1JC2A 1QLKA 1QLSA 1XFRA 2LC5A 1DJWA 3TZ1A 1A75B 2HQWA 3KPXA 1KK7Y 4GFTA 4A4CA 2KLDA 3KEVA 5DKQA 3NSLA 1KQMC 1ALWA 1LXFC 2Q91A 1Y1AA 1WDCB 4ICBA 1A4PA 2K8MB 3D74A 2M29A 1YX7A 2EGDA 3CWGA 3TS5C 2WCHA 2WC5A 3S0AA 1IG5A 2Y5IA 3LCPC 2LP3A 1C3ZA 2M97A 1OOHA 1AHRA 3O78A 1SY9A 2M8UA 1P28A 2KDHA 2NXQA 2QACA 2L5XB 4PE4A 2K7CA 2SCPA 2R2IA 1M31A 5HKYA 1IQ3A 1F55A 1IWQA 1RK9A 2Q4UA 3RM1A 2P6BB 1CKKA 5AFPA 1DJHA 2PYQA 4WQ3A 1RFJA 1TTXA 3OGNA 1DVIA 2M49B 4ORBB 2M7NA 1CM4A 5K89A 2LLUA 1CFFA 2GTEA 1JUOA 3L4AA 4MRYA 1F71A 4L9MA 3FWBA 4YBHB 1T14A 1M46A 1JSAA 4FQOA 1RROA 3PN7C 1AK8A 1K95A 5F6TA 4ZCVA 3B6XA 3SIBA 2E30A 3PJIA 1TCFA 4FTGA 1HQVA 4M2OA 4OR9B 3FIAA 1LA0A 1Y6WA 1NCZA 3CR2A 3BOWB 1HT9A 2JPTA 1PULA 4GUKA 1ALVA 1ZACA 2FCDA 2OTGC 5J3XA 2M1KB 2FJYA 5I8NA 2I7AA 2KPHA 1CLLA 2ZN8A 3I5GB 1AVSA 2QPTA 2L50A 2HF5A 4CLNA 1KFUS 3VRRA 4ZCUA 1E8AA 5AEQA 1SKTA 3CZ1A 5B8IB 1F70A 2JQ6A 1J55A 2Y1MA 2L98A 1CDLA 2HETA 1LS8A 5I2QA 1OQPA 1CDNA 2WC8A 4PHJA 2MHHA 2CCMA 1TN4A 2JTTA 1SL7A 2KAVA 1YVHA 4NDBA 1J7PA 1SSEB 2BNXA 1VRKA 3BUOB 2KI6D 1QATA 2NCPA 1S6IA 1YTZC 1QV0A 1NP8A 1FW4A 4GNKB 3SG3A 1OMVA 3SIAA 2HQ8A 3NSOA 3E3RA 5G08A 1IRJA 3VRNA 5DKRA 3D75A 2KI6C 3BFAA 2QEOA 4CFRA 2BCBA 1JFJA 3DYEA 4OVNF 2SASA 2CBLA 1CB1A 1YR5A 2JOJA 2OPOA 2WCBA 2LCPA 1UHJA 2KOTA 2H61C 2EC6B 3FS7A 3DF0B 5I94A 2F3ZA 2BBMA 1Y1UA 3EG5B 4R1EA 3HCMA 2ZRSA 1W7JB 1OE9B 3CABA 1KK8B 1KFXL 1M45A 3I5IC 1NPQA 1F54A 2K60A 1JBAA 1U5IA 2WCKA 3TUYC 1NX1A 1QV1A 1GM0A 2KNEA 1AJ4A 1CTRA 3GOFA 3NXAA 2MRDA 3IVTA 3NSKA 1RWYA 5KSZA 2L5YA 1A2XA 5CSIA 1YRUB 3IQOA 2H61A 1A29A 1X02A 1IH0A 1OMRA 4HREE 4QJ3B 5D3OA 4M2PA 4PHMA 1UWOA 1NUBA 2M1UA 1CNPA 3GK4X 2KGBC 1OZSA 1K9PA 2JXCA 3QRXA 1DQEA 4IL1A 3CTNA 2M3WA 1MHOA 1OMDA 3MSEB 2D8NA 3B87A 2KBMA 2GGMA 2AMIA 4PCWA 1FF1A 2BBNA 1TIZA 2LNKA 1JF2A 3I5HB 2M0RA 2CTNA 4MLWA 4XJKB 4MZJA 1K96A 4DRWA 1V1GA 3SS3A 2JT0A 4DS7A 1RTP1 1CFDA 1TUJA 4DIRA 1M63B 1B9AA 1J7RA 1R6PA 1GJYA 3O2PA 3D0YB 3WHTB 2ZRTA 2AUCA 2KGRA 1QJTA 2BL0B 2KAYA 1XFVO 2WCJA 3D10A 4JPZB 1QXPA 2BCAA 2MBXA 1JWDA 2BE4A 1KK7Z 4MZLA 2LUXA 1WRLA 4MRXA 1XO5A 1BT6A 1XVJA 3ZWHA 1OZOA 3BQ3A 2LVJA 1BJFA 5CPVA 2MLFC 4OCIA 2WCMA 1TRFA 1BG1A 4YRUA 5FI7A 3TDUA 5AANA 1YX8A 3F45A 2PSRA 1BLQA 1K9UA 1ORGA 1MWNA 4YGEB 2PMYA 2CXJA 3A8RA 2LMTA 3AKBA 4KYNA 1ZUZA 1K94A 4XYNA 5ER5A 3O6BA 4PDZA 2G2BA 1S6CA 3BUWB 4OKHA 2FJUB 3CLNA 1MR8A 2JXLA 3LK1A 1MF8B 1Q80A 4JQ0D 3CZ0A 4MZKA 4NDCA 2O60A 5HYDA 3DZTA 2WNDA 2WOSA 2KBIA 1L2OC 1KFXS 2WCFA 5DICA 3S0DA 4PHNA 1LVCD 1EXRA 1RECA 3B86A 1KQMB 1FI5A 2RGIA 1ZMZA 1DTLA 1QTXA 1G8IA 3A4UB 1WY9A 3FE9A 3TS5B 1PVBA 2L51A 4PE1A 1R2UA 4PE0A 2GV5A 1UUSA 3CDNA 1G33A 1B47A 3OX6A 1CMFA 1GGWA 3NSIA 1UHHA 1CLMA 1ODBA 3CYZA 2ISDA 1N0YA 5AERA 1JFKA 3BUXB 3FE8A 2H2KA 2JT8A 4PHKA 2IS9A 1OW4A 2F2PA 3C1VA 4MEWA 3LK0A 3R1PA 1AJ5A 3O4XA 4M2QA 3TDIA 1SCMC 3BFHA 3B88A 1TUZA 3B7AA 3VRQA 2KI4C 2GGZA 1SW8A 2QEVA 1S1EA 5D7FA 1BODA 1CFPA 4YI8A 1D1OA 1F8HA 4OV2A 4U8DA 2PRUA 1PVAA 2BE6A 3PN7B 2K0JA 1EL4A 1DGUA 1XFXO 1J1DA 1DT7B 2K2AA 2LVKA 1DELA 3FE6A 3RZSA 3AAKA 3WHUB 5CSNA 4YGAA 1OOFA 1PK0D 3D76A 2G9BA 3GK2A 2CNPA 5DKNA 1UHIA 1TCOB 1IGVA 3EVUA 4GBAA 3S0BA 1XFUO 4GGNA 4DCKA 2L2EA 2OTGB 2YGUA 3M0WA 1M39A 1BR4B 3R1VA 3KF9A 4I5JA 4ORAB 3PATA 3OX5A 3BFBA 1QWVA 1J7OA 2LHIA 3DD4A 3JVTC 3SG4A 1SYMA 2Y1NA 2KLEA 2OS8C 1SBJA 3OB2B 2VRGA 1PRWA 1CFCA 2LMVA 1XYDA 3NHIA 1C07A 1PSRA 3NHTA 2KYFA 1B7TY 2L0PA 2H8VA 3SS5A 1QVIY 3UO9A 1KQVA 1B8CA 1K93D 1KWOC 1TNPA 2QEHA 2ZNEA 3CZTX 3EK7A 1CLBA 1EH2A 1XA5A 1UURA 3I5FC 3JTDC 1B7TZ 1QX5B 1BF5A 4BY4A 5JJGA 1OOIX 1CMGA 1QVIZ 3EKHA 1SR6C 1H4BA 1S5GY 3RLZA 1C7WA 3BJHA 3PLFB 3O4YA 3S0GA 1NX2A 1S3PA 2WC6A 4AQJA 1NYAA 1YUSA 1Y1XA 2KSPA 2KHNA 2MAZA 2Y4QA 2PALA 4MN0A 1FI6A 5AXIA 1TNWA 2LLTA 3DVMA 1EG3A 5FI6A 1IJ6A 3TDZA 2O5GA 4GGFA 1WDCC 4IJ7A 1GGZA 2JNXA 4NDDA 1AUIB 3DXLA 1Z4HA 1JF0A 3I5IB 2L2CA 3AKAA 1DJGA 3CZ2A 1CDMA 1QASA 1YURA 3TUYB 3UNWA 4JWQA 1DF0A 2JPOA 4YI9A 1XK4A 1KSMA 1WLZA 4BY5A 4C0KA 3L4LA 1DGVA 4GPLB 4CPVA 2L4HA 1PSBA 1H8BA 1A75A 3SJSA 1MXEA 2ERBA 3PFVA 1K8UA 2NCOA 1FPWA 2BCXA 1NIWA 1DJXA 1QIVA 4AQIA 3BUMB 3FWCA 1CM1A 1W9ZA 1F4QA 3K1EA 3H4SE 3PALA 3NGVA 4PE7A 4INWA 5JOLA 5I2LA 3SG6A 1QS7A 2BAPA 5FI2A 3VROA 2EHBA 4MVFA 1TNXA 2JT3A 1NCXA 1IIOA 2QDIA 5D69A 1ZOTB 1LKJA 4N5XA 1TOPA 2JTZA 1SCVA 2K7DA 3OP0A 5BPJA 3DVEA 4JKTA 3D78A 3EKJA 1J1EA 1XFWO 1EG4A 5EL2A 1QX2A 1IKUA 2I94A 1A03A 2KFFA 2JZIA 2L4IA 1MXLC 4YGDB 2JNFA 2LVVA 2MLEC 5CSJA 3D73A 2F33A 1NCYA 3OHMB 5KU1A 5GQQC 2LHLA 3LL8B 2F8PA 2PASA 3CR5X 3I5GC 4NQGA 4C0LA 3HX4A 2JC2A 3AAJA 1S6JA 4E68A 2V53A 2ZFDA 5PALA 2KFHA 5CSFA 1BR1B 1UHKA 3DVJA 1BU3A 4I5LB 2A4JA 2CT9A 2JWWA 2JRFA 2LE9B 4PT1A 5I2OA 2LLSA 4I5NB 3BOWA
