2KHNA

Nmr solution structure of the eh 1 domain from human intersectin-1 protein. northeast structural genomics consortium target hr3646e.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
MGHHHHHHSHMAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646E.
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Intersectin-1
total genus 23
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2khnA00
3TDZA 1EH2A 4N1GA 2K7DA 4AOMA 2CBLA 2E30A 1L2OB 2LANA 1N2DA 1U5IB 4PE0A 1K9KA 1XO5A 5CSFA 1FW4A 1KK7Z 1JF2A 1M39A 3PATA 3NSLA 3BOWA 4MLWA 1S1EA 1XK4A 2K7OA 1B4CA 1XFUO 1UWOA 1NP8A 2KAYA 2CCMA 4P2YB 1QATA 1L2OC 4YI9A 2PALA 1SW8A 2ZN8A 3DVEA 3CR4X 1CDMA 3EVRA 4GGFA 4PCWA 5IBWA 1KQMC 3BOWB 1JBAA 4N5XA 1KQVA 4C0KA 4NQGA 3GK4X 2L98A 2LLTA 3PN7B 1LA0A 3F45A 1IG5A 3SIBA 4DUQA 1KWOC 1ODBA 3SG4A 2L50A 1MXEA 1KQMB 3FIAA 1K94A 1DGVA 1SY9A 2M49B 2M9GA 3I5IC 2LHLA 3MSEB 2L5XB 4PALA 1PVBA 4OR9B 1NCZA 1UHKA 1TCOB 3BUMB 5F6TA 1S36A 3VRQA 2CNPA 2A4JA 2F33A 3ICBA 1NYAA 1Q80A 2V53A 3AKBA 2BKIB 2H2KA 2LVIA 3CR5X 1CM4A 2FCDA 1OZSA 2BL0C 5FYXA 4MVFA 1SMGA 1KSOA 3EK4A 4CLNA 1B8LA 3SG2A 5G08A 1CDNA 3CLNA 2F3ZA 2LAPA 1M31A 5D69A 3WNXB 4M2OA 1K8UA 1BG1A 4MZLA 1YUUA 2LC5A 1J7PA 1QASA 2KQYA 5TNCA 2BL0B 1FBVA 2Y5IA 4QJ4B 1C7VA 2Y1MA 2BCBA 1UHHA 3NXAA 2KGBC 1ZACA 1DTLA 4Q04A 2CXJA 2HETA 2I7AA 4GGNA 4M2QA 2PVBA 1DJWA 2KYFA 2BCXA 4GBAA 3I5IB 4HRHA 3TS5B 1BU3A 1TNWA 1PRWA 3O6BA 2Q4UA 3DVJA 1F8HA 3PFVA 2KSPA 4PE4A 2CT9A 4YBHB 1CTRA 1SPYA 1OE9B 4U8DA 2O60A 3RM1A 3LLEA 4NDDA 2B1UA 3KEVA 2EC6B 1SL7A 2JXLA 3K21A 4OVNF 3TZ1A 4C0JA 1IWQA 1QTXA 2K2FA 2GV5A 2HQWA 3EKJA 1IH0A 2Q91A 1DJZA 2OS8C 2JNXA 3OB1B 4MRXA 1B7TY 3JVTC 1K96A 2M7LA 3FWBA 1C07A 2F2OA 1J1DA 1S6JA 5B8IB 1AHRA 4R1EA 1YRUB 3I5GC 3NSOA 4JQ0D 1A2XA 3KPXA 4WQ2A 4GNKB 1J55A 1CKKA 4I5KA 1QIWA 1S3PA 2I2RE 2JPTA 5I2LA 1BR1B 1OMRA 2JOJA 1W7IB 1DJYA 1JWDA 4MZJA 2L2EA 4DS7A 1B8CA 1EL4A 1CMFA 1XVJA 2F8PA 5ER5A 3SG6A 1NX2A 2WORA 4PE1A 2BBMA 4ORCB 3PSRA 5HKYA 1MWNA 5I2OA 1YRTB 2JRFA 3C1VA 1CLBA 1S6CA 1LINA 1ZFSA 1XK4C 3O2PA 4WQ3A 2JTZA 5I2QA 1TRFA 5D7FA 2KFGA 1AJ5A 1DGUA 2KDHA 2KAVA 1XYDA 4GGFC 4DCKA 4YRUA 2KGRA 1IKUA 1IRJA 1UUSA 4P5OE 2JC2A 3TDIA 1F4OA 4YGEB 1WRZA 3EVUA 2LVKA 1V1GA 1B7TZ 1Y1UA 1MHOA 2SASA 4NDBA 1BODA 1BMOA 4MEWA 1XFVO 2Y1NA 4MZKA 1SCMC 1MXLC 1PULA 1JUOA 5HKZA 1UHIA 2KHNA 4CPVA 1YURA 1DJXA 1NPQA 1A4PA 2KFFA 1FF1A 2K0JA 3OP0A 1XA5A 2ZNDA 5DKNA 2LMVA 1CM1A 2JTTA 2JQ6A 1QS7A 2SCPA 2KI6C 4DRWA 3DVMA 4HSZA 3TS5C 1F70A 3FWCA 1OQPA 2L51A 4TNCA 5CSJA 2KI6D 1TTXA 3I5GB 3O4YA 1QJTA 2BKHB 2MAZA 1UHJA 2KBMA 1WLZA 1B1GA 1DJIA 5J3XA 4GAOA 4I5NB 1ALVA 1K9PA 3AAKA 1LA3A 4OCIA 5AANA 1F54A 3DVKA 1MF8B 1QLSA 2ZFDA 3I5FB 4ZCUA 3LL8B 2JULA 4YI8A 2M29A 2BECA 4PHKA 3WXAA 1SNLA 2O5GA 2ISDA 1H8BA 1E8AA 3QRXA 1TOPA 2TN4A 4MRYA 2L4HA 3PM8A 1A75B 2M1UA 4MN0A 5AEQA 4JPZB 1N65A 2R2IA 1IQ3A 2QPTA 1LKJA 2BE4A 3DF0B 5PALA 1NWDA 3BXKA 1MUXA 1HT9A 3OB2B 1TNQA 2LCPA 1GGWA 1TCFA 1ZMZA 4XJKB 1UURA 3NSKA 4QJ5B 2OS8B 3WHUB 1Y1XA 4ORAB 1KFXS 1ZOTB 1OSAA 1QX5B 1V1FA 1NX3A 4GUKA 2JT3A 3JTDC 1J7OA 2JXCA 1BF5A 2CTNA 5KU1A 1Y6WA 4PHNA 2KBIA 1RJVA 3OX6A 1F55A 2COLB 1A29A 2MJWB 3D0YA 3O78A 1JC2A 1PK0D 4PE7A 2ZN9A 4L9MA 5I8NA 1LVCD 5K89A 1FPWA 4OV2A 1GGZA 1XFWO 4XYNA 2JNFA 4YGBB 1DVIA 3SG5A 4MBEA 1OOJA 4I5LB 5GQQC 1QLKA 3D10A 1ALWA 1CDLA 2MBXA 2AUCA 1TNPA 1EG3A 1WDCC 3CS1A 1N0YA 1IJ6A 1NCYA 2M0RA 4WRIA 4BY5A 1SYMA 1KK7Y 3IQOA 2M3WA 1YUTA 3BUXB 3I5FC 2OTGB 1A03A 1R2UA 4PHMA 2M1KB 2KOTA 2WCEA 2Y4QA 5JOLA 4CFRA 1K93D 4ETOA 3NSIA 1JFJA 2HF5A 3I5HB 4A4CA 2LP3A 2NCPA 2H61C 3JTDB 2NLNA 1XFZO 3TUYC 2KI4C 1CFCA 4BY4A 1SRAA 1QV0A 2MLEC 1YUSA 2HQ8A 1TIZA 4I5JA 2PMYA 2AMIA 2VRGA 4E68A 2LLSA 2NZ0A 2OPOA 4NDCA 5KTYA 4USLA 2K2AA 4CFQA 1YR5A 1DF0A 2EHBA 5DKQA 4PHJA 1KFUL 1GJYA 3M0WA 2PASA 3DF0A 3TUYB 2KI4B 2K8MB 1NX1A 4OKHA 1H4BA 1W7JB 1PSRA 2LUCA 1S5GZ 1BOCA 1PVAA 2FCEA 2F2PA 1CLLA 1JSAA 2LVVA 1KCYA 1K90D 1RROA 3WHTB 2WNDA 2GGZA 1B8RA 2LP2A 2EC6C 1PALA 2ZKMX 2LUXA 3SJSA 3LK0A 1DT7B 3H4SE 2JT8A 1QV1A 1WRKA 5DKRA 1CMGA 2JU0A 2M7NA 2KAXA 1GQMA 1BJFA 1S26D 2BCAA 2WCFA 3BUWB 1SR6B 3EVVA 1EJ3A 1YTZC 3VRNA 1CLMA 2LMTA 1OMVA 1TNXA 2MRDA 4QJ3B 1SKTA 2WOSA 2LMUA 2LNKA 1A75A 2K61A 2K7CA 1EG4A 1L7ZA 1NUBA 2E6WA 2GGMA 1S6IA 2KFHA 2JWWA 3PALA 1SR6C 4CIDA 3VGOA 4AQIA 1AK8A 4DIRA 2OTGC 3IQQA 1D1OA 1WLMA 1KFXL 1QVIY 3A8RA 1JFKA 4YGAA 1U5IA 1RWYA 2JT0A 3BUNB 3CR2A 1SCMB 2M8UA 1VRKA 1NCXA 1MR8A 3TDUA 1IGVA 3GK2A 3LCPC 2KQ6A 3CTNA 4ORBB 2LVJA 2KNEA 1K95A 1NX0A 1ZUZA 1J1EA 1KK8B 3EKHA 3OHMB 1CFPA 2L0PA 4FQOA 1NSHA 1QXPA 3BUOB 1HQVA 3GK1A 5KSZA 2WC8A 1K9UA 3D0YB 1WDCB 1CFFA 5CSNA 5BPJA 2FOTA 2NCOA 4YGCB 1G33A 1RK9A 5AERA 1SBJA 2MLFC 2HPSA 3SG7A 3KF9A 5AFPA 1J7QA 1M63B 1B9AA 2JZIA 3DD4A 1DF0B 1XFYO 1J7RA 1KSMA 3KHEA 1G4YR 2FJUB 1UP5A 5CPVA 1G8IA 1QX2A 1K2HA 1M46A 2I18A 1BR4B 5CSIA 1OZOA 1DJHA 2M97A 3BYAA 3GOFA 3SIAA 1KFUS 1FI6A 1OMDA 1DJGA 1RTP1 3EK7A 1AP4A 1EXRA 4IL1A 4GFTA 4JWQA 4MSPA 3VRRA 2G2BA 2LE9B 3IF7A 2BE6A 3KO0A 2F3YA 2ZRTA 1S5GY 3ZNIA 3LK1A 1WY9A 1YVHA 1KK8C 5AXIA 1XFXO 2NXQA 3RLZA 4UPGA 1BLQA 1UHNA 1DMOA 2MA2A 1IJ5A 4HREE 3I5HC 3JVTB 3CGAA 1QX7A 1RECA 1JF0A 2L4IA 1YX7A 3PLFB 3VROA 1CB1A 4GPLB 4ICBA 2PSRA 5ER4X 1RFJA 3EK8A 3PN7C 3FS7A 4YGDB 1C7WA 1M45A 1KWOB 1AJ4A 1TN4A 4M2PA 4C0LA 3A4UB 1CNPA 4ZCVA 2PRUA 2EGDA 4A4BA 1CDPA 3ZWHA 1SL9A 1AUIB 1QIVA 1SL8A 2DOQA 3CZTX 4FTGA 3AKAA 4HRGA 4XJKA 5HLOA 2D8NA 1YVLA 2ZNEA 1AVSA 3VRPA 2G9BA 5HLVA 4AQJA 2RGIA 1R6PA 3AAJA 5JJGA 3HCMA 1LXFC 1BT6A 2LM5A 2KYCA 2I94A 4PDZA 4F0ZB 2IS9A 2LLUA 3OX5A 1B47A 3HX4A 1QVIZ 1IQ5A 4N1FA 4D1EA 3BQ3A 2MHHA 2AAOA 2LHIA 1FI5A 3CWGA 1PSBA 2LV7A 2P6BB 2ZRSA 5HYDA 3E3RA 3SG3A 1SCVA 1Y1AA 1WRLA 1X02A 1CFDA 1YX8A 2QACA 1NIWA 2BBNA 1SK6D 1Y0VH 1F4QA 5HKWA 2WCBA 1F71A 2H61A 2K7BA 1MQ1A
chains in the Genus database with same CATH superfamily
3TDZA 1EH2A 4N1GA 2K7DA 4AOMA 2CBLA 2E30A 1L2OB 2LANA 1N2DA 1U5IB 4PE0A 1K9KA 1XO5A 5CSFA 1FW4A 1KK7Z 1JF2A 1M39A 3PATA 3NSLA 3BOWA 4MLWA 1S1EA 1XK4A 2K7OA 1B4CA 1OW4A 1XFUO 1UWOA 1NP8A 1T14A 2KAYA 2CCMA 4P2YB 1QATA 1L2OC 4YI9A 2PALA 1SW8A 2ZN8A 1LS8A 3DVEA 3CR4X 1CDMA 3EVRA 4GGFA 4PCWA 5IBWA 1KQMC 3BOWB 1DQEA 3CYZA 4N5XA 1JBAA 1KQVA 4C0KA 3B6XA 4NQGA 2K60A 2L98A 3GK4X 4F7FA 2LLTA 3PN7B 1LA0A 3F45A 1IG5A 1DEKA 3SIBA 4DUQA 2WCLA 1KWOC 1ODBA 4JD9A 3SG4A 2L50A 1MXEA 1KQMB 3FIAA 1K94A 2WCJA 1DGVA 1SY9A 2M49B 2M9GA 3I5IC 2LHLA 3MSEB 2L5XB 4PALA 2WC6A 1PVBA 4OR9B 1NCZA 1UHKA 1TCOB 3BUMB 5F6TA 3SS5A 3CDNA 1S36A 1OOHA 2CNPA 2L5YA 3VRQA 2A4JA 2F33A 3ICBA 1NYAA 1Q80A 5FI2A 2V53A 3AKBA 3S0DA 2BKIB 3PM2A 2H2KA 2LVIA 3CR5X 1CM4A 2FCDA 1OZSA 2BL0C 4PT1A 5FYXA 4MVFA 1SMGA 1KSOA 3EK4A 4CLNA 1B8LA 3BFBA 3SG2A 5G08A 3D73A 1CDNA 3CLNA 2F3ZA 2LAPA 3B87A 1M31A 5D69A 3WNXB 4M2OA 1K8UA 1BG1A 1OOIX 4MZLA 1YUUA 2LC5A 1J7PA 1QASA 2KQYA 2WCMA 2BL0B 3R1PA 5TNCA 1TUJA 1FBVA 2Y5IA 3OGNA 4QJ4B 1C7VA 2Y1MA 2BCBA 1UHHA 3D76A 3NXAA 2KGBC 1ZACA 1DTLA 4Q04A 2CXJA 1ORGA 2HETA 2I7AA 3DZTA 4GGNA 2PVBA 1DJWA 2KYFA 4M2QA 2H8VA 2BCXA 4GBAA 3I5IB 4HRHA 3TS5B 1BU3A 1TNWA 1PRWA 3O6BA 5D3OA 2Q4UA 3DVJA 1F8HA 3PFVA 2KSPA 3Q8IA 4PE4A 2CT9A 4YBHB 1CTRA 1SPYA 3L47A 1OE9B 4U8DA 3FE8A 2QEBA 2O60A 3RM1A 3LLEA 4NDDA 2B1UA 3KEVA 2EC6B 1SL7A 2JXLA 3K21A 4OVNF 3TZ1A 4C0JA 1IWQA 1QTXA 2K2FA 2GV5A 2HQWA 3EKJA 1IH0A 2Q91A 1DJZA 2OS8C 2JNXA 3OB1B 3D77A 4JKTA 4MRXA 1B7TY 2GTEA 3JVTC 1K96A 2M7LA 3S0AA 3UNWA 3FWBA 1C07A 1J1DA 1S6JA 2F2OA 2FJYA 1AHRA 4R1EA 5B8IB 1YRUB 3I5GC 3NSOA 4JQ0D 1A2XA 3KPXA 4WQ2A 3BJHA 4GNKB 1J55A 3BFAA 1CKKA 4I5KA 1QIWA 1S3PA 2I2RE 2JPTA 5I2LA 1BR1B 1OMRA 2JOJA 1W7IB 1DJYA 1JWDA 4MZJA 2L2EA 4DS7A 1B8CA 1EL4A 4KYNA 1CMFA 1XVJA 2F8PA 5ER5A 3SG6A 1NX2A 2WORA 4PE1A 2BBMA 4ORCB 3PSRA 1QWVA 1MWNA 5HKYA 5I2OA 3SS4A 1YRTB 2JRFA 3C1VA 1CLBA 1S6CA 1LINA 1ZFSA 2KLEA 1XK4C 3O2PA 4WQ3A 2JTZA 5I2QA 3V2LA 1TRFA 5D7FA 2KFGA 1AJ5A 5EL2A 1DGUA 2KDHA 2KAVA 1XYDA 4GGFC 4DCKA 4YRUA 2KGRA 3FE6A 1IRJA 1UUSA 4P5OE 1IKUA 2JC2A 3R1OA 3TDIA 1XFRA 1F4OA 4YGEB 1WRZA 3EVUA 2JPOA 2LVKA 1V1GA 1B7TZ 1Y1UA 1MHOA 2SASA 3NGVA 4NDBA 1BODA 1BMOA 2YGUA 4MEWA 3RZSA 1XFVO 2Y1NA 3D75A 4MZKA 3S0GA 1SCMC 2L2CA 1MXLC 1PULA 1JUOA 2QDIA 5HKZA 3B88A 1UHIA 2KHNA 3K1EA 1YURA 1DJXA 4CPVA 1NPQA 1A4PA 2KFFA 3OBVA 1FF1A 2K0JA 3OP0A 3CABA 1XA5A 2ZNDA 5DKNA 2LMVA 1CM1A 2JTTA 2JQ6A 1QS7A 3O4XA 2SCPA 2KI6C 4DRWA 1TWOA 3DVMA 4HSZA 3TS5C 1F70A 3FWCA 1OQPA 2L51A 4TNCA 5CSJA 2KI6D 1TTXA 3I5GB 1DC1A 3O4YA 1QJTA 2BKHB 2MAZA 1UHJA 2KBMA 1WLZA 1B1GA 1DJIA 5J3XA 4GAOA 4I5NB 1ALVA 1K9PA 3AAKA 1LA3A 4OCIA 5AANA 1F54A 3DVKA 1MF8B 1QLSA 2ZFDA 3I5FB 4ZCUA 3LL8B 2JULA 4YI8A 2M29A 2BECA 3D78A 4PHKA 3QMEA 3WXAA 1SNLA 2O5GA 2ISDA 1H8BA 1E8AA 3QRXA 1TOPA 2TN4A 3R72A 2L4HA 4MRYA 3L4LA 3PM8A 1A75B 2M1UA 4MN0A 5AEQA 2KLDA 3L4AA 4JPZB 1N65A 4INXA 2R2IA 3N7HA 1IQ3A 2QPTA 1LKJA 2BE4A 3DF0B 5PALA 1NWDA 3BXKA 1MUXA 1HT9A 3OB2B 1TNQA 2LCPA 4FQTA 1GGWA 1TCFA 1ZMZA 4XJKB 3SS3A 2QEOA 1UURA 3NHTA 3NSKA 4QJ5B 2OS8B 3WHUB 1Y1XA 4ORAB 1KFXS 1OOFA 1ZOTB 2PYQA 1OSAA 5I94A 1QX5B 1V1FA 1NX3A 4GUKA 2JT3A 3JTDC 1J7OA 2JXCA 1BF5A 2CTNA 2KPHA 1Y6WA 5KU1A 4PHNA 2KBIA 1RJVA 3OX6A 1F55A 2COLB 1A29A 2MJWB 3D0YA 3O78A 1JC2A 1PK0D 4PE7A 2ZN9A 4L9MA 5I8NA 1LVCD 5K89A 1FPWA 4OV2A 1GGZA 1XFWO 3IVTA 4XYNA 2JNFA 4YGBB 1DVIA 3SG5A 4MBEA 1OOJA 4I5LB 5GQQC 1QLKA 3D10A 1ALWA 1CDLA 5DICA 2MBXA 2AUCA 1TNPA 1EG3A 1WDCC 3CS1A 3CZ1A 1N0YA 1IJ6A 1NCYA 2M0RA 4WRIA 4BY5A 1SYMA 1KK7Y 3IQOA 2M3WA 1YUTA 3BUXB 3I5FC 2OTGB 1A03A 1R2UA 4PHMA 2M1KB 2KOTA 2WCEA 2Y4QA 3DY9A 5JOLA 1K93D 4CFRA 3NSIA 4ETOA 1JFJA 2HF5A 3I5HB 4A4CA 3D74A 1DELA 2LP3A 2NCPA 3CZ0A 3PJIA 2H61C 3JTDB 2NLNA 1XFZO 3TUYC 3UO9A 2KI4C 1CFCA 4BY4A 1SRAA 1QV0A 2MLEC 1YUSA 2HQ8A 1TIZA 4I5JA 2PMYA 2AMIA 2VRGA 3R1VA 4E68A 2LLSA 2NZ0A 2OPOA 4NDCA 5KTYA 4USLA 1OOGA 2K2AA 4OZDA 1YR5A 4CFQA 1DF0A 2EHBA 5DKQA 4PHJA 1KFUL 1GJYA 3M0WA 2PASA 3DF0A 3TUYB 2KI4B 2K8MB 1NX1A 4OKHA 1H4BA 1W7JB 1PSRA 2LUCA 1S5GZ 1BOCA 1C3YA 1PVAA 2P70A 2FCEA 1Z2CB 2F2PA 1CLLA 1JSAA 2LVVA 1KCYA 1K90D 1RROA 3WHTB 2WNDA 1IIOA 2GGZA 5FI7A 1B8RA 2LP2A 2EC6C 1PALA 2ZKMX 2LUXA 3SJSA 3LK0A 4INWA 3H4SE 1DT7B 2JT8A 1QV1A 1WRKA 5DKRA 1CMGA 2JU0A 2M7NA 2KAXA 1GQMA 1BJFA 1S26D 2BCAA 2WCFA 3BUWB 1SR6B 3EVVA 1EJ3A 1YTZC 3VRNA 1CLMA 2LMTA 1OMVA 1TNXA 2MRDA 4QJ3B 1SKTA 2WOSA 2LMUA 2LNKA 3S0EA 1A75A 1C3ZA 2K61A 2K7CA 1EG4A 1L7ZA 1NUBA 2E6WA 2GGMA 1S6IA 2KFHA 2JWWA 3PALA 1SR6C 4CIDA 1W9ZA 1Z4HA 3VGOA 4AQIA 2WCHA 1AK8A 4DIRA 2OTGC 3IQQA 1D1OA 1WLMA 2P71A 1KFXL 1QVIY 2QEHA 3A8RA 1JFKA 4YGAA 1U5IA 1RWYA 2JT0A 3BUNB 3CR2A 1SCMB 2M8UA 1VRKA 1NCXA 1MR8A 3S0FA 3TDUA 1IGVA 3GK2A 3LCPC 3VB1A 5HL1A 2KQ6A 2QEVA 3CTNA 4ORBB 2LVJA 2KNEA 1K95A 1NX0A 1ZUZA 3DXLA 1J1EA 1KK8B 3EKHA 3OHMB 1CFPA 2L0PA 4FQOA 1NSHA 1QXPA 3BUOB 1HQVA 3GK1A 5KSZA 2WC8A 1K9UA 3D0YB 1WDCB 3B86A 