chains in the Genus database with same CATH topology
1LINA 4HRGA 4QJ4B 2TN4A 5HLVA 2AAOA 1N65A 2K7BA 2WCEA 4PALA 4YGBB 4ETOA 1B1GA 4YGCB 1IJ5A 1DJZA 2I2RE 3EVRA 2KQYA 1YUTA 1NX0A 1QX7A 5ER4X 2LMUA 2K61A 2ZN9A 2LANA 1L2OB 2EC6C 1SL8A 3CS1A 1B8RA 1C7VA 1YRTB 2KAXA 1WRKA 4A4BA 1DJIA 1QIWA 4I5KA 1GQMA 3CR4X 1SK6D 2LUCA 4GAOA 1KK8C 1OSAA 3VRPA 1NWDA 1L7ZA 2E6WA 2F2OA 3SG5A 2LP2A 3SG7A 3DVKA 4C0JA 2LVIA 3BXKA 2FCEA 1UHNA 4CFQA 1NSHA 2BKIB 3WXAA 5IBWA 2LV7A 1AP4A 4MSPA 1B4CA 3EK4A 3DF0A 3PM8A 4HSZA 4N1GA 2B1UA 1WRZA 2FOTA 2LM5A 3K21A 1KCYA 3SG2A 1SCMB 1CDPA 1SMGA 4USLA 2HPSA 2KI4B 1S36A 1LA3A 3IF7A 4WRIA 1MUXA 2KQ6A 1K90D 1TNQA 3EK8A 1PALA 1K9KA 2NZ0A 3OB1B 4WQ2A 1V1FA 1XFZO 3BYAA 4GGFC 1XFYO 2BKHB 4TNCA 1J7QA 4ORCB 2JULA 5HKZA 3KO0A 3I5HC 3EVVA 2JU0A 3CGAA 1Y0VH 5HLOA 2COLB 4P5OE 1B8LA 1UP5A 1YUUA 1U5IB 1F4OA 2K7OA 1BMOA 1XK4C 4DUQA 2MA2A 5TNCA 4F0ZB 4HRHA 1W7IB 2KYCA 1S5GZ 3BUNB 4CIDA 2LAPA 1KSOA 5FYXA 2BL0C 1DJYA 2F3YA 2ZNDA 1YVLA 1K2HA 3KHEA 3JVTB 2NLNA 1OOJA 2M9GA 2PVBA 1SRAA 1SPYA 4XJKA 1G4YR 5HKWA 3IQQA 2OS8B 3GK1A 3PSRA 1S26D 4AOMA 1KFUL 4Q04A 2M7LA 4D1EA 1N2DA 1IQ5A 1ZFSA 3ICBA 3D0YA 4MBEA 2KFGA 2BECA 2I18A 1FBVA 1KWOB 4N1FA 4QJ5B 2ZKMX 1RJVA 3I5FB 5KTYA 1DMOA 3JTDB 2WORA 1SL9A 1NX3A 1BOCA 1SNLA 1SR6B 3LLEA 4P2YB 3ZNIA 1DF0B 1WLMA 3VGOA 1MQ1A 3WNXB 1EJ3A 4UPGA 2DOQA 2K2FA 2MJWB 1QLKA 1QLSA 2LC5A 3TZ1A 1DJWA 1A75B 2HQWA 3KPXA 1KK7Y 4GFTA 4A4CA 3KEVA 5DKQA 3NSLA 1KQMC 1ALWA 1LXFC 2Q91A 1Y1AA 1WDCB 4ICBA 1A4PA 2K8MB 2M29A 1YX7A 2EGDA 3CWGA 3TS5C 1IG5A 2Y5IA 3LCPC 2LP3A 2M97A 1AHRA 3O78A 1SY9A 2M8UA 2KDHA 2NXQA 2QACA 2L5XB 4PE4A 2K7CA 2SCPA 2R2IA 1M31A 5HKYA 1IQ3A 1F55A 1IWQA 1RK9A 2Q4UA 3RM1A 2P6BB 1CKKA 5AFPA 1DJHA 4WQ3A 1RFJA 1TTXA 1DVIA 2M49B 4ORBB 2M7NA 1CM4A 5K89A 2LLUA 1CFFA 1JUOA 1F71A 4MRYA 4L9MA 3FWBA 4YBHB 1M46A 1JSAA 4FQOA 1RROA 3PN7C 1AK8A 1K95A 5F6TA 4ZCVA 3SIBA 2E30A 1TCFA 4FTGA 1HQVA 4M2OA 4OR9B 3FIAA 1LA0A 1Y6WA 1NCZA 3CR2A 3BOWB 1HT9A 2JPTA 1PULA 4GUKA 1ALVA 1ZACA 2FCDA 2OTGC 5J3XA 2M1KB 5I8NA 2I7AA 1CLLA 2ZN8A 3I5GB 1AVSA 2QPTA 2L50A 2HF5A 4CLNA 1KFUS 3VRRA 4ZCUA 1E8AA 5AEQA 1SKTA 1JC2A 5B8IB 1F70A 2JQ6A 1J55A 2Y1MA 2L98A 1CDLA 2HETA 5I2QA 1OQPA 1CDNA 2WC8A 4PHJA 2MHHA 2CCMA 1TN4A 2JTTA 1SL7A 2KAVA 1YVHA 4NDBA 1J7PA 1VRKA 3BUOB 2KI6D 1QATA 2NCPA 1S6IA 1YTZC 1QV0A 1NP8A 1FW4A 4GNKB 3SG3A 1OMVA 3SIAA 2HQ8A 3NSOA 3E3RA 5G08A 1IRJA 3VRNA 5DKRA 2KI6C 4CFRA 2BCBA 1JFJA 4OVNF 2SASA 2CBLA 1CB1A 1YR5A 2JOJA 2OPOA 2WCBA 2LCPA 1UHJA 2KOTA 2H61C 2EC6B 3FS7A 3DF0B 2F3ZA 2BBMA 1Y1UA 4R1EA 3HCMA 2ZRSA 1W7JB 1OE9B 1KK8B 1KFXL 1M45A 3I5IC 1NPQA 1F54A 1U5IA 3TUYC 1NX1A 1QV1A 2KNEA 1AJ4A 1CTRA 3GOFA 3NXAA 2MRDA 3NSKA 1RWYA 5KSZA 1A2XA 5CSIA 1YRUB 3IQOA 2H61A 1X02A 1A29A 1IH0A 1OMRA 4HREE 4QJ3B 4M2PA 4PHMA 1UWOA 1NUBA 2M1UA 1CNPA 3GK4X 2KGBC 1OZSA 1K9PA 2JXCA 3QRXA 4IL1A 3CTNA 2M3WA 1MHOA 1OMDA 3MSEB 2D8NA 2KBMA 2GGMA 2AMIA 4PCWA 1FF1A 2BBNA 1TIZA 2LNKA 1JF2A 3I5HB 2M0RA 2CTNA 4MLWA 4XJKB 4MZJA 1K96A 4DRWA 1V1GA 2JT0A 4DS7A 1RTP1 1CFDA 4DIRA 1M63B 1B9AA 1J7RA 1R6PA 1GJYA 3O2PA 3D0YB 3WHTB 2ZRTA 2AUCA 2KGRA 1QJTA 2BL0B 2KAYA 1XFVO 3D10A 4JPZB 1QXPA 2BCAA 2MBXA 1JWDA 2BE4A 1KK7Z 4MZLA 2LUXA 1WRLA 4MRXA 1XO5A 1BT6A 1XVJA 3ZWHA 1OZOA 3BQ3A 2LVJA 1BJFA 5CPVA 2MLFC 4OCIA 1TRFA 1BG1A 4YRUA 3TDUA 5AANA 1YX8A 3F45A 2PSRA 1BLQA 1K9UA 1MWNA 4YGEB 2PMYA 2CXJA 3A8RA 2LMTA 3AKBA 1ZUZA 1K94A 4XYNA 5ER5A 3O6BA 4PDZA 2G2BA 1S6CA 3BUWB 4OKHA 2FJUB 3CLNA 1MR8A 2JXLA 3LK1A 1MF8B 1Q80A 4JQ0D 4NDCA 4MZKA 2O60A 5HYDA 2WNDA 2WOSA 2KBIA 1L2OC 1KFXS 2WCFA 4PHNA 1LVCD 1EXRA 1RECA 1KQMB 1FI5A 2RGIA 1ZMZA 1DTLA 1QTXA 1G8IA 3A4UB 1WY9A 3TS5B 1PVBA 2L51A 4PE1A 1R2UA 4PE0A 2GV5A 1UUSA 1G33A 1B47A 3OX6A 1CMFA 1GGWA 3NSIA 1UHHA 1CLMA 1ODBA 2ISDA 1N0YA 5AERA 1JFKA 3BUXB 2H2KA 2JT8A 4PHKA 2IS9A 3C1VA 2F2PA 4MEWA 3LK0A 1AJ5A 4M2QA 3TDIA 1SCMC 3VRQA 2KI4C 2GGZA 1SW8A 1S1EA 5D7FA 1BODA 1CFPA 4YI8A 1D1OA 1F8HA 4OV2A 4U8DA 2PRUA 1PVAA 2BE6A 3PN7B 2K0JA 1EL4A 1DGUA 1XFXO 1J1DA 1DT7B 2K2AA 2LVKA 1JBAA 3AAKA 3WHUB 5CSNA 4YGAA 1PK0D 2G9BA 3GK2A 2CNPA 5DKNA 1UHIA 1TCOB 1IGVA 3EVUA 4GBAA 4DCKA 1XFUO 4GGNA 2L2EA 2OTGB 3M0WA 1M39A 1BR4B 3KF9A 4I5JA 4ORAB 3PATA 3OX5A 1J7OA 2LHIA 3DD4A 3JVTC 3SG4A 