3DYEA 5JJGA 1CFFA 5CSNA 5BPJA 2FOTA 2NCOA 4YGCB 1G33A 1RK9A 5AERA 1SBJA 2MLFC 2HPSA 3SG7A 3KF9A 5AFPA 3CZ2A 1M63B 1J7QA 1B9AA 2JZIA 3DD4A 1DF0B 1XFYO 1J7RA 1KSMA 1SSEB 3KHEA 1G4YR 2FJUB 1UP5A 5CPVA 1G8IA 1QX2A 3EG5B 1K2HA 1M46A 2I18A 1BR4B 5CSIA 1OZOA 1DJHA 2M97A 3BYAA 3GOFA 3SIAA 1KFUS 2WC5A 1FI6A 1OMDA 1DJGA 1RTP1 3EK7A 1AP4A 1EXRA 4IL1A 4GFTA 4JWQA 4MSPA 3VRRA 2G2BA 3BFHA 2LE9B 3IF7A 2BE6A 3KO0A 2F3YA 2ZRTA 1S5GY 3ZNIA 1GM0A 3LK1A 1WY9A 1YVHA 1KK8C 5AXIA 1XFXO 2NXQA 3RLZA 4UPGA 1BLQA 1UHNA 1DMOA 2MA2A 4AQJA 1IJ5A 4HREE 3I5HC 3JVTB 3CGAA 1QX7A 1RECA 2BNXA 1JF0A 2L4IA 1YX7A 2PQLA 3PLFB 3VROA 1CB1A 4GPLB 4ICBA 2PSRA 5ER4X 1RFJA 3EK8A 3PN7C 3FS7A 4YGDB 1C7WA 1M45A 1KWOB 1AJ4A 1P28A 1TN4A 4M2PA 4C0LA 3A4UB 1CNPA 3B7AA 4ZCVA 2PRUA 2EGDA 4A4BA 1CDPA 3ZWHA 1SL9A 1AUIB 1QIVA 1SL8A 2DOQA 3CZTX 4FTGA 3AKAA 4HRGA 4XJKA 5HLOA 2D8NA 1YVLA 2ZNEA 1AVSA 3VRPA 2G9BA 3FE9A 5HLVA 2RGIA 1R6PA 1TUZA 3AAJA 3HCMA 1LXFC 5FI6A 1BT6A 2LM5A 2KYCA 2I94A 4PDZA 4F0ZB 2IS9A 2LLUA 3OX5A 1B47A 3HX4A 1QVIZ 1IQ5A 4N1FA 4D1EA 3BQ3A 2MHHA 2AAOA 4IJ7A 2LHIA 2WCKA 1FI5A 3CWGA 1PSBA 2LV7A 2P6BB 2ZRSA 3NHIA 3S0BA 5HYDA 3E3RA 3SG3A 1SCVA 1Y1AA 2ERBA 1WRLA 1X02A 1CFDA 1YX8A 2QACA 1NIWA 2BBNA 1SK6D 1Y0VH 1F4QA 2BAPA 2WCBA 5HKWA 1F71A 2H61A 2K7BA 1MQ1A
chains in the Genus database with same CATH topology
3TDZA 1EH2A 4N1GA 2K7DA 4AOMA 2CBLA 2E30A 1L2OB 2LANA 1N2DA 1U5IB 4PE0A 1K9KA 1XO5A 5CSFA 1FW4A 1KK7Z 1JF2A 1M39A 3PATA 3NSLA 3BOWA 4MLWA 1S1EA 1XK4A 2K7OA 1B4CA 1XFUO 1UWOA 1NP8A 2KAYA 2CCMA 4P2YB 1QATA 1L2OC 4YI9A 2PALA 1SW8A 2ZN8A 3DVEA 3CR4X 1CDMA 3EVRA 4GGFA 4PCWA 5IBWA 1KQMC 3BOWB 1JBAA 4N5XA 1KQVA 4C0KA 4NQGA 3GK4X 2L98A 2LLTA 3PN7B 1LA0A 3F45A 1IG5A 3SIBA 4DUQA 1KWOC 1ODBA 3SG4A 2L50A 1MXEA 1KQMB 3FIAA 1K94A 1DGVA 1SY9A 2M49B 2M9GA 3I5IC 2LHLA 3MSEB 2L5XB 4PALA 1PVBA 4OR9B 1NCZA 1UHKA 1TCOB 3BUMB 5F6TA 1S36A 3VRQA 2CNPA 2A4JA 2F33A 3ICBA 1NYAA 1Q80A 2V53A 3AKBA 2BKIB 2H2KA 2LVIA 3CR5X 1CM4A 2FCDA 1OZSA 2BL0C 5FYXA 4MVFA 1SMGA 1KSOA 3EK4A 4CLNA 1B8LA 3SG2A 5G08A 1CDNA 3CLNA 2F3ZA 2LAPA 1M31A 5D69A 3WNXB 4M2OA 1K8UA 1BG1A 4MZLA 1YUUA 2LC5A 1J7PA 1QASA 2KQYA 5TNCA 2BL0B 1FBVA 2Y5IA 4QJ4B 1C7VA 2Y1MA 2BCBA 1UHHA 3NXAA 2KGBC 1ZACA 1DTLA 4Q04A 2CXJA 2HETA 2I7AA 4GGNA 4M2QA 2PVBA 1DJWA 2KYFA 2BCXA 4GBAA 3I5IB 4HRHA 3TS5B 1BU3A 1TNWA 1PRWA 3O6BA 2Q4UA 3DVJA 1F8HA 3PFVA 2KSPA 4PE4A 2CT9A 4YBHB 1CTRA 1SPYA 1OE9B 4U8DA 2O60A 3RM1A 3LLEA 4NDDA 2B1UA 3KEVA 2EC6B 1SL7A 2JXLA 3K21A 4OVNF 3TZ1A 4C0JA 1IWQA 1QTXA 2K2FA 2GV5A 2HQWA 3EKJA 1IH0A 2Q91A 1DJZA 2OS8C 2JNXA 3OB1B 4MRXA 1B7TY 3JVTC 1K96A 2M7LA 3FWBA 1C07A 2F2OA 1J1DA 1S6JA 5B8IB 1AHRA 4R1EA 1YRUB 3I5GC 3NSOA 4JQ0D 1A2XA 3KPXA 4WQ2A 4GNKB 1J55A 1CKKA 4I5KA 1QIWA 1S3PA 2I2RE 2JPTA 5I2LA 1BR1B 1OMRA 2JOJA 1W7IB 1DJYA 1JWDA 4MZJA 2L2EA 4DS7A 1B8CA 1EL4A 1CMFA 1XVJA 2F8PA 5ER5A 3SG6A 1NX2A 2WORA 4PE1A 2BBMA 4ORCB 3PSRA 5HKYA 1MWNA 5I2OA 1YRTB 2JRFA 3C1VA 1CLBA 1S6CA 1LINA 1ZFSA 1XK4C 3O2PA 4WQ3A 2JTZA 5I2QA 1TRFA 5D7FA 2KFGA 1AJ5A 1DGUA 2KDHA 2KAVA 1XYDA 4GGFC 4DCKA 4YRUA 2KGRA 1IKUA 1IRJA 1UUSA 4P5OE 2JC2A 3TDIA 1F4OA 4YGEB 1WRZA 3EVUA 2LVKA 1V1GA 1B7TZ 1Y1UA 1MHOA 2SASA 4NDBA 1BODA 1BMOA 4MEWA 1XFVO 2Y1NA 4MZKA 1SCMC 1MXLC 1PULA 1JUOA 5HKZA 1UHIA 2KHNA 4CPVA 1YURA 1DJXA 1NPQA 1A4PA 2KFFA 1FF1A 2K0JA 3OP0A 1XA5A 2ZNDA 5DKNA 2LMVA 1CM1A 2JTTA 2JQ6A 1QS7A 2SCPA 2KI6C 4DRWA 3DVMA 4HSZA 3TS5C 1F70A 3FWCA 1OQPA 2L51A 4TNCA 5CSJA 2KI6D 1TTXA 3I5GB 3O4YA 1QJTA 2BKHB 2MAZA 1UHJA 2KBMA 1WLZA 1B1GA 1DJIA 5J3XA 4GAOA 4I5NB 1ALVA 1K9PA 3AAKA 1LA3A 4OCIA 5AANA 1F54A 3DVKA 1MF8B 1QLSA 2ZFDA 3I5FB 4ZCUA 3LL8B 2JULA 4YI8A 2M29A 2BECA 4PHKA 3WXAA 1SNLA 2O5GA 2ISDA 1H8BA 1E8AA 3QRXA 1TOPA 2TN4A 4MRYA 2L4HA 3PM8A 1A75B 2M1UA 4MN0A 5AEQA 4JPZB 1N65A 2R2IA 1IQ3A 2QPTA 1LKJA 2BE4A 3DF0B 5PALA 1NWDA 3BXKA 1MUXA 1HT9A 3OB2B 1TNQA 2LCPA 1GGWA 1TCFA 1ZMZA 4XJKB 1UURA 3NSKA 4QJ5B 2OS8B 3WHUB 1Y1XA 4ORAB 1KFXS 1ZOTB 1OSAA 1QX5B 1V1FA 1NX3A 4GUKA 2JT3A 3JTDC 1J7OA 2JXCA 1BF5A 2CTNA 5KU1A 1Y6WA 4PHNA 2KBIA 1RJVA 3OX6A 1F55A 2COLB 1A29A 2MJWB 3D0YA 3O78A 1JC2A 1PK0D 4PE7A 2ZN9A 4L9MA 5I8NA 1LVCD 5K89A 1FPWA 4OV2A 1GGZA 1XFWO 4XYNA 2JNFA 4YGBB 1DVIA 3SG5A 4MBEA 1OOJA 4I5LB 5GQQC 1QLKA 3D10A 1ALWA 1CDLA 2MBXA 2AUCA 1TNPA 1EG3A 1WDCC 3CS1A 1N0YA 1IJ6A 1NCYA 2M0RA 4WRIA 4BY5A 1SYMA 1KK7Y 3IQOA 2M3WA 1YUTA 3BUXB 3I5FC 2OTGB 1A03A 1R2UA 4PHMA 2M1KB 2KOTA 2WCEA 2Y4QA 5JOLA 4CFRA 1K93D 4ETOA 3NSIA 1JFJA 2HF5A 3I5HB 4A4CA 2LP3A 2NCPA 2H61C 3JTDB 2NLNA 1XFZO 3TUYC 2KI4C 1CFCA 4BY4A 1SRAA 1QV0A 2MLEC 1YUSA 2HQ8A 1TIZA 4I5JA 2PMYA 2AMIA 2VRGA 4E68A 2LLSA 2NZ0A 2OPOA 4NDCA 5KTYA 4USLA 2K2AA 4CFQA 1YR5A 1DF0A 2EHBA 5DKQA 4PHJA 1KFUL 1GJYA 3M0WA 2PASA 3DF0A 3TUYB 2KI4B 2K8MB 1NX1A 4OKHA 1H4BA 1W7JB 1PSRA 2LUCA 1S5GZ 1BOCA 1PVAA 2FCEA 2F2PA 1CLLA 1JSAA 2LVVA 1KCYA 1K90D 1RROA 3WHTB 2WNDA 2GGZA 1B8RA 2LP2A 2EC6C 1PALA 2ZKMX 2LUXA 3SJSA 3LK0A 1DT7B 3H4SE 2JT8A 1QV1A 1WRKA 5DKRA 1CMGA 2JU0A 2M7NA 2KAXA 1GQMA 1BJFA 1S26D 2BCAA 2WCFA 3BUWB 1SR6B 3EVVA 1EJ3A 1YTZC 3VRNA 1CLMA 2LMTA 1OMVA 1TNXA 2MRDA 4QJ3B 1SKTA 2WOSA 2LMUA 2LNKA 1A75A 2K61A 2K7CA 1EG4A 1L7ZA 1NUBA 2E6WA 2GGMA 1S6IA 2KFHA 2JWWA 3PALA 1SR6C 4CIDA 3VGOA 4AQIA 1AK8A 4DIRA 2OTGC 3IQQA 1D1OA 1WLMA 1KFXL 1QVIY 3A8RA 1JFKA 4YGAA 1U5IA 1RWYA 2JT0A 3BUNB 3CR2A 1SCMB 2M8UA 1VRKA 1NCXA 1MR8A 3TDUA 1IGVA 3GK2A 3LCPC 2KQ6A 