1SYMA 2Y1NA 2OS8C 1SBJA 3OB2B 2VRGA 1PRWA 1CFCA 2LMVA 1XYDA 1C07A 1PSRA 2KYFA 1B7TY 2L0PA 1QVIY 1KQVA 1B8CA 1K93D 1KWOC 1TNPA 3CZTX 2ZNEA 3EK7A 1EH2A 1CLBA 1XA5A 1UURA 3I5FC 3JTDC 1B7TZ 1QX5B 1BF5A 4BY4A 5JJGA 1CMGA 1QVIZ 3EKHA 1SR6C 1H4BA 1S5GY 3RLZA 1C7WA 3PLFB 3O4YA 1NX2A 1S3PA 4AQJA 1NYAA 1YUSA 1Y1XA 2KSPA 2KHNA 2MAZA 2Y4QA 2PALA 4MN0A 1FI6A 5AXIA 1TNWA 2LLTA 3DVMA 1EG3A 3TDZA 1IJ6A 2O5GA 4GGFA 1WDCC 4NDDA 1GGZA 2JNXA 1AUIB 1JF0A 3I5IB 3AKAA 1DJGA 1CDMA 1QASA 1YURA 3TUYB 4JWQA 1DF0A 4YI9A 1XK4A 1KSMA 1WLZA 4BY5A 4C0KA 4GPLB 1DGVA 4CPVA 2L4HA 1PSBA 1H8BA 1A75A 3SJSA 1MXEA 3PFVA 1K8UA 2NCOA 1FPWA 2BCXA 1NIWA 1DJXA 1QIVA 4AQIA 3BUMB 3FWCA 1CM1A 1F4QA 3H4SE 3PALA 4PE7A 5JOLA 5I2LA 3SG6A 1QS7A 3VROA 2EHBA 4MVFA 1TNXA 2JT3A 1NCXA 5D69A 1ZOTB 1LKJA 4N5XA 1TOPA 2JTZA 1SCVA 2K7DA 3OP0A 5BPJA 3DVEA 3EKJA 1J1EA 1XFWO 1EG4A 1QX2A 1IKUA 2I94A 1A03A 2KFFA 2JZIA 2L4IA 1MXLC 4YGDB 2JNFA 2LVVA 2MLEC 5CSJA 2F33A 1NCYA 3OHMB 5KU1A 5GQQC 2LHLA 3LL8B 2F8PA 2PASA 3CR5X 3I5GC 4NQGA 4C0LA 3HX4A 2JC2A 3AAJA 1S6JA 4E68A 2V53A 2ZFDA 5PALA 2KFHA 5CSFA 1BR1B 1UHKA 3DVJA 1BU3A 4I5LB 2A4JA 2CT9A 2JWWA 2JRFA 2LE9B 5I2OA 2LLSA 4I5NB 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIN A;  4HRG A;  4QJ4 B;  2TN4 A;  5HLV A;  2AAO A;  1N65 A;  2K7B A;  2WCE A;  4PAL A;  4YGB B;  4ETO A;  1B1G A;  4YGC B;  1IJ5 A;  1DJZ A;  2I2R E;  3EVR A;  2KQY A;  1YUT A;  1NX0 A;  1QX7 A;  5ER4 X;  2LMU A;  2K61 A;  2ZN9 A;  2LAN A;  1L2O B;  2EC6 C;  1SL8 A;  3CS1 A;  1B8R A;  1C7V A;  1YRT B;  2KAX A;  1WRK A;  4A4B A;  1DJI A;  1QIW A;  4I5K A;  1GQM A;  3CR4 X;  1SK6 D;  2LUC A;  4GAO A;  1KK8 C;  1OSA A;  3VRP A;  1NWD A;  1L7Z A;  2E6W A;  2F2O A;  3SG5 A;  2LP2 A;  3SG7 A;  3DVK A;  4C0J A;  2LVI A;  3BXK A;  2FCE A;  1UHN A;  4CFQ A;  1NSH A;  2BKI B;  3WXA A;  5IBW A;  2LV7 A;  1AP4 A;  4MSP A;  1B4C A;  3EK4 A;  3DF0 A;  3PM8 A;  4HSZ A;  4N1G A;  2B1U A;  1WRZ A;  2FOT A;  2LM5 A;  3K21 A;  1KCY A;  3SG2 A;  1SCM B;  1CDP A;  1SMG A;  4USL A;  2HPS A;  2KI4 B;  1S36 A;  1LA3 A;  3IF7 A;  4WRI A;  1MUX A;  2KQ6 A;  1K90 D;  1TNQ A;  3EK8 A;  1PAL A;  1K9K A;  2NZ0 A;  3OB1 B;  4WQ2 A;  1V1F A;  1XFZ O;  3BYA A;  4GGF C;  1XFY O;  2BKH B;  4TNC A;  1J7Q A;  4ORC B;  2JUL A;  5HKZ A;  3KO0 A;  3I5H C;  3EVV A;  2JU0 A;  3CGA A;  1Y0V H;  5HLO A;  2COL B;  4P5O E;  1B8L A;  1UP5 A;  1YUU A;  1U5I B;  1F4O A;  2K7O A;  1BMO A;  1XK4 C;  4DUQ A;  2MA2 A;  5TNC A;  4F0Z B;  4HRH A;  1W7I B;  2KYC A;  1S5G Z;  3BUN B;  4CID A;  2LAP A;  1KSO A;  5FYX A;  2BL0 C;  1DJY A;  2F3Y A;  2ZND A;  1YVL A;  1K2H A;  3KHE A;  3JVT B;  2NLN A;  1OOJ A;  2M9G A;  2PVB A;  1SRA A;  1SPY A;  4XJK A;  1G4Y R;  5HKW A;  3IQQ A;  2OS8 B;  3GK1 A;  3PSR A;  1S26 D;  4AOM A;  1KFU L;  4Q04 A;  2M7L A;  4D1E A;  1N2D A;  1IQ5 A;  1ZFS A;  3ICB A;  3D0Y A;  4MBE A;  2KFG A;  2BEC A;  2I18 A;  1FBV A;  1KWO B;  4N1F A;  4QJ5 B;  2ZKM X;  1RJV A;  3I5F B;  5KTY A;  1DMO A;  3JTD B;  2WOR A;  1SL9 A;  1NX3 A;  1BOC A;  1SNL A;  1SR6 B;  3LLE A;  4P2Y B;  3ZNI A;  1DF0 B;  1WLM A;  3VGO A;  1MQ1 A;  3WNX B;  1EJ3 A;  4UPG A;  2DOQ A;  2K2F A;  2MJW B;  1QLK A;  1QLS A;  2LC5 A;  3TZ1 A;  1DJW A;  1A75 B;  2HQW A;  3KPX A;  1KK7 Y;  4GFT A;  4A4C A;  3KEV A;  5DKQ A;  3NSL A;  1KQM C;  1ALW A;  1LXF C;  2Q91 A;  1Y1A A;  1WDC B;  4ICB A;  1A4P A;  2K8M B;  2M29 A;  1YX7 A;  2EGD A;  3CWG A;  3TS5 C;  1IG5 A;  2Y5I A;  3LCP C;  2LP3 A;  2M97 A;  1AHR A;  3O78 A;  1SY9 A;  2M8U A;  2KDH A;  2NXQ A;  2QAC A;  2L5X B;  4PE4 A;  2K7C A;  2SCP A;  2R2I A;  1M31 A;  5HKY A;  1IQ3 A;  1F55 A;  1IWQ A;  1RK9 A;  2Q4U A;  3RM1 A;  2P6B B;  1CKK A;  5AFP A;  1DJH A;  4WQ3 A;  1RFJ A;  1TTX A;  1DVI A;  2M49 B;  4ORB B;  2M7N A;  1CM4 A;  5K89 A;  2LLU A;  1CFF A;  1JUO A;  1F71 A;  4MRY A;  4L9M A;  3FWB A;  4YBH B;  1M46 A;  1JSA A;  4FQO A;  1RRO A;  3PN7 C;  1AK8 A;  1K95 A;  5F6T A;  4ZCV A;  3SIB A;  2E30 A;  1TCF A;  4FTG A;  1HQV A;  4M2O A;  4OR9 B;  3FIA A;  1LA0 A;  1Y6W A;  1NCZ A;  3CR2 A;  3BOW B;  1HT9 A;  2JPT A;  1PUL A;  4GUK A;  1ALV A;  1ZAC A;  2FCD A;  2OTG C;  5J3X A;  2M1K B;  5I8N A;  2I7A A;  1CLL A;  2ZN8 A;  3I5G B;  1AVS A;  2QPT A;  2L50 A;  2HF5 A;  4CLN A;  1KFU S;  3VRR A;  4ZCU A;  1E8A A;  5AEQ A;  1SKT A;  1JC2 A;  5B8I B;  1F70 A;  2JQ6 A;  1J55 A;  2Y1M A;  2L98 A;  1CDL A;  2HET A;  5I2Q A;  1OQP A;  1CDN A;  2WC8 A;  4PHJ A;  2MHH A;  2CCM A;  1TN4 A;  2JTT A;  1SL7 A;  2KAV A;  1YVH A;  4NDB A;  1J7P A;  1VRK A;  3BUO B;  2KI6 D;  1QAT A;  2NCP A;  1S6I A;  1YTZ C;  1QV0 A;  1NP8 A;  1FW4 A;  4GNK B;  3SG3 A;  1OMV A;  3SIA A;  2HQ8 A;  3NSO A;  3E3R A;  5G08 A;  1IRJ A;  3VRN A;  5DKR A;  2KI6 C;  4CFR A;  2BCB A;  1JFJ A;  4OVN F;  2SAS A;  2CBL A;  1CB1 A;  1YR5 A;  2JOJ A;  2OPO A;  2WCB A;  2LCP A;  1UHJ A;  2KOT A;  2H61 C;  2EC6 B;  3FS7 A;  3DF0 B;  2F3Z A;  2BBM A;  1Y1U A;  4R1E A;  3HCM A;  2ZRS A;  1W7J B;  1OE9 B;  1KK8 B;  1KFX L;  1M45 A;  3I5I C;  1NPQ A;  1F54 A;  1U5I A;  3TUY C;  1NX1 A;  1QV1 A;  2KNE A;  1AJ4 A;  1CTR A;  3GOF A;  3NXA A;  2MRD A;  3NSK A;  1RWY A;  5KSZ A;  1A2X A;  5CSI A;  1YRU B;  3IQO A;  2H61 A;  1X02 A;  1A29 A;  1IH0 A;  1OMR A;  4HRE E;  4QJ3 B;  4M2P A;  4PHM A;  1UWO A;  1NUB A;  2M1U A;  1CNP A;  3GK4 X;  2KGB C;  1OZS A;  1K9P A;  2JXC A;  3QRX A;  4IL1 A;  3CTN A;  2M3W A;  1MHO A;  1OMD A;  3MSE B;  2D8N A;  2KBM A;  2GGM A;  2AMI A;  4PCW A;  1FF1 A;  2BBN A;  1TIZ A;  2LNK A;  1JF2 A;  3I5H B;  2M0R A;  2CTN A;  4MLW A;  4XJK B;  4MZJ A;  1K96 A;  4DRW A;  1V1G A;  2JT0 A;  4DS7 A;  1RTP 1;  1CFD A;  4DIR A;  1M63 B;  1B9A A;  1J7R A;  1R6P A;  1GJY A;  3O2P A;  3D0Y B;  3WHT B;  2ZRT A;  2AUC A;  2KGR A;  1QJT A;  2BL0 B;  2KAY A;  1XFV O;  3D10 A;  4JPZ B;  1QXP A;  2BCA A;  2MBX A;  1JWD A;  2BE4 A;  1KK7 Z;  4MZL A;  2LUX A;  1WRL A;  4MRX A;  1XO5 A;  1BT6 A;  1XVJ A;  3ZWH A;  1OZO A;  3BQ3 A;  2LVJ A;  1BJF A;  5CPV A;  2MLF C;  4OCI A;  1TRF A;  1BG1 A;  4YRU A;  3TDU A;  5AAN A;  1YX8 A;  3F45 A;  2PSR A;  1BLQ A;  1K9U A;  1MWN A;  4YGE B;  2PMY A;  2CXJ A;  3A8R A;  2LMT A;  3AKB A;  1ZUZ A;  1K94 A;  4XYN A;  5ER5 A;  3O6B A;  4PDZ A;  2G2B A;  1S6C A;  3BUW B;  4OKH A;  2FJU B;  3CLN A;  1MR8 A;  2JXL A;  3LK1 A;  1MF8 B;  1Q80 A;  4JQ0 D;  4NDC A;  4MZK A;  2O60 A;  5HYD A;  2WND A;  2WOS A;  2KBI A;  1L2O C;  1KFX S;  2WCF A;  4PHN A;  1LVC D;  1EXR A;  1REC A;  1KQM B;  1FI5 A;  2RGI A;  1ZMZ A;  1DTL A;  1QTX A;  1G8I A;  3A4U B;  1WY9 A;  3TS5 B;  1PVB A;  2L51 A;  4PE1 A;  1R2U A;  4PE0 A;  2GV5 A;  1UUS A;  1G33 A;  1B47 A;  3OX6 A;  1CMF A;  1GGW A;  3NSI A;  1UHH A;  1CLM A;  1ODB A;  2ISD A;  1N0Y A;  5AER A;  1JFK A;  3BUX B;  2H2K A;  2JT8 A;  4PHK A;  2IS9 A;  3C1V A;  2F2P A;  4MEW A;  3LK0 A;  1AJ5 A;  4M2Q A;  3TDI A;  1SCM C;  3VRQ A;  2KI4 C;  2GGZ A;  1SW8 A;  1S1E A;  5D7F A;  1BOD A;  1CFP A;  4YI8 A;  1D1O A;  1F8H A;  4OV2 A;  4U8D A;  2PRU A;  1PVA A;  2BE6 A;  3PN7 B;  2K0J A;  1EL4 A;  1DGU A;  1XFX O;  1J1D A;  1DT7 B;  2K2A A;  2LVK A;  1JBA A;  3AAK A;  3WHU B;  5CSN A;  4YGA A;  1PK0 D;  2G9B A;  3GK2 A;  2CNP A;  5DKN A;  1UHI A;  1TCO B;  1IGV A;  3EVU A;  4GBA A;  4DCK A;  1XFU O;  4GGN A;  2L2E A;  2OTG B;  3M0W A;  1M39 A;  1BR4 B;  3KF9 A;  4I5J A;  4ORA B;  3PAT A;  3OX5 A;  1J7O A;  2LHI A;  3DD4 A;  3JVT C;  3SG4 A;  1SYM A;  2Y1N A;  2OS8 C;  1SBJ A;  3OB2 B;  2VRG A;  1PRW A;  1CFC A;  2LMV A;  1XYD A;  1C07 A;  1PSR A;  2KYF A;  1B7T Y;  2L0P A;  1QVI Y;  1KQV A;  1B8C A;  1K93 D;  1KWO C;  1TNP A;  3CZT X;  2ZNE A;  3EK7 A;  1EH2 A;  1CLB A;  1XA5 A;  1UUR A;  3I5F C;  3JTD C;  1B7T Z;  1QX5 B;  1BF5 A;  4BY4 A;  5JJG A;  1CMG A;  1QVI Z;  3EKH A;  1SR6 C;  1H4B A;  1S5G Y;  3RLZ A;  1C7W A;  3PLF B;  3O4Y A;  1NX2 A;  1S3P A;  4AQJ A;  1NYA A;  1YUS A;  1Y1X A;  2KSP A;  2KHN A;  2MAZ A;  2Y4Q A;  2PAL A;  4MN0 A;  1FI6 A;  5AXI A;  1TNW A;  2LLT A;  3DVM A;  1EG3 A;  3TDZ A;  1IJ6 A;  2O5G A;  4GGF A;  1WDC C;  4NDD A;  1GGZ A;  2JNX A;  1AUI B;  1JF0 A;  3I5I B;  3AKA A;  1DJG A;  1CDM A;  1QAS A;  1YUR A;  3TUY B;  4JWQ A;  1DF0 A;  4YI9 A;  1XK4 A;  1KSM A;  1WLZ A;  4BY5 A;  4C0K A;  4GPL B;  1DGV A;  4CPV A;  2L4H A;  1PSB A;  1H8B A;  1A75 A;  3SJS A;  1MXE A;  3PFV A;  1K8U A;  2NCO A;  1FPW A;  2BCX A;  1NIW A;  1DJX A;  1QIV A;  4AQI A;  3BUM B;  3FWC A;  1CM1 A;  1F4Q A;  3H4S E;  3PAL A;  4PE7 A;  5JOL A;  5I2L A;  3SG6 A;  1QS7 A;  3VRO A;  2EHB A;  4MVF A;  1TNX A;  2JT3 A;  1NCX A;  5D69 A;  1ZOT B;  1LKJ A;  4N5X A;  1TOP A;  2JTZ A;  1SCV A;  2K7D A;  3OP0 A;  5BPJ A;  3DVE A;  3EKJ A;  1J1E A;  1XFW O;  1EG4 A;  1QX2 A;  1IKU A;  2I94 A;  1A03 A;  2KFF A;  2JZI A;  2L4I A;  1MXL C;  4YGD B;  2JNF A;  2LVV A;  2MLE C;  5CSJ A;  2F33 A;  1NCY A;  3OHM B;  5KU1 A;  5GQQ C;  2LHL A;  3LL8 B;  2F8P A;  2PAS A;  3CR5 X;  3I5G C;  4NQG A;  4C0L A;  3HX4 A;  2JC2 A;  3AAJ A;  1S6J A;  4E68 A;  2V53 A;  2ZFD A;  5PAL A;  2KFH A;  5CSF A;  1BR1 B;  1UHK A;  3DVJ A;  1BU3 A;  4I5L B;  2A4J A;  2CT9 A;  2JWW A;  2JRF A;  2LE9 B;  5I2O A;  2LLS A;  4I5N B;  3BOW A; 