3CTNA 4ORBB 2LVJA 2KNEA 1K95A 1NX0A 1ZUZA 1J1EA 1KK8B 3EKHA 3OHMB 1CFPA 2L0PA 4FQOA 1NSHA 1QXPA 3BUOB 1HQVA 3GK1A 5KSZA 2WC8A 1K9UA 3D0YB 1WDCB 1CFFA 5CSNA 5BPJA 2FOTA 2NCOA 4YGCB 1G33A 1RK9A 5AERA 1SBJA 2MLFC 2HPSA 3SG7A 3KF9A 5AFPA 1J7QA 1M63B 1B9AA 2JZIA 3DD4A 1DF0B 1XFYO 1J7RA 1KSMA 3KHEA 1G4YR 2FJUB 1UP5A 5CPVA 1G8IA 1QX2A 1K2HA 1M46A 2I18A 1BR4B 5CSIA 1OZOA 1DJHA 2M97A 3BYAA 3GOFA 3SIAA 1KFUS 1FI6A 1OMDA 1DJGA 1RTP1 3EK7A 1AP4A 1EXRA 4IL1A 4GFTA 4JWQA 4MSPA 3VRRA 2G2BA 2LE9B 3IF7A 2BE6A 3KO0A 2F3YA 2ZRTA 1S5GY 3ZNIA 3LK1A 1WY9A 1YVHA 1KK8C 5AXIA 1XFXO 2NXQA 3RLZA 4UPGA 1BLQA 1UHNA 1DMOA 2MA2A 1IJ5A 4HREE 3I5HC 3JVTB 3CGAA 1QX7A 1RECA 1JF0A 2L4IA 1YX7A 3PLFB 3VROA 1CB1A 4GPLB 4ICBA 2PSRA 5ER4X 1RFJA 3EK8A 3PN7C 3FS7A 4YGDB 1C7WA 1M45A 1KWOB 1AJ4A 1TN4A 4M2PA 4C0LA 3A4UB 1CNPA 4ZCVA 2PRUA 2EGDA 4A4BA 1CDPA 3ZWHA 1SL9A 1AUIB 1QIVA 1SL8A 2DOQA 3CZTX 4FTGA 3AKAA 4HRGA 4XJKA 5HLOA 2D8NA 1YVLA 2ZNEA 1AVSA 3VRPA 2G9BA 5HLVA 4AQJA 2RGIA 1R6PA 3AAJA 5JJGA 3HCMA 1LXFC 1BT6A 2LM5A 2KYCA 2I94A 4PDZA 4F0ZB 2IS9A 2LLUA 3OX5A 1B47A 3HX4A 1QVIZ 1IQ5A 4N1FA 4D1EA 3BQ3A 2MHHA 2AAOA 2LHIA 1FI5A 3CWGA 1PSBA 2LV7A 2P6BB 2ZRSA 5HYDA 3E3RA 3SG3A 1SCVA 1Y1AA 1WRLA 1X02A 1CFDA 1YX8A 2QACA 1NIWA 2BBNA 1SK6D 1Y0VH 1F4QA 5HKWA 2WCBA 1F71A 2H61A 2K7BA 1MQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDZ A;  1EH2 A;  4N1G A;  2K7D A;  4AOM A;  2CBL A;  2E30 A;  1L2O B;  2LAN A;  1N2D A;  1U5I B;  4PE0 A;  1K9K A;  1XO5 A;  5CSF A;  1FW4 A;  1KK7 Z;  1JF2 A;  1M39 A;  3PAT A;  3NSL A;  3BOW A;  4MLW A;  1S1E A;  1XK4 A;  2K7O A;  1B4C A;  1XFU O;  1UWO A;  1NP8 A;  2KAY A;  2CCM A;  4P2Y B;  1QAT A;  1L2O C;  4YI9 A;  2PAL A;  1SW8 A;  2ZN8 A;  3DVE A;  3CR4 X;  1CDM A;  3EVR A;  4GGF A;  4PCW A;  5IBW A;  1KQM C;  3BOW B;  1JBA A;  4N5X A;  1KQV A;  4C0K A;  4NQG A;  3GK4 X;  2L98 A;  2LLT A;  3PN7 B;  1LA0 A;  3F45 A;  1IG5 A;  3SIB A;  4DUQ A;  1KWO C;  1ODB A;  3SG4 A;  2L50 A;  1MXE A;  1KQM B;  3FIA A;  1K94 A;  1DGV A;  1SY9 A;  2M49 B;  2M9G A;  3I5I C;  2LHL A;  3MSE B;  2L5X B;  4PAL A;  1PVB A;  4OR9 B;  1NCZ A;  1UHK A;  1TCO B;  3BUM B;  5F6T A;  1S36 A;  3VRQ A;  2CNP A;  2A4J A;  2F33 A;  3ICB A;  1NYA A;  1Q80 A;  2V53 A;  3AKB A;  2BKI B;  2H2K A;  2LVI A;  3CR5 X;  1CM4 A;  2FCD A;  1OZS A;  2BL0 C;  5FYX A;  4MVF A;  1SMG A;  1KSO A;  3EK4 A;  4CLN A;  1B8L A;  3SG2 A;  5G08 A;  1CDN A;  3CLN A;  2F3Z A;  2LAP A;  1M31 A;  5D69 A;  3WNX B;  4M2O A;  1K8U A;  1BG1 A;  4MZL A;  1YUU A;  2LC5 A;  1J7P A;  1QAS A;  2KQY A;  5TNC A;  2BL0 B;  1FBV A;  2Y5I A;  4QJ4 B;  1C7V A;  2Y1M A;  2BCB A;  1UHH A;  3NXA A;  2KGB C;  1ZAC A;  1DTL A;  4Q04 A;  2CXJ A;  2HET A;  2I7A A;  4GGN A;  4M2Q A;  2PVB A;  1DJW A;  2KYF A;  2BCX A;  4GBA A;  3I5I B;  4HRH A;  3TS5 B;  1BU3 A;  1TNW A;  1PRW A;  3O6B A;  2Q4U A;  3DVJ A;  1F8H A;  3PFV A;  2KSP A;  4PE4 A;  2CT9 A;  4YBH B;  1CTR A;  1SPY A;  1OE9 B;  4U8D A;  2O60 A;  3RM1 A;  3LLE A;  4NDD A;  2B1U A;  3KEV A;  2EC6 B;  1SL7 A;  2JXL A;  3K21 A;  4OVN F;  3TZ1 A;  4C0J A;  1IWQ A;  1QTX A;  2K2F A;  2GV5 A;  2HQW A;  3EKJ A;  1IH0 A;  2Q91 A;  1DJZ A;  2OS8 C;  2JNX A;  3OB1 B;  4MRX A;  1B7T Y;  3JVT C;  1K96 A;  2M7L A;  3FWB A;  1C07 A;  2F2O A;  1J1D A;  1S6J A;  5B8I B;  1AHR A;  4R1E A;  1YRU B;  3I5G C;  3NSO A;  4JQ0 D;  1A2X A;  3KPX A;  4WQ2 A;  4GNK B;  1J55 A;  1CKK A;  4I5K A;  1QIW A;  1S3P A;  2I2R E;  2JPT A;  5I2L A;  1BR1 B;  1OMR A;  2JOJ A;  1W7I B;  1DJY A;  1JWD A;  4MZJ A;  2L2E A;  4DS7 A;  1B8C A;  1EL4 A;  1CMF A;  1XVJ A;  2F8P A;  5ER5 A;  3SG6 A;  1NX2 A;  2WOR A;  4PE1 A;  2BBM A;  4ORC B;  3PSR A;  5HKY A;  1MWN A;  5I2O A;  1YRT B;  2JRF A;  3C1V A;  1CLB A;  1S6C A;  1LIN A;  1ZFS A;  1XK4 C;  3O2P A;  4WQ3 A;  2JTZ A;  5I2Q A;  1TRF A;  5D7F A;  2KFG A;  1AJ5 A;  1DGU A;  2KDH A;  2KAV A;  1XYD A;  4GGF C;  4DCK A;  4YRU A;  2KGR A;  1IKU A;  1IRJ A;  1UUS A;  4P5O E;  2JC2 A;  3TDI A;  1F4O A;  4YGE B;  1WRZ A;  3EVU A;  2LVK A;  1V1G A;  1B7T Z;  1Y1U A;  1MHO A;  2SAS A;  4NDB A;  1BOD A;  1BMO A;  4MEW A;  1XFV O;  2Y1N A;  4MZK A;  1SCM C;  1MXL C;  1PUL A;  1JUO A;  5HKZ A;  1UHI A;  2KHN A;  4CPV A;  1YUR A;  1DJX A;  1NPQ A;  1A4P A;  2KFF A;  1FF1 A;  2K0J A;  3OP0 A;  1XA5 A;  2ZND A;  5DKN A;  2LMV A;  1CM1 A;  2JTT A;  2JQ6 A;  1QS7 A;  2SCP A;  2KI6 C;  4DRW A;  3DVM A;  4HSZ A;  3TS5 C;  1F70 A;  3FWC A;  1OQP A;  2L51 A;  4TNC A;  5CSJ A;  2KI6 D;  1TTX A;  3I5G B;  3O4Y A;  1QJT A;  2BKH B;  2MAZ A;  1UHJ A;  2KBM A;  1WLZ A;  1B1G A;  1DJI A;  5J3X A;  4GAO A;  4I5N B;  1ALV A;  1K9P A;  3AAK A;  1LA3 A;  4OCI A;  5AAN A;  1F54 A;  3DVK A;  1MF8 B;  1QLS A;  2ZFD A;  3I5F B;  4ZCU A;  3LL8 B;  2JUL A;  4YI8 A;  2M29 A;  2BEC A;  4PHK A;  3WXA A;  1SNL A;  2O5G A;  2ISD A;  1H8B A;  1E8A A;  3QRX A;  1TOP A;  2TN4 A;  4MRY A;  2L4H A;  3PM8 A;  1A75 B;  2M1U A;  4MN0 A;  5AEQ A;  4JPZ B;  1N65 A;  2R2I A;  1IQ3 A;  2QPT A;  1LKJ A;  2BE4 A;  3DF0 B;  5PAL A;  1NWD A;  3BXK A;  1MUX A;  1HT9 A;  3OB2 B;  1TNQ A;  2LCP A;  1GGW A;  1TCF A;  1ZMZ A;  4XJK B;  1UUR A;  3NSK A;  4QJ5 B;  2OS8 B;  3WHU B;  1Y1X A;  4ORA B;  1KFX S;  1ZOT B;  1OSA A;  1QX5 B;  1V1F A;  1NX3 A;  4GUK A;  2JT3 A;  3JTD C;  1J7O A;  2JXC A;  1BF5 A;  2CTN A;  5KU1 A;  