#chains in the Genus database with same CATH topology
 3PM2 A;  1LIN A;  4HRG A;  4QJ4 B;  2TN4 A;  5HLV A;  2PQL A;  2AAO A;  1N65 A;  2K7B A;  2WCE A;  4PAL A;  4YGB B;  4ETO A;  1B1G A;  4YGC B;  1IJ5 A;  1DJZ A;  2I2R E;  3EVR A;  1Z2C B;  2KQY A;  1YUT A;  1NX0 A;  1QX7 A;  5ER4 X;  2LMU A;  2K61 A;  2ZN9 A;  2LAN A;  1L2O B;  2EC6 C;  1SL8 A;  3CS1 A;  1B8R A;  1C3Y A;  1YRT B;  2KAX A;  1WRK A;  1C7V A;  4A4B A;  1DJI A;  1QIW A;  1OOG A;  4I5K A;  1GQM A;  3CR4 X;  1SK6 D;  1DEK A;  2LUC A;  1KK8 C;  1OSA A;  4GAO A;  3VB1 A;  3VRP A;  1NWD A;  3S0F A;  1L7Z A;  2E6W A;  4OZD A;  2F2O A;  3SG5 A;  2LP2 A;  3SG7 A;  3DVK A;  4C0J A;  2LVI A;  3BXK A;  2FCE A;  1UHN A;  4CFQ A;  1NSH A;  2BKI B;  3WXA A;  5IBW A;  2LV7 A;  1AP4 A;  2P70 A;  4MSP A;  3EK4 A;  3DF0 A;  3V2L A;  1B4C A;  3PM8 A;  4HSZ A;  4N1G A;  2B1U A;  1DC1 A;  1WRZ A;  2FOT A;  2LM5 A;  3K21 A;  3SS4 A;  3SG2 A;  1KCY A;  3S0E A;  1SCM B;  3QME A;  1CDP A;  1SMG A;  4USL A;  2HPS A;  2KI4 B;  1S36 A;  1LA3 A;  3IF7 A;  4WRI A;  1MUX A;  2KQ6 A;  2WCL A;  1K90 D;  1TNQ A;  3EK8 A;  4INX A;  1PAL A;  1K9K A;  2NZ0 A;  3OB1 B;  4WQ2 A;  1V1F A;  1XFZ O;  3BYA A;  4GGF C;  1XFY O;  2BKH B;  4TNC A;  1J7Q A;  4ORC B;  2JUL A;  5HKZ A;  3KO0 A;  3I5H C;  3EVV A;  2JU0 A;  3CGA A;  1Y0V H;  5HLO A;  2COL B;  4JD9 A;  2P71 A;  4P5O E;  1B8L A;  1UP5 A;  1YUU A;  1U5I B;  1F4O A;  2K7O A;  1BMO A;  1XK4 C;  4DUQ A;  2MA2 A;  4FQT A;  2QEB A;  3L47 A;  5TNC A;  4F0Z B;  4HRH A;  1W7I B;  2KYC A;  1S5G Z;  3BUN B;  4CID A;  2LAP A;  1KSO A;  5FYX A;  2BL0 C;  1DJY A;  3DY9 A;  3OBV A;  2F3Y A;  2ZND A;  3N7H A;  1YVL A;  1K2H A;  3KHE A;  3JVT B;  2NLN A;  1OOJ A;  2M9G A;  2PVB A;  1SRA A;  1SPY A;  4XJK A;  1G4Y R;  5HKW A;  3IQQ A;  2OS8 B;  1TWO A;  3GK1 A;  1S26 D;  3PSR A;  3Q8I A;  1KFU L;  4Q04 A;  2M7L A;  4AOM A;  4D1E A;  1N2D A;  1IQ5 A;  1ZFS A;  3ICB A;  3R1O A;  3D0Y A;  3D77 A;  4MBE A;  2KFG A;  2BEC A;  2I18 A;  1FBV A;  1KWO B;  4N1F A;  4QJ5 B;  2ZKM X;  1RJV A;  3I5F B;  5KTY A;  1DMO A;  3JTD B;  2WOR A;  1SL9 A;  1NX3 A;  5HL1 A;  1BOC A;  1SNL A;  1SR6 B;  3LLE A;  4P2Y B;  3R72 A;  4F7F A;  3ZNI A;  1DF0 B;  1WLM A;  3VGO A;  1MQ1 A;  3WNX B;  1EJ3 A;  4UPG A;  2DOQ A;  2K2F A;  2MJW B;  1JC2 A;  1QLK A;  1QLS A;  1XFR A;  2LC5 A;  1DJW A;  3TZ1 A;  1A75 B;  2HQW A;  3KPX A;  1KK7 Y;  4GFT A;  4A4C A;  2KLD A;  3KEV A;  5DKQ A;  3NSL A;  1KQM C;  1ALW A;  1LXF C;  2Q91 A;  1Y1A A;  1WDC B;  4ICB A;  1A4P A;  2K8M B;  3D74 A;  2M29 A;  1YX7 A;  2EGD A;  3CWG A;  3TS5 C;  2WCH A;  2WC5 A;  3S0A A;  1IG5 A;  2Y5I A;  3LCP C;  2LP3 A;  1C3Z A;  2M97 A;  1OOH A;  1AHR A;  3O78 A;  1SY9 A;  2M8U A;  1P28 A;  2KDH A;  2NXQ A;  2QAC A;  2L5X B;  4PE4 A;  2K7C A;  2SCP A;  2R2I A;  1M31 A;  5HKY A;  1IQ3 A;  1F55 A;  1IWQ A;  1RK9 A;  2Q4U A;  3RM1 A;  2P6B B;  1CKK A;  5AFP A;  1DJH A;  2PYQ A;  4WQ3 A;  1RFJ A;  1TTX A;  3OGN A;  1DVI A;  2M49 B;  4ORB B;  2M7N A;  1CM4 A;  5K89 A;  2LLU A;  1CFF A;  2GTE A;  1JUO A;  3L4A A;  4MRY A;  1F71 A;  4L9M A;  3FWB A;  4YBH B;  1T14 A;  1M46 A;  1JSA A;  4FQO A;  1RRO A;  3PN7 C;  1AK8 A;  1K95 A;  5F6T A;  4ZCV A;  3B6X A;  3SIB A;  2E30 A;  3PJI A;  1TCF A;  4FTG A;  1HQV A;  4M2O A;  4OR9 B;  3FIA A;  1LA0 A;  1Y6W A;  1NCZ A;  3CR2 A;  3BOW B;  1HT9 A;  2JPT A;  1PUL A;  4GUK A;  1ALV A;  1ZAC A;  2FCD A;  2OTG C;  5J3X A;  2M1K B;  2FJY A;  5I8N A;  2I7A A;  2KPH A;  1CLL A;  2ZN8 A;  3I5G B;  1AVS A;  2QPT A;  2L50 A;  2HF5 A;  4CLN A;  1KFU S;  3VRR A;  4ZCU A;  1E8A A;  5AEQ A;  1SKT A;  3CZ1 A;  5B8I B;  1F70 A;  2JQ6 A;  1J55 A;  2Y1M A;  2L98 A;  1CDL A;  2HET A;  1LS8 A;  5I2Q A;  1OQP A;  1CDN A;  2WC8 A;  4PHJ A;  2MHH A;  2CCM A;  1TN4 A;  2JTT A;  1SL7 A;  2KAV A;  1YVH A;  4NDB A;  1J7P A;  1SSE B;  2BNX A;  1VRK A;  3BUO B;  2KI6 D;  1QAT A;  2NCP A;  1S6I A;  1YTZ C;  1QV0 A;  1NP8 A;  1FW4 A;  4GNK B;  3SG3 A;  1OMV A;  3SIA A;  2HQ8 A;  3NSO A;  3E3R A;  5G08 A;  1IRJ A;  3VRN A;  5DKR A;  3D75 A;  2KI6 C;  3BFA A;  2QEO A;  4CFR A;  2BCB A;  1JFJ A;  3DYE A;  4OVN F;  2SAS A;  2CBL A;  1CB1 A;  1YR5 A;  2JOJ A;  2OPO A;  2WCB A;  2LCP A;  1UHJ A;  2KOT A;  2H61 C;  2EC6 B;  3FS7 A;  3DF0 B;  5I94 A;  2F3Z A;  2BBM A;  1Y1U A;  3EG5 B;  4R1E A;  3HCM A;  2ZRS A;  1W7J B;  1OE9 B;  3CAB A;  1KK8 B;  1KFX L;  1M45 A;  3I5I C;  1NPQ A;  1F54 A;  2K60 A;  1JBA A;  1U5I A;  2WCK A;  3TUY C;  1NX1 A;  1QV1 A;  1GM0 A;  2KNE A;  1AJ4 A;  1CTR A;  3GOF A;  3NXA A;  2MRD A;  3IVT A;  3NSK A;  1RWY A;  5KSZ A;  2L5Y A;  1A2X A;  5CSI A;  1YRU B;  3IQO A;  2H61 A;  1A29 A;  1X02 A;  1IH0 A;  1OMR A;  4HRE E;  4QJ3 B;  5D3O A;  4M2P A;  4PHM A;  1UWO A;  1NUB A;  2M1U A;  1CNP A;  3GK4 X;  2KGB C;  1OZS A;  1K9P A;  2JXC A;  3QRX A;  1DQE A;  4IL1 A;  3CTN A;  2M3W A;  1MHO A;  1OMD A;  3MSE B;  2D8N A;  3B87 A;  2KBM A;  2GGM A;  2AMI A;  4PCW A;  1FF1 A;  2BBN A;  1TIZ A;  2LNK A;  1JF2 A;  3I5H B;  2M0R A;  2CTN A;  4MLW A;  4XJK B;  4MZJ A;  1K96 A;  4DRW A;  1V1G A;  3SS3 A;  2JT0 A;  4DS7 A;  1RTP 1;  1CFD A;  1TUJ A;  4DIR A;  1M63 B;  1B9A A;  1J7R A;  1R6P A;  1GJY A;  3O2P A;  3D0Y B;  3WHT B;  2ZRT A;  2AUC A;  2KGR A;  1QJT A;  2BL0 B;  2KAY A;  1XFV O;  2WCJ A;  3D10 A;  4JPZ B;  1QXP A;  2BCA A;  2MBX A;  1JWD A;  2BE4 A;  1KK7 Z;  4MZL A;  2LUX A;  1WRL A;  4MRX A;  1XO5 A;  1BT6 A;  1XVJ A;  3ZWH A;  1OZO A;  3BQ3 A;  2LVJ A;  1BJF A;  5CPV A;  2MLF C;  4OCI A;  2WCM A;  1TRF A;  1BG1 A;  4YRU A;  5FI7 A;  3TDU A;  5AAN A;  1YX8 A;  3F45 A;  2PSR A;  1BLQ A;  1K9U A;  1ORG A;  1MWN A;  4YGE B;  2PMY A;  2CXJ A;  3A8R A;  2LMT A;  3AKB A;  4KYN A;  1ZUZ A;  1K94 A;  4XYN A;  5ER5 A;  3O6B A;  4PDZ A;  2G2B A;  1S6C A;  3BUW B;  4OKH A;  2FJU B;  3CLN A;  1MR8 A;  2JXL A;  3LK1 A;  1MF8 B;  1Q80 A;  4JQ0 D;  3CZ0 A;  4MZK A;  4NDC A;  2O60 A;  5HYD A;  3DZT A;  2WND A;  2WOS A;  2KBI A;  1L2O C;  1KFX S;  2WCF A;  5DIC A;  3S0D A;  4PHN A;  1LVC D;  1EXR A;  1REC A;  3B86 A;  1KQM B;  1FI5 A;  2RGI A;  1ZMZ A;  1DTL A;  1QTX A;  1G8I A;  3A4U B;  1WY9 A;  3FE9 A;  3TS5 B;  1PVB A;  2L51 A;  4PE1 A;  1R2U A;  4PE0 A;  2GV5 A;  1UUS A;  3CDN A;  1G33 A;  1B47 A;  3OX6 A;  1CMF A;  1GGW A;  3NSI A;  1UHH A;  1CLM A;  1ODB A;  3CYZ A;  2ISD A;  1N0Y A;  5AER A;  1JFK A;  3BUX B;  3FE8 A;  2H2K A;  2JT8 A;  4PHK A;  2IS9 A;  1OW4 A;  2F2P A;  3C1V A;  4MEW A;  3LK0 A;  3R1P A;  1AJ5 A;  3O4X A;  4M2Q A;  3TDI A;  1SCM C;  3BFH A;  3B88 A;  1TUZ A;  3B7A A;  3VRQ A;  2KI4 C;  2GGZ A;  1SW8 A;  2QEV A;  1S1E A;  5D7F A;  1BOD A;  1CFP A;  4YI8 A;  1D1O A;  1F8H A;  4OV2 A;  4U8D A;  2PRU A;  1PVA A;  2BE6 A;  3PN7 B;  2K0J A;  1EL4 A;  1DGU A;  1XFX O;  1J1D A;  1DT7 B;  2K2A A;  2LVK A;  1DEL A;  3FE6 A;  3RZS A;  3AAK A;  3WHU B;  5CSN A;  4YGA A;  1OOF A;  1PK0 D;  3D76 A;  2G9B A;  3GK2 A;  2CNP A;  5DKN A;  1UHI A;  1TCO B;  1IGV A;  3EVU A;  4GBA A;  3S0B A;  1XFU O;  4GGN A;  4DCK A;  2L2E A;  2OTG B;  2YGU A;  3M0W A;  1M39 A;  1BR4 B;  3R1V A;  3KF9 A;  4I5J A;  4ORA B;  3PAT A;  3OX5 A;  3BFB A;  1QWV A;  1J7O A;  2LHI A;  3DD4 A;  3JVT C;  3SG4 A;  1SYM A;  2Y1N A;  2KLE A;  2OS8 C;  1SBJ A;  3OB2 B;  2VRG A;  1PRW A;  1CFC A;  2LMV A;  1XYD A;  3NHI A;  1C07 A;  1PSR A;  3NHT A;  2KYF A;  1B7T Y;  2L0P A;  2H8V A;  3SS5 A;  1QVI Y;  3UO9 A;  1KQV A;  1B8C A;  1K93 D;  1KWO C;  1TNP A;  2QEH A;  2ZNE A;  3CZT X;  3EK7 A;  1CLB A;  1EH2 A;  1XA5 A;  1UUR A;  3I5F C;  3JTD C;  1B7T Z;  1QX5 B;  1BF5 A;  4BY4 A;  5JJG A;  1OOI X;  1CMG A;  1QVI Z;  3EKH A;  1SR6 C;  1H4B A;  1S5G Y;  3RLZ A;  1C7W A;  3BJH A;  3PLF B;  3O4Y A;  3S0G A;  1NX2 A;  1S3P A;  2WC6 A;  4AQJ A;  1NYA A;  1YUS A;  1Y1X A;  2KSP A;  2KHN A;  2MAZ A;  2Y4Q A;  2PAL A;  4MN0 A;  1FI6 A;  5AXI A;  1TNW A;  2LLT A;  3DVM A;  1EG3 A;  5FI6 A;  1IJ6 A;  3TDZ A;  2O5G A;  4GGF A;  1WDC C;  4IJ7 A;  1GGZ A;  2JNX A;  4NDD A;  1AUI B;  3DXL A;  1Z4H A;  1JF0 A;  3I5I B;  2L2C A;  3AKA A;  1DJG A;  3CZ2 A;  1CDM A;  1QAS A;  1YUR A;  3TUY B;  3UNW A;  4JWQ A;  1DF0 A;  2JPO A;  4YI9 A;  1XK4 A;  1KSM A;  1WLZ A;  4BY5 A;  4C0K A;  3L4L A;  1DGV A;  4GPL B;  4CPV A;  2L4H A;  1PSB A;  1H8B A;  1A75 A;  3SJS A;  1MXE A;  2ERB A;  3PFV A;  1K8U A;  2NCO A;  1FPW A;  2BCX A;  1NIW A;  1DJX A;  1QIV A;  4AQI A;  3BUM B;  3FWC A;  1CM1 A;  1W9Z A;  1F4Q A;  3K1E A;  3H4S E;  3PAL A;  3NGV A;  4PE7 A;  4INW A;  