1Y6W A;  4PHN A;  2KBI A;  1RJV A;  3OX6 A;  1F55 A;  2COL B;  1A29 A;  2MJW B;  3D0Y A;  3O78 A;  1JC2 A;  1PK0 D;  4PE7 A;  2ZN9 A;  4L9M A;  5I8N A;  1LVC D;  5K89 A;  1FPW A;  4OV2 A;  1GGZ A;  1XFW O;  4XYN A;  2JNF A;  4YGB B;  1DVI A;  3SG5 A;  4MBE A;  1OOJ A;  4I5L B;  5GQQ C;  1QLK A;  3D10 A;  1ALW A;  1CDL A;  2MBX A;  2AUC A;  1TNP A;  1EG3 A;  1WDC C;  3CS1 A;  1N0Y A;  1IJ6 A;  1NCY A;  2M0R A;  4WRI A;  4BY5 A;  1SYM A;  1KK7 Y;  3IQO A;  2M3W A;  1YUT A;  3BUX B;  3I5F C;  2OTG B;  1A03 A;  1R2U A;  4PHM A;  2M1K B;  2KOT A;  2WCE A;  2Y4Q A;  5JOL A;  4CFR A;  1K93 D;  4ETO A;  3NSI A;  1JFJ A;  2HF5 A;  3I5H B;  4A4C A;  2LP3 A;  2NCP A;  2H61 C;  3JTD B;  2NLN A;  1XFZ O;  3TUY C;  2KI4 C;  1CFC A;  4BY4 A;  1SRA A;  1QV0 A;  2MLE C;  1YUS A;  2HQ8 A;  1TIZ A;  4I5J A;  2PMY A;  2AMI A;  2VRG A;  4E68 A;  2LLS A;  2NZ0 A;  2OPO A;  4NDC A;  5KTY A;  4USL A;  2K2A A;  4CFQ A;  1YR5 A;  1DF0 A;  2EHB A;  5DKQ A;  4PHJ A;  1KFU L;  1GJY A;  3M0W A;  2PAS A;  3DF0 A;  3TUY B;  2KI4 B;  2K8M B;  1NX1 A;  4OKH A;  1H4B A;  1W7J B;  1PSR A;  2LUC A;  1S5G Z;  1BOC A;  1PVA A;  2FCE A;  2F2P A;  1CLL A;  1JSA A;  2LVV A;  1KCY A;  1K90 D;  1RRO A;  3WHT B;  2WND A;  2GGZ A;  1B8R A;  2LP2 A;  2EC6 C;  1PAL A;  2ZKM X;  2LUX A;  3SJS A;  3LK0 A;  1DT7 B;  3H4S E;  2JT8 A;  1QV1 A;  1WRK A;  5DKR A;  1CMG A;  2JU0 A;  2M7N A;  2KAX A;  1GQM A;  1BJF A;  1S26 D;  2BCA A;  2WCF A;  3BUW B;  1SR6 B;  3EVV A;  1EJ3 A;  1YTZ C;  3VRN A;  1CLM A;  2LMT A;  1OMV A;  1TNX A;  2MRD A;  4QJ3 B;  1SKT A;  2WOS A;  2LMU A;  2LNK A;  1A75 A;  2K61 A;  2K7C A;  1EG4 A;  1L7Z A;  1NUB A;  2E6W A;  2GGM A;  1S6I A;  2KFH A;  2JWW A;  3PAL A;  1SR6 C;  4CID A;  3VGO A;  4AQI A;  1AK8 A;  4DIR A;  2OTG C;  3IQQ A;  1D1O A;  1WLM A;  1KFX L;  1QVI Y;  3A8R A;  1JFK A;  4YGA A;  1U5I A;  1RWY A;  2JT0 A;  3BUN B;  3CR2 A;  1SCM B;  2M8U A;  1VRK A;  1NCX A;  1MR8 A;  3TDU A;  1IGV A;  3GK2 A;  3LCP C;  2KQ6 A;  3CTN A;  4ORB B;  2LVJ A;  2KNE A;  1K95 A;  1NX0 A;  1ZUZ A;  1J1E A;  1KK8 B;  3EKH A;  3OHM B;  1CFP A;  2L0P A;  4FQO A;  1NSH A;  1QXP A;  3BUO B;  1HQV A;  3GK1 A;  5KSZ A;  2WC8 A;  1K9U A;  3D0Y B;  1WDC B;  1CFF A;  5CSN A;  5BPJ A;  2FOT A;  2NCO A;  4YGC B;  1G33 A;  1RK9 A;  5AER A;  1SBJ A;  2MLF C;  2HPS A;  3SG7 A;  3KF9 A;  5AFP A;  1J7Q A;  1M63 B;  1B9A A;  2JZI A;  3DD4 A;  1DF0 B;  1XFY O;  1J7R A;  1KSM A;  3KHE A;  1G4Y R;  2FJU B;  1UP5 A;  5CPV A;  1G8I A;  1QX2 A;  1K2H A;  1M46 A;  2I18 A;  1BR4 B;  5CSI A;  1OZO A;  1DJH A;  2M97 A;  3BYA A;  3GOF A;  3SIA A;  1KFU S;  1FI6 A;  1OMD A;  1DJG A;  1RTP 1;  3EK7 A;  1AP4 A;  1EXR A;  4IL1 A;  4GFT A;  4JWQ A;  4MSP A;  3VRR A;  2G2B A;  2LE9 B;  3IF7 A;  2BE6 A;  3KO0 A;  2F3Y A;  2ZRT A;  1S5G Y;  3ZNI A;  3LK1 A;  1WY9 A;  1YVH A;  1KK8 C;  5AXI A;  1XFX O;  2NXQ A;  3RLZ A;  4UPG A;  1BLQ A;  1UHN A;  1DMO A;  2MA2 A;  1IJ5 A;  4HRE E;  3I5H C;  3JVT B;  3CGA A;  1QX7 A;  1REC A;  1JF0 A;  2L4I A;  1YX7 A;  3PLF B;  3VRO A;  1CB1 A;  4GPL B;  4ICB A;  2PSR A;  5ER4 X;  1RFJ A;  3EK8 A;  3PN7 C;  3FS7 A;  4YGD B;  1C7W A;  1M45 A;  1KWO B;  1AJ4 A;  1TN4 A;  4M2P A;  4C0L A;  3A4U B;  1CNP A;  4ZCV A;  2PRU A;  2EGD A;  4A4B A;  1CDP A;  3ZWH A;  1SL9 A;  1AUI B;  1QIV A;  1SL8 A;  2DOQ A;  3CZT X;  4FTG A;  3AKA A;  4HRG A;  4XJK A;  5HLO A;  2D8N A;  1YVL A;  2ZNE A;  1AVS A;  3VRP A;  2G9B A;  5HLV A;  4AQJ A;  2RGI A;  1R6P A;  3AAJ A;  5JJG A;  3HCM A;  1LXF C;  1BT6 A;  2LM5 A;  2KYC A;  2I94 A;  4PDZ A;  4F0Z B;  2IS9 A;  2LLU A;  3OX5 A;  1B47 A;  3HX4 A;  1QVI Z;  1IQ5 A;  4N1F A;  4D1E A;  3BQ3 A;  2MHH A;  2AAO A;  2LHI A;  1FI5 A;  3CWG A;  1PSB A;  2LV7 A;  2P6B B;  2ZRS A;  5HYD A;  3E3R A;  3SG3 A;  1SCV A;  1Y1A A;  1WRL A;  1X02 A;  1CFD A;  1YX8 A;  2QAC A;  1NIW A;  2BBN A;  1SK6 D;  1Y0V H;  1F4Q A;  5HKW A;  2WCB A;  1F71 A;  2H61 A;  2K7B A;  1MQ1 A; 
#chains in the Genus database with same CATH topology
 3TDZ A;  1EH2 A;  4N1G A;  2K7D A;  4AOM A;  2CBL A;  2E30 A;  1L2O B;  2LAN A;  1N2D A;  1U5I B;  4PE0 A;  1K9K A;  1XO5 A;  5CSF A;  1FW4 A;  1KK7 Z;  1JF2 A;  1M39 A;  3PAT A;  3NSL A;  3BOW A;  4MLW A;  1S1E A;  1XK4 A;  2K7O A;  1B4C A;  1OW4 A;  1XFU O;  1UWO A;  1NP8 A;  1T14 A;  2KAY A;  2CCM A;  4P2Y B;  1QAT A;  1L2O C;  4YI9 A;  2PAL A;  1SW8 A;  2ZN8 A;  1LS8 A;  3DVE A;  3CR4 X;  1CDM A;  3EVR A;  4GGF A;  4PCW A;  5IBW A;  1KQM C;  3BOW B;  1DQE A;  3CYZ A;  4N5X A;  1JBA A;  1KQV A;  4C0K A;  3B6X A;  4NQG A;  2K60 A;  2L98 A;  3GK4 X;  4F7F A;  2LLT A;  3PN7 B;  1LA0 A;  3F45 A;  1IG5 A;  1DEK A;  3SIB A;  4DUQ A;  2WCL A;  1KWO C;  1ODB A;  4JD9 A;  3SG4 A;  2L50 A;  1MXE A;  1KQM B;  3FIA A;  1K94 A;  2WCJ A;  1DGV A;  1SY9 A;  2M49 B;  2M9G A;  3I5I C;  2LHL A;  3MSE B;  2L5X B;  4PAL A;  2WC6 A;  1PVB A;  4OR9 B;  1NCZ A;  1UHK A;  1TCO B;  3BUM B;  5F6T A;  3SS5 A;  3CDN A;  1S36 A;  1OOH A;  2CNP A;  2L5Y A;  3VRQ A;  2A4J A;  2F33 A;  3ICB A;  1NYA A;  1Q80 A;  5FI2 A;  2V53 A;  3AKB A;  3S0D A;  2BKI B;  3PM2 A;  2H2K A;  2LVI A;  3CR5 X;  1CM4 A;  2FCD A;  1OZS A;  2BL0 C;  4PT1 A;  5FYX A;  4MVF A;  1SMG A;  1KSO A;  3EK4 A;  4CLN A;  1B8L A;  3BFB A;  3SG2 A;  5G08 A;  3D73 A;  1CDN A;  3CLN A;  2F3Z A;  