5JOL A;  5I2L A;  3SG6 A;  1QS7 A;  2BAP A;  5FI2 A;  3VRO A;  2EHB A;  4MVF A;  1TNX A;  2JT3 A;  1NCX A;  1IIO A;  2QDI A;  5D69 A;  1ZOT B;  1LKJ A;  4N5X A;  1TOP A;  2JTZ A;  1SCV A;  2K7D A;  3OP0 A;  5BPJ A;  3DVE A;  4JKT A;  3D78 A;  3EKJ A;  1J1E A;  1XFW O;  1EG4 A;  5EL2 A;  1QX2 A;  1IKU A;  2I94 A;  1A03 A;  2KFF A;  2JZI A;  2L4I A;  1MXL C;  4YGD B;  2JNF A;  2LVV A;  2MLE C;  5CSJ A;  3D73 A;  2F33 A;  1NCY A;  3OHM B;  5KU1 A;  5GQQ C;  2LHL A;  3LL8 B;  2F8P A;  2PAS A;  3CR5 X;  3I5G C;  4NQG A;  4C0L A;  3HX4 A;  2JC2 A;  3AAJ A;  1S6J A;  4E68 A;  2V53 A;  2ZFD A;  5PAL A;  2KFH A;  5CSF A;  1BR1 B;  1UHK A;  3DVJ A;  1BU3 A;  4I5L B;  2A4J A;  2CT9 A;  2JWW A;  2JRF A;  2LE9 B;  4PT1 A;  5I2O A;  2LLS A;  4I5N B;  3BOW A; 
#chains in the Genus database with same CATH homology
 1LIN A;  4HRG A;  4QJ4 B;  2TN4 A;  5HLV A;  2AAO A;  1N65 A;  2K7B A;  2WCE A;  4PAL A;  4YGB B;  4ETO A;  1B1G A;  4YGC B;  1IJ5 A;  1DJZ A;  2I2R E;  3EVR A;  2KQY A;  1YUT A;  1NX0 A;  1QX7 A;  5ER4 X;  2LMU A;  2K61 A;  2ZN9 A;  2LAN A;  1L2O B;  2EC6 C;  1SL8 A;  3CS1 A;  1B8R A;  1C7V A;  1YRT B;  2KAX A;  1WRK A;  4A4B A;  1DJI A;  1QIW A;  4I5K A;  1GQM A;  3CR4 X;  1SK6 D;  2LUC A;  4GAO A;  1KK8 C;  1OSA A;  3VRP A;  1NWD A;  1L7Z A;  2E6W A;  2F2O A;  3SG5 A;  2LP2 A;  3SG7 A;  3DVK A;  4C0J A;  2LVI A;  3BXK A;  2FCE A;  1UHN A;  4CFQ A;  1NSH A;  2BKI B;  3WXA A;  5IBW A;  2LV7 A;  1AP4 A;  4MSP A;  1B4C A;  3EK4 A;  3DF0 A;  3PM8 A;  4HSZ A;  4N1G A;  2B1U A;  1WRZ A;  2FOT A;  2LM5 A;  3K21 A;  1KCY A;  3SG2 A;  1SCM B;  1CDP A;  1SMG A;  4USL A;  2HPS A;  2KI4 B;  1S36 A;  1LA3 A;  3IF7 A;  4WRI A;  1MUX A;  2KQ6 A;  1K90 D;  1TNQ A;  3EK8 A;  1PAL A;  1K9K A;  2NZ0 A;  3OB1 B;  4WQ2 A;  1V1F A;  1XFZ O;  3BYA A;  4GGF C;  1XFY O;  2BKH B;  4TNC A;  1J7Q A;  4ORC B;  2JUL A;  5HKZ A;  3KO0 A;  3I5H C;  3EVV A;  2JU0 A;  3CGA A;  1Y0V H;  5HLO A;  2COL B;  4P5O E;  1B8L A;  1UP5 A;  1YUU A;  1U5I B;  1F4O A;  2K7O A;  1BMO A;  1XK4 C;  4DUQ A;  2MA2 A;  5TNC A;  4F0Z B;  4HRH A;  1W7I B;  2KYC A;  1S5G Z;  3BUN B;  4CID A;  2LAP A;  1KSO A;  5FYX A;  2BL0 C;  1DJY A;  2F3Y A;  2ZND A;  1YVL A;  1K2H A;  3KHE A;  3JVT B;  2NLN A;  1OOJ A;  2M9G A;  2PVB A;  1SRA A;  1SPY A;  4XJK A;  1G4Y R;  5HKW A;  3IQQ A;  2OS8 B;  3GK1 A;  3PSR A;  1S26 D;  4AOM A;  1KFU L;  4Q04 A;  2M7L A;  4D1E A;  1N2D A;  1IQ5 A;  1ZFS A;  3ICB A;  3D0Y A;  4MBE A;  2KFG A;  2BEC A;  2I18 A;  1FBV A;  1KWO B;  4N1F A;  4QJ5 B;  2ZKM X;  1RJV A;  3I5F B;  5KTY A;  1DMO A;  3JTD B;  2WOR A;  1SL9 A;  1NX3 A;  1BOC A;  1SNL A;  1SR6 B;  3LLE A;  4P2Y B;  3ZNI A;  1DF0 B;  1WLM A;  3VGO A;  1MQ1 A;  3WNX B;  1EJ3 A;  4UPG A;  2DOQ A;  2K2F A;  2MJW B;  1QLK A;  1QLS A;  2LC5 A;  3TZ1 A;  1DJW A;  1A75 B;  2HQW A;  3KPX A;  1KK7 Y;  4GFT A;  4A4C A;  3KEV A;  5DKQ A;  3NSL A;  1KQM C;  1ALW A;  1LXF C;  2Q91 A;  1Y1A A;  1WDC B;  4ICB A;  1A4P A;  2K8M B;  2M29 A;  1YX7 A;  2EGD A;  3CWG A;  3TS5 C;  1IG5 A;  2Y5I A;  3LCP C;  2LP3 A;  2M97 A;  1AHR A;  3O78 A;  1SY9 A;  2M8U A;  2KDH A;  2NXQ A;  2QAC A;  2L5X B;  4PE4 A;  2K7C A;  2SCP A;  2R2I A;  1M31 A;  5HKY A;  1IQ3 A;  1F55 A;  1IWQ A;  1RK9 A;  2Q4U A;  3RM1 A;  2P6B B;  1CKK A;  5AFP A;  1DJH A;  4WQ3 A;  1RFJ A;  1TTX A;  1DVI A;  2M49 B;  4ORB B;  2M7N A;  1CM4 A;  5K89 A;  2LLU A;  1CFF A;  1JUO A;  1F71 A;  4MRY A;  4L9M A;  3FWB A;  4YBH B;  1M46 A;  1JSA A;  4FQO A;  1RRO A;  3PN7 C;  1AK8 A;  1K95 A;  5F6T A;  4ZCV A;  3SIB A;  2E30 A;  1TCF A;  4FTG A;  1HQV A;  4M2O A;  4OR9 B;  3FIA A;  1LA0 A;  1Y6W A;  1NCZ A;  3CR2 A;  3BOW B;  1HT9 A;  2JPT A;  1PUL A;  4GUK A;  1ALV A;  1ZAC A;  2FCD A;  2OTG C;  5J3X A;  2M1K B;  5I8N A;  2I7A A;  1CLL A;  2ZN8 A;  3I5G B;  1AVS A;  2QPT A;  2L50 A;  2HF5 A;  4CLN A;  1KFU S;  3VRR A;  4ZCU A;  1E8A A;  5AEQ A;  1SKT A;  1JC2 A;  5B8I B;  1F70 A;  2JQ6 A;  1J55 A;  2Y1M A;  2L98 A;  1CDL A;  2HET A;  5I2Q A;  1OQP A;  1CDN A;  2WC8 A;  4PHJ A;  2MHH A;  2CCM A;  1TN4 A;  2JTT A;  1SL7 A;  2KAV A;  1YVH A;  4NDB A;  1J7P A;  1VRK A;  3BUO B;  2KI6 D;  1QAT A;  2NCP A;  1S6I A;  1YTZ C;  1QV0 A;  1NP8 A;  1FW4 A;  4GNK B;  3SG3 A;  1OMV A;  3SIA A;  2HQ8 A;  3NSO A;  3E3R A;  5G08 A;  1IRJ A;  3VRN A;  5DKR A;  2KI6 C;  4CFR A;  2BCB A;  1JFJ A;  4OVN F;  2SAS A;  2CBL A;  1CB1 A;  