2LAP A;  3B87 A;  1M31 A;  5D69 A;  3WNX B;  4M2O A;  1K8U A;  1BG1 A;  1OOI X;  4MZL A;  1YUU A;  2LC5 A;  1J7P A;  1QAS A;  2KQY A;  2WCM A;  2BL0 B;  3R1P A;  5TNC A;  1TUJ A;  1FBV A;  2Y5I A;  3OGN A;  4QJ4 B;  1C7V A;  2Y1M A;  2BCB A;  1UHH A;  3D76 A;  3NXA A;  2KGB C;  1ZAC A;  1DTL A;  4Q04 A;  2CXJ A;  1ORG A;  2HET A;  2I7A A;  3DZT A;  4GGN A;  2PVB A;  1DJW A;  2KYF A;  4M2Q A;  2H8V A;  2BCX A;  4GBA A;  3I5I B;  4HRH A;  3TS5 B;  1BU3 A;  1TNW A;  1PRW A;  3O6B A;  5D3O A;  2Q4U A;  3DVJ A;  1F8H A;  3PFV A;  2KSP A;  3Q8I A;  4PE4 A;  2CT9 A;  4YBH B;  1CTR A;  1SPY A;  3L47 A;  1OE9 B;  4U8D A;  3FE8 A;  2QEB A;  2O60 A;  3RM1 A;  3LLE A;  4NDD A;  2B1U A;  3KEV A;  2EC6 B;  1SL7 A;  2JXL A;  3K21 A;  4OVN F;  3TZ1 A;  4C0J A;  1IWQ A;  1QTX A;  2K2F A;  2GV5 A;  2HQW A;  3EKJ A;  1IH0 A;  2Q91 A;  1DJZ A;  2OS8 C;  2JNX A;  3OB1 B;  3D77 A;  4JKT A;  4MRX A;  1B7T Y;  2GTE A;  3JVT C;  1K96 A;  2M7L A;  3S0A A;  3UNW A;  3FWB A;  1C07 A;  1J1D A;  1S6J A;  2F2O A;  2FJY A;  1AHR A;  4R1E A;  5B8I B;  1YRU B;  3I5G C;  3NSO A;  4JQ0 D;  1A2X A;  3KPX A;  4WQ2 A;  3BJH A;  4GNK B;  1J55 A;  3BFA A;  1CKK A;  4I5K A;  1QIW A;  1S3P A;  2I2R E;  2JPT A;  5I2L A;  1BR1 B;  1OMR A;  2JOJ A;  1W7I B;  1DJY A;  1JWD A;  4MZJ A;  2L2E A;  4DS7 A;  1B8C A;  1EL4 A;  4KYN A;  1CMF A;  1XVJ A;  2F8P A;  5ER5 A;  3SG6 A;  1NX2 A;  2WOR A;  4PE1 A;  2BBM A;  4ORC B;  3PSR A;  1QWV A;  1MWN A;  5HKY A;  5I2O A;  3SS4 A;  1YRT B;  2JRF A;  3C1V A;  1CLB A;  1S6C A;  1LIN A;  1ZFS A;  2KLE A;  1XK4 C;  3O2P A;  4WQ3 A;  2JTZ A;  5I2Q A;  3V2L A;  1TRF A;  5D7F A;  2KFG A;  1AJ5 A;  5EL2 A;  1DGU A;  2KDH A;  2KAV A;  1XYD A;  4GGF C;  4DCK A;  4YRU A;  2KGR A;  3FE6 A;  1IRJ A;  1UUS A;  4P5O E;  1IKU A;  2JC2 A;  3R1O A;  3TDI A;  1XFR A;  1F4O A;  4YGE B;  1WRZ A;  3EVU A;  2JPO A;  2LVK A;  1V1G A;  1B7T Z;  1Y1U A;  1MHO A;  2SAS A;  3NGV A;  4NDB A;  1BOD A;  1BMO A;  2YGU A;  4MEW A;  3RZS A;  1XFV O;  2Y1N A;  3D75 A;  4MZK A;  3S0G A;  1SCM C;  2L2C A;  1MXL C;  1PUL A;  1JUO A;  2QDI A;  5HKZ A;  3B88 A;  1UHI A;  2KHN A;  3K1E A;  1YUR A;  1DJX A;  4CPV A;  1NPQ A;  1A4P A;  2KFF A;  3OBV A;  1FF1 A;  2K0J A;  3OP0 A;  3CAB A;  1XA5 A;  2ZND A;  5DKN A;  2LMV A;  1CM1 A;  2JTT A;  2JQ6 A;  1QS7 A;  3O4X A;  2SCP A;  2KI6 C;  4DRW A;  1TWO A;  3DVM A;  4HSZ A;  3TS5 C;  1F70 A;  3FWC A;  1OQP A;  2L51 A;  4TNC A;  5CSJ A;  2KI6 D;  1TTX A;  3I5G B;  1DC1 A;  3O4Y A;  1QJT A;  2BKH B;  2MAZ A;  1UHJ A;  2KBM A;  1WLZ A;  1B1G A;  1DJI A;  5J3X A;  4GAO A;  4I5N B;  1ALV A;  1K9P A;  3AAK A;  1LA3 A;  4OCI A;  5AAN A;  1F54 A;  3DVK A;  1MF8 B;  1QLS A;  2ZFD A;  3I5F B;  4ZCU A;  3LL8 B;  2JUL A;  4YI8 A;  2M29 A;  2BEC A;  3D78 A;  4PHK A;  3QME A;  3WXA A;  1SNL A;  2O5G A;  2ISD A;  1H8B A;  1E8A A;  3QRX A;  1TOP A;  2TN4 A;  3R72 A;  2L4H A;  4MRY A;  3L4L A;  3PM8 A;  1A75 B;  2M1U A;  4MN0 A;  5AEQ A;  2KLD A;  3L4A A;  4JPZ B;  1N65 A;  4INX A;  2R2I A;  3N7H A;  1IQ3 A;  2QPT A;  1LKJ A;  2BE4 A;  3DF0 B;  5PAL A;  1NWD A;  3BXK A;  1MUX A;  1HT9 A;  3OB2 B;  1TNQ A;  2LCP A;  4FQT A;  1GGW A;  1TCF A;  1ZMZ A;  4XJK B;  3SS3 A;  2QEO A;  1UUR A;  3NHT A;  3NSK A;  4QJ5 B;  2OS8 B;  3WHU B;  1Y1X A;  4ORA B;  1KFX S;  1OOF A;  1ZOT B;  2PYQ A;  1OSA A;  5I94 A;  1QX5 B;  1V1F A;  1NX3 A;  4GUK A;  2JT3 A;  3JTD C;  1J7O A;  2JXC A;  1BF5 A;  2CTN A;  2KPH A;  1Y6W A;  5KU1 A;  4PHN A;  2KBI A;  1RJV A;  3OX6 A;  1F55 A;  2COL B;  1A29 A;  2MJW B;  3D0Y A;  3O78 A;  1JC2 A;  1PK0 D;  4PE7 A;  2ZN9 A;  4L9M A;  5I8N A;  1LVC D;  5K89 A;  1FPW A;  4OV2 A;  1GGZ A;  1XFW O;  3IVT A;  4XYN A;  2JNF A;  4YGB B;  1DVI A;  3SG5 A;  4MBE A;  1OOJ A;  4I5L B;  5GQQ C;  1QLK A;  3D10 A;  1ALW A;  1CDL A;  5DIC A;  2MBX A;  2AUC A;  1TNP A;  1EG3 A;  1WDC C;  3CS1 A;  3CZ1 A;  1N0Y A;  1IJ6 A;  1NCY A;  2M0R A;  4WRI A;  4BY5 A;  1SYM A;  1KK7 Y;  3IQO A;  2M3W A;  1YUT A;  3BUX B;  3I5F C;  2OTG B;  1A03 A;  1R2U A;  4PHM A;  2M1K B;  2KOT A;  2WCE A;  2Y4Q A;  3DY9 A;  5JOL A;  1K93 D;  4CFR A;  3NSI A;  4ETO A;  1JFJ A;  2HF5 A;  3I5H B;  4A4C A;  3D74 A;  1DEL A;  2LP3 A;  2NCP A;  3CZ0 A;  3PJI A;  2H61 C;  3JTD B;  2NLN A;  1XFZ O;  3TUY C;  3UO9 A;  2KI4 C;  1CFC A;  4BY4 A;  1SRA A;  1QV0 A;  2MLE C;  1YUS A;  2HQ8 A;  1TIZ A;  4I5J A;  2PMY A;  2AMI A;  2VRG A;  3R1V A;  4E68 A;  2LLS A;  2NZ0 A;  2OPO A;  4NDC A;  5KTY A;  4USL A;  1OOG A;  2K2A A;  4OZD A;  1YR5 A;  4CFQ A;  1DF0 A;  2EHB A;  5DKQ A;  4PHJ A;  1KFU L;  1GJY A;  3M0W A;  2PAS A;  3DF0 A;  3TUY B;  2KI4 B;  2K8M B;  1NX1 A;  4OKH A;  1H4B A;  1W7J B;  1PSR A;  2LUC A;  1S5G Z;  1BOC A;  1C3Y A;  1PVA A;  2P70 A;  2FCE A;  1Z2C B;  2F2P A;  1CLL A;  1JSA A;  2LVV A;  1KCY A;  1K90 D;  1RRO A;  3WHT B;  2WND A;  1IIO A;  2GGZ A;  5FI7 A;  1B8R A;  2LP2 A;  2EC6 C;  1PAL A;  2ZKM X;  2LUX A;  3SJS A;  3LK0 A;  4INW A;  3H4S E;  1DT7 B;  2JT8 A;  1QV1 A;  1WRK A;  5DKR A;  1CMG A;  2JU0 A;  2M7N A;  2KAX A;  1GQM A;  1BJF A;  1S26 D;  2BCA A;  2WCF A;  3BUW B;  1SR6 B;  3EVV A;  1EJ3 A;  1YTZ C;  3VRN A;  1CLM A;  2LMT A;  1OMV A;  1TNX A;  2MRD A;  4QJ3 B;  1SKT A;  2WOS A;  2LMU A;  2LNK A;  3S0E A;  1A75 A;  1C3Z A;  2K61 A;  2K7C A;  1EG4 A;  1L7Z A;  1NUB A;  2E6W A;  2GGM A;  1S6I A;  2KFH A;  2JWW A;  3PAL A;  1SR6 C;  4CID A;  1W9Z A;  1Z4H A;  3VGO A;  4AQI A;  2WCH A;  1AK8 A;  4DIR A;  2OTG C;  3IQQ A;  1D1O A;  1WLM A;  2P71 A;  1KFX L;  1QVI Y;  2QEH A;  3A8R A;  1JFK A;  4YGA A;  1U5I A;  1RWY A;  2JT0 A;  3BUN B;  3CR2 A;  1SCM B;  2M8U A;  1VRK A;  1NCX A;  1MR8 A;  3S0F A;  3TDU A;  1IGV A;  3GK2 A;  3LCP C;  3VB1 A;  5HL1 A;  2KQ6 A;  2QEV A;  3CTN A;  4ORB B;  2LVJ A;  2KNE A;  1K95 A;  1NX0 A;  1ZUZ A;  3DXL A;  1J1E A;  1KK8 B;  3EKH A;  3OHM B;  1CFP A;  2L0P A;  4FQO A;  1NSH A;  1QXP A;  3BUO B;  1HQV A;  3GK1 A;  5KSZ A;  2WC8 A;  1K9U A;  3D0Y B;  1WDC B;  3B86 A;  3DYE A;  5JJG A;  1CFF A;  5CSN A;  5BPJ A;  2FOT A;  2NCO A;  4YGC B;  1G33 A;  1RK9 A;  5AER A;  1SBJ A;  2MLF C;  2HPS A;  3SG7 A;  3KF9 A;  5AFP A;  3CZ2 A;  1M63 B;  1J7Q A;  1B9A A;  2JZI A;  3DD4 A;  1DF0 B;  1XFY O;  1J7R A;  1KSM A;  1SSE B;  3KHE A;  1G4Y R;  2FJU B;  1UP5 A;  5CPV A;  1G8I A;  1QX2 A;  3EG5 B;  1K2H A;  1M46 A;  2I18 A;  1BR4 B;  5CSI A;  1OZO A;  1DJH A;  2M97 A;  3BYA A;  3GOF A;  3SIA A;  1KFU S;  2WC5 A;  1FI6 A;  1OMD A;  1DJG A;  1RTP 1;  3EK7 A;  1AP4 A;  1EXR A;  4IL1 A;  4GFT A;  4JWQ A;  4MSP A;  3VRR A;  2G2B A;  3BFH A;  2LE9 B;  3IF7 A;  2BE6 A;  3KO0 A;  2F3Y A;  2ZRT A;  1S5G Y;  3ZNI A;  1GM0 A;  3LK1 A;  1WY9 A;  1YVH A;  1KK8 C;  5AXI A;  1XFX O;  2NXQ A;  3RLZ A;  4UPG A;  1BLQ A;  1UHN A;  1DMO A;  2MA2 A;  4AQJ A;  1IJ5 A;  4HRE E;  3I5H C;  3JVT B;  3CGA A;  1QX7 A;  1REC A;  2BNX A;  1JF0 A;  2L4I A;  1YX7 A;  2PQL A;  3PLF B;  3VRO A;  1CB1 A;  4GPL B;  4ICB A;  2PSR A;  5ER4 X;  1RFJ A;  3EK8 A;  3PN7 C;  3FS7 A;  4YGD B;  1C7W A;  1M45 A;  1KWO B;  1AJ4 A;  1P28 A;  1TN4 A;  4M2P A;  4C0L A;  3A4U B;  1CNP A;  3B7A A;  4ZCV A;  2PRU A;  2EGD A;  4A4B A;  1CDP A;  3ZWH A;  1SL9 A;  1AUI B;  1QIV A;  1SL8 A;  2DOQ A;  3CZT X;  4FTG A;  3AKA A;  4HRG A;  4XJK A;  5HLO A;  2D8N A;  1YVL A;  2ZNE A;  1AVS A;  3VRP A;  2G9B A;  3FE9 A;  5HLV A;  2RGI A;  1R6P A;  1TUZ A;  3AAJ A;  3HCM A;  1LXF C;  5FI6 A;  1BT6 A;  2LM5 A;  2KYC A;  2I94 A;  4PDZ A;  4F0Z B;  2IS9 A;  2LLU A;  3OX5 A;  1B47 A;  3HX4 A;  1QVI Z;  1IQ5 A;  4N1F A;  4D1E A;  3BQ3 A;  2MHH A;  2AAO A;  4IJ7 A;  2LHI A;  2WCK A;  1FI5 A;  3CWG A;  1PSB A;  2LV7 A;  2P6B B;  2ZRS A;  3NHI A;  3S0B A;  5HYD A;  3E3R A;  3SG3 A;  1SCV A;  1Y1A A;  2ERB A;  1WRL A;  1X02 A;  1CFD A;  1YX8 A;  2QAC A;  1NIW A;  2BBN A;  1SK6 D;  1Y0V H;  1F4Q A;  2BAP A;  2WCB A;  5HKW A;  1F71 A;  2H61 A;  2K7B A;  1MQ1 A; 
#chains in the Genus database with same CATH homology
 3TDZ A;  1EH2 A;  4N1G A;  2K7D A;  4AOM A;  2CBL A;  2E30 A;  1L2O B;  2LAN A;  1N2D A;  1U5I B;  4PE0 A;  1K9K A;  1XO5 A;  5CSF A;  1FW4 A;  1KK7 Z;  1JF2 A;  1M39 A;  3PAT A;  3NSL A;  3BOW A;  4MLW A;  1S1E A;  1XK4 A;  2K7O A;  1B4C A;  1XFU O;  1UWO A;  1NP8 A;  2KAY A;  2CCM A;  4P2Y B;  1QAT A;  1L2O C;  4YI9 A;  2PAL A;  1SW8 A;  2ZN8 A;  3DVE A;  3CR4 X;  1CDM A;  3EVR A;  4GGF A;  4PCW A;  5IBW A;  1KQM C;  3BOW B;  1JBA A;  4N5X A;  1KQV A;  4C0K A;  4NQG A;  3GK4 X;  2L98 A;  2LLT A;  3PN7 B;  1LA0 A;  3F45 A;  1IG5 A;  3SIB A;  4DUQ A;  1KWO C;  1ODB A;  3SG4 A;  2L50 A;  1MXE A;  1KQM B;  3FIA A;  1K94 A;  1DGV A;  1SY9 A;  2M49 B;  2M9G A;  3I5I C;  2LHL A;  3MSE B;  2L5X B;  4PAL A;  1PVB A;  4OR9 B;  1NCZ A;  1UHK A;  1TCO B;  3BUM B;  5F6T A;  1S36 A;  3VRQ A;  2CNP A;  2A4J A;  2F33 A;  3ICB A;  1NYA A;  1Q80 A;  2V53 A;  3AKB A;  2BKI B;  2H2K A;  2LVI A;  3CR5 X;  1CM4 A;  2FCD A;  1OZS A;  2BL0 C;  5FYX A;  4MVF A;  1SMG A;  1KSO A;  3EK4 A;  4CLN A;  1B8L A;  3SG2 A;  5G08 A;  1CDN A;  3CLN A;  2F3Z A;  2LAP A;  1M31 A;  5D69 A;  3WNX B;  4M2O A;  1K8U A;  1BG1 A;  4MZL A;  1YUU A;  2LC5 A;  1J7P A;  1QAS A;  2KQY A;  5TNC A;  2BL0 B;  1FBV A;  2Y5I A;  4QJ4 B;  1C7V A;  2Y1M A;  2BCB A;  1UHH A;  3NXA A;  2KGB C;  1ZAC A;  1DTL A;  4Q04 A;  2CXJ A;  2HET A;  2I7A A;  4GGN A;  4M2Q A;  2PVB A;  1DJW A;  2KYF A;  2BCX A;  4GBA A;  3I5I B;  4HRH A;  3TS5 B;  1BU3 A;  1TNW A;  1PRW A;  3O6B A;  2Q4U A;  3DVJ A;  1F8H A;  3PFV A;  2KSP A;  4PE4 A;  2CT9 A;  4YBH B;  1CTR A;  1SPY A;  1OE9 B;  4U8D A;  2O60 A;  3RM1 A;  3LLE A;  4NDD A;  2B1U A;  3KEV A;  2EC6 B;  1SL7 A;  2JXL A;  3K21 A;  4OVN F;  3TZ1 A;  4C0J A;  1IWQ A;  1QTX A;  2K2F A;  2GV5 A;  2HQW A;  3EKJ A;  1IH0 A;  2Q91 A;  1DJZ A;  2OS8 C;  2JNX A;  3OB1 B;  4MRX A;  1B7T Y;  3JVT C;  1K96 A;  2M7L A;  3FWB A;  1C07 A;  2F2O A;  1J1D A;  1S6J A;  5B8I B;  1AHR A;  4R1E A;  1YRU B;  3I5G C;  3NSO A;  4JQ0 D;  1A2X A;  3KPX A;  4WQ2 A;  4GNK B;  1J55 A;  1CKK A;  4I5K A;  1QIW A;  1S3P A;  2I2R E;  2JPT A;  5I2L A;  1BR1 B;  1OMR A;  2JOJ A;  1W7I B;  1DJY A;  1JWD A;  4MZJ A;  2L2E A;  4DS7 A;  1B8C A;  1EL4 A;  1CMF A;  1XVJ A;  2F8P A;  5ER5 A;  3SG6 A;  1NX2 A;  2WOR A;  4PE1 A;  2BBM A;  4ORC B;  3PSR A;  5HKY A;  1MWN A;  5I2O A;  1YRT B;  2JRF A;  3C1V A;  1CLB A;  1S6C A;  1LIN A;  1ZFS A;  1XK4 C;  3O2P A;  4WQ3 A;  2JTZ A;  5I2Q A;  1TRF A;  5D7F A;  2KFG A;  1AJ5 A;  1DGU A;  2KDH A;  2KAV A;  1XYD A;  4GGF C;  4DCK A;  4YRU A;  2KGR A;  1IKU A;  1IRJ A;  1UUS A;  4P5O E;  2JC2 A;  3TDI A;  1F4O A;  4YGE B;  1WRZ A;  3EVU A;  2LVK