1YR5 A;  2JOJ A;  2OPO A;  2WCB A;  2LCP A;  1UHJ A;  2KOT A;  2H61 C;  2EC6 B;  3FS7 A;  3DF0 B;  2F3Z A;  2BBM A;  1Y1U A;  4R1E A;  3HCM A;  2ZRS A;  1W7J B;  1OE9 B;  1KK8 B;  1KFX L;  1M45 A;  3I5I C;  1NPQ A;  1F54 A;  1U5I A;  3TUY C;  1NX1 A;  1QV1 A;  2KNE A;  1AJ4 A;  1CTR A;  3GOF A;  3NXA A;  2MRD A;  3NSK A;  1RWY A;  5KSZ A;  1A2X A;  5CSI A;  1YRU B;  3IQO A;  2H61 A;  1X02 A;  1A29 A;  1IH0 A;  1OMR A;  4HRE E;  4QJ3 B;  4M2P A;  4PHM A;  1UWO A;  1NUB A;  2M1U A;  1CNP A;  3GK4 X;  2KGB C;  1OZS A;  1K9P A;  2JXC A;  3QRX A;  4IL1 A;  3CTN A;  2M3W A;  1MHO A;  1OMD A;  3MSE B;  2D8N A;  2KBM A;  2GGM A;  2AMI A;  4PCW A;  1FF1 A;  2BBN A;  1TIZ A;  2LNK A;  1JF2 A;  3I5H B;  2M0R A;  2CTN A;  4MLW A;  4XJK B;  4MZJ A;  1K96 A;  4DRW A;  1V1G A;  2JT0 A;  4DS7 A;  1RTP 1;  1CFD A;  4DIR A;  1M63 B;  1B9A A;  1J7R A;  1R6P A;  1GJY A;  3O2P A;  3D0Y B;  3WHT B;  2ZRT A;  2AUC A;  2KGR A;  1QJT A;  2BL0 B;  2KAY A;  1XFV O;  3D10 A;  4JPZ B;  1QXP A;  2BCA A;  2MBX A;  1JWD A;  2BE4 A;  1KK7 Z;  4MZL A;  2LUX A;  1WRL A;  4MRX A;  1XO5 A;  1BT6 A;  1XVJ A;  3ZWH A;  1OZO A;  3BQ3 A;  2LVJ A;  1BJF A;  5CPV A;  2MLF C;  4OCI A;  1TRF A;  1BG1 A;  4YRU A;  3TDU A;  5AAN A;  1YX8 A;  3F45 A;  2PSR A;  1BLQ A;  1K9U A;  1MWN A;  4YGE B;  2PMY A;  2CXJ A;  3A8R A;  2LMT A;  3AKB A;  1ZUZ A;  1K94 A;  4XYN A;  5ER5 A;  3O6B A;  4PDZ A;  2G2B A;  1S6C A;  3BUW B;  4OKH A;  2FJU B;  3CLN A;  1MR8 A;  2JXL A;  3LK1 A;  1MF8 B;  1Q80 A;  4JQ0 D;  4NDC A;  4MZK A;  2O60 A;  5HYD A;  2WND A;  2WOS A;  2KBI A;  1L2O C;  1KFX S;  2WCF A;  4PHN A;  1LVC D;  1EXR A;  1REC A;  1KQM B;  1FI5 A;  2RGI A;  1ZMZ A;  1DTL A;  1QTX A;  1G8I A;  3A4U B;  1WY9 A;  3TS5 B;  1PVB A;  2L51 A;  4PE1 A;  1R2U A;  4PE0 A;  2GV5 A;  1UUS A;  1G33 A;  1B47 A;  3OX6 A;  1CMF A;  1GGW A;  3NSI A;  1UHH A;  1CLM A;  1ODB A;  2ISD A;  1N0Y A;  5AER A;  1JFK A;  3BUX B;  2H2K A;  2JT8 A;  4PHK A;  2IS9 A;  3C1V A;  2F2P A;  4MEW A;  3LK0 A;  1AJ5 A;  4M2Q A;  3TDI A;  1SCM C;  3VRQ A;  2KI4 C;  2GGZ A;  1SW8 A;  1S1E A;  5D7F A;  1BOD A;  1CFP A;  4YI8 A;  1D1O A;  1F8H A;  4OV2 A;  4U8D A;  2PRU A;  1PVA A;  2BE6 A;  3PN7 B;  2K0J A;  1EL4 A;  1DGU A;  1XFX O;  1J1D A;  1DT7 B;  2K2A A;  2LVK A;  1JBA A;  3AAK A;  3WHU B;  5CSN A;  4YGA A;  1PK0 D;  2G9B A;  3GK2 A;  2CNP A;  5DKN A;  1UHI A;  1TCO B;  1IGV A;  3EVU A;  4GBA A;  4DCK A;  1XFU O;  4GGN A;  2L2E A;  2OTG B;  3M0W A;  1M39 A;  1BR4 B;  3KF9 A;  4I5J A;  4ORA B;  3PAT A;  3OX5 A;  1J7O A;  2LHI A;  3DD4 A;  3JVT C;  3SG4 A;  1SYM A;  2Y1N A;  2OS8 C;  1SBJ A;  3OB2 B;  2VRG A;  1PRW A;  1CFC A;  2LMV A;  1XYD A;  1C07 A;  1PSR A;  2KYF A;  1B7T Y;  2L0P A;  1QVI Y;  1KQV A;  1B8C A;  1K93 D;  1KWO C;  1TNP A;  3CZT X;  2ZNE A;  3EK7 A;  1EH2 A;  1CLB A;  1XA5 A;  1UUR A;  3I5F C;  3JTD C;  1B7T Z;  1QX5 B;  1BF5 A;  4BY4 A;  5JJG A;  1CMG A;  1QVI Z;  3EKH A;  1SR6 C;  1H4B A;  1S5G Y;  3RLZ A;  1C7W A;  3PLF B;  3O4Y A;  1NX2 A;  1S3P A;  4AQJ A;  1NYA A;  1YUS A;  1Y1X A;  2KSP A;  2KHN A;  2MAZ A;  2Y4Q A;  2PAL A;  4MN0 A;  1FI6 A;  5AXI A;  1TNW A;  2LLT A;  3DVM A;  1EG3 A;  3TDZ A;  1IJ6 A;  2O5G A;  4GGF A;  1WDC C;  4NDD A;  1GGZ A;  2JNX A;  1AUI B;  1JF0 A;  3I5I B;  3AKA A;  1DJG A;  1CDM A;  1QAS A;  1YUR A;  3TUY B;  4JWQ A;  1DF0 A;  4YI9 A;  1XK4 A;  1KSM A;  1WLZ A;  4BY5 A;  4C0K A;  4GPL B;  1DGV A;  4CPV A;  2L4H A;  1PSB A;  1H8B A;  1A75 A;  3SJS A;  1MXE A;  3PFV A;  1K8U A;  2NCO A;  1FPW A;  2BCX A;  1NIW A;  1DJX A;  1QIV A;  4AQI A;  3BUM B;  3FWC A;  1CM1 A;  1F4Q A;  3H4S E;  3PAL A;  4PE7 A;  5JOL A;  5I2L A;  3SG6 A;  1QS7 A;  3VRO A;  2EHB A;  4MVF A;  1TNX A;  2JT3 A;  1NCX A;  5D69 A;  1ZOT B;  1LKJ A;  4N5X A;  1TOP A;  2JTZ A;  1SCV A;  2K7D A;  3OP0 A;  5BPJ A;  3DVE A;  3EKJ A;  1J1E A;  1XFW O;  1EG4 A;  1QX2 A;  1IKU A;  2I94 A;  1A03 A;  2KFF A;  2JZI A;  2L4I A;  1MXL C;  4YGD B;  2JNF A;  2LVV A;  2MLE C;  5CSJ A;  2F33 A;  1NCY A;  3OHM B;  5KU1 A;  5GQQ C;  2LHL A;  3LL8 B;  2F8P A;  2PAS A;  3CR5 X;  3I5G C;  4NQG A;  4C0L A;  3HX4 A;  2JC2 A;  3AAJ A;  1S6J A;  4E68 A;  2V53 A;  2ZFD A;  5PAL A;  2KFH A;  5CSF A;  1BR1 B;  1UHK A;  3DVJ A;  1BU3 A;  4I5L B;  2A4J A;  2CT9 A;  2JWW A;  2JRF A;  2LE9 B;  5I2O A;  2LLS A;  4I5N B;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...