A;  1V1G A;  1B7T Z;  1Y1U A;  1MHO A;  2SAS A;  4NDB A;  1BOD A;  1BMO A;  4MEW A;  1XFV O;  2Y1N A;  4MZK A;  1SCM C;  1MXL C;  1PUL A;  1JUO A;  5HKZ A;  1UHI A;  2KHN A;  4CPV A;  1YUR A;  1DJX A;  1NPQ A;  1A4P A;  2KFF A;  1FF1 A;  2K0J A;  3OP0 A;  1XA5 A;  2ZND A;  5DKN A;  2LMV A;  1CM1 A;  2JTT A;  2JQ6 A;  1QS7 A;  2SCP A;  2KI6 C;  4DRW A;  3DVM A;  4HSZ A;  3TS5 C;  1F70 A;  3FWC A;  1OQP A;  2L51 A;  4TNC A;  5CSJ A;  2KI6 D;  1TTX A;  3I5G B;  3O4Y A;  1QJT A;  2BKH B;  2MAZ A;  1UHJ A;  2KBM A;  1WLZ A;  1B1G A;  1DJI A;  5J3X A;  4GAO A;  4I5N B;  1ALV A;  1K9P A;  3AAK A;  1LA3 A;  4OCI A;  5AAN A;  1F54 A;  3DVK A;  1MF8 B;  1QLS A;  2ZFD A;  3I5F B;  4ZCU A;  3LL8 B;  2JUL A;  4YI8 A;  2M29 A;  2BEC A;  4PHK A;  3WXA A;  1SNL A;  2O5G A;  2ISD A;  1H8B A;  1E8A A;  3QRX A;  1TOP A;  2TN4 A;  4MRY A;  2L4H A;  3PM8 A;  1A75 B;  2M1U A;  4MN0 A;  5AEQ A;  4JPZ B;  1N65 A;  2R2I A;  1IQ3 A;  2QPT A;  1LKJ A;  2BE4 A;  3DF0 B;  5PAL A;  1NWD A;  3BXK A;  1MUX A;  1HT9 A;  3OB2 B;  1TNQ A;  2LCP A;  1GGW A;  1TCF A;  1ZMZ A;  4XJK B;  1UUR A;  3NSK A;  4QJ5 B;  2OS8 B;  3WHU B;  1Y1X A;  4ORA B;  1KFX S;  1ZOT B;  1OSA A;  1QX5 B;  1V1F A;  1NX3 A;  4GUK A;  2JT3 A;  3JTD C;  1J7O A;  2JXC A;  1BF5 A;  2CTN A;  5KU1 A;  1Y6W A;  4PHN A;  2KBI A;  1RJV A;  3OX6 A;  1F55 A;  2COL B;  1A29 A;  2MJW B;  3D0Y A;  3O78 A;  1JC2 A;  1PK0 D;  4PE7 A;  2ZN9 A;  4L9M A;  5I8N A;  1LVC D;  5K89 A;  1FPW A;  4OV2 A;  1GGZ A;  1XFW O;  4XYN A;  2JNF A;  4YGB B;  1DVI A;  3SG5 A;  4MBE A;  1OOJ A;  4I5L B;  5GQQ C;  1QLK A;  3D10 A;  1ALW A;  1CDL A;  2MBX A;  2AUC A;  1TNP A;  1EG3 A;  1WDC C;  3CS1 A;  1N0Y A;  1IJ6 A;  1NCY A;  2M0R A;  4WRI A;  4BY5 A;  1SYM A;  1KK7 Y;  3IQO A;  2M3W A;  1YUT A;  3BUX B;  3I5F C;  2OTG B;  1A03 A;  1R2U A;  4PHM A;  2M1K B;  2KOT A;  2WCE A;  2Y4Q A;  5JOL A;  4CFR A;  1K93 D;  4ETO A;  3NSI A;  1JFJ A;  2HF5 A;  3I5H B;  4A4C A;  2LP3 A;  2NCP A;  2H61 C;  3JTD B;  2NLN A;  1XFZ O;  3TUY C;  2KI4 C;  1CFC A;  4BY4 A;  1SRA A;  1QV0 A;  2MLE C;  1YUS A;  2HQ8 A;  1TIZ A;  4I5J A;  2PMY A;  2AMI A;  2VRG A;  4E68 A;  2LLS A;  2NZ0 A;  2OPO A;  4NDC A;  5KTY A;  4USL A;  2K2A A;  4CFQ A;  1YR5 A;  1DF0 A;  2EHB A;  5DKQ A;  4PHJ A;  1KFU L;  1GJY A;  3M0W A;  2PAS A;  3DF0 A;  3TUY B;  2KI4 B;  2K8M B;  1NX1 A;  4OKH A;  1H4B A;  1W7J B;  1PSR A;  2LUC A;  1S5G Z;  1BOC A;  1PVA A;  2FCE A;  2F2P A;  1CLL A;  1JSA A;  2LVV A;  1KCY A;  1K90 D;  1RRO A;  3WHT B;  2WND A;  2GGZ A;  1B8R A;  2LP2 A;  2EC6 C;  1PAL A;  2ZKM X;  2LUX A;  3SJS A;  3LK0 A;  1DT7 B;  3H4S E;  2JT8 A;  1QV1 A;  1WRK A;  5DKR A;  1CMG A;  2JU0 A;  2M7N A;  2KAX A;  1GQM A;  1BJF A;  1S26 D;  2BCA A;  2WCF A;  3BUW B;  1SR6 B;  3EVV A;  1EJ3 A;  1YTZ C;  3VRN A;  1CLM A;  2LMT A;  1OMV A;  1TNX A;  2MRD A;  4QJ3 B;  1SKT A;  2WOS A;  2LMU A;  2LNK A;  1A75 A;  2K61 A;  2K7C A;  1EG4 A;  1L7Z A;  1NUB A;  2E6W A;  2GGM A;  1S6I A;  2KFH A;  2JWW A;  3PAL A;  1SR6 C;  4CID A;  3VGO A;  4AQI A;  1AK8 A;  4DIR A;  2OTG C;  3IQQ A;  1D1O A;  1WLM A;  1KFX L;  1QVI Y;  3A8R A;  1JFK A;  4YGA A;  1U5I A;  1RWY A;  2JT0 A;  3BUN B;  3CR2 A;  1SCM B;  2M8U A;  1VRK A;  1NCX A;  1MR8 A;  3TDU A;  1IGV A;  3GK2 A;  3LCP C;  2KQ6 A;  3CTN A;  4ORB B;  2LVJ A;  2KNE A;  1K95 A;  1NX0 A;  1ZUZ A;  1J1E A;  1KK8 B;  3EKH A;  3OHM B;  1CFP A;  2L0P A;  4FQO A;  1NSH A;  1QXP A;  3BUO B;  1HQV A;  3GK1 A;  5KSZ A;  2WC8 A;  1K9U A;  3D0Y B;  1WDC B;  1CFF A;  5CSN A;  5BPJ A;  2FOT A;  2NCO A;  4YGC B;  1G33 A;  1RK9 A;  5AER A;  1SBJ A;  2MLF C;  2HPS A;  3SG7 A;  3KF9 A;  5AFP A;  1J7Q A;  1M63 B;  1B9A A;  2JZI A;  3DD4 A;  1DF0 B;  1XFY O;  1J7R A;  1KSM A;  3KHE A;  1G4Y R;  2FJU B;  1UP5 A;  5CPV A;  1G8I A;  1QX2 A;  1K2H A;  1M46 A;  2I18 A;  1BR4 B;  5CSI A;  1OZO A;  1DJH A;  2M97 A;  3BYA A;  3GOF A;  3SIA A;  1KFU S;  1FI6 A;  1OMD A;  1DJG A;  1RTP 1;  3EK7 A;  1AP4 A;  1EXR A;  4IL1 A;  4GFT A;  4JWQ A;  4MSP A;  3VRR A;  2G2B A;  2LE9 B;  3IF7 A;  2BE6 A;  3KO0 A;  2F3Y A;  2ZRT A;  1S5G Y;  3ZNI A;  3LK1 A;  1WY9 A;  1YVH A;  1KK8 C;  5AXI A;  1XFX O;  2NXQ A;  3RLZ A;  4UPG A;  1BLQ A;  1UHN A;  1DMO A;  2MA2 A;  1IJ5 A;  4HRE E;  3I5H C;  3JVT B;  3CGA A;  1QX7 A;  1REC A;  1JF0 A;  2L4I A;  1YX7 A;  3PLF B;  3VRO A;  1CB1 A;  4GPL B;  4ICB A;  2PSR A;  5ER4 X;  1RFJ A;  3EK8 A;  3PN7 C;  3FS7 A;  4YGD B;  1C7W A;  1M45 A;  1KWO B;  1AJ4 A;  1TN4 A;  4M2P A;  4C0L A;  3A4U B;  1CNP A;  4ZCV A;  2PRU A;  2EGD A;  4A4B A;  1CDP A;  3ZWH A;  1SL9 A;  1AUI B;  1QIV A;  1SL8 A;  2DOQ A;  3CZT X;  4FTG A;  3AKA A;  4HRG A;  4XJK A;  5HLO A;  2D8N A;  1YVL A;  2ZNE A;  1AVS A;  3VRP A;  2G9B A;  5HLV A;  4AQJ A;  2RGI A;  1R6P A;  3AAJ A;  5JJG A;  3HCM A;  1LXF C;  1BT6 A;  2LM5 A;  2KYC A;  2I94 A;  4PDZ A;  4F0Z B;  2IS9 A;  2LLU A;  3OX5 A;  1B47 A;  3HX4 A;  1QVI Z;  1IQ5 A;  4N1F A;  4D1E A;  3BQ3 A;  2MHH A;  2AAO A;  2LHI A;  1FI5 A;  3CWG A;  1PSB A;  2LV7 A;  2P6B B;  2ZRS A;  5HYD A;  3E3R A;  3SG3 A;  1SCV A;  1Y1A A;  1WRL A;  1X02 A;  1CFD A;  1YX8 A;  2QAC A;  1NIW A;  2BBN A;  1SK6 D;  1Y0V H;  1F4Q A;  5HKW A;  2WCB A;  1F71 A;  2H61 A;  2K7B A;  1MQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...